ID 2L standard; DNA; HTG; 614 BP. XX AC chromosome:AgamP3:2L:39221590:39222203:1 XX SV chromosome:AgamP3:2L:39221590:39222203:1 XX DT 3-OCT-2013 XX DE Anopheles gambiae chromosome 2L AgamP3 partial sequence 39221590..39222203 DE annotated by VectorBase XX KW . XX OS Anopheles gambiae (African malaria mosquito) OC Pyretophorus; Pterygota; Protostomia; Pancrustacea; Panarthropoda; OC Neoptera; Nematocera; Metazoa; Mandibulata; Insecta; Hexapoda; Eumetazoa; OC Eukaryota; Endopterygota; Diptera; Dicondylia; Culicoidea; Culicimorpha; OC Culicidae; Coelomata; Bilateria; Arthropoda; Anophelinae; Anopheles. XX CC This sequence displays annotation from Ensembl Genomes, based on underlying CC annotation from VectorBase ( http://www.vectorbase.org ). See CC http://www.ensemblgenomes.org for more information. XX CC All feature locations are relative to the first (5') base of the sequence CC in this file. The sequence presented is always the forward strand of the CC assembly. Features that lie outside of the sequence contained in this file CC have clonal location coordinates in the format: .:.. XX CC The /gene indicates a unique id for a gene, /note="transcript_id=..." a CC unique id for a transcript, /protein_id a unique id for a peptide and CC note="exon_id=..." a unique id for an exon. These ids are maintained CC wherever possible between versions. XX FH Key Location/Qualifiers FT source 1..614 FT /organism="Anopheles gambiae" FT /db_xref="taxon:7165" FT gene 1..614 FT /gene=AGAP006864 FT /locus_tag="CPR34" FT /note="cuticular protein RR-1 family (CPR34) [Source:VB FT Community Annotation;Acc:AGAP006864]" FT mRNA join(1..60,123..614) FT /gene="AGAP006864" FT /note="transcript_id=AGAP006864-RA" FT CDS join(52..60,123..527) FT /gene="AGAP006864" FT /protein_id="AGAP006864-PA" FT /note="transcript_id=AGAP006864-RA" FT /db_xref="RefSeq_peptide:XP_308891.2" FT /db_xref="RefSeq_dna_predicted:XM_308891.2" FT /db_xref="RefSeq_dna_predicted:XM_308891.2" FT /db_xref="RefSeq_mRNA_predicted:XM_308891.2" FT /db_xref="RefSeq_peptide_predicted:XP_308891.2" FT /db_xref="RefSeq_rna_predicted:XM_308891.2" FT /db_xref="EMBL_predicted:AAAB01008807" FT /db_xref="Uniprot/SPTREMBL:B5KP61_ANOGA" FT /db_xref="Uniprot/SPTREMBL:B5KP62_ANOGA" FT /db_xref="Uniprot/SPTREMBL:B5KP63_ANOGA" FT /db_xref="Uniprot/SPTREMBL:B5KP64_ANOGA" FT /db_xref="Uniprot/SPTREMBL:B5KP66_ANOGA" FT /db_xref="Uniprot/SPTREMBL:B5KP68_ANOGA" FT /db_xref="Uniprot/SPTREMBL:B5KP69_ANOGA" FT /db_xref="Uniprot/SPTREMBL:B5KP73_ANOGA" FT /db_xref="Uniprot/SPTREMBL:B5KP75_ANOGA" FT /db_xref="Uniprot/SPTREMBL:B5KP76_ANOGA" FT /db_xref="Uniprot/SPTREMBL:B5KP77_ANOGA" FT /db_xref="Uniprot/SPTREMBL:B5KP81_ANOGA" FT /db_xref="Uniprot/SPTREMBL:B5KP82_ANOGA" FT /db_xref="Uniprot/SPTREMBL:B5KP84_ANOGA" FT /db_xref="Uniprot/SPTREMBL_predicted:Q7PF34_ANOGA" FT /db_xref="EMBL:EU097424" FT /db_xref="EMBL:EU097425" FT /db_xref="EMBL:EU097426" FT /db_xref="EMBL:EU097427" FT /db_xref="EMBL:EU097428" FT /db_xref="EMBL:EU097429" FT /db_xref="EMBL:EU097430" FT /db_xref="EMBL:EU097431" FT /db_xref="EMBL:EU097432" FT /db_xref="EMBL:EU097433" FT /db_xref="EMBL:EU097434" FT /db_xref="EMBL:EU097435" FT /db_xref="EMBL:EU097436" FT /db_xref="EMBL:EU097437" FT /db_xref="EMBL:EU097438" FT /db_xref="EMBL:EU097439" FT /db_xref="EMBL:EU097440" FT /db_xref="EMBL:EU097441" FT /db_xref="EMBL:EU097442" FT /db_xref="EMBL:EU097443" FT /db_xref="EMBL:EU097444" FT /db_xref="EMBL:EU097445" FT /db_xref="EMBL:EU097446" FT /db_xref="EMBL:EU097447" FT /db_xref="EMBL:EU097448" FT /db_xref="EMBL:EU097449" FT /db_xref="EMBL:EU097450" FT /db_xref="GO:GO:0042302" FT /db_xref="goslim_goa:GO:0003674" FT /db_xref="goslim_goa:GO:0005198" FT /db_xref="protein_id:ABY16715.1" FT /db_xref="protein_id:ABY16716.1" FT /db_xref="protein_id:ABY16717.1" FT /db_xref="protein_id:ABY16718.1" FT /db_xref="protein_id:ABY16719.1" FT /db_xref="protein_id:ABY16720.1" FT /db_xref="protein_id:ABY16721.1" FT /db_xref="protein_id:ABY16722.1" FT /db_xref="protein_id:ABY16723.1" FT /db_xref="protein_id:ABY16724.1" FT /db_xref="protein_id:ABY16725.1" FT /db_xref="protein_id:ABY16726.1" FT /db_xref="protein_id:ABY16727.1" FT /db_xref="protein_id:ABY16728.1" FT /db_xref="protein_id:ABY16729.1" FT /db_xref="protein_id:ABY16730.1" FT /db_xref="protein_id:ABY16731.1" FT /db_xref="protein_id:ABY16732.1" FT /db_xref="protein_id:ABY16733.1" FT /db_xref="protein_id:ABY16734.1" FT /db_xref="protein_id:ABY16735.1" FT /db_xref="protein_id:ABY16736.1" FT /db_xref="protein_id:ABY16737.1" FT /db_xref="protein_id:ABY16738.1" FT /db_xref="protein_id:ABY16739.1" FT /db_xref="protein_id:ABY16740.1" FT /db_xref="protein_id:ABY16741.1" FT /db_xref="protein_id_predicted:EAA45480.2" FT /db_xref="UniParc:UPI00002458F1" FT /translation="MFKIIALTVACLAVAASAQYWGGSGYGYGAEHHGHHDYYSHPSYK FT FEYGVKDPHTGDHKSQWEHRDGDVVKGAYTLHEADGTERVVEYSSDKHNGFQAHVKRVG FT HAHHPQVYGHHGGYYGGYGHGSGYSYSKLDQHF" FT exon 123..614 FT /note="exon_id=E023377" FT exon 1..60 FT /note="exon_id=E023376" FT gene 1..614 FT /gene=vb_estg021899 FT mRNA join(1..60,123..614) FT /gene="vb_estg021899" FT /note="transcript_id=vb_estt021899" FT CDS join(52..60,123..527) FT /gene="vb_estg021899" FT /protein_id="vb_estp021899" FT /note="transcript_id=vb_estt021899" FT /translation="MFKIIALTVACLAVAASAQYWGGSGYGYGAEHHGHHDYYSHPSYK FT FEYGVKDPHTGDHKSQWEHRDGDVVKGAYTLHEADGTERVVEYSSDKHNGFQAHVKRVG FT HAHHPQVYGHHGGYYGGYGHGSGYSYSKLDQHF" FT exon 123..614 FT /note="exon_id=vb_este054395" FT exon 1..60 FT /note="exon_id=vb_este054394" FT mRNA join(52..60,123..527) FT /product="MFKIIALTVACLAVAASAQYWGGSGYGYGAEHHGHHDYYSHPSYKFEYG FT VKDPHTGDHKSQWEHRDGDVVKGAYTLHEADGTERVVEYSSDKHNGFQAHVKRVGHAHH FT PQVYGHHGGYYGGYGHGSGYSYSKLDQHF" FT /note="identifier=SNAP_ANOPHELES00000011350" FT /note="Derived by automated computational analysis using FT gene prediction method:snap" FT variation 7..7 FT /replace="C/A" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39221596" FT variation 67..67 FT /replace="T/A" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39221656" FT variation 73..73 FT /replace="C/T" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39221662" FT variation 99..99 FT /replace="A/T" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39221688" FT variation 130..130 FT /replace="C/T" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39221719" FT variation 151..151 FT /replace="C/T" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39221740" FT variation 160..160 FT /replace="C/T" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39221749" FT variation 168..168 FT /replace="C/G" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39221757" FT variation 308..308 FT /replace="C/G" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39221897" FT variation 311..311 FT /replace="C/T" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39221900" FT variation 404..404 FT /replace="A/G" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39221993" FT variation 409..409 FT /replace="A/G" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39221998" FT variation 432..432 FT /replace="C/T" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39222021" FT variation 455..455 FT /replace="T/C" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39222044" FT variation 479..479 FT /replace="C/T" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39222068" FT variation 491..491 FT /replace="G/A" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39222080" FT variation 534..534 FT /replace="G/T" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39222123" FT variation 561..561 FT /replace="C/A" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39222150" FT variation 565..565 FT /replace="G/A" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39222154" FT variation 601..601 FT /replace="A/G" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39222190" FT variation 613..613 FT /replace="G/A" FT /db_xref="WTSI-Ag-GVP-0.1:WTSI-Ag-GVP-0.1-SNP-2L-39222202" FT misc_feature complement(AAAB01008807_203:34205..34678) FT /note="match: Q5TWJ2.3 : 687..849(1)" FT misc_feature 59..157 FT /note="match: B6KS04.1 : 97..130(1)" FT misc_feature 65..157 FT /note="match: B3S3U6.1 : 119..151(1)" FT misc_feature 83..157 FT /note="match: Q91ZR4.1 : 125..151(1)" FT misc_feature 83..157 FT /note="match: B1AQC9.1 : 125..151(1)" FT misc_feature 83..157 FT /note="match: Q86SG6.1 : 125..151(1)" FT misc_feature 96..449 FT /note="match: B4L0R9.1 : 3..125(1)" FT misc_feature 96..419 FT /note="match: Q8IPD9.2 : 54..157(1)" FT misc_feature 99..440 FT /note="match: B4NJ31.1 : 11..139(1)" FT misc_feature 102..404 FT /note="match: B5KPC0.1 : 3..102(1)" FT misc_feature 102..449 FT /note="match: B5KPA7.1 : 3..117(1)" FT misc_feature 102..452 FT /note="match: Q16X38.1 : 20..122(1)" FT misc_feature 108..440 FT /note="match: Q16EY1.1 : 1..104(1)" FT