
ID   AF003293; SV 1; linear; gDNA; STD; MUS; 570 BP.
AC   AF003293;
DT   13-FEB-1998 (Rel. 199807-5, arrived in LIGM-DB)
DT   14-JAN-2013 (Rel. 201303-1, Last updated, Version 11)
DE   Mus musculus Ig kappa light chain variable region gene, partial cds.
KW   antigen receptor; Immunoglobulin superfamily (IgSF); immunoglobulin (IG);
KW   IG-Light; IG-Light-Kappa-IGK; variable; promoter; regular; gDNA; germline;
KW   functional; V-gene.
OS   Mus musculus (house mouse)
OC   cellular organisms; Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria;
OC   Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi;
OC   Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota;
OC   Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires;
OC   Rodentia; Sciurognathi; Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus.
RN   [1]
RP   1-570
RX   DOI; 10.1007/s002510050331.
RX   PUBMED; 9382926.
RA   Ulrich H.D., Moore F.L., Schultz P.G.;
RT   "Germline diversity within the mouse Igk-V9 gene family";
RL   Immunogenetics 47(1):91-95(1997).
RN   [2]
RP   1-570
RA   Ulrich H.D., Schultz P.G.;
RT   ;
RL   Submitted (09-MAY-1997) to the INSDC.
RL   ZMBH, Universitaet Heidelberg, Im Neuenheimer Feld 282, Heidelberg D-69120,
RL   Germany
DR   ENA; AF003293.
DR   EPD; EP11154; MM_IGKM.
CC   IMGT/LIGM-DB annotation level: by annotators
FH   Key                 Location/Qualifiers
FT   V-GENE              1..>570
FT                       /partial
FT                       /IMGT_allele="IGKV9-120*01"
FT                       /IMGT_gene="IGKV9-120"
FT                       /cell_line="MOPC41"
FT                       /db_xref="taxon:10090"
FT                       /mol_type="genomic DNA"
FT                       /organism="Mus musculus"
FT                       /strain="BALB/c; A/J; Swiss Webster"
FT                       /tissue_type="liver"
FT   5'UTR               1..98
FT   OCTAMER             8..15
FT   TATA_BOX            47..52
FT   L-PART1             99..153
FT                       /translation="MDMRAPAQIFGFLLLLFP"
FT                       /protein_id="AAB97638.1"
FT   INIT-CODON          99..101
FT   DONOR-SPLICE        153..155
FT   V-INTRON            154..274
FT   ACCEPTOR-SPLICE     272..276
FT   V-EXON              275..570
FT                       /codon_start=3
FT                       SP"
FT                       /protein_id="AAB97638.1"
FT   L-PART2             275..285
FT                       /codon_start=3
FT                       /translation="TRC"
FT   V-REGION            286..570
FT                       /CDR_length="[6.3.7]"
FT                       /IMGT_allele="IGKV9-120*01"
FT                       /IMGT_gene="IGKV9-120"
FT   FR1-IMGT            286..363
FT                       /translation="DIQMTQSPSSLSASLGERVSLTCRAS"
FT                       /AA_IMGT="1 to 26"
FT   1st-CYS             352..354
FT   CDR1-IMGT           364..381
FT                       /translation="QDIGSS"
FT                       /AA_IMGT="27 to 32"
FT   FR2-IMGT            382..432
FT                       /translation="LNWLQQEPDGTIKRLIY"
FT                       /AA_IMGT="39 to 55"
FT   CONSERVED-TRP       388..390
FT   CDR2-IMGT           433..441
FT                       /translation="ATS"
FT                       /AA_IMGT="56 to 58"
FT   FR3-IMGT            442..549
FT                       /translation="SLDSGVPKRFSGSRSGSDYSLTISSLESEDFVDYYC"
FT                       /AA_IMGT="66 to 104,AA 73,81,82 missing"
FT   2nd-CYS             547..549
FT   CDR3-IMGT           550..570
FT                       /translation="LQYASSP"
FT                       /AA_IMGT="105 to 111"
SQ   Sequence 570 BP; 135 A; 131 C; 121 G; 183 T; 0 other;
     cttaataatt tgcataccct cactgcatcg ccttggggac ttctttatat aacagtcaaa        60
     catatcctgt gccattgtca ttgcagtcag gactcagcat ggacatgagg gctcctgcac       120
     agatttttgg cttcttgttg ctcttgtttc caggtaaaat gaactaaaat tggaatttca       180
     ctgttccact gtggttagtg ttgactggca tttgggggat gtcctctttt atcatgctta       240
     tctatgtgga tattcattat gtctccactc ctaggtacca gatgtgacat ccagatgacc       300
     cagtctccat cctccttatc tgcctctctg ggagaaagag tcagtctcac ttgtcgggca       360
     agtcaggaca ttggtagtag cttaaactgg cttcagcagg aaccagatgg aactattaaa       420
     cgcctgatct acgccacatc cagtttagat tctggtgtgc ccaaaaggtt cagtggcagt       480
     aggtctgggt cagattattc tctcaccatc agcagccttg agtctgaaga ttttgtagac       540
     tattactgtc tacaatatgc tagttctcct                                        570