spacer

EBI Dbfetch

ID   AL672111; SV 1; linear; genomic DNA; CON; PRO; 501801 BP.
XX
AC   AL672111;
XX
DT   18-JUL-2002 (Rel. 72, Created)
DT   24-MAR-2007 (Rel. 91, Last updated, Version 2)
XX
DE   Mesorhizobium loti R7A symbiosis island; segment 1/4
XX
KW   .
XX
OS   Mesorhizobium loti
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Phyllobacteriaceae; Mesorhizobium.
XX
RN   [1]
RP   1-501801
RX   DOI; 10.1128/JB.184.11.3086-3095.2002.
RX   PUBMED; 12003951.
RA   Sullivan J.T., Trzebiatowski J.R., Cruickshank R.W., Gouzy J., Brown S.D.,
RA   Elliot R.M., Fleetwood D.J., McCallum N.G., Rossbach U., Stuart G.S.,
RA   Weaver J.E., Webby R.J., de Bruijn F.J., Ronson C.W.;
RT   "Comparative sequence analysis of the symbiosis island of Mesorhizobium
RT   loti strain R7A";
RL   J. Bacteriol. 184(11):3086-3095(2002).
XX
RN   [2]
RP   1-501801
RA   Ronson C.W.;
RT   ;
RL   Submitted (07-FEB-2002) to the INSDC.
XX
DR   MD5; 715f3d4276fbd06c7d8314f6667a6b48.
DR   EuropePMC; PMC135072; 12003951.
DR   EuropePMC; PMC193615; 12801410.
XX
CC   Department of Microbiology, University of Otago, P.O. Box 56,
CC   Dunedin, New Zealand; MSU-DOE Plant Research Laboratory, Michigan
CC   State University, East Lansing, Michigan 48824 USA; Laboratoire de
CC   Biologie Moleculaire des Relations Plantes-Microorganismes, Unite
CC   Mixte de Recherche (UMR) 215 Centre National de la Recherche
CC   Scientifique (CNRS), Institut National de la Recherche Agronomique,
CC   Chemin de Borde Rouge, BP27, F-31326 Castanet Tolosan Cedex, France.
CC   clive.ronson@stonebow.otago.ac.nz
CC   
CC   http://sequence.toulouse.inra.fr/msi
XX
CO   join(AL672112.1:1..150050,AL672113.1:51..152050,AL672114.1:51..149050,
CO   AL672115.1:51..50801)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..501801
FT                   /organism="Mesorhizobium loti"
FT                   /strain="R7A"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:381"
FT   gene            198..1457
FT                   /gene="intS"
FT   CDS             198..1457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="intS"
FT                   /product="P4-TYPE SYMBIOSIS ISLAND INTEGRASE PROTEIN"
FT                   /function="elements of external origin; phage-related
FT                   functions and prophages"
FT                   /note="Gene name confidence : probable"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31406.1"
FT                   /translation="MEVPKMALSDVKCRNARPISKLVKLSDGGGLQLWVQPTGSRLWRL
FT                   AYRFGGKQKLLALGSYPLISLAEAREARDAAKRLLLRGIDPAQERKSQKASAEDTFRSI
FT                   AEDYVDKLKKEGRADRTITKVKWLLDFAYPTFGNKSVREIDPATILVALRSVEVRGRYE
FT                   SARRLRSTIGSVFRYAIATARADVDPTIALRGALVGPTVTPRAAVTDPKALGGLLRAIN
FT                   AFDGQPTTRAALKLMALLFPRPGELRAAEWDEFDFESAVWSIPEGRMKMRRPHRVPLSR
FT                   QAVSVLTSLREISDGGALVFPSVRSRSRPISDNTLNAALRRMGYGKEEATAHGFRATAS
FT                   TLLNECGKWHPDAIERQLAHIESNDVRRAYARAEHWEERIKMMQWWADYLDELESKDAG
FT                   VISIGGHGKSTVHTPSRDLR"
FT   gene            complement(1845..3002)
FT                   /gene="msi002"
FT   CDS             complement(1845..3002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi002"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31407.1"
FT                   /translation="MRWDPYSLTLDSDFTMFWRRRLSAKKRKVLLVIGRGFDVRTLETA
FT                   RRLHALDADISVWQLVFDNGLGDSPKRSELTATNHEGLLKLVPAEKIVAVPIEIGGPVG
FT                   AAVTPRNTKASLDRAGDCRDFDDVIVDISAMPRMVALTAVSVLLFKLDKLAEANGPSVN
FT                   LHVTTSESVSADLGAAKGSLRDSVTFVLGFSGHLEEQTTQNWPRVWFPVLGEGQRDRLH
FT                   LIQDHVNPDEICPVIPFPTRKPRRGDEVVGEHRDTLFDDFKVEPANILLASEYNPFEAY
FT                   RQIFTAMERYKKALKPMGGCKLFVSPLSSKLLSIGVLLACYDHKFGKGSSDRFDVGIPY
FT                   VETAVYGDPEQNAETADFELHSLWIRGEWEEPIPATASAAVTAAT"
FT   gene            complement(3016..4908)
FT                   /gene="msi003"
FT   CDS             complement(3016..4908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi003"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31408.1"
FT                   /translation="MRASQRSTSDDEFVRLFGVGALEVIKSFDDPWNGLVFLRSAPGGG
FT                   KTTFLRILTPRPLKLTDNLADQHQQVKATRDALREVGAIGRDGPKLLGAMVVFTSEYKE
FT                   LSAFDRGNILFRELLNSRIVVATLRSVLERAERQFPDDLDQYSFEWEPESDATIPGRAT
FT                   GKELFTWASRIERDFYDRMDDLGSPASIKGGHARLDGLKWFAHVRISDAQGDMDVKRVL
FT                   LMDELQTLAPPQRASLIEFITNAREQCGVWIAERLEALTHKDLLSEGALRKRDYENVVQ
FT                   LEERWSGTRTKSYTKFVETIANLRAAKADGFEGRELFPLIGETDDIPSLETALTGRTAE
FT                   IEAEVVKMAGVGPRYSNWLANARGLSGNLLERAFKWQLLKILVIRDTRRTQTSFDFDSL
FT                   TLDEFGARSGSGTDRAAEHFLRTDVGAPIYFGRESLSAVSSSNVDQYLEVAGALFEEIS
FT                   AKIRFHRDQPVPLTAARQDALIRGVAKDRWDGLPRRLPRGVEARRLLEAIGEYCRQQTF
FT                   RSSAPYAPGVTGIAITMDDRKLIIDSEDAEISHFIRLRDVMTSLVSHNLLMPRLDHRNN
FT                   GREYVVFYLNRLLCVHFGLPLGYGGWRHQTLKSLLHWQEAGAKAIAVAEEATLV"
FT   gene            complement(4927..6045)
FT                   /gene="msi004"
FT   CDS             complement(4927..6045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi004"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31409.1"
FT                   /translation="MRKDLAESLLAKIMEWSDEEKAAERAYLESFASYKYDEYQQFSPG
FT                   KRFIESLALWLGQFTGGEERREAYNFVRKRLLFISTDEMNHLVELTFPTIIRPILIADT
FT                   ATELGVDPHKVKAIVDTVEYRTRLRQTLVLGLSDGARTDWFRRANPQEMSNEQVFHAYD
FT                   VSDPKSEGMVQDLRKHLTKILGREPHDHEARFRYIVLLDDFTGSGTSFIREDGQGGWTG
FT                   KIAKIVSGLMKAGNLGDAIANSGVKIIIILYVAGDQAIEHIESRLPKLTFGKGTVEFEV
FT                   VHKLGETTPLDDASDSPILGLVADDRYFDDDADDEHSKVGGTSKRYGFANCRLPLVLAH
FT                   NTPNNSIYLLWAEDDQSVRGLFPRVSRHRKLQ"
FT   gene            complement(6149..6520)
FT                   /gene="msi005"
FT   CDS             complement(6149..6520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi005"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31410.1"
FT                   /translation="MQIYMKPKQIERAELVRHINEKRLEAGLSYAELADIADVDASQVS
FT                   RICRGQFITFGASVVRICTTLGLQNTQGEGTTWKRSRHASDPNWAKLERSIRRAWDNTP
FT                   AGAERLAKVIAAVGEITRK"
FT   gene            6544..7041
FT                   /gene="msi006"
FT   CDS             6544..7041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi006"
FT                   /product="HYPOTHETICAL TRANSMEMBRANE PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31411.1"
FT                   /translation="MEFFVTDVGQEIRFYRASEKPYGAFSNLFRREIEFEGERFATSEH
FT                   AYQAGKARKPEVKAWLMAAPSPALLAMAAHGLYYWDVSPGWSRTKFDRMRCVLRAKFTQ
FT                   HEDLRELLVSTGSARLIETATVDNEVNRLWGEVNGQGRNMLGELLMELRAKLQNDDVSK
FT                   AA"
FT   gene            complement(7080..7988)
FT                   /gene="msi007"
FT   CDS             complement(7080..7988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi007"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /note="predicted by FrameD"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31412.1"
FT                   /translation="MSAVDVVGTGFTVLDRIYADSLAVSSEDLGGSCGNVLISLAMLQR
FT                   NVAPVLSLGEDEVGIRLVVAFRHAGAETRYIRQTEHIRSPILAQRLHGPGVHTFEFRCP
FT                   ETSIDLPRYEPIDWEDVSRALPAIKNCNVFYTDRLSGAIVDAMEAAADAGSTVYFEPSA
FT                   LGDKELFRRAVAAASVLKFSAERLATLAGQVAPHDALFLIVTHGEAGLEVRRGAEKAWC
FT                   KSYPAPELRDTCGSGDMVSVGVIDWLLSRRDRATRKISIDEFVVGIEAGQRLAAENCAY
FT                   VGARGIFRERGAEYARSVLRG"
FT   gene            complement(8041..9972)
FT                   /gene="msi008"
FT   CDS             complement(8041..9972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi008"
FT                   /product="HYPOTHETICAL TRANSMEMBRANE PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31413.1"
FT                   /translation="MTVFSEKLRRLPETIELASAHGAGDIAFALSQGKGRLAVAIASGG
FT                   SVVTAEFFSRCRTTLQLGPTMVMTPMQFVLSMENWDGCDIWLFSAGANNPDIAAAFRVA
FT                   NASSCKSLQLMTVQSEGATTIVASNSPRAKVIVTPVADPKDGFLATHSMISMVTALLMA
FT                   SDLTTEQPQRGRLAEELRKRAEEVLSAPQSPDFDFQVGDTLFVLHDPQNAAAATLIETS
FT                   LWETGIAPVQRTDFRNFAHGRHVWAAKHPETMYVLALTTAESGDVWKPIRAALPSQTRI
FT                   QDAEFDHGGRLANAVSILWGLSFVQHLGNATSIDPGRPGRGAFAEAIYDNPALDTLSRD
FT                   LTSSVRHKTSARMYFDPIDERSASLCSVGRERLLSLGGASFVGLALDYDGTVVPNDPRE
FT                   ARLGPPPKAIMHELVRLVDDGIQVGFATGRGGSAGEKLRDALPKRIHRNVLMGYYNGAH
FT                   IRTLDVDIAEDPPQRNPNIAEVTRWLTGSGLLRDGVEIKTRPIQVSIDCADVIDVERFA
FT                   DGLAACPQIVEGSVKVLRSHHSVDIVLASTSKLRVVEELARRSGDASKAVLGIGDSGSP
FT                   LGNDRELLSGPHCLSVGSVCGASGGAWTLFGSKLRGPDALLRILQAARAKGCEMMIDLS
FT                   ALTLDQHS"
FT   gene            10380..10892
FT                   /gene="msi009"
FT   CDS             10380..10892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi009"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31414.1"
FT                   /translation="MGAQLKFLLTHMYLAQSSIGQSWKRPYSASSRRAWQTLRSLSPTR
FT                   WLSCQQARRFSAPSCIRARVCIDQVSFMSSLFDFNQLARRLQRFVQRYDLKPEAFRLLE
FT                   EALLRGEFDRGEASRIAGLPERRARRVFTEVLELGLLASDTPKGPVSLRFPVDTLDELF
FT                   PKLFPET"
FT   misc_feature    11100..11279
FT                   /note="INTEGRASE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(11322..11471)
FT                   /gene="fixS"
FT   CDS             complement(11322..11471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixS"
FT                   /product="PROBABLE NITROGEN FIXATION FIXS TRANSMEMBRANE
FT                   PROTEIN"
FT                   /function="small molecule metabolism; energy transfer;
FT                   electron transport"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31415.1"
FT                   /translation="MTILVYLMPVALFLGALGLTGFLWALKSGQYEDLDGAAERILRDD
FT                   KPER"
FT   gene            complement(11468..13750)
FT                   /gene="fixI"
FT   CDS             complement(11468..13750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixI"
FT                   /product="PROBABLE FIXI COPPER TRANSPORT ATPASE PROTEIN"
FT                   /function="small molecule metabolism; energy transfer;
FT                   electron transport"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31416.1"
FT                   /translation="MSCCAPSAELALDLTGTTSVLPSSQEIRLASRSLGDNLWQTDLSV
FT                   PTVHCAACIQTIETALAKLDNVEGARVNLSTKRVAIRWRGDEVPPFVAALGRLGYQAHL
FT                   FAAEIDEKDKTLAELIRAVAVAGFAAGNIMLLSVSVWSGAEGATRDLFHWVSALIAIPA
FT                   LAFAGGIFFRSAWNALRHGRMNMDVPIAVGVSLAYAMSLYETINHGDHAYFDASVSLLF
FT                   FLLIGRTLDHVMRERARTAVKGLSQLAARGAMVLRGDGARDYLPVGEIEPGMLLLIGAG
FT                   ERIPVDGKIIQGASDLDCSLVSGESTPRNVAAGEAVQAGVLNLTGSLTIEATAAAKDSF
FT                   LAEMVRLMEAAEGGRAHYRRIADRVSGLYAPVVHLTAFATFLGWMAATGDWHRAITIAI
FT                   AVLIITCPCALGLAVPIVQVVAARRLFENGIMVKDGSAMERLATIDTAVFDKTGTLTLG
FT                   QPRLVNASSIDPTMLAIAADMAAHSRHPFSKAIAGFANFVGQPKLEAVSEHPGFGIEAT
FT                   TADSTWRLGRRGWAGWKARTGGEGKHGYGTVLTKNRMIVASFAFEDALQADAGSVMAQL
FT                   NDAGVAVEMLSGDTADACGDVARILGIDRFVPALLPSGKVERIEVLTKAGHKVLMVGDG
FT                   LNDTPALGAAHVSIAPATAADIGRNAADFVFLRESLSAVTLALDVSRKAGRLIRQNIAI
FT                   AIIYNAVAVPIAIFGNVTPLVAAVAMSASSLLVIGNGLRLQGFMLAELTRASSATHSGI
FT                   HPSARSS"
FT   gene            complement(13747..14244)
FT                   /gene="fixH"
FT   CDS             complement(13747..14244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixH"
FT                   /product="PROBABLE NITROGEN FIXATION FIXH TRANSMEMBRANE
FT                   PROTEIN"
FT                   /function="small molecule metabolism; energy transfer;
FT                   electron transport"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31417.1"
FT                   /translation="MSTNTQKTREFTGRHMLLTILGFFGVIIAVNLTMATLASTSWTGL
FT                   VVENTYVASQQFNRKAEEGRAQAALGWTGKLTIARGEVRYSLSDTTGKPVPLHGVKILF
FT                   RHPAYEAEDKSVTLTLASAQEFAARDVPKDGVWIVEVDADVGLAEPYRDVRRIIISQGA
FT                   LQ"
FT   gene            complement(14241..15806)
FT                   /gene="fixG"
FT   CDS             complement(14241..15806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixG"
FT                   /product="PROBABLE IRON-SULFUR PROTEIN FIXG"
FT                   /function="small molecule metabolism; energy transfer;
FT                   electron transport"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31418.1"
FT                   /translation="MHVLDKTQMERLEAKAVNSAKTRQPLYAPRKKIFPKRASGSFRRF
FT                   KWLVMAITLGIYYLMPWLRWDRGPFAPDQAVLIDLANRRFYVFFIEIWPQEFYYVAGLL
FT                   MMAGIGLFLITSTVARAWCGYTCPQTVWVDLFLVVERAIEGDRNARMKLDAGRWTARKL
FT                   VLRVSKHVIWLVIAAATGGAWILYFADAPTLIGDVFNGTAASVAYVTIAVLTATTYTFG
FT                   GLMREQVCTYMCPWPRIQAAMLDENSLTVTYNDWRGEPRSRHAKKVQAAGQPVGDCVDC
FT                   NACVAVCPMGIDIRDGQQLECITCALCLDACDGVMNKLGKERGLISYATLSDYNANMAV
FT                   ATAGGSGPVNPSLVRTADSTFSARLAHFHIRKIFRPRTFFYMGAWTAVGLALIYSLLTR
FT                   DRLEINVLHDRNPQFVTLSDGSIRNGYTVKLLNMIPEPRTIVVTMQGLQGAEMSVVGSD
FT                   LPAARFFAIAVEPDRLNMLKVFVRQPAGEVRHAAQTFKFRVEDRASFESDEYTATFNAP
FT                   EIAR"
FT   gene            complement(16010..16873)
FT                   /gene="fixP"
FT   CDS             complement(16010..16873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixP"
FT                   /product="PROBABLE FIXP CYTOCHROME C OXIDASE MEMBRANE
FT                   ANCHORED SUBUNIT PROTEIN"
FT                   /function="small molecule metabolism; energy transfer;
FT                   electron transport"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31419.1"
FT                   /translation="MSSEYIDEVSGISTTGHEWDGIRELNTPLPRWWVITFYITVAWAV