misc_feature 111..437 FT /note="match: B4IZX6.1 : 3..121(1)" FT misc_feature 111..455 FT /note="match: B3M794.1 : 3..130(1)" FT misc_feature 111..455 FT /note="match: B4LDF1.1 : 3..127(1)" FT misc_feature 111..455 FT /note="match: B4N5F2.1 : 3..126(1)" FT misc_feature 114..449 FT /note="match: B4LDJ1.1 : 3..122(1)" FT misc_feature 114..467 FT /note="match: B4KYC4.1 : 20..138(1)" FT misc_feature 114..467 FT /note="match: B4N4B7.1 : 1..121(1)" FT misc_feature 114..455 FT /note="match: B3M8K0.1 : 1..117(1)" FT misc_feature 116..172 FT /note="match: Q8IQ18.4 : 3591..3609(1)" FT misc_feature 117..440 FT /note="match: Q16EX9.1 : 2..92(1)" FT misc_feature 117..524 FT /note="match: A0NBC0.2 : 2..143(1)" FT misc_feature 117..437 FT /note="match: Q16EX1.1 : 2..101(1)" FT misc_feature 117..419 FT /note="match: B4I4J2.1 : 3..100(1)" FT misc_feature 117..521 FT /note="match: Q16X34.1 : 2..141(1)" FT misc_feature 117..524 FT /note="match: Q16X70.1 : 2..129(1)" FT misc_feature 117..239 FT /note="match: B2DBJ2.1 : 3..43(1)" FT misc_feature 117..524 FT /note="match: Q7PP69.3 : 2..138(1)" FT misc_feature 117..458 FT /note="match: A7URY7.1 : 2..117(1)" FT misc_feature 117..524 FT /note="match: Q16FG0.1 : 2..129(1)" FT misc_feature 117..419 FT /note="match: B4NA93.1 : 3..100(1)" FT misc_feature 117..419 FT /note="match: B4PSJ7.1 : 3..100(1)" FT misc_feature 117..524 FT /note="match: A7URZ0.1 : 2..143(1)" FT misc_feature 117..524 FT /note="match: Q16X60.1 : 2..129(1)" FT misc_feature 117..476 FT /note="match: B4M8Y6.1 : 6..141(1)" FT misc_feature 117..524 FT /note="match: Q7PF34.2 : 2..137(1)" FT misc_feature 117..524 FT /note="match: A0NBB9.1 : 2..129(1)" FT misc_feature 117..524 FT /note="match: Q7PTA3.4 : 2..139(1)" FT misc_feature 117..524 FT /note="match: A7URZ1.1 : 2..143(1)" FT misc_feature 117..524 FT /note="match: A7URY9.1 : 2..143(1)" FT misc_feature 117..440 FT /note="match: Q16X50.1 : 2..92(1)" FT misc_feature 117..470 FT /note="match: B0W890.1 : 2..99(1)" FT misc_feature 117..521 FT /note="match: Q17NJ2.1 : 2..120(1)" FT misc_feature 117..440 FT /note="match: B0W8A5.1 : 2..92(1)" FT misc_feature 117..470 FT /note="match: B0W887.1 : 2..110(1)" FT misc_feature 117..524 FT /note="match: Q16X65.1 : 2..129(1)" FT misc_feature 117..524 FT /note="match: Q16EC2.1 : 2..129(1)" FT misc_feature 117..521 FT /note="match: B0W0B5.1 : 2..109(1)" FT misc_feature 117..521 FT /note="match: Q1DGS7.1 : 2..110(1)" FT misc_feature 117..524 FT /note="match: Q16EB8.1 : 2..129(1)" FT misc_feature 117..419 FT /note="match: Q8MRD2.1 : 18..115(1)" FT misc_feature 117..440 FT /note="match: Q16X49.1 : 2..92(1)" FT misc_feature 117..524 FT /note="match: A0NBM4.2 : 2..143(1)" FT misc_feature 117..521 FT /note="match: Q16EW9.1 : 2..140(1)" FT misc_feature 117..524 FT /note="match: A7URY8.1 : 2..129(1)" FT misc_feature 117..419 FT /note="match: O97064.1 : 3..100(1)" FT misc_feature 117..419 FT /note="match: B4QYE2.1 : 3..100(1)" FT misc_feature 120..467 FT /note="match: Q16JC2.1 : 3..102(1)" FT misc_feature 120..521 FT /note="match: B0W885.1 : 3..121(1)" FT misc_feature 123..419 FT /note="match: Q17015.3 : 33..124(1)" FT misc_feature 123..419 FT /note="match: B5DRX5.1 : 31..124(1)" FT misc_feature 123..419 FT /note="match: B4JE44.1 : 5..96(1)" FT misc_feature 123..419 FT /note="match: A0NH01.1 : 33..124(1)" FT misc_feature 123..419 FT /note="match: Q7PXZ2.3 : 33..124(1)" FT misc_feature 123..521 FT /note="match: B0X224.1 : 19..169(1)" FT misc_feature 123..419 FT /note="match: Q380K3.1 : 34..131(1)" FT misc_feature 126..521 FT /note="match: Q16X42.1 : 4..136(1)" FT misc_feature 126..419 FT /note="match: B3M0R8.1 : 5..95(1)" FT misc_feature 126..449 FT /note="match: B0X2K8.1 : 8..111(1)" FT misc_feature 126..419 FT /note="match: B0X2K5.1 : 8..97(1)" FT misc_feature 126..449 FT /note="match: B0X2K3.1 : 8..111(1)" FT misc_feature 126..521 FT /note="match: Q16X77.1 : 4..144(1)" FT misc_feature 126..449 FT /note="match: B0X2K0.1 : 8..111(1)" FT misc_feature 129..434 FT /note="match: P81225.1 : 30..131(1)" FT misc_feature 132..446 FT /note="match: Q16PW8.1 : 5..121(1)" FT misc_feature 132..419 FT /note="match: B3M0R7.1 : 13..105(1)" FT misc_feature 132..419 FT /note="match: B2DBK4.1 : 19..115(1)" FT misc_feature 132..458 FT /note="match: B0X2J5.1 : 6..99(1)" FT misc_feature 132..485 FT /note="match: A0NG12.1 : 35..153(1)" FT misc_feature 132..437 FT /note="match: Q17J78.1 : 45..147(1)" FT