spacer

EBI Dbfetch

ID   HLA00001; SV 1; standard; DNA; HUM; 1098 BP.
XX
AC   HLA00001;
XX
SV   HLA00001.1
XX
DT   01-AUG-1989 (Rel. 1.0.0, Created, Version 1)
DT   17-APR-2015 (Rel. 3.20.0, Last Updated, Version 1)
XX
DE   HLA-A*01:01:01:01, Human MHC Class I sequence
XX
KW   Human MHC; HLA; Class I; HLA-A; Allele; HLA-A*01:01:01:01;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IMGT/HLA Release Version 3.20.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-1098
RX   PUBMED; 3375250.
RA   Parham P, Lomen CE, Lawlor DA, Ways JP, Holmes N, Coppin HL, Salter RD,
RA   Wan AM, Ennis PD;
RT   "Nature of polymorphism in HLA-A, -B, and -C molecules";
RL   Proc Natl Acad Sci U S A 85:4005-9(1988).
XX
RN   [2]
RP   1-1098
RX   PUBMED; 2251137.
RA   Girdlestone J;
RT   "Nucleotide sequence of an HLA-A1 gene";
RL   Nucleic Acids Res 18:6701-6701(1990).
XX
RN   [3]
RP   1-1098
RX   PUBMED; 9349617.
RA   Laforet M, Froelich N, Parissiadis A, Pfeiffer B, Schell A, Faller B,
RA   Woehl-Jaegle ML, Cazenave JP, Tongio MM;
RT   "A nucleotide insertion in exon 4 is responsible for the absence of
RT   expression of an HLA-A*01 allele";
RL   Tissue Antigens 50:347-50(1997).
XX
RN   [4]
RP   1-1098
RX   PUBMED; 15140828.
RA   Stewart CA, Horton R, Allcock RJ, Ashurst JL, Atrazhev AM, Coggill P,
RA   Dunham I, Forbes S, Halls K, Howson JM, Humphray SJ, Hunt S, Mungall AJ,
RA   Osoegawa K, Palmer S, Roberts AN, Rogers J, Sims S, Wang Y, Wilming LG,
RA   Elliott JF, de Jong PJ, Sawcer S, Todd JA, Trowsdale J, Beck S;
RT   "Complete MHC haplotype sequencing for common disease gene mapping";
RL   Genome Res 14:1176-87(2004).
XX
RN   [5]
RP   1-1098
RX   PUBMED; 19735485.
RA   Zhu F, He Y, Zhang W, He J, He J, Xu X, Yan L;
RT   "Analysis of the complete genomic sequence of HLA-A alleles in the Chinese
RT   Han population.";
RL   Int J Immunogenet 36:351-360(2009).
XX
RN   [6]
RP   1-1098
RX   PUBMED; 24673518.
RA   Lu L, Xu YP;
RT   "Genomic full-length sequence of two HLA-A alleles, A*01:01:01:01 and
RT   A*01:03, identified by cloning and sequencing.";
RL   Tissue Antigens 83:423-424(2014).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence for as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; AJ278305; AJ278305.1.
DR   EMBL; AL645935; AL645935.0.
DR   EMBL; CR759913; CR759913.0.
DR   EMBL; EU445470; EU445470.0.
DR   EMBL; GU812295; GU812295.0.
DR   EMBL; HG794373; HG794373.0.
DR   EMBL; M24043; M24043.1.
DR   EMBL; X55710; X55710.1.
DR   EMBL; Z93949; Z93949.1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1098
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Oriental, Caucasoid"
FT                   /cell_line="7550800303"
FT                   /cell_line="APD"
FT                   /cell_line="B4702"
FT                   /cell_line="COX"
FT                   /cell_line="LCL721"
FT                   /cell_line="MOLT-4"
FT                   /cell_line="PP"
FT   CDS             1..1098
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:01:01:01"
FT                   /product="MHC Class I HLA-A*01:01:01:01 sequence"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   exon            1..73
FT                   /number="1"
FT   exon            74..343
FT                   /number="2"
FT   exon            344..619
FT                   /number="3"
FT   exon            620..895
FT                   /number="4"
FT   exon            896..1012
FT                   /number="5"
FT   exon            1013..1045
FT                   /number="6"
FT   exon            1046..1093
FT                   /number="7"
FT   exon            1094..1098
FT                   /number="8"
SQ   Sequence 1098 BP; 221 A; 332 C; 368 G; 177 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggctccca ctccatgagg tatttcttca catccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaagatggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccagga gacacggaat atgaaggccc actcacagac tgaccgagcg       300
     aacctgggga ccctgcgcgg ctactacaac cagagcgagg acggttctca caccatccag       360
     ataatgtatg gctgcgacgt ggggccggac gggcgcttcc tccgcgggta ccggcaggac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcttg gaccgcggcg       480
     gacatggcag ctcagatcac caagcgcaag tgggaggcgg tccatgcggc ggagcagcgg       540
     agagtctacc tggagggccg gtgcgtggac gggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcacgga cccccccaag acacatatga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca       780
     ggggatggaa ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga       840
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atgggagctg       900
     tcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ccttggagct       960
     gtgatcactg gagctgtggt cgctgccgtg atgtggagga ggaagagctc agatagaaaa      1020
     ggagggagtt acactcaggc tgcaagcagt gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgta aagtgtga                                                    1098
//


spacer
spacer