FT                   AYTIAYPAWPMLSSATKGVLGYSSRNAVKIELAAAEAAKGKYVAAIQQKTVSEIAADDA
FT                   LREFAIAAGGATFKVNCVQCHGSGAQGSKGFPNLNDDDWLWGGTTEQIQQTIAHGIRFA
FT                   SDPDTRQSEMPPFGDIITPEQIAQVGAYVASLSGKVQDASLIEPGAKVFVENCVACHGD
FT                   NAKGNKELGAPNLTDAIWLYAPGETAIAVQVRAPKHGVMPAWIGRLGETKVKELAVYVH
FT                   SLGGGE"
FT   gene            complement(16876..17025)
FT                   /gene="fixQ"
FT   CDS             complement(16876..17025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixQ"
FT                   /product="PROBABLE FIXQ CBB3-TYPE CYTOCHROME OXIDASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism; energy transfer;
FT                   electron transport"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31420.1"
FT                   /translation="MSYNLMREFADSWGLLAMALFFVGCIAFALRPGGKTQADQAAQIP
FT                   LKDD"
FT   gene            complement(17036..17767)
FT                   /gene="fixO"
FT   CDS             complement(17036..17767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixO"
FT                   /product="PROBABLE FIXO CYTOCHROME-C OXIDASE SUBUNIT
FT                   PROTEIN"
FT                   /function="small molecule metabolism; energy transfer;
FT                   electron transport"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31421.1"
FT                   /translation="MGLMDKHAIIEKNATLLLVGSLLVVTVGGIVEIAPLFYLDNTIEK
FT                   VEGMRPYSPLELAGRNIYVREGCYLCHSQMIRPFRDEVERYGHYSLAAESMYDHPFQWG
FT                   SKRTGPDLARVGNRYSNEWHVQHLMDPRSVVPESIMPRYAFLKDAPIEVKDFSTHLVAN
FT                   ARVGVPYSDEMIAHANADLMVQADPNADASGVEKRYPKAKVGDLDGNPQQVTEMDALVA
FT                   YLQMLGTLVDFKTYDDAAGYR"
FT   gene            complement(17779..19389)
FT                   /gene="fixN"
FT   CDS             complement(17779..19389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixN"
FT                   /product="PROBABLE FIXN CYTOCHROME C OXIDASE PROTEIN"
FT                   /function="small molecule metabolism; energy transfer;
FT                   electron transport"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31422.1"
FT                   /translation="MKFGTEIVVLSLFAFAALVAAGFGVEGPFRQHMGVLFFAVAGFTA
FT                   ILLRNTDFKPAAPIDTSAYMDGPIRYGAIATVFWGVVGMLVGVIIALQLAYPHLNIQPW
FT                   FNFGRLRPLHTSGVVFAFGGNALLCTSLYVVQRTCRARLFGGKLAWFVFWGYQLFIVMA
FT                   ATGYLLGITEAREYAEPEWYVDLWLTIVWVAYLILFLGTILKRKEPHIYVANWFYLSFI
FT                   VTIAMLHVVNNLSMPASFLGSKSYSAFSGVQDALTQWWYGHNAVGFFLTAGFLGMMYYF
FT                   VPKQANRPVYSYRLSIVHFWAIIFLYIWAGPHHLHYTALPDWAQTLGMAFSIMLWMPSW
FT                   GGMINGLMTLSGAWDKLRTDPIIRMMVMAVAFYGMSTFEGPIMSIKTVNSLSHYTDWTI
FT                   GHVHSGALGWVGMISFGAIYYMVPKLWNRERLYSLRLVTWHFWLATLGIVVYAAVMWVS
FT                   GIMQGLMWREHDEQGFLVYSFAETVAAMHPFYVMRAIGGAMYLTGALLMAWNVTMTILG
FT                   HQREEQPMPGSEPALRPAE"
FT   gene            19519..20058
FT                   /gene="msi018"
FT   CDS             19519..20058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi018"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31423.1"
FT                   /translation="MQSEGGDLNKETQHGPTRSWTSAAFSRQAGTEAIPGEVMKLAHRE
FT                   KLELCFSLESIADALPNVDRLKCLGTAKKIVPLLRDIHGFEERVIFPAYEAHLTPAEAK
FT                   LASTSRLRIEHLEDQCFAGEVAETLLAIGHGDPIESAEAVGFMLRGFFEGLRRHIAFER
FT                   EHVLPRIVISDEGPDA"
FT   gene            complement(20062..20817)
FT                   /gene="fnrN"
FT   CDS             complement(20062..20817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fnrN"
FT                   /product="PROBABLE FNR/CRP FAMILY TRANSCRIPTIONAL REGULATOR
FT                   PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31424.1"
FT                   /translation="MTVRQDIHSSGIPVLCLSCAARHRGVCGALDPNHLVGLAKTSSRH
FT                   KLEPGVELITDAEAVDSYSNLLSGVVKLTKCLSDGRQQIVGLRFAPDFLGRPFKVKSTI
FT                   NVEAATSVSLCSFPKAAVERIMKESPGLEHRLLKQTLDELDEALEWMVTLGRKTAPEKV
FT                   ASFLLMIARNMDSSIDPAAGSACFDLPLTRADISDFLGLTNETVSRQLTRLRADGVIRI
FT                   ENKRHVTVDSMSRLEQRCGGRGARQPAFE"
FT   gene            20975..22324
FT                   /gene="hemN2"
FT   CDS             20975..22324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN2"
FT                   /product="PROBABLE OXYGEN-INDEPENDENT COPROPORPHYRINOGEN
FT                   III OXIDASE PROTEIN"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; heme, porphyrin"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31425.1"
FT                   /translation="MRPELAARLGENVPRYTSYPTAPHFHPGVDADVYRSWLKALESGD
FT                   EVSLYLHIPYCDRLCWFCACHTKQTRRYEPVASYLRSLHAEIATVAGLVGSKAHVRAVH
FT                   FGGGSPTMLKPEDMIALGTVLRDSFDFLADAKISVEIEPNDMDEARLDTLAEIGMARAS
FT                   VGVQDFDPKVQKAINREQSFLQTKAVVDGIRSRGVGSVNLDLLYGLPHQTRESVCSTVA
FT                   QALTLEPDRMALFGYAHVPWFKKHQTMIDEAWLPGPAERFAQWQIAARLIMGAGYEAIG
FT                   IDHFARPDDALAVSARAGTIRRNFQGYTEDRCETLIGLGSSSISRFRQGYSQNMPSTAE
FT                   YRRMVEGGHLATVRGIAFSEDDRVRGWIIERLMCDFGFSAADLVERFGEAGQKLLFQAS
FT                   SIAIGDPARPLELQGDSYVVSAESRPFVRSIAAKFDKYFESGTARHSVAV"
FT   gene            complement(22863..23135)
FT                   /gene="msi021"
FT   CDS             complement(22863..23135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi021"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31426.1"
FT                   /translation="MADLKLGKLPDRTPSKMTITVSADLNQALKDYAALYRQTYGESET
FT                   VAELIPFMLAGFLEGDRAFAKARKESLPAAGMSEKSRRVSGSDSE"
FT   gene            complement(23148..24377)
FT                   /gene="trbI"
FT   CDS             complement(23148..24377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbI"
FT                   /product="PROBABLE TRBI CONJUGAL TRANSFER TRANSMEMBRANE
FT                   PROTEIN"
FT                   /function="cell processes"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31427.1"
FT                   /translation="MRGALMTDTSRSDAPPKLDPEQLQLRASPRRAVRFRRGVIVAIAA
FT                   VGSGAILGVTMMALQGPAWRIKHQAEDRYNTERKPPAEGLEALPKDYSGIMPKAPVLGP
FT                   PLPGDLGRPILERQRQLGIAPGQDISAEEQRLAQQAIEARESQVLFRIDNRPRQTDVAG
FT                   GGPSAQQPSEALPQSGATRASASVAPAEGDQNNQQRKLDFVSQRNTSGIYNPHALQTPA
FT                   SPYQLMAGSVIAASLVTGINSDLPGLVVAQVTENVHDTVTGSIVLIPQGSRLIGTYDSV
FT                   VAFGQRRALLVWQRIILPDGSSIEIDNLPATDTAGYAGLEDKVDFHTWQLIKGVALATL
FT                   LGVGTELSFGENESDLVKAIRESTQQNISQAGQRITEKNLNIQPTIIVRPGWPLRVIVH
FT                   KDLVLRPYPT"
FT   gene            complement(24374..25402)
FT                   /gene="trbG"
FT   CDS             complement(24374..25402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbG"
FT                   /product="PROBABLE TRBG CONJUGAL TRANSFER PROTEIN"
FT                   /function="cell processes"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31428.1"
FT                   /translation="MKNRMSSVRAVLILSASTAVLSACASKPVPPPEISYDAADFKPAA
FT                   IEKPPEKPVKIVEVPKPLPLPGQLQPNPGRVAEDKRSPEERVSDANKAATQQPTRYGYM
FT                   NAVQVYPFADGALYQLYAAPERVTDIALQPGEKLTAVSAGDTVRWVIGDTVSGTGDNQR
FT                   THVLVKPFAPGLTTNLVITTERRTYHLQLQSTEKTSMAAISWTYSEDQIIALRQRNAQA
FT                   EGAMPVASNVALENIRFRYSITGDTPPWRPTRAFDDGSKVYIEFPRRIDQGEAPPLFIV
FT                   GADGNDQLVNFRMRGNYYIVDRLFAAAELRLGAKQQQVVRITRTDGRQPPRRIPLFART
FT                   SR"
FT   gene            complement(25399..26124)
FT                   /gene="trbF"
FT   CDS             complement(25399..26124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbF"
FT                   /product="PROBABLE TRBF CONJUGAL TRANSFER PROTEIN"
FT                   /function="cell processes"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31429.1"
FT                   /translation="MLFKRPIQRYGKTPEPVTPYQKAAQLWDERIGSSRVQARNWRFMA
FT                   LGCLTLAAGLSGGLVWQSMQSRVVPYVVEVDGFGEARAVAPAIRDYEPSDAQIAWHLGR
FT                   FIQNVRSVSTDPVLVRQNWLSAYDFATDRAALFLNEYAKANDPFGQIGTRSVSVQVTSV
FT                   VRASDSSFQVKWAEQVFERGSLASTTRWTAILTIVIRPPSNTDQLRNNPLGVFINAIDW
FT                   SRELDSAAPTSVSPKGVHQ"
FT   gene            complement(26125..27417)
FT                   /gene="trbL"
FT   CDS             complement(26125..27417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbL"
FT                   /product="PROBABLE TRBL CONJUGAL TRANSFER PROTEIN"
FT                   /function="cell processes"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31430.1"
FT                   /translation="METFIRYIDSGFGLLSGDVAFLTTTLIGIDVTLAGLAWAFGGEPN
FT                   IFGRLIRKVLYVGVFAFILNNFKNLADIIYRSFAGLGINASSGNLSADNLLHPGRIAAT
FT                   GFEGAWPLLDQASQLLGFPEIFGNALTIFVLLVAWFLVIIAFFILSIQLFITILEFKLT
FT                   TLAGFILVPFALWNRSAFLAERVLGNVISSGIKVMVLAVIIGIGSTLFGEFASALQGKE
FT                   PDLAAAMSQVLGALALLGLGIFGPGIASGLVSGAPQLGAGAALGTTAAAAGASLVAAGA
FT                   AFAGARTATGSGLTALRAGTTMGSAASTAWQIGRATSPESGLSGVAAGMHGVTSAAGGA
FT                   AMRAARSAAGGFGRSVDAGREAAWTATGGAPTASMTGSPTGPVADAAPGWARRLRSEQT
FT                   ARAHRHTAMQAVREGDRPGGSANPSLNDKDD"
FT   gene            complement(27479..28204)
FT                   /gene="trbJ"
FT   CDS             complement(27479..28204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbJ"
FT                   /product="PROBABLE TRBJ CONJUGAL TRANSFER PROTEIN"
FT                   /function="cell processes"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31431.1"
FT                   /translation="MMRRRFLSGLITLSLIAKPMADYVQPAYALIVFDPSNYAQNVLTA
FT                   ARSLEQINNQIQSLQNQATVLQNMARNLQSLDFSSVGQLTGSLQRIDSLMDQASGLSFD
FT                   LNKLQDQWRNQYPESYDATIKVSDVASAARDRWQSAMQAFRQTMGVQSQIVENVRGDGD
FT                   LLADLVNRSQGAAGALQASQATNQLLALSTKQQMQIQTLLATQFRAEAEDAARKAQSEE
FT                   AARETTKRFLGTGTAYPSN"
FT   gene            complement(28201..30651)
FT                   /gene="trbE"
FT   CDS             complement(28201..30651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbE"
FT                   /product="PROBABLE TRBE CONJUGAL TRANSFER PROTEIN"
FT                   /function="cell processes"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31432.1"
FT                   /translation="MLNLSEYRGRADRLADHLPWAALVAPGIVLNKDGSVQRTLRFRGP
FT                   DLESSTEAELLGICARANNALRRLGSGWTLFFEAERIEALGYPSSRFPDAASWLVDEER
FT                   RAAFEGKVAHFESRYHLTLLSMPPPDAQARAESALVDSHHSEGERDWRQEMARFRDETD
FT                   RVLDLLSGFMPEVRPLDDAETLTYLHDTISTRRHPVAVPETPMYLDGILVDVPLTGGLE
FT                   PMLGEQHLRTLTILGFPNLTRPGILDALNHQDFAYRWMTRFIPLDKTEATKTLTRLRRQ
FT                   WFAKRKSIVAILREVVSNEPVPLVDSDADNKALDADEALQALGGDHVGFGYLTATVTVW
FT                   DEDRQAAAEKLRAVERIINGLGFTTIRESVNAVEAWLGSLPGHVYANVRQPLVHTLNLA
FT                   HLMPLSSVWAGPAANEHLAEVTGREAPPLLIAETSGSTPFRLSSHVEDVGHMLIVGPTG
FT                   AGKSVLLALIALQFRRYAGAQVYVFDKGNSARAATLAMGGEHHVLGSDGALAFQPLRNI
FT                   GDQGRRSWAAEWIAGLIAHENVTLTPEVKEAIWSALNSLATAPAQERTLTGLSVLLQSN
FT                   ALKSALMPYTLDGPFGRLLDADDDRLALSDVQCFETEELMHSQSAVLPVLTYLFHRLEE
FT                   RFDGRPTLLMLDEAWVYLDNPLFAARIREWLKVLRKKNVSVIFATQSLADIAGSAIAPA
FT                   IIESCPQRIFLPNDRAVEPQARTAYERFGLNNRQIELIARATPKRHYYLQSRCGNRLFE
FT                   LGLGPIALALCGASGPAAQSLIDRVLSEHGQDSFVFRFLGARGLDWGAELLQQFPQPTK
FT                   EQSS"
FT   gene            complement(30645..30905)
FT                   /gene="trbD"
FT   CDS             complement(30645..30905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbD"
FT                   /product="PROBABLE TRBD CONJUGAL TRANSFER PROTEIN"
FT                   /function="cell processes"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31433.1"
FT                   /translation="MQHIEGFEVPVHRALTEPILLGGAPRAVAILNGTVAAAIGLGLQQ
FT                   WIAGLVLWLGGHTLAVFAARRDPDFASVLVRHLRLRGWLAC"
FT   gene            complement(30917..31225)
FT                   /gene="trbC"
FT   CDS             complement(30917..31225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbC"
FT                   /product="PROBABLE TRBC CONJUGAL TRANSFER PROTEIN"
FT                   /function="cell processes"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31434.1"
FT                   /translation="MRKKLRFLSFAALAFLLTVPAHAAGSGMPWEQPLQQILESVQGPV
FT                   AKIVAVIIIITTGLTLAFGDTAGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV"
FT   gene            complement(31237..32205)
FT                   /gene="trbB"
FT   CDS             complement(31237..32205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbB"
FT                   /product="PROBABLE TRBB CONJUGAL TRANSFER PROTEIN"
FT                   /function="cell processes"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31435.1"
FT                   /translation="MSAHPEADHRRRAMLRTAMGPTITEALADPLVIEVMVNPDGALRL
FT                   DRLGEGRIDTAVHMHPSEAERIIRLVASHVRAEAHADNPIVSAELPSGERFEGLLPPVV
FT                   LAPCFAIRKPAAKLYTLANYVADRIMLPLQADALIKAVRERRNILVAGGTSSGKTTLAN
FT                   ALLAEVAECDERVILIEDTRELQCAAKDCVALRTRRGSVTLADLVRSTLRLRPDRIIVG
FT                   EVRGAEALDMLKAWNTGHPGGIATVHANSARSALYRIEQLAQEAVVTVPRRLIADAIDL
FT                   IVFIAGRGSSRRIDAIAEVTGLDGSGDYAVSPLTPPQLQQL"
FT   gene            complement(32202..32615)
FT                   /gene="msi031"
FT   CDS             complement(32202..32615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi031"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31436.1"
FT                   /translation="MKPHRIRHQFLLEPELSEKLDNLSRDPSTTKSAVVAKAVEAFIER
FT                   RGENELDRRYGMRLDRLSRDLSHVRRDVDMTLESLALFIRFSITLHAHTPVPDKATQAI
FT                   AQERFDKFVEQVGRQIASGKRSLGKDNGGGGEG"
FT   gene            complement(32734..35085)
FT                   /gene="traG"