misc_feature 135..455 FT /note="match: B4QMZ3.1 : 6..127(1)" FT misc_feature 135..455 FT /note="match: Q9W077.1 : 6..127(1)" FT misc_feature 135..455 FT /note="match: B4PDV2.1 : 6..127(1)" FT misc_feature 135..455 FT /note="match: B4HW15.1 : 6..127(1)" FT misc_feature 135..455 FT /note="match: B3NEW5.1 : 6..127(1)" FT misc_feature complement(138..200) FT /note="match: Q9VW05.4 : 601..621(1)" FT misc_feature complement(138..200) FT /note="match: B3NIE6.1 : 593..613(1)" FT misc_feature complement(138..200) FT /note="match: B4IIL7.1 : 605..625(1)" FT misc_feature complement(138..200) FT /note="match: B4IUB7.1 : 302..322(1)" FT misc_feature complement(138..200) FT /note="match: B4PGG1.1 : 605..625(1)" FT misc_feature 141..491 FT /note="match: B3NFT9.1 : 57..172(1)" FT misc_feature 147..521 FT /note="match: Q16X32.1 : 1..128(1)" FT misc_feature 147..500 FT /note="match: B4KZD5.1 : 109..226(1)" FT misc_feature 147..524 FT /note="match: Q5TWJ1.2 : 9..131(1)" FT misc_feature 153..515 FT /note="match: B4LCK8.1 : 64..181(1)" FT misc_feature 153..515 FT /note="match: B4KZD6.1 : 59..179(1)" FT misc_feature 156..434 FT /note="match: P11733.2 : 8..97(1)" FT misc_feature 156..449 FT /note="match: A1YLE4.1 : 69..168(1)" FT misc_feature 159..479 FT /note="match: B4MZ37.1 : 39..150(1)" FT misc_feature 159..521 FT /note="match: Q9NES7.1 : 570..689(1)" FT misc_feature 162..524 FT /note="match: B5KP73.1 : 1..121(1)" FT misc_feature 162..524 FT /note="match: B5KP63.1 : 1..121(1)" FT misc_feature 162..524 FT /note="match: B5KP62.1 : 1..121(1)" FT misc_feature 168..494 FT /note="match: B2ZGH4.1 : 247..363(1)" FT misc_feature 168..494 FT /note="match: B2ZGH4.1 : 110..219(1)" FT misc_feature 168..515 FT /note="match: B3M7J5.1 : 69..184(1)" FT misc_feature 171..524 FT /note="match: B4IIL5.1 : 55..177(1)" FT misc_feature 171..512 FT /note="match: Q16EY2.1 : 114..240(1)" FT misc_feature 174..518 FT /note="match: B4J1B4.1 : 67..198(1)" FT misc_feature 177..503 FT /note="match: B4IIL5.1 : 67..182(1)" FT misc_feature 177..425 FT /note="match: Q5TR98.1 : 47..132(1)" FT misc_feature 177..503 FT /note="match: B4IUB5.1 : 67..182(1)" FT misc_feature 177..437 FT /note="match: Q16JC3.1 : 58..146(1)" FT misc_feature 177..503 FT /note="match: B4PGG4.1 : 66..179(1)" FT misc_feature 177..512 FT /note="match: Q7Q693.3 : 53..173(1)" FT misc_feature 177..503 FT /note="match: B4QQU2.1 : 67..182(1)" FT misc_feature 177..503 FT /note="match: Q9VW03.1 : 67..182(1)" FT misc_feature 177..521 FT /note="match: B0WPC1.1 : 49..166(1)" FT misc_feature 177..515 FT /note="match: B3NIE4.1 : 67..173(1)" FT misc_feature 180..524 FT /note="match: B4LCK9.1 : 61..179(1)" FT misc_feature 180..524 FT /note="match: B3M7J4.1 : 56..175(1)" FT misc_feature 180..506 FT /note="match: B0W878.1 : 73..187(1)" FT misc_feature 180..470 FT /note="match: Q7QIG3.3 : 48..140(1)" FT misc_feature 180..485 FT /note="match: B4H986.1 : 60..172(1)" FT misc_feature 180..485 FT /note="match: Q29DG6.1 : 60..172(1)" FT misc_feature 180..512 FT /note="match: Q16X29.1 : 75..187(1)" FT misc_feature 186..521 FT /note="match: Q29P45.1 : 48..159(1)" FT misc_feature 186..521 FT /note="match: B2ZGH4.1 : 60..180(1)" FT misc_feature 186..506 FT /note="match: B4MXK9.1 : 62..172(1)" FT misc_feature 186..521 FT /note="match: B4GK10.1 : 48..157(1)" FT misc_feature 189..521 FT /note="match: Q9GTN1.1 : 53..172(1)" FT misc_feature 189..485 FT /note="match: Q9NES7.1 : 542..632(1)" FT misc_feature 189..497 FT /note="match: Q9NES7.1 : 519..620(1)" FT misc_feature 189..521 FT /note="match: A8XY13.1 : 591..704(1)" FT misc_feature 189..506 FT /note="match: B4P0L2.1 : 53..171(1)" FT misc_feature 189..479 FT /note="match: Q9V3P9.1 : 53..153(1)" FT misc_feature 189..506 FT /note="match: Q9GTN0.1 : 53..171(1)" FT misc_feature 189..521 FT /note="match: B4Q5J5.1 : 53..172(1)" FT misc_feature 189..521 FT /note="match: B4HXH2.1 : 53..172(1)" FT misc_feature 189..521 FT /note="match: A7URX7.1 : 15..121(1)" FT misc_feature 192..521 FT /note="match: Q5TWJ0.2 : 71..181(1)" FT misc_feature 195..515 FT /note="match: B3MLG2.1 : 56..167(1)" FT misc_feature 195..458 FT /note="match: B3M8K1.1 : 66..156(1)" FT misc_feature 195..548 FT /note="match: B0W888.1 : 70..194(1)" FT misc_feature 198..419 FT /note="match: B0X2L5.1 : 62..129(1)" FT misc_feature 201..419 FT /note="match: B4LEL8.1 : 154..225(1)" FT misc_feature 201..521 FT /note="match: Q1DGY5.1 : 18..125(1)" FT