spacer

EBI Dbfetch

ID   HLA00001; SV 1; standard; DNA; HUM; 3503 BP.
XX
AC   HLA00001;
XX
SV   HLA00001.1
XX
DT   01-AUG-1989 (Rel. 1.0.0, Created, Version 1)
DT   17-JUL-2014 (Rel. 3.17.0, Last Updated, Version 1)
XX
DE   HLA-A*01:01:01:01, Human MHC Class I sequence
XX
KW   Human MHC; HLA; Class I; HLA-A; Allele; HLA-A*01:01:01:01;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IMGT/HLA Release Version 3.17.0 - Updated 21-AUG-2014
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-3503
RX   PUBMED; 3375250.
RA   Parham P, Lomen CE, Lawlor DA, Ways JP, Holmes N, Coppin HL, Salter RD,
RA   Wan AM, Ennis PD;
RT   "Nature of polymorphism in HLA-A, -B, and -C molecules";
RL   Proc Natl Acad Sci U S A 85:4005-9(1988).
XX
RN   [2]
RP   1-3503
RX   PUBMED; 2251137.
RA   Girdlestone J;
RT   "Nucleotide sequence of an HLA-A1 gene";
RL   Nucleic Acids Res 18:6701-6701(1990).
XX
RN   [3]
RP   1-3503
RX   PUBMED; 9349617.
RA   Laforet M, Froelich N, Parissiadis A, Pfeiffer B, Schell A, Faller B,
RA   Woehl-Jaegle ML, Cazenave JP, Tongio MM;
RT   "A nucleotide insertion in exon 4 is responsible for the absence of
RT   expression of an HLA-A*01 allele";
RL   Tissue Antigens 50:347-50(1997).
XX
RN   [4]
RP   1-3503
RX   PUBMED; 15140828.
RA   Stewart CA, Horton R, Allcock RJ, Ashurst JL, Atrazhev AM, Coggill P,
RA   Dunham I, Forbes S, Halls K, Howson JM, Humphray SJ, Hunt S, Mungall AJ,
RA   Osoegawa K, Palmer S, Roberts AN, Rogers J, Sims S, Wang Y, Wilming LG,
RA   Elliott JF, de Jong PJ, Sawcer S, Todd JA, Trowsdale J, Beck S;
RT   "Complete MHC haplotype sequencing for common disease gene mapping";
RL   Genome Res 14:1176-87(2004).
XX
RN   [5]
RP   1-3503
RX   PUBMED; 19735485.
RA   Zhu F, He Y, Zhang W, He J, He J, Xu X, Yan L;
RT   "Analysis of the complete genomic sequence of HLA-A alleles in the Chinese
RT   Han population.";
RL   Int J Immunogenet 36:351-360(2009).
XX
RN   [6]
RP   1-3503
RX   PUBMED; 24673518.
RA   Lu L, Xu YP;
RT   "Genomic full-length sequence of two HLA-A alleles, A*01:01:01:01 and
RT   A*01:03, identified by cloning and sequencing.";
RL   Tissue Antigens 83:423-424(2014).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence for as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; AJ278305; AJ278305.1.
DR   EMBL; AL645935; AL645935.0.
DR   EMBL; CR759913; CR759913.0.
DR   EMBL; EU445470; EU445470.0.
DR   EMBL; GU812295; GU812295.0.
DR   EMBL; HG794373; HG794373.0.
DR   EMBL; M24043; M24043.1.
DR   EMBL; X55710; X55710.1.
DR   EMBL; Z93949; Z93949.1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3503
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Oriental, Caucasoid"
FT                   /cell_line="7550800303"
FT                   /cell_line="APD"
FT                   /cell_line="B4702"
FT                   /cell_line="COX"
FT                   /cell_line="LCL721"
FT                   /cell_line="MOLT-4"
FT                   /cell_line="PP"
FT   CDS             join(301..373,504..773,1015..1290,1870..2145,2248..2364,
FT                   2807..2839,2982..3029,3199..3203)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:01:01:01"
FT                   /product="MHC Class I HLA-A*01:01:01:01 sequence"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   UTR             1..300
FT   exon            301..373
FT                   /number="1"
FT   intron          374..503
FT                   /number="1"
FT   exon            504..773
FT                   /number="2"
FT   intron          774..1014
FT                   /number="2"
FT   exon            1015..1290
FT                   /number="3"
FT   intron          1291..1869
FT                   /number="3"
FT   exon            1870..2145
FT                   /number="4"
FT   intron          2146..2247
FT                   /number="4"
FT   exon            2248..2364
FT                   /number="5"
FT   intron          2365..2806
FT                   /number="5"
FT   exon            2807..2839
FT                   /number="6"
FT   intron          2840..2981
FT                   /number="6"
FT   exon            2982..3029
FT                   /number="7"
FT   intron          3030..3198
FT                   /number="7"
FT   exon            3199..3203
FT                   /number="8"
FT   UTR             3204..3503
SQ   Sequence 3503 BP; 666 A; 1012 C; 1070 G; 755 T; 0 other;
     caggagcaga ggggtcaggg cgaagtccca gggccccagg cgtggctctc agggtctcag        60
     gccccgaagg cggtgtatgg attggggagt cccagccttg gggattcccc aactccgcag       120