FT   CDS             complement(32734..35085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /product="PROBABLE TRAG CONJUGAL TRANSFER TRANSMEMBRANE
FT                   PROTEIN"
FT                   /function="cell processes"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31437.1"
FT                   /translation="MAGRATSRSDLDRLVVPQTGLDVTNFLSGLPACHRQLPDHVLTIG
FT                   TNDMSPLRHSSPRECANIDTPRRRATARQTASHRTKSYIGRIPVPAVPGDARSISPEQR
FT                   SKPVTPTKLLIGQIAIVFAIVLLGVWAATQWCAHMLAFQEQLGAPWFVAAGWPIYEPWK
FT                   LLEWWFQFDAYAPEVFDKAGMLAGTSGFMGCAAAIAGSLWRARQRGLVTTYGSSRWAAT
FT                   REIEKAGLFQPAGVFLGKLKDRYLRHDGPEHVMAFAPTRSGKGVGLVVPTLLSWSGSAV
FT                   IHDIKGENWQLSSGWRSRFSHCLLFNPTDPRSARYNPLLEVRKGSDEIRDVQNIADILV
FT                   DPEGALERRNHWEKTSHSLLVGAILHVLYAEEEKTLARVATFLSDPQRSFAATLRRMMT
FT                   TNHLGAANKPQVHPVVASAAREVLNKSENERSGVLSTAMSFLGLYRDPTVAAVTSDCDW
FT                   RIADLMDAEWPMSLYLVVPPSDISRTKPLVRLILNQIGRRLTERLEGDPKKSRKHQLLM
FT                   MLDEFPALGRLDFFETALAFMAGYGIRAYLIAQSLNQISKAYGDNNAILDNCHLRIAFS
FT                   SNDERTAKRISDALGTATELRSMRNYAGHRLAPWLSHVMVSRQETARPLLTPGEVMQLP
FT                   PADELVLVSGLPPIRAKKLRYYEDHNFTERVLPSPVLRDGPYADCPMSRPDDWTGQVRG
FT                   VDRRLASDDESAGAALADEGGVQQQRHPGLPEEHTAVTQEPDQDDLSRPADDDSEAMAD
FT                   KRVMDRISTVAGAYGINEGRGDDKDIVPGF"
FT   gene            complement(35426..35815)
FT                   /gene="msi033"
FT   CDS             complement(35426..35815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi033"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31438.1"
FT                   /translation="MAVNELDLLVFQMAVESVRSLCLSFNDKAAEIAARSRGNLLFDVR
FT                   IDDDAEVQRLAAIRYRGGQIGVVTLDRQGLISRYCVVDGTFSRFIAPLENWTNMPVSMQ
FT                   AKIDVTHHAGLFLGALRNAGHMLRN"
FT   gene            36548..36793
FT                   /gene="msi034"
FT   CDS             36548..36793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi034"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /note="predicted by FrameD"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31439.1"
FT                   /translation="MAYKAESGDQSADEYALRDRLSHQFERITIDGDTVAFFEGGKPLE
FT                   ACYAGDGCEILTSKKGNRMGVKFRFGVALASSHLFG"
FT   gene            complement(36795..38120)
FT                   /gene="hemN1"
FT   CDS             complement(36795..38120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN1"
FT                   /product="PROBABLE OXYGEN-INDEPENDENT COPROPORPHYRINOGEN
FT                   III OXIDASE PROTEIN"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; heme, porphyrin"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31440.1"
FT                   /translation="MQTTKHREARLPWYTIYPTVAEFSGAVGADAYEEWLRNLPANDPA
FT                   SLYLHVPFCRSKCWYCGFPTTITRHDAPIVNYLAALRDEIRLVSEHAPQALPVSDVHFG
FT                   GGTPTLMGPVEFLALTEFLRRHFALAETATIAVEIDPRTFTADMAEALQAAGVNRASLG
FT                   VQSFDPIVQKAINRVQSEAQTAAAVEMLRRHGVTSINFDLIFGLPHQTVQSCVETTRAA
FT                   VAMRPNRLAVFGYSHIPSFIKNQRLIEEASLPGSAARAEQDAAIAVTLIAAGYREIGLD
FT                   HFALPDDDLALAQKTGRLRRNSLGYSADTCKTLIGFGASAIGRVGEGYVQNEVTRDSYC
FT                   RHIAAGRLATSKGYRLTDEDRARAAIIERLMCDLEADVPAICAAHGSDPIHFLDSAERL
FT                   AMLAKDGIVDIEKGFVRVRRQHRFAMRVVAAAFDAFLDRVAR"
FT   misc_feature    38387..38799
FT                   /note="REGION CONTAINS 2 TRANSPOSASE FRAGMENTS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            39468..40631
FT                   /gene="omp2a"
FT   CDS             39468..40631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omp2a"
FT                   /product="PROBABLE PORIN PROTEIN"
FT                   /function="structural elements; cell envelope; membrane,
FT                   outer"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31441.1"
FT                   /translation="MNIRSLLLGSAAALIAVSCARAADAIVLAEPEPVEYVKICDVYGA
FT                   GYYYIPGTETCLRIGGYVRYDIGLGDVVSYDKARTTDVKTGEAQGIWQNHTRFTFKTWT
FT                   GQESELGTLQTYIETRMNYGKHTAYSGSDSPRYYAFSQGITLTFAWVQLGGLRVGKDWS
FT                   AFDMFIGYAGDVLNQMLIPYGAFDTNVVQYYFDAGNGFTAVVSLEEGSGLVGTIDSYVP
FT                   HLVGGVKYTQHWGAITGVVAYDSNYESVAGKVRIDVDVTDQLSLFGMFGYGSSGKLNDD
FT                   VTNAIDAHGRGFYKSWGGNWGFWAGATYKLNETTSLNLQLSGDQLRNYGVAANVAYAFL
FT                   ADFTITAELDYDRYGDFAVGKVDPSISWANANKKSSVGGILRFERSF"
FT   misc_feature    40652..40870
FT                   /note="REGION CONTAINS TWO DAPA FRAGMENTS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            41028..41228
FT                   /gene="msi037"
FT   CDS             41028..41228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi037"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31442.1"
FT                   /translation="MPSDKQITCVKAPFKSLIDHVFISPNLVPGGHDFMILALDRTIER
FT                   FLEVSDHRPVLFRLAGPIGER"
FT   misc_feature    41209..41424
FT                   /note="HEMN FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(41624..43447)
FT                   /gene="nodM"
FT   CDS             complement(41624..43447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodM"
FT                   /product="PROBABLE NODM AMINOTRANSFERASE
FT                   GLUCOSAMINE--FRUCTOSE-6-PHOSPHATE AMIDOTRANSFERASE PROTEIN"
FT                   /function="cell processes; nodulation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31443.1"
FT                   /translation="MCGIVGIVGQQPVSERLVDALKRLEYRGYDSAGIATITEGTLHRR
FT                   RAEGKLVNLERRLKEEPLGGTIGIAHTRWATHGPPTERNAHPHFTDGVAVVHNGIIENF
FT                   AELKDELAATGAEFQTDTDTEVLAHLLARHRREGMRRGEAVHAMLKSVRGAYALAILFE
FT                   DDPSTIIAARNGPPLAIGHGDGEMFLGSDAIALAPFTNEITYLIDGDWAVVGRTGADIF
FT                   DYDGHPVARPRQTSVAVATLANKGNHRHFMEKEILEQPEVIADALGHYINFIENGADAV
FT                   FGIDFAKIPSLAISACGTAYLAGLIGKYWFERYARLPVEIDVASEFRYREIPLSPQSAA
FT                   LFISQSGETADTLASLRYCKQLGLKIGAVVNARESTIAREADVVFPILAGPEIGVASTK
FT                   AFTCQLAALAALAIHAAKARGTVTEDEVQALVESLAEMPGVMRQVLDSIQPEIELLSRE
FT                   LSKCHHVLYLGRGTNFPLAMEGALKLKEISYIHAEGYAAGELKHGPIALIDENMPVIVI
FT                   APHDRFFDKTLSNMQEVAARGGRIILITDGKGAAASKLDTMHTIVLPATDEIIAPMIFS
FT                   LPIQLLAYHTALFMGTDLDQPRNLAKSVTVE"
FT   gene            complement(43904..44548)
FT                   /gene="traI"
FT   CDS             complement(43904..44548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traI"
FT                   /product="PROBABLE AUTOINDUCER SYNTHESIS PROTEIN TRAI"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31444.1"
FT                   /translation="MIQLITPGLYSEFAGELKEMHGLRYRVFKERLDWEVQTGGEMETD
FT                   TFDDLKPVYLLLKGSDWRIRGCVRLLPTTGPTMLRDTFPALLGEAVAPASPDIWESSRF
FT                   ALDLPPSTPKAAGGLAQATYELFAGMIEFGLANNLTRIVTVTDTRMERILRLATWPLSR
FT                   IGKPQPVGKTEAVAGFLEISHASLLRIRWRGRLNGPVLWQPILGLPHGPCG"
FT   gene            45230..45982
FT                   /gene="msi040"
FT   CDS             45230..45982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi040"
FT                   /product="PROBABLE A-TYPE CARBONIC ANHYDRASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31445.1"
FT                   /translation="MHRRNLIRGFIALGVCPICAQTARAASAHWGYGGSVGPEHWADLD
FT                   TRNFACSAGRQQSPIDIAGTVKADIPRIDISWLKGGGRMVNNGHTIQINMPEGSTLTRG
FT                   DRVYQLAQLHFHAPSEHHVAGMSFPMEAHFVHKDTKSDTLGVLSALLTPGATNKSFAGL
FT                   AKVFPARPGEEMAVDEFDPNGLLPASLGYWTYEGSLTTPPCTENVEWMVAMEPVEVDTA
FT                   DIKRFTTLYASNARSIRPSNRRFILGLS"
FT   gene            46382..47071
FT                   /gene="msi041"
FT   CDS             46382..47071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi041"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31446.1"
FT                   /translation="MFEGPIIDGRIKNIASGFRAVSVYVDATSAGEGRFDPRLLGEACD
FT                   CALADGPAWAEAHLASWSDAYVVFGAKPNRTPCSAQALRKRVLKDGTLSTINPIVDLYN
FT                   AISLKYAVPVGGENFDAYVGRPHLTIADGSETFDTMMNGEAVNDPPLPGEVIWRDDIGV
FT                   TCRRWNWRQGTRTRLKTITGRMWFVLEALETMPDDALAEATDAMVGGLNALMPGCKIAS
FT                   QEIAIAG"
FT   gene            47156..47794
FT                   /gene="msi042"
FT   CDS             47156..47794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi042"
FT                   /product="PROBABLE AMINO ACID EFFLUX TRANSMEMBRANE PROTEIN"
FT                   /function="cell processes; transport of small molecules;
FT                   amino acids, amines, peptides"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31447.1"
FT                   /translation="MNVDLHQLLIVFAAYVIAAGSPGPSNMRIMGVAMARGRGAALMLA
FT                   SGVVSGSIFWGFMASTGISALLARYAQALLVLQVFGGLYLLFLAFRAGRSALTSNEKLA
FT                   VRASTDQVALSRGELYRKGLLMHLANPKSVLAWIALVTLGIGPNSSWQSIAAILGGCAI
FT                   LSVTIFCGYAIVFSTPPMVALYRRCRRWIESLLAMFFAFAGLRMLLSRM"
FT   gene            47810..48700
FT                   /gene="dapA"
FT   CDS             47810..48700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /product="PROBABLE DIHYDRODIPICOLINATE SYNTHASE PROTEIN"
FT                   /function="small molecule metabolism; amino acid
FT                   biosynthesis; lysine"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31448.1"
FT                   /translation="MMTLFHGLSAFPLTPTDAEGHVDTEGLARFLERIQRAGADSIGLL
FT                   GSTGGYAYLTREERKRAVQAAVECIGGKTPLVVGVGALRTDEAQALARDAKSAGADGLL
FT                   LAPMSYVPLNEDEVFQHFVAVAEAGELPLCIYNNPSTTRFTFSDALIARLSEVSNIVAV
FT                   KMPLAANDDYAGELARLRSMTTDTFTIGYSGDWGAADALLAGCDTWYSVAAGLLPVPAL
FT                   ALTRAAQSGDAVESTRLNRAFGPLWTLFKHYGSFRVMFVIADYLGLAHVQPPRPILPLP
FT                   EDAGDDIRQALEKLE"
FT   gene            complement(48730..49155)
FT                   /gene="msi044"
FT   CDS             complement(48730..49155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi044"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31449.1"
FT                   /translation="MRTVIWNQSAFFPTVGDEGDILIGLDGLLLEMVENAPLRLAIIAI
FT                   DETDVARSTLFRQRAAYDQLEILLPVVWSRMKVRCGCRTRLRWPPIFPALPEHDNVATI
FT                   SPPKRPQSQSATNPIQFCAAQLPSRTVRGTPARRVPN"
FT   gene            complement(49421..49669)
FT                   /gene="msi045"
FT   CDS             complement(49421..49669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi045"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31450.1"
FT                   /translation="MQRRFSLDASERLLARTTAGRGRGEGLHAKRVGTVIEDLRAGLQQ
FT                   KMCADPAPLHLPLVGEPLGTALTVALTRAEEMRSPDR"
FT   gene            50528..53086
FT                   /gene="virA"
FT   CDS             50528..53086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virA"
FT                   /product="PROBABLE VIRA SENSORY TRANSDUCTION HISTIDINE
FT                   KINASE TRANSMEMBRANE PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31451.1"
FT                   /translation="MRGEVYMVFLFQQHPAAHRSNEELEFRSDFRKARTAHQTPFRCEK
FT                   RLSTDNVFVIALAASFALLFGIQRQDPQVDEAVLSELRTIQINYALLQRDVARARTDMV
FT                   LDFRPVDSTLQALQRNVTNLQRLAEISPDESSGAHSRLLAQLKKSVENTEAAISAAAAQ
FT                   NELLQSSLVRFARSVNRLEGAPSNRLELSNLILQFSARPGFSLASQIDQSLSRLPPSQD
FT                   QATHDVVRNGRAILSALSRVDRAADRIASFNTFAKGAELEREYLKDYSLASAQAQRTRL
FT                   FFGSVSICLCLFAIIRAFRLHVRTNRLERRLELEEAMREIEARFNESKAKNASPRFSTE
FT                   AALRLVQRAFDADQCALAQVDPSLSRHTECFVTNTCMRVWNVALLDEVVSLVRAGRPVF
FT                   RVVPAAEMVRTALDTSGVCQIVACRASDQQAVVCILVFERDRSLPSAGDLWVLASAIGR
FT                   LSNHLEMQRVNAERDLLVSRWEQVERLRTVGTIASGATHEFNNILGAIIGYSEIAQGLV
FT                   RRPSRIRNHIDQIILAGHRAKLIVDQILSLSRNRKRVALPFNVSEIVMDLAPLLRVTVR
FT                   AGVQLNFKINEWQTVVEGSPTEMQQILMNLCKNASEAVLNEGRVEVSVSRAQVCQTKPL
FT                   AQGTLRPGDYVLLSISDDGPGIANSILPHVFEPFFTTRSLVGGTGLGLAAVDRHVSALA
FT                   GCLDVTSVVGRGTRFDIYLPASEEEPVSADVTFGPYNGSPANGGIIAVVEPDPAELEIH
FT                   KDNIAALGYEPIGFATFESLCGWIESGKAADLLILAKTPFLERGRAESVCPTIMAVPFI
FT                   VIGDIDPMPVTSDNQAFVLRLARPVSSRTIEHAIRIMMMA"
FT   gene            complement(53209..54249)
FT                   /gene="virB11"
FT   CDS             complement(53209..54249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB11"
FT                   /product="PROBABLE VIRB11 TYPE IV SECRETION PROTEIN"
FT                   /function="cell processes; transport of large molecules"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31452.1"
FT                   /translation="MRSEADPQLRLLLDPVLKWLEEPRTEEVAINRPGEAFVRQAGVFT
FT                   KHPLPLGYNDLEDIAILAGALRKQDVGPQSPLCATELPNGERLQICLPPAVPSGTVSLT
FT                   IRRPSSRVTELKEVSSRYEYSRWNQWRSRKQRQERQDETILQQYDDGDLEKFLQACVSG
FT                   RLTMLLCGPTGSGKTTMSKTLINAIPPQERLISIEDTLELVIPHENHVRLLYPKDRAGV
FT                   GAVTAEQLLQASLRMRPDRILLGEMRDDAAWAYLSEVVSGHAGSISTIHGADPVQGFKK
FT                   LFSLVKSSPQGAAVEDRTLLDMLSAAVDVIVPFHTQGDLYEVGEVWLAADARRRGETVA
FT                   DLLNKH"
FT   gene            complement(54233..55372)
FT                   /gene="virB10"
FT   CDS             complement(54233..55372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB10"
FT                   /product="PROBABLE VIRB10 TYPE IV SECRETION PROTEIN"
FT                   /function="cell processes; transport of large molecules"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31453.1"
FT                   /translation="MNETGPQSGHDVNASASLVSEPARRHVSGPQKLAVAGLVLISSLS
FT                   LIWLGSRPSTQDEPSQPNPPISPNAEPFRPVPIELAPEPPAPAKAAQASDPAPSTPQPA
FT                   AAEPPPEESPIFAYSSGSQKPDVAQRSEDAHKDAPATADEISTGGDLSGRLKPDIQEPS
FT                   RATLLPHPDLVITQGTIIPCLLQTAVDTNLPGYVKCVLPKDVRGATNNVVLLDRGTTVI