misc_feature 201..419 FT /note="match: B4QYE1.1 : 22..95(1)" FT misc_feature 201..419 FT /note="match: P27780.1 : 22..95(1)" FT misc_feature 201..419 FT /note="match: B3P2P1.1 : 22..95(1)" FT misc_feature 201..521 FT /note="match: Q16X37.1 : 18..125(1)" FT misc_feature 201..443 FT /note="match: Q170Z6.1 : 112..195(1)" FT misc_feature 201..521 FT /note="match: Q16X36.1 : 16..125(1)" FT misc_feature 201..458 FT /note="match: Q9BPR5.1 : 162..243(1)" FT misc_feature 201..293 FT /note="match: Q29DG5.2 : 231..260(1)" FT misc_feature 204..413 FT /note="match: B3M4S4.1 : 1290..1358(1)" FT misc_feature 204..413 FT /note="match: B4MXL1.1 : 1276..1343(1)" FT misc_feature 204..458 FT /note="match: Q2LYM9.1 : 72..158(1)" FT misc_feature 204..458 FT /note="match: B4H621.1 : 72..158(1)" FT misc_feature 204..413 FT /note="match: B4LCL1.1 : 1272..1340(1)" FT misc_feature 204..458 FT /note="match: Q16X30.1 : 49..143(1)" FT misc_feature 204..413 FT /note="match: Q9VW05.4 : 1141..1209(1)" FT misc_feature 204..470 FT /note="match: B4IZF9.1 : 72..167(1)" FT misc_feature 204..413 FT /note="match: B3NIE6.1 : 1124..1192(1)" FT misc_feature 204..521 FT /note="match: B4JPG0.1 : 45..153(1)" FT misc_feature 204..425 FT /note="match: Q16R87.1 : 26..97(1)" FT misc_feature 204..413 FT /note="match: B4KZD3.1 : 1073..1141(1)" FT misc_feature 204..413 FT /note="match: B4IIL7.1 : 1144..1212(1)" FT misc_feature 204..413 FT /note="match: B4IUB7.1 : 842..910(1)" FT misc_feature 204..413 FT /note="match: B5DRL0.1 : 1254..1322(1)" FT misc_feature 204..413 FT /note="match: Q9BPR4.1 : 111..180(1)" FT misc_feature 204..470 FT /note="match: B4LDJ3.1 : 72..164(1)" FT misc_feature 204..413 FT /note="match: B4H988.1 : 1252..1320(1)" FT misc_feature 204..413 FT /note="match: B3DMW6.1 : 371..439(1)" FT misc_feature 204..413 FT /note="match: B4PGG1.1 : 1110..1178(1)" FT misc_feature 204..458 FT /note="match: B3NFT7.1 : 73..161(1)" FT misc_feature 204..458 FT /note="match: Q7QIH3.4 : 60..145(1)" FT misc_feature 204..413 FT /note="match: B4J1B6.1 : 1988..2056(1)" FT misc_feature 205..408 FT /note="match: A8XNH3.2 : 1299..1366(1)" FT misc_feature 207..515 FT /note="match: B4IIL4.1 : 85..192(1)" FT misc_feature 207..515 FT /note="match: B4H985.1 : 100..201(1)" FT misc_feature 207..518 FT /note="match: A0APM1.1 : 85..190(1)" FT misc_feature 207..521 FT /note="match: A8XY13.1 : 385..472(1)" FT misc_feature 207..458 FT /note="match: B0W879.1 : 56..140(1)" FT misc_feature 207..518 FT /note="match: Q9VW02.1 : 85..190(1)" FT misc_feature 207..515 FT /note="match: Q29DG7.1 : 100..201(1)" FT misc_feature 207..434 FT /note="match: Q16X31.1 : 53..128(1)" FT misc_feature 207..434 FT /note="match: Q16EW8.1 : 53..128(1)" FT misc_feature 207..518 FT /note="match: B4QQU1.1 : 85..191(1)" FT misc_feature 207..518 FT /note="match: A0APM5.1 : 85..190(1)" FT misc_feature 207..518 FT /note="match: A0APM8.1 : 85..190(1)" FT misc_feature 207..518 FT /note="match: A0APM6.1 : 85..190(1)" FT misc_feature 210..431 FT /note="match: Q29KF3.1 : 114..187(1)" FT misc_feature 210..443 FT /note="match: B0WMM6.1 : 83..161(1)" FT misc_feature 210..446 FT /note="match: B3M0R3.1 : 46..132(1)" FT misc_feature 210..431 FT /note="match: B3NA72.1 : 147..220(1)" FT misc_feature 210..431 FT /note="match: Q9VQH5.2 : 146..219(1)" FT misc_feature 210..437 FT /note="match: B0XH89.1 : 23..100(1)" FT misc_feature 210..443 FT /note="match: Q5TR20.2 : 60..138(1)" FT misc_feature 210..437 FT /note="match: B0XH90.1 : 23..100(1)" FT misc_feature 210..455 FT /note="match: O77057.1 : 84..163(1)" FT misc_feature 210..446 FT /note="match: B4LZ37.1 : 52..136(1)" FT misc_feature 210..419 FT /note="match: Q45V97.1 : 66..133(1)" FT misc_feature 210..431 FT /note="match: B4HBX8.1 : 114..187(1)" FT misc_feature 213..419 FT /note="match: B4PSJ8.1 : 26..95(1)" FT misc_feature 213..419 FT /note="match: B4GEP3.1 : 26..95(1)" FT misc_feature 213..419 FT /note="match: Q296T8.2 : 26..95(1)" FT misc_feature 213..449 FT /note="match: B0X2K4.1 : 25..109(1)" FT misc_feature 213..431 FT /note="match: B4L9C2.1 : 61..133(1)" FT misc_feature 213..419 FT /note="match: B3MPB3.1 : 27..97(1)" FT misc_feature 216..521 FT /note="match: A0NBC1.2 : 21..126(1)" FT misc_feature 216..419 FT /note="match: Q7Q0X1.4 : 71..139(1)" FT misc_feature 216..524 FT /note="match: A7URY2.1 : 21..122(1)" FT misc_feature 216..428 FT /note="match: Q17C16.1 : 26..99(1)" FT misc_feature 