     tttcttttct ccctctccca acctacgtag ggtccttcat cctggatact cacgacgcgg       180
     acccagttct cactcccatt gggtgtcggg tttccagaga agccaatcag tgtcgtcgcg       240
     gtcgctgttc taaagtccgc acgcacccac cgggactcag attctcccca gacgccgagg       300
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc       360
     cagacctggg cgggtgagtg cggggtcggg agggaaaccg cctctgcggg gagaagcaag       420
     gggccctcct ggcgggggcg caggaccggg ggagccgcgc cgggaggagg gtcgggcagg       480
     tctcagccac tgctcgcccc caggctccca ctccatgagg tatttcttca catccgtgtc       540
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       600
     cgtgcggttc gacagcgacg ccgcgagcca gaagatggag ccgcgggcgc cgtggataga       660
     gcaggagggg ccggagtatt gggaccagga gacacggaat atgaaggccc actcacagac       720
     tgaccgagcg aacctgggga ccctgcgcgg ctactacaac cagagcgagg acggtgagtg       780
     accccggccc ggggcgcagg tcacgacccc tcatccccca cggacgggcc aggtcgccca       840
     cagtctccgg gtccgagatc caccccgaag ccgcgggact ccgagaccct tgtcccggga       900
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       960
     ggtcggggcg gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc      1020
     acaccatcca gataatgtat ggctgcgacg tggggccgga cgggcgcttc ctccgcgggt      1080
     accggcagga cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctctt      1140
     ggaccgcggc ggacatggca gctcagatca ccaagcgcaa gtgggaggcg gtccatgcgg      1200
     cggagcagcg gagagtctac ctggagggcc ggtgcgtgga cgggctccgc agatacctgg      1260
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1320
     cgcctataga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1380
     agaatatcac cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1440
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1500
     ctgaaggagt gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacaccg      1560
     gcagcagcct tgggcccgtg acttttcctc tcaggccttg ttctctgctt cacactcaat      1620
     gtgtgtgggg gtctgagtcc agcacttctg agtctctcag cctccactca ggtcaggacc      1680
     agaagtcgct gttcccttct cagggaatag aagattatcc caggtgcctg tgtccaggct      1740
     ggtgtctggg ttctgtgctc tcttccccat cccgggtgtc ctgtccattc tcaagatggc      1800
     cacatgcgtg ctggtggagt gtcccatgac agatgcaaaa tgcctgaatt ttctgactct      1860
     tcccgtcaga cccccccaag acacatatga cccaccaccc catctctgac catgaggcca      1920
     ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1980
     atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca ggggatggaa      2040
     ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga tacacctgcc      2100
     atgtgcagca tgagggtctg cccaagcccc tcaccctgag atggggtaag gagggagatg      2160
     ggggtgtcat gtctcttagg gaaagcagga gcctctctgg agacctttag cagggtcagg      2220
     gcccctcacc ttcccctctt ttcccagagc tgtcttccca gcccaccatc cccatcgtgg      2280
     gcatcattgc tggcctggtt ctccttggag ctgtgatcac tggagctgtg gtcgctgccg      2340
     tgatgtggag gaggaagagc tcaggtggag aaggggtgaa gggtggggtc tgagatttct      2400
     tgtctcactg agggttccaa gccccagcta gaaatgtgcc ctgtctcatt actgggaagc      2460
     accttccaca atcatgggcc gacccagcct gggccctgtg tgccagcact tactcttttg      2520
     taaagcacct gttaaaatga aggacagatt tatcaccttg attacggcgg tgatgggacc      2580
     tgatcccagc agtcacaagt cacaggggaa ggtccctgag gacagacctc aggagggcta      2640
     ttggtccagg acccacacct gctttcttca tgtttcctga tcccgccctg ggtctgcagt      2700
     cacacatttc tggaaacttc tctggggtcc aagactagga ggttcctcta ggaccttaag      2760
     gccctggctc ctttctggta tctcacagga cattttcttc ccacagatag aaaaggaggg      2820
     agttacactc aggctgcaag taagtatgaa ggaggctgat gcctgaggtc cttgggatat      2880
     tgtgtttggg agcccatggg ggagctcacc caccccacaa ttcctcctct agccacatct      2940
     tctgtgggat ctgaccaggt tctgtttttg ttctacccca ggcagtgaca gtgcccaggg      3000
     ctctgatgtg tctctcacag cttgtaaagg tgagagcttg gagggcctga tgtgtgttgg      3060
     gtgttgggtg gaacagtgga cacagctgtg ctatggggtt tctttgcgtt ggatgtattg      3120
     agcatgcgat gggctgttta aggtgtgacc cctcactgtg atggatatga atttgttcat      3180
     gaatattttt ttctatagtg tgagacagct gccttgtgtg ggactgagag gcaagagttg      3240
     ttcctgccct tccctttgtg acttgaagaa ccctgacttt gtttctgcaa aggcacctgc      3300
     atgtgtctgt gttcgtgtag gcataatgtg aggaggtggg gagagcaccc cacccccatg      3360
     tccaccatga ccctcttccc acgctgacct gtgctccctc tccaatcatc tttcctgttc      3420
     cagagaggtg gggctgaggt gtctccatct ctgtctcaac ttcatggtgc actgagctgt      3480
     aacttcttcc ttccctatta aaa                                              3503
//


spacer
spacer