ID HLA00001 standard; DNA; HUM; 3503 BP. XX AC HLA00001; XX DT 01-AUG-1989 (Rel. 1.0.0, Created, Version 1) DT 16-DEC-1998 (Rel. 1.0.0, Sequence Updated, Version 1) DT 12-JUL-2013 (Rel. 3.13.0, Current Release, Version 1) XX DE HLA-A*01:01:01:01, Human MHC Class I sequence XX KW Human MHC; HLA; Class I; HLA-A; Allele; A*01:01:01:01; XX OS Homo Sapiens (human) OC Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates; OC Catarrhini; Hominidae; Homo. XX CC -------------------------------------------------------------------------- CC Copyrighted by the IMGT/HLA Database, Distributed under the Creative CC Commons Attribution-NoDerivs License, see; CC http://www.ebi.ac.uk/imgt/hla/licence.html for further details. CC -------------------------------------------------------------------------- XX RN [1] RP 1-3503 RX PUBMED; 3375250. RA Parham P, Lomen CE, Lawlor DA, Ways JP, Holmes N, Coppin HL, Salter RD, RA Wan AM, Ennis PD; RT "Nature of polymorphism in HLA-A, -B, and -C molecules"; RL Proc Natl Acad Sci U S A 85:4005-9(1988). XX RN [2] RP 1-3503 RX PUBMED; 2251137. RA Girdlestone J; RT "Nucleotide sequence of an HLA-A1 gene"; RL Nucleic Acids Res 18:6701-6701(1990). XX RN [3] RP 1-3503 RX PUBMED; 9349617. RA Laforet M, Froelich N, Parissiadis A, Pfeiffer B, Schell A, Faller B, RA Woehl-Jaegle ML, Cazenave JP, Tongio MM; RT "A nucleotide insertion in exon 4 is responsible for the absence of RT expression of an HLA-A*01 allele"; RL Tissue Antigens 50:347-50(1997). XX RN [4] RP 1-3503 RX PUBMED; 15140828. RA Stewart CA, Horton R, Allcock RJ, Ashurst JL, Atrazhev AM, Coggill P, RA Dunham I, Forbes S, Halls K, Howson JM, Humphray SJ, Hunt S, Mungall AJ, RA Osoegawa K, Palmer S, Roberts AN, Rogers J, Sims S, Wang Y, Wilming LG, RA Elliott JF, de Jong PJ, Sawcer S, Todd JA, Trowsdale J, Beck S; RT "Complete MHC haplotype sequencing for common disease gene mapping"; RL Genome Res 14:1176-87(2004). XX RN [5] RP 1-3503 RX PUBMED; 19735485. RA Zhu F, He Y, Zhang W, He J, He J, Xu X, Yan L; RT "Analysis of the complete genomic sequence of HLA-A alleles in the Chinese RT Han population."; RL Int. J. Immunogenetics 36:351-360(2009). XX CC -------------------------------------------------------------------------- CC The sequence below is the official sequence for A*01:01:01:01, as CC approved by the WHO Nomenclature Committee for Factors of the HLA System. CC Any cross references may differ from the sequence shown below. CC -------------------------------------------------------------------------- XX DR EMBL; AJ278305; AJ278305.1. DR EMBL; AL645935; AL645935.0. DR EMBL; CR759913; CR759913.0. DR EMBL; EU445470; EU445470.0. DR EMBL; GU812295; GU812295.0. DR EMBL; M24043; M24043.1. DR EMBL; X55710; X55710.1. DR EMBL; Z93949; Z93949.1. XX FH Key Location/Qualifiers FH FT source 1..3503 FT /organism="Homo sapiens" FT /mol_type="genomic DNA" FT /db_xref="taxon:9606" FT /ethnic="Oriental, Caucasoid" FT /cell_line="7550800303" FT /cell_line="APD" FT /cell_line="B4702" FT /cell_line="COX" FT /cell_line="LCL721" FT /cell_line="MOLT-4" FT /cell_line="PP" FT CDS join(301..373,504..773,1015..1290,1870..2145,2248..2364, FT 2807..2839,2982..3029,3199..3203) FT /codon_start=1 FT /gene="HLA-A" FT /allele="HLA-A*01:01:01:01" FT /product="MHC Class I HLA-A*01:01:01:01 sequence" FT /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR FT FIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGT FT LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA FT AQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE FT ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY FT TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK FT GGSYTQAASSDSAQGSDVSLTACKV" FT UTR 1..300 FT exon 301..373 FT /number="1" FT intron 374..503 FT /number="1" FT exon 504..773 FT /number="2" FT intron 774..1014 FT /number="2" FT exon 1015..1290 FT /number="3" FT intron 1291..1869 FT /number="3" FT exon 1870..2145 FT /number="4" FT intron 2146..2247 FT /number="4" FT exon 2248..2364 FT /number="5" FT intron 2365..2806 FT /number="5" FT exon 2807..2839 FT /number="6" FT intron 2840..2981 FT /number="6" FT exon 2982..3029 FT /number="7" FT intron 3030..3198 FT /number="7" FT exon 3199..3203 FT /number="8" FT UTR 3204..3503 SQ Sequence 3503 BP; 666 A; 1012 C; 1070 G; 755 T; 0 other;