216..521 FT /note="match: A7URY4.1 : 21..127(1)" FT misc_feature 216..521 FT /note="match: A7URY1.1 : 21..127(1)" FT misc_feature 216..452 FT /note="match: B0W874.1 : 614..694(1)" FT misc_feature 216..419 FT /note="match: B0X2J3.1 : 26..94(1)" FT misc_feature 216..419 FT /note="match: B0X2J6.1 : 26..94(1)" FT misc_feature 216..440 FT /note="match: B0W8A1.1 : 18..92(1)" FT misc_feature 216..419 FT /note="match: Q17C13.1 : 26..94(1)" FT misc_feature 216..512 FT /note="match: B0W891.1 : 70..164(1)" FT misc_feature 216..419 FT /note="match: B0X2J1.1 : 26..94(1)" FT misc_feature 216..419 FT /note="match: B0X2J4.1 : 26..94(1)" FT misc_feature 216..428 FT /note="match: Q17C14.1 : 26..99(1)" FT misc_feature 216..521 FT /note="match: A7URY0.1 : 21..127(1)" FT misc_feature 216..437 FT /note="match: Q17C20.1 : 58..133(1)" FT misc_feature 216..521 FT /note="match: A7UR77.1 : 21..121(1)" FT misc_feature 216..521 FT /note="match: A7URX9.1 : 21..123(1)" FT misc_feature 216..521 FT /note="match: A7URX6.1 : 21..127(1)" FT misc_feature 216..419 FT /note="match: Q17C18.1 : 57..125(1)" FT misc_feature 216..419 FT /note="match: Q17C17.1 : 52..120(1)" FT misc_feature 216..518 FT /note="match: A0APM2.1 : 91..190(1)" FT misc_feature 219..521 FT /note="match: A7URX8.1 : 22..127(1)" FT misc_feature 219..458 FT /note="match: A9NM67.1 : 95..179(1)" FT misc_feature 219..470 FT /note="match: Q16EY0.1 : 21..100(1)" FT misc_feature 219..416 FT /note="match: B4IZF9.1 : 22..87(1)" FT misc_feature 219..470 FT /note="match: Q16X55.1 : 33..112(1)" FT misc_feature 222..419 FT /note="match: Q16UT4.1 : 66..131(1)" FT misc_feature 222..419 FT /note="match: O61484.1 : 85..150(1)" FT misc_feature 222..419 FT /note="match: O61483.1 : 109..174(1)" FT misc_feature 222..431 FT /note="match: B0W473.1 : 83..152(1)" FT misc_feature 222..521 FT /note="match: Q7PTB7.4 : 20..119(1)" FT misc_feature 222..419 FT /note="match: Q17BZ5.1 : 71..136(1)" FT misc_feature 222..419 FT /note="match: Q17C00.1 : 71..136(1)" FT misc_feature 222..419 FT /note="match: B4NA94.1 : 64..129(1)" FT misc_feature 222..431 FT /note="match: B0W474.1 : 75..144(1)" FT misc_feature 222..431 FT /note="match: B0W475.1 : 83..152(1)" FT misc_feature 222..419 FT /note="match: B4PZA1.1 : 63..128(1)" FT misc_feature 222..419 FT /note="match: B2DBJ2.1 : 66..131(1)" FT misc_feature 222..524 FT /note="match: Q16E61.1 : 20..105(1)" FT misc_feature 222..419 FT /note="match: Q7Q0W4.3 : 85..150(1)" FT misc_feature 222..419 FT /note="match: B4JGV1.1 : 68..133(1)" FT misc_feature 222..431 FT /note="match: B0WR05.1 : 36..105(1)" FT misc_feature 222..419 FT /note="match: O62615.1 : 77..142(1)" FT misc_feature 222..443 FT /note="match: B4IZX5.1 : 28..101(1)" FT misc_feature 222..419 FT /note="match: O61485.1 : 85..150(1)" FT misc_feature 222..419 FT /note="match: B0WB48.1 : 93..158(1)" FT misc_feature 222..443 FT /note="match: B3NEW4.1 : 28..101(1)" FT misc_feature 222..419 FT /note="match: B0W478.1 : 83..148(1)" FT misc_feature 222..419 FT /note="match: Q7PRE1.4 : 35..100(1)" FT misc_feature 222..521 FT /note="match: Q16EX2.1 : 20..115(1)" FT misc_feature 222..419 FT /note="match: Q17BZ9.1 : 71..136(1)" FT misc_feature 222..434 FT /note="match: B3DNH1.1 : 66..136(1)" FT misc_feature 222..431 FT /note="match: Q16I16.1 : 58..127(1)" FT misc_feature 222..419 FT /note="match: B0X2L6.1 : 74..139(1)" FT misc_feature 222..419 FT /note="match: B4KJF6.1 : 27..93(1)" FT misc_feature 222..443 FT /note="match: B4GS24.1 : 28..101(1)" FT misc_feature 222..419 FT /note="match: B0W471.1 : 75..140(1)" FT misc_feature 222..443 FT /note="match: B3M795.1 : 28..101(1)" FT misc_feature 222..419 FT /note="match: B0W472.1 : 83..148(1)" FT misc_feature 222..521 FT /note="match: Q7PTF0.4 : 20..119(1)" FT misc_feature 222..431 FT /note="match: A0NFT0.1 : 87..156(1)" FT misc_feature 222..419 FT /note="match: B4KIU0.1 : 69..134(1)" FT misc_feature 222..419 FT /note="match: A0NG21.1 : 85..150(1)" FT misc_feature 222..419 FT /note="match: B4GEN4.1 : 34..99(1)" FT misc_feature 222..443 FT /note="match: B4PDV1.1 : 28..101(1)" FT misc_feature 222..419 FT /note="match: B0W477.1 : 75..140(1)" FT misc_feature 222..419 FT /note="match: B0X2L7.1 : 70..135(1)" FT misc_feature 222..524 FT /note="match: Q16X50.1 : 20..105(1)" FT misc_feature 222..419 FT /note="match: B0X2M3.1 : 90..155(1)" FT misc_feature 222..440 FT /note="match: P82166.1 : 52..124(1)" FT misc_feature 222..440 