FT                   GEIQHGLEQGDARVFVLWTRIETPDHALVSIASPGADELGRSGVPGTVDNHFRERFGGA
FT                   MLMSVLQGAFQAAGQYAASSGGGSGIDSFQSNGGQAVETTLRATVNIPPTLKKNQGDAV
FT                   SIFVARDLDFSDVYGLTATVVAPAPQHRQRRRDNNAIGG"
FT   gene            complement(55369..56250)
FT                   /gene="virB9"
FT   CDS             complement(55369..56250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB9"
FT                   /product="PROBABLE VIRB9 TYPE IV SECRETION PROTEIN"
FT                   /function="cell processes; transport of large molecules"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31454.1"
FT                   /translation="MTKRAFLALACSLLLTLEASAEDTPLAGKHDARMRYLAYRPDEVV
FT                   RLSTAVGATLVVTFAANETVAAVAVSNSKDLAALPRANYLFFKASRILPPQPVVVLADS
FT                   ESGTRRYVFSISTRAMPKLDEQQPDLYYSVQFTYPGDEAAALRQAAEKRSILGQARAKV
FT                   QQEQRVQDLLNRPGTTASSDESNFHYVAKGDRSLAPLQVFDNGFTTVFGFASNSRIPSL
FT                   YIINPDGKEAAANFTVKGDYVEVSAVAREWRLRDGNTVLSIFNRAYDPVGRAPGTGTVR
FT                   PDVWRVLKGSGR"
FT   gene            complement(56247..56960)
FT                   /gene="virB8"
FT   CDS             complement(56247..56960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB8"
FT                   /product="PROBABLE VIRB8 TYPE IV SECRETION PROTEIN"
FT                   /function="cell processes; transport of large molecules"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31455.1"
FT                   /translation="MKFPEHALLVERETLAAHYKKVEAFQTSRAKSARRLSKALIAFAA
FT                   AAVLGNVAQAFTIAAMVPLAKLVPVFLWVRPDGTVDSEVSVSRLPATQERAVINASLWE
FT                   YVRLRESYTADSAQYGYDLVSSFSAPAVRQQYQDFFNYPNPTSPQVTVGKLGKLEVGHI
FT                   SSNDISPDVQQIRYKRTLSIDGQMPLVTTWTATIRYERLTDLPAQSRLTNPGGLLVTSY
FT                   QTSEDSVSNLGDVQP"
FT   gene            complement(56957..57115)
FT                   /gene="virB7"
FT   CDS             complement(56957..57115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB7"
FT                   /product="PROBABLE VIRB7 TYPE IV SECRETION PROTEIN"
FT                   /function="cell processes; transport of large molecules"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31456.1"
FT                   /translation="MKYYLLLSILALAACKTTDKLATCTGSPFQLNVGQWETSPEDLQV
FT                   ECAKEPK"
FT   gene            complement(57142..58029)
FT                   /gene="virB6"
FT   CDS             complement(57142..58029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB6"
FT                   /product="PROBABLE VIRB6 TYPE IV SECRETION PROTEIN"
FT                   /function="cell processes; transport of large molecules"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31457.1"
FT                   /translation="MVFRIPAPFTAIHAIFHVAFTAGLHKVIGNVQEAVSAPLVACVTL
FT                   WIIIQGFLVMRGQVDARGGISRVVTVSIVVALILGQANYQLYIESVFDDTIPKLAHQIS
FT                   GSTLPFIGIPQKLDVMFASSQSAFQRIASEIGPMNQQDILAFQGAQWILYGSLWTAFEI
FT                   YDAVGILTKVLLAIGPLVLVGYLFDHTRDMATRWIGQLLSYGLLLVLLNIVATIVIAAE
FT                   SVALGVMLAVIKYKGTTAAKIIGLYELDMLFLAGDALIVALPTIASSIAGGSWAGANQS
FT                   LSSLNRRIAKTAGG"
FT   gene            complement(58087..58761)
FT                   /gene="virB5"
FT   CDS             complement(58087..58761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB5"
FT                   /product="PROBABLE VIRB5 TYPE IV SECRETION PROTEIN"
FT                   /function="cell processes; transport of large molecules"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31458.1"
FT                   /translation="MRFPTLAATTLAASFLFSGQARSQFVVIDPAVVTQAGLTAVSTAQ
FT                   ILIKSAQTLASTMEMVEILKSSFGVTGLLSSLNQGNHYPSGYQLERQMFEGQAPTSIKA
FT                   RAIADNPNRKVDGTDSEAKLLQGQIAGAINAAALASDTLGVMDKRLKANDNTLGQLSRS
FT                   GNIVQATVTNGLVLKQIHDAIIQNVQATSLLTMATAQASLHAAEEAAMQRRERQDTARM
FT                   FE"
FT   gene            complement(58775..61144)
FT                   /gene="virB4"
FT   CDS             complement(58775..61144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB4"
FT                   /product="PROBABLE VIRB4 TYPE IV SECRETION PROTEIN"
FT                   /function="cell processes; transport of large molecules"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31459.1"
FT                   /translation="MFGASGRTERSGEIYLPYVGHLSDQVVLLEDGSIMAMAHVNGLPF
FT                   DLEDAEMRNSRCRAFNTLLRNIADDNVTLYAHLVRNNDVPEPASRQFQSAFAGSLSEAY
FT                   ERHVLSGKLFRNDHFLTIVVSPRTAIGKIGWRIAKSPRRNDNDLATQLRSLEDLWQIIA
FT                   GSLGGYGLRRLGIREKGNVLFTEIGEALRLIMTCRFLPVPMVTGSLGASIYTDRVICGK
FT                   RALEIRRPGDSSVGSLFSFREYPATTRPGMLNPLLSANFPLVLSQSFSFLTRPQAHAKL
FT                   SLKSSQMTSAGDKALTQINELAEAEDALASNEFVMGSHHLSLCVYGDSLNSLADRAANA
FT                   RARLADTGAVIVQEGIGMEAAYWSQLPGNNRWRTRPGAITSYNFAGLVSFENFPSGSSS
FT                   GHWGKAVARFRTNGGTSFDYIPHENDVGMTAIFGPVGKGKTTLMTFILAMLEQSVVDRN
FT                   GAIVFFDKDRGGELLVRATGGTYLALRRGAPSGLAPLRGLDNTSASLDFLREWLMALIE
FT                   SDGRGPISPEESRRLERGILRQLSFEPAMRSLAGLREFLLHSPSEGAGARLQRWCRGNA
FT                   LGWAFDGDEDEVRLDASITGFDMTQLLEFEEVCAPAAAYLLHRVGAVVDGRRFVMSCDE
FT                   FRFYLLNPQFSAVIDKFLLTVRKNNGMLILATQQPEHVLESPLGASLVAQCMTKIFYPS
FT                   PTADRAAYVDGLKCTTQEFEAIRQGMAIGSRKFLLKRESGSVVCEFDLGQMREYVAVLS
FT                   GRANTVRFVDQLRDQHGDAPSAWLDKFMARYNEIQD"
FT   gene            complement(61144..61470)
FT                   /gene="virB3"
FT   CDS             complement(61144..61470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB3"
FT                   /product="PROBABLE VIRB3 TYPE IV SECRETION PROTEIN"
FT                   /function="cell processes; transport of large molecules"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31460.1"
FT                   /translation="MSDRLEVSTLYVAATRPALFLGVPLTLAGLLMMLAGLVIIVLQNP
FT                   LYEIVLVPLWFGARLVVERDYNAASVALLYLQTAGRSVDGPVWGGASVSVNPIRVPKRG
FT                   RGMV"
FT   gene            complement(61470..61835)
FT                   /gene="virB2"
FT   CDS             complement(61470..61835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB2"
FT                   /product="PROBABLE VIRB2 TYPE IV SECRETION PROTEIN"
FT                   /function="cell processes; transport of large molecules"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31461.1"
FT                   /translation="MMKPFKILRALKTRVPSPFSMLRTTAEYVPAAAAGAAWTVFSIGP
FT                   ASAQVTGGTDPAKMVQNICTFILGPFGQSLAVLGLVAIGISWMFGRASLGLVAGVVGGI
FT                   VIMFGASFLGKALIGGG"
FT   gene            complement(61850..62632)
FT                   /gene="virB1"
FT   CDS             complement(61850..62632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB1"
FT                   /product="PROBABLE VIRB1 TYPE IV SECRETION PROTEIN"
FT                   /function="cell processes; transport of large molecules"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31462.1"
FT                   /translation="MFIAAWPLAIALLTSMSFPAEPAPLSPREFHRLSRKCAPWVAPST
FT                   LAAIAKIESGFETLVAHDNTTGEQLRWTDHLEATRGIKNRLEAQHSVDVGLMQINSKNF
FT                   SFLNLTPEKAFEPCASLSAAAHLLESRYAGGTTAPAQQLALRRAISAYNTGDVTRGFTN
FT                   GYVRKVESAAKDITSHLERTLEPTAPDAPHLEASGRKAVPPLLQQSQQANGKQPNQNSW
FT                   DIWGSYESNRSGADPSGPTGSQAAEEREPSNPNKLVFD"
FT   gene            63937..64662
FT                   /gene="virG"
FT   CDS             63937..64662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virG"
FT                   /product="PROBABLE REGULATORY PROTEIN VIRG"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31463.1"
FT                   /translation="MKHVLVIDDDAAMRRLISQYLMMHALKVTAVNDSKQFNYVLSHEP
FT                   VDLVVVDLNLGREDGLAIVRNLATKSDLPIIVISGDRLDEAEKVVALELGATDFIPKPF
FT                   GLREFLARIRVGLRQRISSPRTKDHRSFRFGAWKLSVKQRRLICAERGEVKLTACEFNL
FT                   LIAFLENPRNVLSRERLLLASRVRGEEVYDRSIDVLILRLRRKLEADAANPRLVKTCRG
FT                   AGYFFNADVDVSYGGTLAA"
FT   misc_feature    64735..65224
FT                   /note="REGION CONTAINS TWO FRAGMENTS WITH SIMILARITY TO
FT                   PNGR234A Y4QI"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(65336..70732)
FT                   /gene="msi059"
FT   CDS             complement(65336..70732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi059"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31464.1"
FT                   /translation="MDQRKNPSRVTALPQVQDAGLEEDQAVQARQVGVEQHLAEARRLF
FT                   DQADESPTNPEELQRLDQGFREVLQQWQDEQAASSSFSAEVPEALRPLFDDRAHQPPTN
FT                   AEELLRLEQGFREVLQQRQDDQAASSSLSNPGMHAGPEDPNRGVSDAFATSGHAGVQAP
FT                   APPVLAASQQQIRPSPDALDQGNHLPPQGGIINNEHSTALFPPAKRQRAVDRPQAVAIQ
FT                   QQPSEIGNSGGRMPMQPPMRQLGELPLQGVPVQGTGSEHIGRLHAGAAPSARSEAPPAA
FT                   IEDFINVSIAVPQGFSHGTQRVPDAMLSSLDRPGPLPDAGQARQAVFEQHVAEPRRADP
FT                   VASGARASRYHHLSGEHRDLIDRAIAHSQEKYNETTARKYTFALRRLANDLSARGQATD
FT                   LRNHKSLVDHVGAFFPKDVDMKSALKALRAYHEPGYSATAGGPAASYPHLSAEHRDVID
FT                   KAIDRAAAQQNQSADTLRIYSNALRRLANDLGARGQATDLKNHQSLVDHLDTFFPNDQS
FT                   IKTALNVLRAYHDPGYAATGWWPAAVPSKPDARILEKLSSDSELALSTRVVYGRLLRRF
FT                   SEELESRGQTISGLDHKSRTELAEALFPGNKKLRLALQRVHNAEVPEALRPLFDNRAHK
FT                   PPTNPEELLRLEQEFREVLQQRQDDQATSSSFSAQVPEALRPLVDDRAHQPPTNAEELL
FT                   RLEQGLREVLEQRQGDQATSPSLNNPGMRAGPEDPNRSVSDAFATSGHAGVQAPAPPVL
FT                   AASQQQIRPSPDALDHRNHLPPQGGILNNEHSTALFRPAKRQRAVDRPPAVAIQQQPSE
FT                   IGNSGGRMPMQPPMQQLGELPLQGVPVQGTRSEHIGRLHAGAAPSARSEAPPAAIEDSI
FT                   NVSFAVPQGFSHGTQRVPDAMLSSLDRPGLLPDAGQSRQAGFEQHVAEPRRAEPVASGA
FT                   RATGYPHLSDEHRDLIDKAIAHAAAQQKYSESTVLKYRYALRRLANDLGARGQATDLKN
FT                   HQSLVDHLDAFFPKNDDMKRALNVLRVYHEPGYSVTVGAPANRYPHLSDEHRDVIDKAI
FT                   AHAEAQQHHSAPTLRIYSNALRRLANDLGARGQATDLKNHQSLVDHLDTFFPKDTDIKD
FT                   IRPALNVLRAYHEPGYSATGRWRVTVPSKADAHVLEQVTSDSSLAPSTRVAYGRSLRRF
FT                   SEALERRGQTISGLDHDSRIEFAEVLFPGNDYLRLALERVRDAKPASDRIVADALAAAG
FT                   SGHAGVEAAAPPALAVSQHRPWPDALDQGNLLPPERFIINNEHSTAPLRPAERQGTDNP
FT                   QSIAIQQPPSEGGRVPMQPPMQQLGELPLAGVPVQGPGSEHIGSLHAEAAPFARSEAPP
FT                   AAIENSINVSFAVPKGFSHGTQRVPEAMLSSLYHYGLLPDADKPEWNYEIKGHGYTARR
FT                   PEEGNDVWLLHRGAIREAGAAAVPARAPGPALPATARLSDTHLGVPLVDLTTSSDAHIE
FT                   ALPSGLSNLPRGAVLGATELLGDEHIQRDYEFLEQQLQQADPALAARTRLVDPSVSHLL
FT                   RHMEQQDARGTLQSIYDRNAGPSDFLFVPVNDGVGIDRGTHWSLLLVDRRDPERAVAYH
FT                   YDSIQQNEQRYNDAPARKLATRLDATLVTPDMAQQKNAVDCGVFVVDGTRELVRRLANE
FT                   ERPDQQLPLHLNYLVADRQALQNRLREGRLPHELAASPAEALAAAGSQVQHAALQEQQA
FT                   RQVAPAPLERHLGQTREAEDKLTSTLHRSNRVNSGGVIINTERYTAPLRPAKRQRTDNS
FT                   QSLAIGRQPSDANTTSVGQASDQARADLMASFRSRERSDAGR"
FT   gene            complement(70745..72490)
FT                   /gene="virD4"
FT   CDS             complement(70745..72490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virD4"
FT                   /product="PROBABLE VIRD4 TYPE IV SECRETION PROTEIN"
FT                   /function="cell processes; transport of large molecules"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31465.1"
FT                   /translation="MSSTKTTSPNIAISIACSLALGFCAASLYATFRHGGSGEALMAFD
FT                   VRAFWFETPFYLGFATPVFYQGAAIVLSTSAVVLLIQQVVLRRKLEHHGTARWARVDEM
FT                   RRTGYLRRYRGVTGPVFGKTSGPFWPGYYLTNGEQPHSLIVAPTRAGKGVGIVIPTLLT
FT                   FKGSVIALDVKGELFELTSRARKAAGHEVFKFAPLDSERRTNCYNPLLDLIALHPQQQF
FT                   TEARRLAANLITAKGEGAEGFVAGARDIFVAGILACIERGTPTIGAVYDLFAQPGEKFK
FT                   LFAQLAMETRNKEAQRIFDDMAGNDTKILTSYTSVLGDGGLNLWADPAVKAATSRSDFS
FT                   VYDLRRRRTCIYLCVGPNDLEVIAPLIRLFFQQIVSILQRSLPRQDEKHEVLFLLDEFK
FT                   HLGKLEAIETAITTIAGYKGRFMLIIQSLSALTGAYGEAGKQNFLSNTGLQVFMATADD
FT                   ETPNYISKAIGEYTFEAKSISYSQSRAFDRNIQNSFQGAPLLRPEQVRLLNDEYEIVLI
FT                   KGLPPLQLRKVRYFSDRILKRIFESQTGALPEPAPLTEAEEGFSAESRLDEPLRGLAQD
FT                   FDDTV"
FT   gene            complement(72735..73598)
FT                   /gene="msi061"
FT   CDS             complement(72735..73598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi061"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31466.1"
FT                   /translation="MDRDNKRARAAASSSQDVGNRSTLRDLPYGPLTDVAERLVSANPR
FT                   DTARNLGTFKELGRRERIAVRGTRTEPETDLAKFETRTNQLGRSAVDLGDKLTAGLGHT
FT                   PDEVALEQFRAVSNVSHYLRPETQNSIVNRIGNMDPPSQAIGALYAAQNFSKFNAENKA
FT                   RIFDQAAELATDPDGHVRSTASNAMYAMYHQLDPNQQAQAHSIPGMQDILPQMPPPRHA
FT                   AEERSADLDAHIAGIGAAVRDTVGPQTSHEQLQRGGQVGRDISHSYNHAREDLMEARRS
FT                   RDRTGR"
FT   gene            complement(73904..74116)
FT                   /gene="csp1"
FT   CDS             complement(73904..74116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csp1"
FT                   /product="PROBABLE TRANSCRIPTION REGULATOR COLD SHOCK
FT                   PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31467.1"
FT                   /translation="MATGTVKWFNSTKGFGFIQPDDDGQDVFVHISAVERAGLSNLVDG
FT                   QKIKYEIEQDRRSGKSSAGSLSKVG"
FT   gene            complement(74476..76128)
FT                   /gene="msi063"
FT   CDS             complement(74476..76128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi063"
FT                   /product="PUTATIVE TRANSMEMBRANE EFFLUX PROTEIN"
FT                   /function="cell processes; transport of small molecules"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31468.1"
FT                   /translation="MSGVAREEVNPVSSATFAPLENSTFRPIWIATQVSSLGWLIQMVA
FT                   ISWLMATISTSDVMVALVQASTTLPTFLLSIIAGALADNYSRRNLMFAGWCVIALSSTM