FT /note="match: P45583.1 : 52..124(1)" FT misc_feature 222..524 FT /note="match: Q16EX8.1 : 20..104(1)" FT misc_feature 222..419 FT /note="match: B4J1G2.1 : 27..92(1)" FT misc_feature 222..443 FT /note="match: B4NSZ7.1 : 28..101(1)" FT misc_feature 222..434 FT /note="match: O97063.1 : 55..125(1)" FT misc_feature 222..443 FT /note="match: Q9W078.2 : 28..101(1)" FT misc_feature 222..419 FT /note="match: B0X2M0.1 : 79..144(1)" FT misc_feature 222..419 FT /note="match: O61480.1 : 85..150(1)" FT misc_feature 222..419 FT /note="match: O97061.1 : 55..120(1)" FT misc_feature 222..419 FT /note="match: Q17BZ4.1 : 71..136(1)" FT misc_feature 222..419 FT /note="match: Q16UU5.1 : 67..132(1)" FT misc_feature 222..521 FT /note="match: Q16X35.1 : 26..109(1)" FT misc_feature 222..443 FT /note="match: B4L0J9.1 : 28..101(1)" FT misc_feature 222..431 FT /note="match: Q7PWH8.4 : 33..102(1)" FT misc_feature 222..419 FT /note="match: Q16UT6.1 : 93..158(1)" FT misc_feature 222..524 FT /note="match: Q16E60.1 : 20..105(1)" FT misc_feature 222..443 FT /note="match: B4LDF3.1 : 28..101(1)" FT misc_feature 222..443 FT /note="match: B4HW14.1 : 28..101(1)" FT misc_feature 222..419 FT /note="match: B0X2M4.1 : 63..128(1)" FT misc_feature 222..443 FT /note="match: B4N5F3.1 : 28..101(1)" FT misc_feature 222..419 FT /note="match: Q7Q0W1.3 : 85..150(1)" FT misc_feature 222..524 FT /note="match: Q16X49.1 : 20..105(1)" FT misc_feature 222..524 FT /note="match: Q16X51.1 : 20..105(1)" FT misc_feature 222..419 FT /note="match: A0NG22.1 : 76..141(1)" FT misc_feature 222..419 FT /note="match: O61489.1 : 85..150(1)" FT misc_feature 222..419 FT /note="match: B4LBP1.1 : 183..248(1)" FT misc_feature 222..419 FT /note="match: Q17C02.1 : 71..136(1)" FT misc_feature 222..419 FT /note="match: O61482.1 : 85..150(1)" FT misc_feature 222..434 FT /note="match: B4GEN9.1 : 55..125(1)" FT misc_feature 222..419 FT /note="match: A0NCX3.2 : 77..142(1)" FT misc_feature 225..440 FT /note="match: B4IIL6.1 : 50..121(1)" FT misc_feature 225..437 FT /note="match: B4NA98.1 : 49..119(1)" FT misc_feature 225..431 FT /note="match: B4LBP0.1 : 111..179(1)" FT misc_feature 225..419 FT /note="match: B4PNH5.1 : 315..379(1)" FT misc_feature 225..419 FT /note="match: B4PNH5.1 : 60..124(1)" FT misc_feature 225..437 FT /note="match: B4NA97.1 : 49..119(1)" FT misc_feature 225..437 FT /note="match: Q7QDL7.4 : 70..140(1)" FT misc_feature 225..440 FT /note="match: Q4V6L8.1 : 50..121(1)" FT misc_feature 225..425 FT /note="match: B3M4X1.1 : 67..133(1)" FT misc_feature 225..431 FT /note="match: B4LBP1.1 : 74..142(1)" FT misc_feature 225..440 FT /note="match: B4JYZ4.1 : 62..133(1)" FT misc_feature 228..554 FT /note="match: Q16X28.1 : 34..143(1)" FT misc_feature 228..419 FT /note="match: B3N811.1 : 30..93(1)" FT misc_feature 228..521 FT /note="match: B0W877.1 : 35..133(1)" FT misc_feature 228..440 FT /note="match: B4MXL0.1 : 49..119(1)" FT misc_feature 228..419 FT /note="match: B4NY49.1 : 30..93(1)" FT misc_feature 228..440 FT /note="match: B4QQU3.1 : 51..121(1)" FT misc_feature 228..440 FT /note="match: B3NIE5.1 : 51..121(1)" FT misc_feature 228..440 FT /note="match: B3M4S3.1 : 54..124(1)" FT misc_feature 228..440 FT /note="match: B4PGG3.1 : 51..121(1)" FT misc_feature 228..419 FT /note="match: B4LRE1.1 : 30..93(1)" FT misc_feature 228..521 FT /note="match: B4KZD4.1 : 61..160(1)" FT misc_feature 228..440 FT /note="match: Q29DG5.2 : 3..73(1)" FT misc_feature 228..419 FT /note="match: Q17C03.1 : 88..151(1)" FT misc_feature 231..419 FT /note="match: B4HWF4.1 : 131..193(1)" FT misc_feature 231..419 FT /note="match: B4PHR9.1 : 172..234(1)" FT misc_feature 231..419 FT /note="match: Q8IPD5.1 : 131..193(1)" FT misc_feature 231..419 FT /note="match: B4N3H9.1 : 135..197(1)" FT misc_feature 231..419 FT /note="match: B4HU24.1 : 153..215(1)" FT misc_feature 231..419 FT /note="match: B4JGV6.1 : 33..95(1)" FT misc_feature 231..419 FT /note="match: B5DHY8.1 : 788..850(1)" FT misc_feature 231..419 FT /note="match: B4G7V0.1 : 35..97(1)" FT misc_feature 231..419 FT /note="match: B4Q8N4.1 : 131..193(1)" FT misc_feature 231..509 FT /note="match: B0X227.1 : 98..192(1)" FT misc_feature 231..419 FT /note="match: B4H7W8.1 : 133..195(1)" FT misc_feature 231..422 FT /note="match: B4KH48.1 : 115..178(1)" FT misc_feature 231..419 FT /note="match: B3N917.1 : 131..193(1)" FT misc_feature 231..419 FT /note="match: B3MPD5.1 : 141..203(1)" FT misc_feature 231..434 FT /note="match: P11734.1 : 57..124(1)" FT misc_feature 231..419 FT /note="match: B4N3E9.1 : 144..206(1)" FT misc_feature 231..263 FT /note="match: Q5I2R0.1 : 590..600(1)" FT misc_feature 231..413 FT /note="match: Q9BPR7.1 : 165..225(1)" FT misc_feature 234..419 FT /note="match: B4QQH7.1 : 66..127(1)" FT misc_feature 234..419 FT /note="match: Q296U0.2 : 101..162(1)" FT misc_feature 234..440 FT /note="match: B4J1B5.1 : 17..85(1)" FT misc_feature 234..419 FT /note="match: B3M0R5.1 : 48..109(1)" FT misc_feature 234..440 FT /note="match: B4LCL0.1 : 6..74(1)" FT misc_feature 234..419 FT /note="match: B4N3H7.1 : 34..94(1)" FT misc_feature 234..419 FT /note="match: B3NBZ8.1 : 67..128(1)" FT misc_feature 237..419 FT /note="match: Q45V98.1 : 113..173(1)" FT misc_feature 240..422 FT /note="match: B4KF96.1 : 131..191(1)" FT misc_feature 240..431 FT /note="match: B4LUX7.1 : 132..195(1)" FT misc_feature 243..503 FT /note="match: B7PWW2.1 : 582..683(1)" FT misc_feature 266..340 FT /note="match: Q9VPG1.1 : 723..748(1)" FT misc_feature 268..405 FT /note="match: B7P4B9.1 : 1284..1330(1)" FT misc_feature complement(274..348) FT /note="match: B0XAI8.1 : 1539..1561(1)" FT misc_feature complement(274..396) FT /note="match: B0XAI8.1 : 1375..1415(1)" FT misc_feature 274..402 FT /note="match: Q7Z884.1 : 639..682(1)" FT misc_feature 274..402 FT /note="match: Q8NK55.1 : 219..262(1)" FT misc_feature 278..346 FT /note="match: Q28CC2.1 : 406..428(1)" FT misc_feature 278..445 FT /note="match: A4HM87.1 : 4622..4676(1)" FT misc_feature 278..442 FT /note="match: A4HM87.1 : 2450..2506(1)" FT misc_feature 278..346 FT /note="match: B2GTX8.1 : 404..426(1)" FT misc_feature 280..525 FT /note="match: A9V1U7.1 : 795..878(1)" FT misc_feature 296..343 FT /note="match: Q9VPG1.1 : 765..780(1)" FT misc_feature complement(328..384) FT /note="match: B0WEI8.1 : 194..212(1)" FT misc_feature 330..455 FT /note="match: B4QYE1.1 : 142..186(1)" FT misc_feature 330..455 FT /note="match: P27780.1 : 142..186(1)" FT misc_feature 330..455 FT /note="match: B3P2P1.1 : 137..181(1)" FT misc_feature 351..479 FT /note="match: A8X1H7.2 : 144..191(1)" FT misc_feature 354..461 FT /note="match: Q5SYE6.2 : 19..56(1)" FT misc_feature 354..461 FT /note="match: Q9UBE8.1 : 7..44(1)" FT misc_feature 354..461 FT /note="match: O54949.1 : 7..44(1)" FT misc_feature 365..505 FT /note="match: Q9D1E5.1 : 224..268(1)" FT misc_feature 366..455 FT /note="match: Q233Z3.1 : 149..180(1)" FT misc_feature 385..558 FT /note="match: A4IAU8.1 : 250..301(1)" FT misc_feature 390..539 FT /note="match: B4LCK8.1 : 23..67(1)" FT misc_feature complement(430..489) FT /note="match: Q4DST2.1 : 199..218(1)" FT misc_feature complement(493..606) FT /note="match: B8AIF0.1 : 1051..1084(1)" FT misc_feature 1..60 FT /note="match: BX621784.1 : 1..60(1)" FT misc_feature 1..60 FT /note="match: community_annotation_AGAP801761 : 1..60(1)" FT misc_feature 1..614 FT /note="match: BX621784.1 : 1..552(1)" FT misc_feature 52..60 FT /note="match: community_annotation_CPR34 : 1..9(1)" FT misc_feature 52..527 FT /note="match: community_annotation_CPR34 : 1..414(1)" FT misc_feature 52..527 FT /note="match: community_annotation_AGAP801761 : 1..405(1)" FT misc_feature 123..527 FT /note="match: community_annotation_CPR34 : 10..414(1)" FT misc_feature 123..614 FT /note="match: BX621784.1 : 61..552(1)" FT misc_feature 123..614 FT /note="match: community_annotation_AGAP801761 : 61..552(1)" FT repeat_region complement(AAAB01008807_203:33845..34046) FT /note="139093..165245 repeat: matches 928..1148(1) of FT consensus" FT misc_feature 1..614 FT /note="contig AAAB01008807_203 34043..34656(-1)" XX SQ Sequence 614 BP; 161 A; 140 C; 153 G; 160 T; 0 other; TCTTGCCAAC AGTAGCCAAA GCCAACTAAC CAAATCACTT CTTTAGCAAA GATGTTCAAG 60 GTAGATTTTC AGCAGCAAAT CCTTGTATCG TGATCTTCAA CAATAGTGTA TTCTACTTTC 120 AGATCATCGC ACTGACTGTC GCCTGTTTGG CTGTAGCTGC TTCGGCTCAA TACTGGGGCG 180 GATCTGGATA TGGATACGGT GCGGAGCATC ATGGCCATCA CGATTACTAT TCACATCCTA 240 GTTACAAGTT CGAGTACGGT GTGAAGGATC CTCACACCGG AGACCACAAG AGCCAGTGGG 300 AACATCGCGA CGGAGATGTC GTCAAGGGAG CGTACACCCT GCACGAGGCC GACGGAACTG 360 AACGAGTGGT TGAGTACTCG TCCGACAAGC ACAACGGCTT CCAAGCTCAT GTGAAGCGAG 420 TGGGTCATGC TCATCATCCT CAAGTGTATG GACATCACGG AGGATACTAT GGAGGATACG 480 GTCATGGCTC GGGCTACAGC TACAGCAAGT TGGACCAGCA TTTCTAAGTT ATTGTTGATT 540 TTGCTAAATC AGAATCGGCG CTATGTGTTT GGTTGATTGT TCCTGAATAA ATCCATTGTT 600 AACGTTGCAT ACGT 614 //