FT                   LTVLAGLGIFNPWMVLAFSCLAGVGAAFTDPAWHASVGDILRKRDVPAAVTLISVGYNA
FT                   VRSIGPALGGVVVASFGPLTAFAVATLTYLMLLWTIGRCKWHVRSSPLPSEPLTTAIHD
FT                   GARFTALSSEIKAAIARGALFGLTSISILALLPLVARDQLGGGPVVYGILMAGFGTGAL
FT                   FAGICNNILRRRLSQERLTTLSCIACAACCLSLAFTPSVAVAAIALALGGAGWVVTWTG
FT                   LDVSVQLASPRWVVGRTLSIYYALSSGGIAAGSWLWGTVAESYSLSSALELSGGALLLV
FT                   AGTGFLLPIRQWKDSDQAPLGFETPQVALDLKPRSGPIVAKIEYSIPEANVEAFLEQMR
FT                   ERRRVQSGVGARHWNLQRDLQQPSRWTETFRTPTWMDYLRLNHRLTAADKELDQRLLAL
FT                   HLGELPPRTTLAIERPTGAGRKRDQSMRFFFRR"
FT   gene            complement(76535..77656)
FT                   /gene="msi064"
FT   CDS             complement(76535..77656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi064"
FT                   /product="PROBABLE OXIDOREDUCTASE PROTEIN DEHYDROGENASE"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31469.1"
FT                   /translation="MRALPSVRSDATPSPDATDGASMSDSDNIPSRRKDDHLDIVLDRR
FT                   TAPATVAAGWEYIRFEHCALPELDLTQIDLRASLLGKTMRAPLLISSMTGGVPRAEAIN
FT                   RHLSEAAQALGIAMCVGSQRVSLQSRNSQGLTRALRRMAPDIPLLANIGAAQLREADGL
FT                   DLARRAVDALEADGLIVHLNALQEAVQPEGDRDWRGVLAQIARAASSVDVPIVAKEVGS
FT                   GLSASVACALVKAGVAVIDVAGAGGTSWAAVEGERARDAADRAVAMAFADWGIPTPASV
FT                   QAVRRALPTVKLIASGGIRDGVDVAKAIRLGADIAGQAAGVLRAATVSTEAVVAHFEIV
FT                   IRQLAVACFCTGSADLAALRQARLLPSAHLPAG"
FT   gene            complement(77675..78577)
FT                   /gene="msi065"
FT   CDS             complement(77675..78577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi065"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31470.1"
FT                   /translation="MIQTERALQQVLEWGRSLTGFADEHAVEAVRGGQYILQRIHPSLR
FT                   DTCARTGRDPQAETLIVAFYRELALLFWLDDCNDLGLIAPEELAAVEQALGQGVPCALP
FT                   GFEGCAVLRASLAALAYDRRDYARLLDDTRCYCAALRAGHAQAVGAERWSYAEYLHNGI
FT                   DSIAYTNVFCCLSLLWGLDMATLRARPAFRQVLRLISAIGRLQNDLHGRDKDRSAGEAD
FT                   NAAILLRQRYPAMPVVEFLNDELAGHTRMLHRVMAEERFPAPWGALIEAMAAIRAQYYQ
FT                   TSTSRYRSDAAGGGQRAPA"
FT   gene            complement(78574..80406)
FT                   /gene="msi066"
FT   CDS             complement(78574..80406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi066"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31471.1"
FT                   /translation="MPLRSIGRRERCMLHCVQVGGGDRSGCPARPRLTRRAARKPMRRT
FT                   GPSMGRVAAPEQGGRPALPVRRAATGLRRRARRLPDPGSRQLSAEGTYRVNALSEQILS
FT                   ELRHLLIEMSDGGSVGPSVYDTARALQFHGNVTGRQDAYAWLIAQQQADGGWGSADFPL
FT                   FRHAPTWAALLTLQRADPLPGAADAVQAATRFLERQPDPYAHSVPEDAPIGAELILPQL
FT                   CGEAASLLGGVGFPRHPALLPLRQACLVKLGAVATLPSGHPLLHSWEAWGTSPTTACPD
FT                   DDGSIGISPAATAAWRAHAVTHGSTPQVGRTDAYLQAASRATRSGIEGVVPNVWPINVF
FT                   EPCWSLYTLHLAGLFAHPAFADAVRVIVAQLDARMGVRGLGPALHFAADADDTSVALCV
FT                   LRLAGRDPPVDALRDFEIGELFVTFPGERNASVSTNIHALHALRLLGKPAAGTSYYVEA
FT                   NRNPHGLWDNEKWHVSWLYPTAHAVAALAQGKPQWRDERALAALLQAQRDDGGWGAGRA
FT                   SSFEETAYALFALHVMDGSEEPTGRRRIAQAVARALEWMLARHVAHALPQTALWIGKEL
FT                   YCPTRVVRVAELAGLWLALRWGRRVLAEGAGAAS"
FT   gene            complement(80435..81409)
FT                   /gene="ispA"
FT   CDS             complement(80435..81409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /product="PROBABLE FARNESYL-DIPHOSPHATE SYNTHASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31472.1"
FT                   /translation="MNDMQTDSTLHDDAQARGASGRLPPEIWMQDGARRVEQALARLLC
FT                   AEDDGETELMAAMRYATLHGGKRTRALLCLATGALADTPAPMLDDVGAAIEMMHACTLV
FT                   HDDLPAMDDDVLRRGLPTVHVKFGEATAILVGDALQAHAFLTLASLDAPGDNRIALVRE
FT                   LAQAVSAEGAAGGQAMDLSLVGKHVELDRIVAMHRMKSGALVRASVRMGALCAIAEDAA
FT                   HAALYCALDRYSACFGLALQVVDDILDATADTATLGKTPGKDAAAQKPTCASIMGLQAA
FT                   RQLALDLLRDAGEAIAPLGTRAERLAQMLQRANAYLFKHAPCA"
FT   gene            complement(81551..82888)
FT                   /gene="msi068"
FT   CDS             complement(81551..82888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi068"
FT                   /product="PROBABLE CYTOCHROME P450 MONOOXYGENASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31473.1"
FT                   /translation="MLLNPLDRRHRLRDDIPVVPGAFPLVGHLPAIVCDLPRLLRRAER
FT                   TLGSHFWLDFGPAGHLMTCVDPDAFALLRHKDVSSALIEEIAPELLGGTLVAQDGGAHR
FT                   QARDAIKAAFLPKGLTQAGIGNLFAPVIQARVQAWRDRGDVTILRETGDLMLKLIFSLM
FT                   GIPAQDLPGWHRKYRQLLQLIVAPPVDLPGLPLRRGRAARDWIDAQLRQFVRDARAHAA
FT                   RTGLINDMVSAFDRGDDALSDDVLVANIRLLLLAGHDTTASTMAWMVIELARQPGLWDA
FT                   LVEEAQRVGAVPTRHADLAQCPVAEALFRETLRVHPATTLLPRRALQELQLGQRRIPAG
FT                   THLCIPLLHFSTSALLHEAPDQFRLARWLQRTEPIRPVDMLQFGTGPHVCIGYHLVWLE
FT                   MVQFCIALALTMHKAGVRPRLLSAVEKGRRYFPTAHPSMKIRIGFS"
FT   gene            complement(82894..84036)
FT                   /gene="msi069"
FT   CDS             complement(82894..84036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi069"
FT                   /product="PUTATIVE SHORT-CHAIN TYPE DEHYDROGENASE/REDUCTASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31474.1"
FT                   /translation="MLRGAEMRVVIDQDLCGTTGQCVLTLPGTFRQREPDGVAEVCVAT
FT                   VPQALHAAARLAASQCPVAAIRVIESDAGERASADPAPSPAQAERHAAKDQRNPGGRFE
FT                   GKVAVVTGAGAGIGKACALAIAREGGRVVVADIDGSAAVACTAQIAAEAGHALALAMDI
FT                   ADAQAVAALFETAERHFGGVDLLVNNASAMHLTPRDRTILDLDLAVWDQTMATNLRGTL
FT                   LCCRQAIPRMIARGGGAIVNMSSCQGLSGDTAQTSYAASKAAMNMLSASLATQYGHAQI
FT                   RCNAVAPGLIMTERLLAKLDECMQRHLSRHQLLQRVGRPEDVAALVAFLLSDDAAFITG
FT                   QVLCIDGGMLAHVPTYADGGNSRAARPAGDTAKAAAGPRC"
FT   gene            complement(84020..85309)
FT                   /gene="msi070"
FT   CDS             complement(84020..85309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi070"
FT                   /product="PROBABLE MONOOXYGENASE CYTOCHROME P450 PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31475.1"
FT                   /translation="MDVQETTAACRDAFAELASPACIQDPYTFMRWLREHDPVHRAASG
FT                   LFLLSRHADIYWALKATGDVFRGPAPGELARYFPRAETSLSLNLLASTLAMKEPPTHTR
FT                   LRRLISRDFTMRQIDNLRPSIARIVAARLDGMAPALERGDAVDLHWEFALALPMLVFAE
FT                   LFGMPQDDMFGLAAGIGAILEGLSPRASDPQLAAADAASARVQTYFGDLIQRKRTDPRN
FT                   DIVSMVVGAHDEDADTLSDAELISMLWGMLLGGFATTAATIDHAVLAMLAYPEQRHWLQ
FT                   GDAVGVKAFVEEVLRCDAPAMFSSIPRIAQRDIELGGVVIPKNADVRVLIAAGNRDPDA
FT                   FADPDRFNPARFYGTTPGMSTDGKIMLSFGHGIHFCLGAQLARVQLAESLPRIEARFPT
FT                   LALAEQPTREPSAFLRTFRALPVRLHAQGG"
FT   gene            complement(85404..86606)
FT                   /gene="msi071"
FT   CDS             complement(85404..86606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi071"
FT                   /product="PROBABLE CYTOCHROME P450-LIKE MONOOXYGENASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31476.1"
FT                   /translation="MSEQPLPTLPMWRVDHIEPSPEMLALRANGPIHRVRFPSGHEGWW
FT                   VTGYDEAKAALSDAAFRPAGMPPAAFTPDSVILGSPGWLVSHEGGEHARLRTIVAPAFS
FT                   NRRVKLLAQQVEAIAAQLFETLAAQPQPADLRRHLSFPLPAMVISALMGVLYEDHAFFA
FT                   GLSDEVMTHQHESGPRSASRLAWEELRAYIRGKMWDKRQDPGDNLLTDLLAAVEQGNAT
FT                   EEEAIGLAAGMLVAGHESTVAQIEFGLLAMFRHPQQRERLVGDPSLVDKAVEEILRMYP
FT                   PGAGWDGIMRYPRTDVTIAGVHIPAESKVLVGLPATSFDPRHFDDPEIFDIGRDENPHL
FT                   TFSHGPHYCIGMALARLELKVVVGSIFQRFPALRLAVAPEELKLRKEIITGGFEEFPVL
FT                   W"
FT   gene            86940..87119
FT                   /gene="msi072"
FT   CDS             86940..87119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi072"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31477.1"
FT                   /translation="MLFFLRSIDRGVIHEMKIGRRLPAPNEGVSKLVPIWPTQQKKNIV
FT                   IAFQGISLRQTRAR"
FT   misc_feature    87231..87670
FT                   /note="REGION CONTAINS 3  RESOLVASE FRAGMENTS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(87985..88467)
FT                   /gene="msi073"
FT   CDS             complement(87985..88467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi073"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /note="predicted by Homology"
FT                   /note="predicted by FrameD"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31478.1"
FT                   /translation="MMLSCSRGKSPAQLFRYLSAKWPAAFNPKAPRPLKIGIHRDIRVL
FT                   DGELSDDELRRALLAYTKMARYLARLDAGAARIDLNGKPAGMVSDADAATAKALLCARK
FT                   DKQKSKQTPEPRAEPQALPKPKPKRTAVFKAKNTADSPTGVVVETKRRRSFRKPMT"
FT   gene            complement(89155..89346)
FT                   /gene="msi074"
FT   CDS             complement(89155..89346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi074"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31479.1"
FT                   /translation="MTSDFSAARVHLDRAYHYLRGDDPMSQRGREALDLLIEAVAVEEF
FT                   KQPSQNAQVLMFPIGRRF"
FT   misc_feature    89546..90289
FT                   /note="REGION CONTAINS 3 FRAGMENTS OF REGULATORY PROTEINS
FT                   WHICH CONTAIN BOTH A GNTR AND AMINOTRANSFERASE MOTIF"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            90368..90940
FT                   /gene="msi075"
FT   CDS             90368..90940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi075"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31480.1"
FT                   /translation="MFDLPAGGLALWLRLRNGLSGETWAANAASAGLAITPGIRFALDP
FT                   ANAPEAFRFGYARHESRTSAHRSTAFAHAAEPIAVQLGREKKSCQSFQKVPRHLRHSPN
FT                   LLGRPAILIRFRAFAPMNPPADHGRRVGISDSHHGGGKISGRLRAYYDLLFRWNWLCLL
FT                   ATGPPHGAPRPAENVIVAMRTRSTWPF"
FT   gene            complement(90972..91967)
FT                   /gene="msi076"
FT   CDS             complement(90972..91967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi076"
FT                   /product="PUTATIVE TRANSCRIPTION REGULATOR PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31481.1"
FT                   /translation="MSDFKFNSMTHFEAVARLGGVAKAAQELRVTPSAVSQQLRLLEHQ
FT                   LGVRLFQREKRHLSLTIDGERLFQTTTQAFESIREVRNAIVRQRESFQLSIRVSPSFGE
FT                   KWLAPRLAEFSKDYPSWNLRVDATPNFSDFETEVIDLDLRYGDGGWAGLYSDCVVNDLI
FT                   LPMCSPSYLAELHAISPDPREQLRHARLIDSVKAYFRWDYWLPRNAIQGARMTYPYRFD
FT                   RSSMSVQLAKDGAGVVLESTSIAFEDLVSGSLVPVSTEFDVIEFPGYWLVCPSRHMNRR
FT                   AVRLFSEWVSRIGKRDTDLARHFLLEKQLHISFERRPHFGAQDDRATPMA"
FT   gene            92071..93603
FT                   /gene="msi077"
FT   CDS             92071..93603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi077"
FT                   /product="PROBABLE ABC TRANSPORTER ATP-BINDING PROTEIN"
FT                   /function="cell processes; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31482.1"
FT                   /translation="MEPGSAQSLGTTGNLPGVGLASARKTLIEASNVEKSYGATRVLRG
FT                   VSFQVRAGEIHALLGGNGAGKSTLIRIITGLTSRDAGGIDLRSSKADRTSPIIAVVHQE
FT                   LALLPELSVAENIGIVHARSGWSLISRRRMREIALGALRLIDPAIGEEIIDLPARKLSL
FT                   HEGQIVEIARALSTGAEVLLLDEPTANLTAGETAKLFSVLKRLVREEGIGIVFVSHRMR
FT                   EIRELCDVCTILRDGVTIANAAPLASLSDGEIVQQMGQPTQRQATHRNPQQNPRQGSPI
FT                   ELLGPGDVRISILSGTILGLAGAPAGPTGLIAALVGAGPGAGWRLSGEGFGDRFPSPAA
FT                   AARAGIGFVSGDRATKGILSQLPIVDNVLAARRVRERRRIVAAAERQECRDLVSALKLK
FT                   AGSIWDLPASLSGGNQQKLLVARLLGLPLRMVVLEEPTRGVDIGTKHDIYGLIRQMADA
FT                   GAIIIWWSTENVELLELCDAIFAFDTDGRPKGFLPEDRYTEGGLAELTGMAA"
FT   gene            93600..94604
FT                   /gene="msi078"
FT   CDS             93600..94604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi078"
FT                   /product="PROBABLE SUGAR UPTAKE ABC TRANSPORTER, PERMEASE
FT                   PROTEIN"
FT                   /function="cell processes; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31483.1"
FT                   /translation="MTDATNGTTTTNKLRTTRFRVPAVLFSYRTEVAIAAAIVVLLLAV
FT                   GMFVPAALSMGNLQNIIQAAAPLIIMSLGVLLVVVTGGIDLSVGSVFSLTGMVTALAMA
FT                   SGADGLTASAAGLAVGLVFGSINGLLVTVVGLAPFVVTLITYAVAGSLAFIVTNGRSMP
FT                   IGAPDFWLLNSGEIIPGIPNHLLFCIVLMVALEYVLRKVVVGRWFYAVGSSAIAARLLG
FT                   IPVLRIKFAAYVASSLLASFAGLLTVSYILNAEATAGASLMLQAIAAVVIGGASLFGGT
FT                   GSAIGAVLGALMITCIQNGVNLIGVNSFWQGSVTGAAILLAVLIDRFSNKNRI"
FT   gene            94627..95589
FT                   /gene="msi079"
FT   CDS             94627..95589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi079"
FT                   /product="PROBABLE SUGAR UPTAKE ABC TRANSPORTER PERIPLASMIC
FT                   SUGAR-BINDING PROTEIN"
FT                   /function="cell processes; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31484.1"
FT                   /translation="MKMKTILLAALAAAALSSASYAEDKKTVAYIAPSLDISYWQWVGY
FT                   GVKEKAKELGMDYVEYTSENSPAKQMDNARTAVTKGVSAIVIGPVSSTSTPPLLDYLAK
FT                   QKVPIAFAGIGPQPGLTNYTSSVTANNYETGKAQAKFTCELAKERGSKKVGMLSLPQDR
FT                   ENAQKYLKGAKEAFAAAGCDLVQMLETRGLTISEAVTQANDLLTANPDIKAIYGMYDEA
FT                   GTGAAKVVETRGLNGKIGITVADGSPTTIALLKKGAIQGIFFQEAVGQGIDGTQQVYNA
FT                   LTGAPVTQDMALVMPLVTADKVDSPEAKKVIARVFPPSN"
FT   gene            95653..96546
FT                   /gene="msi080"
FT   CDS             95653..96546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi080"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31485.1"
FT                   /translation="MAELPFIDPHHHLWDLETNYYPWLTDGVKPSVFGDYEAIRKSYLL
FT                   DDYLEDARNQNLVKSVHLDVGFNPSDPVGETRWLQEIANKRGFPHGIVGYADLSKPDVG
FT                   DLLDQHMEYPNFRGIRQSMNYHPDSAKTYQARPEVSRTPQWRLGFGELAKRRLSFDLQL
FT                   YYPQMGEFLELAHDFPDVQIILDHTGMQVDGPEHFGAWRKAMHKLAQAPNVSCKISGLG
FT                   MGDWRWTTASIRPYVEEAIAAFGVDRSMFATNFPVDKLFSSFDAIVNAFKEITKAYPHE
FT                   QRLALFHDNAARYYRL"
FT   gene            96581..97333
FT                   /gene="msi081"
FT   CDS             96581..97333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi081"
FT                   /product="PUTATIVE SHORT-CHAIN TYPE DEHYDROGENASE/REDUCTASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31486.1"
FT                   /translation="MLLKGKAAVISGAASPRGIGRSTATLMAEQGARIAILDLDEGQAR
FT                   DAAASLGPEHIGLACNVADLDACKKAAAEVTEVFGKVDVLCNIAGITQPVKTLDIGPAD
FT                   WDRILDVNLRGVLYLSQAFIPHMRENGGGSIICMSSVSAQRGGGIFGGPHYSAAKAGVL
FT                   GLAKAMAREFGPDGIRINCVTPGLIQTDITGDKLTDAMRADIIKGIPLSRLGDARDVAG
FT                   AYLFLASDLASYITGAVIDVNGGMLIHG"
FT   gene            97353..98192
FT                   /gene="msi082"
FT   CDS             97353..98192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi082"
FT                   /product="PROBABLE TRANSKETOLASE ALPHA SUBUNIT PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31487.1"
FT                   /translation="MPRAGSNVGLAERAYRIRRHAVRMGQVQGQGYVGQALGVADVLAV
FT                   AYFHALRYRPTDTRWEGRDRFLLSIGHYAIALYAALIEAGVLPEEELETYGTDDSRMPM
FT                   SGMAAYTPGMEITGGSLGHGLGIAVGMCLGLKRKRSGSFVYNLMSDGELGEGSTWEAAM
FT                   SAAHHRLDNLIAIVDFNNQQADGPSTAMLSSEPVTDKFEAFGWHAQRVDGNDIEAVRMA
FT                   FDLARGLKEPRPRVIVCDTRMAKGVPFLESRDIAHFIRVEPHEWTLALEALERGRSH"
FT   gene            98189..99211
FT                   /gene="msi083"
FT   CDS             98189..99211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi083"
FT                   /product="PROBABLE TRANSKETOLASE BETA SUBUNIT PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31488.1"
FT                   /translation="MRLSKFAPRHAVNAGERKTTSAMIASIAPDGIATRNAPFGHTLAR
FT                   LAHERLGIVGLTADLAKYTDLHVFAQEHPDRFYQMGMAEQVLMSAAAGLAREGFTPFAT
FT                   TYAVFASRRAYDFICMAIAEENLDVKIVCALPGLTTGYGPSHQATEDIAIFRGMPNLTI
FT                   IDPCDALDIEQATEAIADYKGPVYMRLLRGKVPVVLDEYDYTFQIGKARLLRDGADVLF
FT                   ISSGLMTMRVLEAAKALEADRIDCAVLHVPTIKPLDTDAILAAARRAGRMVVVAENHTM
FT                   IGGLGEGVAGLLMREGVTPVFRQIALPDEFLDAGALPTLHDRYGISTSEIVRRVRKWVK
FT                   "
FT   gene            complement(99629..99928)
FT                   /gene="msi084"
FT   CDS             complement(99629..99928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi084"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31489.1"
FT                   /translation="MGFLESGWACAVPTSAYFDTLDPAEIEPCVPVRPVSALTMSDSTA
FT                   LQQGFKAFEQTPALGVRDLCFHVATKLECRAASKVEMSPRSFRRTGRSKSEMRQ"
FT   gene            99987..101552
FT                   /gene="msi085"
FT   CDS             99987..101552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi085"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="elements of external origin; phage-related
FT                   functions and prophages"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31490.1"
FT                   /translation="MATTRVLGATLFFTVLAAGVRPPSNARSRAFLVTDNWDDWFEFST
FT                   MYFLTYVDTAGEQHDIGSVKIGQVGMEKGQRRPNIPNRFDALDDPFFALGQDDTYYAGL
FT                   NDLGPELRDRILEGLRDVALDADLFERSLDERVTGISLLRSVTPQAVRGQYRRMARGGA
FT                   RVTPYELSYTTARDRRSDTSRIELTFAVSPEVQPPTNIHVITGRNGVGKTHLLNSMTES
FT                   ILNDGERAKGRFVVNHDGDDTGTFTGLVSVSFSAFDDFTPLSVPRDKSSGLQYSYIGLK
FT                   KVGLSPEGKPLAPKSPNYLGRDFAESVQICRRGARASRWRRALQMLEADPIFKDADVAQ
FT                   LAAEDEDDASSEASRLFGQLSSGHKIVLLTITRLVETVEERTLVLLDEPEAHLHPPLLS
FT                   AFVRALSDLLINRNGVAIIATHSPVVLQEVPMSCVWKVRRNGRTVIAERPEIETFGENV
FT                   GILTREIFGLEVTDSGFHKMLRDKVEEGGDFEDILEHFGGRVGLEGQAIIRGLIAARDA
FT                   DGHE"
FT   gene            101552..102397
FT                   /gene="msi086"
FT   CDS             101552..102397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi086"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="elements of external origin; phage-related
FT                   functions and prophages"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31491.1"
FT                   /translation="MWKLPKPELTAEDVFITAISRVADVGLKGRLESVTATIIQASIDF
FT                   DEAASNNEIHTIEPSPNVDGVVTIKEMSGVYAGRMVARGSPGRTIYDELLAAPKYGRCP
FT                   LCGQHIVSTLDHYLPKTRYPALAVAPWNLVPACHDCNKAKSDTRPLTADEEAFHPYYDD
FT                   IDGDLWLVAQVVESAPAALRFLGSPSPGWSDTLTARVLRQFQMLKLARLYAAKGAQELT
FT                   DLHNLLRTHLANGGPDEVRLLLQQFADSCRAANMNAWRTATYQALANSDWYCQGGFAHV
FT                   "
FT   gene            complement(102824..103726)
FT                   /gene="msi087"
FT   CDS             complement(102824..103726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi087"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31492.1"
FT                   /translation="MDQLRAVELKLVDDLFGISSGWVLDFTNATFDDFFRREVGIDIYD
FT                   DAYASGSGSKGKRLRALLTIGHPRAIVRALTALWEYRETIRISRGDPETVVNARARLSS
FT                   IVERLGGALLPSFDINVGSSPAQSHSATKAGPDHAALDRLERDFIALFAMTDEPHARGY
FT                   HFERLLTALFNAWDMDAREGSRLAGEQIDGSFQHGAITYLLEAKWHRAKTGAENLHAFQ
FT                   GKLSERLEGTRGLFVSFEGFTDGALEAFTARRIILADGMDIFDALKRRISFPDIIVAKA
FT                   RYASEYRNPFARVRTLFPA"
FT   gene            complement(103806..104618)
FT                   /gene="msi088"
FT   CDS             complement(103806..104618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi088"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31493.1"
FT                   /translation="MGLVGEAKRRKQNAALASTMDAEQGEKVLRQAYQNTCRAFDVYPD
FT                   NIVDALIASYAGRNASLDLVARNNPQGVVAFRAGCSACCHQMVLCSPFEIFILAQLLLS
FT                   TRTDDELASIERRLSEISKLPLNPDARYGSHATCPLLVDNQCSVYDRRPAVCRALFSNS
FT                   RERCEQALAGGAGDVAFLVHPKLISSALQVGIDSALHVKRGLNTELAEMCGSLLVALRD
FT                   FDASLSVWLDGGIHFRFSTRSETVHRQMLSSWRTSRLDWGFEVERPPP"
FT   gene            complement(104678..107221)
FT                   /gene="msi089"
FT   CDS             complement(104678..107221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi089"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31494.1"
FT                   /translation="MAEPLARPIQVFLDTQRLIQIQATGTRGPNRDFFAGNNSGFQRHK
FT                   ARLRQQLLQASSALRTEADPAGFVLVQMREEGLAKSYRPLGALFTTPNRFALVGGAAIG
FT                   QMYFQTTPDALDRLSELIEQRAEVQPRLRENPETGRMEERVSAYRSEVGAIDEIRLPTP
FT                   ADRLGFSARDAVMWLEQETIIGGYVVEMFRPDPRVTPQAVEAMIARFRGRLNELGGLIA
FT                   VPFSSRTTKATASALTLSIDLRSDGRRAISLPLVPDVDAEQTEGVPDLGPRAPDRSLAR
FT                   HQALLDLLAREPLVRRVELPLRLESGSASSIGLGAEALVQPPVANQSYPVVGVIDAGVA
FT                   AISQLEPWRAGTAGLISPADRDEAHGSFIAGLLAGGGGLNPTIANRLEPTPCRFFDIDV
FT                   LPRRGLLGQYYQTPDEFFDQLETQIEVAKAEGVRVFNMSLGAPGVRQGLGYSSFAANLD
FT                   RIALTHDVIFLVSAGNLRGRDARPEWSATAEDALEMLATRAIAEERITAPGEHLFGITV
FT                   GAINAPSVLGAVADVPTTYTRRGPGPGGARKPELAHIGGVSPRAGSSCGLHSIGVDGQL
FT                   VEGSGTSYATPLVTGSLAALDHRLEGQAPRETLLALSVHKAEKPHILCAKPLRTVARDF
FT                   VGFGVPRHADACLSDDLNSITLVFADILPPRRELSFIFTWPRSLVTTEGKCRGRIDVTL
FT                   AHTPPIDAAFDAECQRVQLGVGLHQLEEKENEDGELVPDPQQRLNACDSQLPQHLDYTE
FT                   RYLLENGLKWTPIKRYEKNIPKGCGTTSEWKLSLKGLTRAGALYPEEGVRFAVLMTIAD
FT                   PRGTAPVYEEVRAEILRRGLRLADITVAQRLRTRG"
FT   gene            complement(107227..108444)
FT                   /gene="msi090"
FT   CDS             complement(107227..108444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi090"
FT                   /product="PUTATIVE AAA ATPASE FAMILY PROTEIN ASSOCIATED
FT                   WITH VARIOUS CELLULAR ACTIVITIES (PFAM00004)"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31495.1"
FT                   /translation="MEHFDIVLAIARIALSGDSERATHQVKRLREAVSKAKPDQAEKLA
FT                   RLLNRDDRRHSVAPMSLEQMRVSGSSPPVIPGEKLGRNTPLPNDRETATPLVRVVFPED
FT                   NVGAEPVLSPVLADALDGLIGEWAHTEELAALGVQPNMRCLLYGKPGVGKTMLARYIGA
FT                   KLGLPIVEARLDGLVSSFLGTTARNIGALFDFADRYRCVLFLDEFDAIAKARDDAQEVG
FT                   EIKRVVNALLQCLDARGRRGFTLAATNHEHLLDPAVWRRFDGRIEIPLPDADARKNLLA
FT                   RFLPPLTPGEAEMKMLVWMTEGMSGADIETLISGGKRFLVMKEASGASGSRRRGLLGGL
FT                   RRQATLSGQLFSVEQRALLLGSNEELAAALVDNGGLTQREAGLLVGVSQSTVSRRRRDT
FT                   ANPLEA"
FT   gene            complement(108847..109338)
FT                   /gene="msi091"
FT   CDS             complement(108847..109338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi091"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31496.1"
FT                   /translation="MIWPFVTKQTEPAKAQSAPIAFSTADLELAAVAERAVAAFVDYLG
FT                   ADTMVGEIRDVKVLPGPKQALVNAFTLALALEGDAERRDALLRYGLLLSHFQEGVGDKP
FT                   VRQMPDFSGDDEAILEVVLAHKSEFDRFNQVYPTAIAEAKQMAEKYQRSIDAAVRRGGA
FT                   "
FT   gene            complement(109379..111391)
FT                   /gene="msi092"
FT   CDS             complement(109379..111391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi092"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31497.1"
FT                   /translation="MRLKKARITNYRSVKDSGSIELEPNKTILVGPNEAGKSALLKALQ
FT                   QINPPAGVPGFDALRDYPRGDYNDITSKRLKPEDIKVAVAHFELEDDDKKAIESEFHSA
FT                   TYVCWRNLDNSWGHELQGVPEKPTIEDLKKDLARLAAHVDSRQKDGEPQPSKELEGILA
FT                   GYKDKNYYIQGEVATKLIDWLEKHYPLVDEDDEKEEDRYTRLLGHCKYADRLKTTRTAL
FT                   RTKLPVFVLFSNYFRVRPLIHLDHLATRVEQNLLDDAQYDYGNQCLLKLLGFTARELSD
FT                   LGKAAEPGAKDTDAQKKYRDQLDNRAYQLNAASVRLTDQIVKVWNPNPERAEASRLRIT
FT                   ADGQYLKVVVEDGLGVEIELDQRSEGFQWLVSFFVVFFSETEDKHANAILLLDEPGMSL
FT                   HALKQRDFRNTISMLSESNQTVYTTHSPFLVGPNELDLVRVVEMADRKVGTKVHTTITA
FT                   ADPAALLPLQEALGYDLAQSLFAQQRNLILEGLTDFWYLEATSEMLRVGGVADLNDKIA
FT                   LISANTASKVVYFATILIAHNLKVAALLDSDNAGDQAAKQEVLVHRLGAKRILRTMDFT
FT                   VPPRPKAEIEDLLRDVLIPLAAKELGIDVTAEAAATPEKPLVDLLLAKGGANFSKYKLA
FT                   KAYVRWTRDHTAQDLSQAERDAWIKLIGAVNSALK"
FT   gene            complement(111835..114312)
FT                   /gene="msi093"
FT   CDS             complement(111835..114312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi093"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31498.1"
FT                   /translation="MGEVNVLQRLVDASKRATTAVVLTHNIDFMFAQAILVNQLRKSGA
FT                   PRLTVFADAGCAAASFNRQSVIADRVGRSYRVVPIDLGVGRRFHPKAIFLAGEEGTRLA
FT                   IGSGNLGHGGWSSNREIWTYFNFPGEGGPAIAAFRDYLEKVCGMAGASDAVRATVLDPF
FT                   RSEAWAADLPEPDRLVELPADTPLMDRMLSQFQEPPASFDMMAPYFDPEGAAVNELAAR
FT                   LGVPMRVLIQHGKEGLSSKAGAKLPSSARIVGIAPGAGERQTIHAKLYAARYTDHVVIL
FT                   AGSANCSRAALLRSDNGNAELMAISHLSNAEYEELLSGIQISDSPPDLPETAPNADWDE
FT                   IENPPVRVLSASFDAGSLVVRCAFAGGDTPSDIRVVLHTGSLIAVADETGSFRVSVPGP
FT                   GTRLWVEIDTPAGAVRSAPMWIDHEAELRVGRPEFDVQTRLAGNEGTISSEGLIDIFTL
FT                   VVEHYKSPVPWAGTRGAKGASAIDYNLEDVFSTGFGRRSYAPVSGGGYLTTDEWSLMND
FT                   YFRLGGVGPRNGDPSDNSTDNPDGNPPEPKEPRAPAKPLEPTQVEKLARLIDRAVSSMS
FT                   SMAFLESRPPPRLAADIRTVALLLGIARRREGMDKARVDSASARLFHALFFGNGSRPLL
FT                   DLYVEAHPEAPALMQSSDLTAAMTLWIADLINKPEAGTWFNFAATRLAAAHPWLTLGDD
FT                   EAMDSLERLSVHIAGLVEALPDFWLSWVQGGAAIRALMKNLTDPDQLLATVTRPRIYSG
FT                   EIVWIGNQFAVAETDFDRKSNAGFFLLGEARHARYQGSRAVPILDVIDAVELPEAVKHT
FT                   IKQILTPASLSFR"
FT   gene            complement(114312..115799)
FT                   /gene="msi094"
FT   CDS             complement(114312..115799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi094"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31499.1"
FT                   /translation="MNIAWGARLSSETKGLDVIGIRALDQNIEASLTNGLTTISIRARY
FT                   ISVLPWAIGQYFVHESAGGRVRHDKDALAVHLNRVRFLVLAATFVDEGASRIGTMGSDF
FT                   YLDEMATLVTGKTVRMPDVGNLAVLATYFGPASALGFVESRPGSSGLPFGLSARGTAMY
FT                   QERSKALGSSRLVDLLRDGGDLDYDTAREAVSAFSLARIADFGREVDLLREAFEQPWVP
FT                   GSSIAAKLVAQAYQRMIDTRSWLHRELEVEPASASELIARNYDRAVLEGADGIELEWAS
FT                   FEWHRRVHFALELLLAAMTRTLLDDGSMSVAQLIAIWSSHAVASEPLTDHWNSPVDVAA
FT                   LTVQPGAFSGGLLRPADFHLEPHIQAIRAFEILVTQARDAQSIGVVPGASSGASAPSAR
FT                   AIQLVAAGTGTLGAVLRAICDECVAQRHIANTMRKMGNHQDCSLRFYPEGPVLVPTDID
FT                   FSPNYSGSRLQNTMRILGDIGMLNIGSGGVIAADVVG"
FT   gene            complement(115909..116682)
FT                   /gene="msi095"
FT   CDS             complement(115909..116682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi095"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31500.1"
FT                   /translation="MGIVLYRQYRQSLKVTPFTGRYMPYNWSSLPNPLDAQWMAYSWML
FT                   DEFGRELANTVNGFTNDVHSLTAWSTVVEPLTQQSQLEANREFIDKLATTAVNLPYVVK
FT                   GRFAFAAAHLCHQANMLKFPATWRDDLPLDCEIYPHVADSYGKSWKGYKRLKRALDAIG
FT                   ARAFRDGTGDFRHAYNHRFSPRFVVGMTQFVTRTVNASTGRVRYGFGGRCPLDLAKIVK
FT                   LLEQEQMRFYAAFESFQELVREHERAIRDHVEAKL"
FT   gene            116779..121434
FT                   /gene="msi096"
FT   CDS             116779..121434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi096"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31501.1"
FT                   /translation="MGVHGYDISMVNQRGSGPSTGLTEGVGPAAGKKDMNKLVPSTGGL
FT                   IGINLDSETAGRRAIAGFLLQILRSIKLGLDMTLTLSPLADGTQMVLHLEPAEGSDHQV
FT                   VGGASDIVEQVKMRASRRKWTSGEIASKVFPDLLKAVKLAADQQFRFVTNNAEGLAPLQ
FT                   AYIASRGKSSERQHRWGNARLTTIAFEQRLAEAAGLIKVNAELRHLLDRFEIEIIAADV
FT                   TQDAIDKALTPLLRKDEVASDKRFQLLGQLMTLATDGAKLTPAELLTLINPQAHRLLAH
FT                   IQSLPALLARHVDEDAQLIGYVPSQQARLALPKLVSNFAILSGESGQGKTWTLAQLAFD
FT                   QIARGELAIVMRSPTKIEDVVNCISERIWQPAHPDRGTIAVVAKVLGDAFRDENGNWLT
FT                   VYIDDVQDREFAQRLARSKWDEYGVRIVVSAQPRITNVIRSIREGVQIIEIGNFRSADL
FT                   HRFLRHHDLAEALETMPDDVFELLLKPVHASIFVQLPKRASWAGVSEYELFSAYWEYAS
FT                   LRAREQSDHPTDKYALRSLAARLLTGKGYYPWRVTDLHAVNLDDHAVLRLEQVGLLRRP
FT                   VPDRFLFAADRMLNWAIAESLADNIQEDELSAEQAEALFASIDGLQTKKKEPIGSRLGY
FT                   VYFDALWLLARQSEPEFVADLIQEHVARLPEDTHSEDQWRNGYGSLGGAILSALEVLTL
FT                   GTFDERDLGILRNVPHALAAVAASDPGPVGDLIARQVASPNEVAVDIGLRAACLVQAPA
FT                   ALTAIWDEHLKRALAYEQARLASDVDTRSQAIFAQQLSSEALHVAISANPGWLDPKLAT
FT                   ETNEIAVSQLLWMLKDEKTVDSDLAAEIWERHRERIVALMPTPSAALIEAIGHFQEASL
FT                   LPMLDAAPSSGEWTHARVLRSRARVAPHEAIRQIAEGTDSYGWGAANWWFDELAAVDPD
FT                   GLAAAIRARAHAGDDPLTDTVLYYGFNPEAMDARTLDEVLDAFAEKLRVFSESNANTDA
FT                   HEGRLHHPLNFLPRLSERWQFEALRRRSGTKLEKELVQFAAARRGRISMTRDNTGNECE
FT                   RILAMIGGSGYDDLVLAELSRPNVFGRQDGFIAARWTNDDRVAAALAKSPGDPENQTFD
FT                   QVVRMEALAVHCCDEQLEAMVRAGTPIYVNAVGMRCSIDRDMSGLRTRIADLLASGDIE
FT                   SLDIAAALTGFLGGAEEAQPLVAIYLAPATKQQTRHRTLASFRALHFYTPELLPIARDM
FT                   IAERIDDEAQFVATYLAEVGDDGARQAVIDWLSSQDLGSASASRRRYLTALVEHPSGKA
FT                   AVVEYLQRSRANGHLVVDGGQLRLLAEAGDGWAQEQLVRASYRYSGFDRGNVIAAIDYL
FT                   RKEEPDEAYFAAQRLLSRHAVAVAGDLMLEINPDRAGPELIERYRHAKPSLRLQLERRL
FT                   RAHLGGNVLAALVTPLASALPAADRKTAAQLAAVVPPGEALPWLDRLARDSSPAVQQAA
FT                   RMALRQRRLETTAMAHRDLLLSSPKPLQWARLLTILELVDPFYLWARDDPANLSEVFDA
FT                   LPFEFLHEGRQLGKKQLKRREDAAAKADKDH"
FT   gene            121598..123874
FT                   /gene="msi097"
FT   CDS             121598..123874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi097"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31502.1"
FT                   /translation="MQFWQIDLIRPKTSKTGCGIMSYDLSALGWKAFQDLAAAVAAEIL
FT                   KRPVQTFLGSNDGGRDAAFLGRWEDSDGATSKSTIQCKFLGKPGANLALSDLKDELPKA
FT                   EKLAADGLAEDYIILTNAGVSGDADAQICAAFEGAGVKRCRTFGGTWIIQQLTENPKLR
FT                   MLVPRVYGIGDLSHIITGHGYKQAKAILESMGSDLSCFVPTDAYRSAVKALQEHGFVIL
FT                   LGDPASGKSTIAAILALGAIDDGCLGALKINSPDQLNLWHPGERQFLWVDDAFGPNHFD
FT                   ASRMSRWNAELGTLRAAVEGGARIVFTSRNYIWEAAKPHLKTSSFSLLKESQVVVNVHA
FT                   LSDEERAQMLYNHVRRAQPQQIRHRLKPFLPAIAVSKAFLPETARRLGDPLFTKNLIIG
FT                   EERLTRLVEHPVEFLTEVLAQLDDASRAAVALIFLNSQAGVPSPITASPALEMVTRLVG
FT                   VKPADLARAMQHLNDSLTRLISEDDGNRWVFRHPTITDAFATLVAASPELVELYAHGAK
FT                   LDRLLGEVACNSKAAEDGRIRVPPALYPGLIERLKASPLDESLKSFLGARCERAFLAMV
FT                   LEARPDILEWAARAPASGQALGGKLLIAALASWGLLPEEVRQKMVADIREQSITWLDAK
FT                   PLTDTLLRQIFKDAEFADYAEAFRKEWLSDIPSVFGEFSRFSSEDAPGMYKEFKENLKV
FT                   AQAYFELKSDDSFDELYAEIDVHIEELESLQSAPDSSAWSPTSMEKSAVLPSDGPGLIF
FT                   HDVDG"
FT   gene            complement(124082..125140)
FT                   /gene="msi098"
FT   CDS             complement(124082..125140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi098"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31503.1"
FT                   /translation="MTSYCTFLIFNPTHVEAVDFMCSAAGWKIRFIADPSERFWFYKNG
FT                   VTEISHPDALTMRPTGSIAGQLMVIDSDETTANNIIGLVRAANDVIEGNYKQDAPFRRG
FT                   FELPDDPSEQTGVFCDVFRSHGFFEQFSHDPDFPLAVALAATAWQDRRLVYAIHKLSRS
FT                   FETESITWWSTHPRYGQIFDKRSQLHSAHVNTSIAINLAFSAIEEIKLQVKSSAAKARF
FT                   LAGEWNPAVLKDILDRLQEAGIDVDQKVNWIVRGEISRSEDRIKPTLGAPAPYSDGQVV
FT                   RDVELTIPDALHISSFIRNFMTAHGFSDSSEFLGPYEVFNVESLARRLILSKAQLWNVS
FT                   TDDILRRTSSEN"
FT   gene            complement(125234..125743)
FT                   /gene="msi099"
FT   CDS             complement(125234..125743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi099"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31504.1"
FT                   /translation="MDENETYLWCGVFRDLNSEARLSLTQLVIKGGAVKGTPDQIGARL
FT                   GRTRTLALLRVKATDRIVGVATLKNPHSGYRVNTFAAAAAPIAGYETAPELGYVVIAKE
FT                   MQGKRLSGGLVEAILKELREPAYATTDSNTMRNNLERSGFTRAGREWQGKRGTLSLWTF
FT                   VPRQGA"
FT   gene            complement(126145..126840)
FT                   /gene="msi100"
FT   CDS             complement(126145..126840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi100"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31505.1"
FT                   /translation="MSEASARRKSNDQPALLDTELDHLPPELRWREWMGRVEAVIFAAN
FT                   EPVTRSVLARVVGRNCNIELVIDDIRAELAGRPYELVAVAGGWQHRTKKIFGDAIRAAF
FT                   GTAAGEGAKELSQAEALVLMCIAYFQPITRGELSSFFGKEVSRDLIGVLRGQDLIASGP
FT                   RSPQPGAPYTYVTTKTFLSQFGLDTLRQLPEFEALEDAGLLSKEKLLAGDIVPGFSSNH
FT                   RNAHPEIED"
FT   gene            complement(126843..127796)
FT                   /gene="msi101"
FT   CDS             complement(126843..127796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi101"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31506.1"
FT                   /translation="MIRLDPATASSGAPPSVPAWAITSAGAPSDGAAAFRAGAALGVLD
FT                   TLARAQPAWAGVWRQRLALSCAAASMRLAGRAEDAAALRDAWYLRPAGADSGPAGTIFG
FT                   AWRQLAGQPPVATPDRLEKILDQLGFHWESAALADLCRDIENLARSQRPAPFAAAAIVA
FT                   HVVAMRPDAELFGWWLADLVLAQSLGWPQPLPLLMAQAFGPAFRPDGGGKRIRPGDKNF
FT                   ERAVCVALVHAAADACRLATELSRRAAKLLAVAPKLRSKGAGEVVFLLFNEDAVSGSLT
FT                   TKNLSRFASRRLFERLQQLEAVRELSDRPTFRLFGL"
FT   gene            128280..128813
FT                   /gene="msi102"
FT   CDS             128280..128813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi102"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31507.1"
FT                   /translation="MYRQYFRIALIDYSCEAQFQPVYLPLKSRIKEGSTDSVAYPLSFA
FT                   YSRPVAPSGRLKIAGLTSGWAQAPGAGWQATGVGQMSKDSGKGDHGGGPGKIEITVVVN
FT                   GQPTQVEANPNQPLHVVRAKALENTQNVAQPAENWEFKDEAGNLLDVDKKVGDFGFANI
FT                   VTLFLSLKAGVAGA"
FT   gene            128806..129423
FT                   /gene="msi103"
FT   CDS             128806..129423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi103"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31508.1"
FT                   /translation="MPEIQTVDPAVSRAKFDRQIGWFQTQAGAYRAQGCFLIEARFPTA
FT                   FFIFAPPKIRPQIIGAAVEIDFSNYDLRPPSVVFVDPFTRRPVARKDLLLSMLRRPHLP
FT                   GTPPGMISVLMQQKALSLSDFLQANSAEHTPFLCMAGVREYHDNPAHSGDSWLLHRGSG
FT                   EGCLAFILDKIIKYGTGPVEQIQYQFQISVGAMVVPPSAIPE"
FT   gene            129420..129908
FT                   /gene="msi104"
FT   CDS             129420..129908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi104"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31509.1"
FT                   /translation="MSVLMDVTTVTLPRHCISTVHAHLRSVGREGNEGMALWVGVQQDQ
FT                   HFAVTETVIPAQRHIRTGDGVCVMVPAEELHRLNVWLYNSGLKLLAQIHSHPGRAYHST
FT                   TDDAYAVATTVGCLSLVVPNFAREPFDFARVAAYRLDGKANWNALPSAALSRMITITS"
FT   gene            130013..131470
FT                   /gene="msi105"
FT   CDS             130013..131470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi105"
FT                   /product="HYPOTHETICAL CONSERVED TRANSMEMBRANE PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31510.1"
FT                   /translation="MAVAFDDQAASCAEGQATLDLAVRLLARLYPVLAILPLGSAASSQ
FT                   AQALERLAKSINPKVGIRRSGKSATICVVAGVTRPPLRCPTFFMGSDGWAAKLSRTDPV
FT                   GSGSSLLPYGAGAASCFGAANVFRTIFAAQLTGAELDETIDLSLYSYDKTRAGEAGPID
FT                   IPVDLGETHLVGLGAIGHGSLWALARQPGLTGRLHVIDHEAIELSNLQRYALAGQAEIG
FT                   MSKAVLAATALRSTALGVEAHPLTWAEYVARHGDWVFDRVGVALDTAADRLAVQGALPR
FT                   WIANAWTQEHDLGISRHGFDDGQACLCCMYLPSGKSKDEHQLIAEELGIPEAHEQVKTL
FT                   LQTNAGVPNDFVVRVATAMAVPFEPLAPFVGQPLRSFYQQAICGGLVFQLSDGSRRVRT
FT                   VVPMAFQSALAGIMLAAELVKHSAGFPVGPTTSTRVNLLRPLGSHLHDPKAKDSSGRCI
FT                   CSDDDFIAAYRRKYGKSVVQLSDVSAA"
FT   gene            complement(131520..133490)
FT                   /gene="msi106"
FT   CDS             complement(131520..133490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi106"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31511.1"
FT                   /translation="MQDDEFRPKLGKIGSRGSKAGKRYAGQVKAAINRAGGRLQRGGRF
FT                   TGSRTGRGGAAAALLKSRDRYAAFRQRRVMVKARIVKLAGKGSDRARAHLRYIQRDGVT
FT                   REGEPGKLYGPGSDRIDSKAFVDRADSDRHQFRFIVAPEDGIDYDDLKPLARRLMAQMQ
FT                   EDLGTKLDWVAVDHFNTGHPHTHIIVRGKDDRGENLVIAREYISSGIRERAAELVSLDL
FT                   GPRTDREIEQRLRQEMEQERFTSIDRQLLRMRDEDRLVSTDGRDAFRQTLHQGRLRKLE
FT                   RMGLAEEVDPVRWRLDDELEATLRRTGERGDIIKTMHRELTGKGLARSAADYLVHDRRE
FT                   EPSPPVVGRLAARGLADEINDRHYLIVDGVDGKSHWIDIGKGELTEPTPDGCIVRVTSR
FT                   DTKPRQVDRTIADIATAHGGRYSVDMHLKHDAFATESFAETHIRRLEAIRRSTGGVERE
FT                   PNGTWIIAPDHLDRVAEYERLRARVEPVIVEKLSSMPLERQVSFEGATWLDRNLVAERP
FT                   EPLRNSGFGHEVREAHARRRQWLIAQGLAHEEQDRVVYRANMISILRQRELNRVAGQLS
FT                   DQLGLSYAEAQPGERIEGTLRRSVELASGKYAVIEKSREFTLVPWRPVLDRYIGKEVSG
FT                   VARGEAISWTLGRQRSGHSVS"
FT   gene            complement(133681..134364)
FT                   /gene="msi107"
FT   CDS             complement(133681..134364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi107"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31512.1"
FT                   /translation="MDRVTLLMLGMIAVAPCACSASTGAEPAVISQSPQLQRWQHFVSE
FT                   ASARFHIPQAWICAVIDAESRGKTVLDGRPITSRAGAMGLMQVMPGTYQEMRVEHGLGA
FT                   DPHDPRDNILAGTAYLSAMYKRFGFPGLFAAYNAGPERYEGHLKLRRPLPKETVAYLKQ
FT                   LEATGISAADMNEFKGQSTTSKGRNAPSGRSLFFLRDGVRAGETNGGLFVPLGRDLARP
FT                   KKHNG"
FT   gene            complement(134352..134900)
FT                   /gene="traF"
FT   CDS             complement(134352..134900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /product="PROBABLE TRAF CONJUGAL TRANSFER PROTEIN"
FT                   /function="cell processes"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31513.1"
FT                   /translation="MSQRPSIHLIGSRLRRVRARKAIAIAAIGLSLTGFTALPKPSPLL
FT                   VWNASASAPVGLYRVGSGTPARGDLVLARPPGFVAYLADQRGYLPRNTPLVKRLAALPD
FT                   EHVCAFSNAIIIGGEIVARRLKIDTQGRPLPWWNGCRALAHDEVFLLGNEKNHSFDSRY
FT                   FGPVPAENIIGRLVPLWTE"
FT   gene            complement(134897..135166)
FT                   /gene="msi109"
FT   CDS             complement(134897..135166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi109"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31514.1"
FT                   /translation="MDDENDRAARAKKGSPFLNTAQAAFYIGLSQRTLEKMRLTGGGPK
FT                   YRKHGRYVRYHIDELDDWSKGRPPEPGSDDDKGGSGSADEGARS"
FT   gene            complement(135329..135652)
FT                   /gene="msi110"
FT   CDS             complement(135329..135652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi110"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31515.1"
FT                   /translation="MTAIGYVNKQENGSYKGQLRTLSVRADIDIVPNRSKSADNHPDFR
FT                   VLTQGVEVGAGWVRTGETSGNDYVSLSIAAPEFGPRKLYANLGRAAGQDDQDTYAVIWN
FT                   PAD"
FT   gene            complement(136184..136438)
FT                   /gene="msi111"
FT   CDS             complement(136184..136438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi111"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31516.1"
FT                   /translation="MAAGRSPGYVRVDKRKASGLSQADLAKAIGINVVEFLDHAETIGF
FT                   APMEPAGADSTKFPTENTRNAAASDRRSMGQGPVAVTLE"
FT   gene            136731..137093
FT                   /gene="msi112"
FT   CDS             136731..137093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi112"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31517.1"
FT                   /translation="MLKSSKVSKAFLDRGSSNSAIVGATAASSQIAARARNYTQETKPY
FT                   AVDAGVRQCIGSARPERFSPSLAGAEVLTTPTVQHLCSVRVTTRLCGALGLGQGTAPLL
FT                   KPTGLRQKIVRFGAPK"
FT   misc_feature    137337..137715
FT                   /note="REGION CONTAINS 3 RPON2 FRAGMENTS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            137783..139009
FT                   /gene="msi113"
FT   CDS             137783..139009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi113"
FT                   /product="HYPOTHETICAL CONSERVED MEMBRANE TRANSMEMBRANE
FT                   PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31518.1"
FT                   /translation="MTESATGFMDGVLHDPKQPDQRSGPAWGAVISLALGTFGLVTAEF
FT                   LPASVLTPLAHDLSITEGAVGQALTTTAIVGAISAPTMAVITRPLDRRIVIWAMTLLLI
FT                   LSNVLSAVAGSLPVLLAARVVLGIALGGFWSISAALAMRLVPSHLLRRAMSIILTGVTC
FT                   ATVCAAPIGAYVGDIWGWRTAFMIAAVVGAVTLVAQLITIPRLPPIGVASFRSLLDVAK
FT                   NPMIKVAMLVVLLVASGHFAGFTYIRAFLEKFPALDIETISLVLLVFGIGGFFGNLAGG
FT                   FLAEHSLKAAAALPPLLIAMATVSLLTLGASAWATAIAVTVWGFAFGAVPVGLQTWMVL
FT                   HAAPEQAESAGGLMAATFQVAIAAGAIFGGLLMDNAGVASSLAYSAVASFLGALTVFLL
FT                   GPKREPQTT"
FT   gene            139157..139372
FT                   /gene="msi114"
FT   CDS             139157..139372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi114"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31519.1"
FT                   /translation="MMVPTREPKSAGPNRTASSVDRSGMATRSMRLCLAASIGRIARLI
FT                   SYMKLGAEHAPRLLIRPEIEDRSAIS"
FT   misc_feature    139555..139638
FT                   /note="NIFQ FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(139758..140663)
FT                   /gene="nodD1"
FT   CDS             complement(139758..140663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodD1"
FT                   /product="NODD TRANSCRIPTIONAL REGULATOR PROTEIN"
FT                   /function="cell processes; nodulation"
FT                   /note="Gene name confidence : probable"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31520.1"
FT                   /translation="MRFKGLDLNLLVVLDALLTARNLTAAASSINLSQPAMSAAVARLR
FT                   NYFNDELFTMSGRERVLTPRAETLAPAVRGALLHIQCSIISWDPFNPAQSNRRFRIILS
FT                   DFATLVFFEKVVERVAREAPAVSFELRPLDNDPDELLRRGDVDFVILPEFFMSSAHPRA
FT                   ALFDETFVCVGCPTNKQLPRQLTFERYVSMKHIAFRVGGAQMPSIEEQFLLEHGLKRRV
FT                   EIVVQAFSMIPPMVSGTARIATMPFRLVQHFKKTFPLRIIELPRPLPTFTEAVQWPTLH
FT                   NSDPASIWMRQIMLQEASRM"
FT   gene            complement(140871..141992)
FT                   /gene="nolL"
FT   CDS             complement(140871..141992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nolL"
FT                   /product="ACETYL TRANSFERASE, NODULATION PROTEIN NOLL"
FT                   /function="cell processes; nodulation"
FT                   /note="Gene name confidence : probable"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31521.1"
FT                   /translation="MLDHIRAGAKGHGSCPAGTNNRDLSFDFAKGILITLVIIGHLLQY
FT                   LIYQGTDAFWLSPYFKSIYMFHMPLFMAISGYLSSGAILRKSFTQGVGERAMQLLLPML
FT                   FWCTLIWTLKSAVIFPTKSLTDTLLDLSTEVIGTYWFIWAAFISFVLIRVLTTFNRLSM
FT                   WIISASAIAVAFAPITLSITPLLKYTYPFYCLGFLFAQPIGWQNGVIWRYKSIFVVLFS
FT                   IAAFICFLGWGKETYAYNNLVLIHDEQSAKQVFLMFSGSLAASAVAMQSMFQCWRLVYS
FT                   TRVARFVAVQLGQSTLLLYLVQGAVFRLMDLIQFGEVWNLATRIAFATVLGVAIVVIAM
FT                   AIRSIARNLGYVSRIVVGAPPRPSLLKSQSVIN"
FT   gene            142171..142503
FT                   /gene="msi117"
FT   CDS             142171..142503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi117"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31522.1"
FT                   /translation="MCGDANARHYGRLAVSAEPLKMVSQRVPNHAKSEWNATLLQHRTH
FT                   DADRMAHSESLKIGVHPVRSEFAYQEINLANREEMAQQVLVSCYAVHIRADCANLRPCT
FT                   GPATTA"
FT   gene            142709..143653
FT                   /gene="nodD2"
FT   CDS             142709..143653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodD2"
FT                   /product="HYPOTHETICAL NODD TRANSCRIPTIONAL REGULATOR
FT                   PROTEIN"
FT                   /function="cell processes; nodulation"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31523.1"
FT                   /translation="MRFKGLDLNLLVVLDALLTERTLTAAASSINLSQPAMSAAVARLR
FT                   DYFNDELFTTSGRERVLTPRAETLAPAVRSALLQIQCSIISWDPFNPAQSDRRFRIILS
FT                   DFATLVFFEKVVERVASEAPAVSFELLPIDDDPDELLRRGDVDFLIFPELFMSSAHPRA
FT                   ALFDDTLVCVGCSTNKQLPRQLTFERYMSMRHVAVKFGRTLKPSIEEQFFLEHGLKRRV
FT                   EIVVQAFSMIPPMVSGTARIATMPFRLVQHFKKTFPLRIIHLPLPLPAFTEAVQWPALH
FT                   NSDPASIWLREILLQEASRMTSPGDAKRRPKQP"
FT   gene            complement(143668..144480)
FT                   /gene="msi119"
FT   CDS             complement(143668..144480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi119"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /note="predicted by Homology"
FT                   /note="predicted by FrameD"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31524.1"
FT                   /translation="MRQASPRFALDYMATPGLDVRALFAFARDQGLTDVQIRGQPGSNA
FT                   MARGEPAADVRSAAADTGVGIISVNALQRFNEWTPARRAEASKLADYAAACGATALMLV
FT                   PVNGGSWPANVERRGDLRVALKALKPILQSRGLIGLIEPLGFRTCSLRSKNEAAKAIAA
FT                   IDGQSVFRLVHDTFHHTLAGEAFFSSELTGLVHISSVNDPIHWIYPDRVLVGSDNGSQI
FT                   RALLDGGYGGPFSFAPFVDAAHPLDDLAGAIAASIALFRHGLLTRVPA"
FT   gene            complement(144776..145426)
FT                   /gene="msi120"
FT   CDS             complement(144776..145426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi120"
FT                   /product="PROBABLE AMINO ACID EFFLUX PROTEIN"
FT                   /function="cell processes; transport of small molecules;
FT                   amino acids, amines, peptides"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31525.1"
FT                   /translation="MPELTPLALYLAAASVLAITPGPGIFYVAARTLAGGRREGIASSF
FT                   GTGLGGMIHVLAASLGVSAIVLESSELFSALKLFGAVYLVWLGFRTFQAARLKGATGGD
FT                   DGAAVGPVGPRRAFREGVLVEALNPKTAVFFLAFIPQFVNPSAGLVALQFAVLGSVSIA
FT                   LNTLADIVVAVVASGIQDGAAARPGLIRRLREASGGAMIALGVGLALAKHPAA"
FT   gene            complement(145454..146077)
FT                   /gene="msi121"
FT   CDS             complement(145454..146077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi121"
FT                   /product="PUTATIVE TRANSCRIPTIONAL REGULATOR PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31526.1"
FT                   /translation="MYIPPAFRDDDKECLRATIRAALLANFVTVTAEGPLATPLPLFLN
FT                   ENEGEHGVIYGHLAKANPQCRVPPLGDGLAIFMGPDAYVTPAWYATKRETGKVVPTWNY
FT                   VAVHAYGPVEFFEDAGRLLDVVNRLTDHHEGERASPWAVSDAPPDFVQAQLRGIVGLRM
FT                   PITRLEGKRKMSQNRNAADRAGVAAGLAASERASDRDVAALIPK"
FT   gene            complement(146575..147234)
FT                   /gene="nodB"
FT   CDS             complement(146575..147234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodB"
FT                   /product="NODB CHITOOLIGOSACCHARIDE DEACETYLASE PROTEIN"
FT                   /function="cell processes; nodulation"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31527.1"
FT                   /translation="MRRLDDRWEVQSECADGTGRRSVYLTFDDGPNPCFTPQILDVLAQ
FT                   NRVPATFFVIGAYAAEHPDLIQRMIAEGHEVGNHTMSHPDLSKCGLGEVQREVFEANQA
FT                   IMLACPQASIRYIRAPYGAWSEEVLTASEIAGLAALHWSIDPRDWSRPGTDAIVDAVLA
FT                   SVRPGAIVLLHDGCPPDESTRSTQASLRNQTVMALSNLIPALDACGYEIRSLPEHH"
FT   gene            complement(147370..147549)
FT                   /gene="msi123"
FT   CDS             complement(147370..147549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi123"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31528.1"
FT                   /translation="MLVIETIDFADSTERPIGRIQGCSPKEIVDACVGSEEHFLVWSAP
FT                   NIKRADPLFDQVHR"
FT   gene            complement(147735..149204)
FT                   /gene="msi124"
FT   CDS             complement(147735..149204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi124"
FT                   /product="PROBABLE TRANSCRIPTIONAL REGULATOR GNTR-FAMILY
FT                   PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31529.1"
FT                   /translation="MVQSPGPGASTRSHGMGARQIYEALREQILRGVYGTGSQLPSSRG
FT                   LAEELGVSRTTVTVAYEQLAAEGFIDIRQGARPRVASSLLGHELTANPPKRFGPVHLSS
FT                   YGERLRGTPRWPDYLPNTLKVDFRYGVLAPSDFPASVWKRAMNAAMAQRPARLAYDDPC
FT                   GSSRLRQALQGYLWRARTVRCDPEQIVIVNGSQQGLDLCARLLLDPGDSFVIEDPCYRM
FT                   ARQVFASTGATPVPVEVDDHGMQTEQLAGVAARLAYVTPSHQFPLGGVMPIPRRHQLLE
FT                   WAREQGAYVIEDDYDSEYRYDISPVPPLHSLEDHGAVIYLGTISKTLSPMLRIGYLVVP
FT                   AEFLQVFETAKQLADRHSPMAGQESLASLIESGGYESHVRRVRRINGERREALLTALKR
FT                   SFQGRIAVQGAEAGLHVVIWFNDLPRSRETALVEAAQYAGLGLHPISPLYHRQSGAGEA
FT                   DRVGLVMGYSALSIRQIEKGVEMLRDVVARL"
FT   misc_feature    149451..149676
FT                   /note="TWO FRAMENTS SIMILAR TO M. LOTI MAFF303099 MSL6173
FT                   AND OTHER GENES CONTAINING PFAM01053 MOTIF CYS/MET
FT                   METABOLISM PLP-DEPENDENT ENZYMES"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(150104..152125)
FT                   /gene="nolO"
FT   CDS             complement(150104..152125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nolO"
FT                   /product="PROBABLE TRANSFERASE, NODULATION PROTEIN NOLO"
FT                   /function="cell processes; nodulation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31530.1"
FT                   /translation="MLCLGLSGGLDKVYENRFQIANTFMHDGAAVLVRDGQVIAAVEEE
FT                   RLNRIKHSNKLPISSVQYCLSAAGVQLSEIDHVAYYATETYCNAMLENMLASEPNASIP
FT                   LDAKFLVQQLLAQEFGSELDPSRISFVSHHQAHAVSAFAMSGFEQSLIFAIDGSGDFQS
FT                   GLVAVGSGAEISQLATFPENNSLGLFYLEVIRYLGYGLFDEYKVMGLAPYGDPVPYREL
FT                   FEQFYELSANGEYRVHLDRIGPTLLRTIQVRQKGMPFTQQHKDVSASLQEALERIVFHI
FT                   LRHHREATGMTRLCLAGGVAHNCSMNGKLLYSGLFEDIFVQPASHDAGCALGAALIVSG
FT                   ELGRPAPRARLQEVYWGPDLASDHAVEEELKAWAGHLEFERTEAVADRAAEWMAGGAVI
FT                   GWVQGRSEFGPRALGNRSILADPRPATNKDRINAMVKKREGYRPFAPSVLEEDAREFFD
FT                   LPGSACEFPFMNFVVRVRDSKRGLLGAITHVDGTARLQTVSRKASPAYWDVINAFKQRT
FT                   GIPILLNTSFNNNAEPIVDSVADSIATFLTTGLDGLVVGPFLVKKRATTLEDWTALAVS
FT                   LPPYVSLYKVRAHTALDRQETVCEIRTDHSSRDGVRISHDLFDLLTRIEGEAVLADLLD
FT                   TITLDQAQREALTGELRRLWEQRRVRMRPSQAARVDQN"
FT   gene            complement(152430..153218)
FT                   /gene="nodJ"
FT   CDS             complement(152430..153218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodJ"
FT                   /product="PROBABLE NODJ MEMBRANE TRANSPORT PROTEIN"
FT                   /function="cell processes; nodulation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31531.1"
FT                   /translation="MIEGFAAALPANAWNWVAVWRRNYLAWKKVALVSLLGNLADPMIY
FT                   LFGLGTGLGIMVGRVDGASYIAFLAAGMVAVSAMTASTLETLYAAFARMHSQRTWEAML
FT                   YTHITLGDIVLGELAWAATKAFMAGTAITIVTATLGYAAWPSVLYALPIIALTGCVFAS
FT                   LAMIVTALSPSYDYFVFYQTLVLTPMLFLSGAVFPLNQLPGAFQQIARCMPLSHAIDLI
FT                   RPVMLDHPISGIALHVGVLGLYALLPFFLSMALLRRRLMR"
FT   gene            complement(153222..154289)
FT                   /gene="nodI"
FT   CDS             complement(153222..154289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodI"
FT                   /product="PROBABLE NODI MEMBRANE TRANSPORT PROTEIN"
FT                   /function="cell processes; nodulation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31532.1"
FT                   /translation="MISGGRVLSQDQKHQVLKRKLGPEDLRRFETPAIEREFHGQTSAK
FT                   SSVPDSLSTVAVDFAGVTKSYGNKIVVDELSFSVASGECFGLLGPNGAGKSTIARMLLG
FT                   MTCPDAGTITVLGVPVPARARLARRGIGVVPQFDNLDQEFTVRENLLVFGRYFGMSTRQ
FT                   SEAVIPSLLEFARLERKADARVSELSGGMKRCLTMARALINDPQLIVMDEPTTGLDPHA
FT                   RHLIWERLRALLARGKTIILTTHFMEEAERLCDRLCVLEKGRNIAEGGPQALIDEHIGC
FT                   QVMEIYGGDPHELLSLVKPHSQRIEVSGETLYCYAPDPDQVRTQLQGRAGLRLLLRPAN
FT                   LEDVFLRLTGREMEE"
FT   gene            complement(154294..155568)
FT                   /gene="nodC"
FT   CDS             complement(154294..155568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodC"
FT                   /product="PROBABLE NODULATION PROTEIN C,
FT                   N-ACETYLGLUCOSAMINYLTRANSFERASE"
FT                   /function="cell processes; nodulation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31533.1"
FT                   /translation="MTLFATASTVAICSYALLSTVYKTAQVFYTLPTNVPPTSGDPPGG
FT                   EPWPSVDVIIPCYNEAPRTLSDCLASIASQEYAGKLQVYVVDDGSANRDALVGVHEEYA
FT                   GDPRFNFIALPKNVGKRKAQIAAIRRSCGDLVLNVDSDTILAPDVITRLALKMQDQAVG
FT                   AAMGQLAASNRSETWLTRLIDMEYWLACNEERAAQARFGAVMCCCGPCAMYRRSALVSL
FT                   LDQYETQRFRGKPSDFGEDRHLTILMLKAGFRTEYVPEAVAATVVPNSMGPYLRQQLRW
FT                   ARSTFRDTLLAFQLLRGLNIYLTLDVIGQNIGPLLLSLSILAGLAQLVTTGTAPWTACL
FT                   MIAAMTIVRCSVAAFRARQLRFLGFSLHTLINIFLLLPLKAYALCTLSNSDWLSRSSAA
FT                   NVTDTGGTSSKPNLVGSDAAYSEQQ"
FT   gene            complement(155624..156220)
FT                   /gene="nodA"
FT   CDS             complement(155624..156220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodA"
FT                   /product="PROBABLE NODA N-ACYLTRANSFERASE PROTEIN"
FT                   /function="cell processes; nodulation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31534.1"
FT                   /translation="MRPDVQWRLCWENELQLPDHLELSEFFRKTYEPTGAFNGKQFEGG
FT                   RSWAGARPELRAIGYDVHGVAAHMGVLRRYIKVGDVDLLVAELGLYGVRPDLEGLGIAH
FT                   SISVMYPVLQQLGVPFAFGTVRQALRNHVSRFCRKGLANILTGVRVRSTLPDVYSDLPS
FT                   TTRVDDDVLLMVLPIGRSMSEWPAGTLIDRNGPEL"
FT   gene            156579..156833
FT                   /gene="msi130"
FT   CDS             156579..156833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi130"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31535.1"
FT                   /translation="MAIAQLWIAGGKQVPRSSIALANRNRLVNAFECCRSTGLSVKAPG
FT                   EREGARPDGATSNELFEVLADWNTQLEHLRPEVRKGAGP"
FT   gene            complement(157450..158058)
FT                   /gene="nodS"
FT   CDS             complement(157450..158058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodS"
FT                   /product="PROBABLE NODULATION PROTEIN S, METHYLTRANSFERASE"
FT                   /function="cell processes; nodulation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31536.1"
FT                   /translation="MTHKIDHELLNREMAADDPWRLDGNPFERERHTQILRLSLAQGRV
FT                   ANALEVGCAAGAFTERLAPICQRLTVIDVVEPAITRARLRMKETPHISWIISDVQQFSS
FT                   DELFDLIVVAEVLYYVGDLDQIRAAVRNLVSLLAPGGQLVFGSARDANCQRWGHAAGAE
FT                   TTIAMLNESLTEIECIECRGASINEDCLLALFRKPISAS"
FT   gene            complement(158659..159840)
FT                   /gene="msi132"
FT   CDS             complement(158659..159840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi132"
FT                   /product="PUTATIVE OXIDOREDUCTASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31537.1"
FT                   /translation="MAGRDDSFDIIVVGAGPVGLSFAASLAHSQLKLAVVEGQSLERLA
FT                   SPAFDGREIALTHASIGILRELGAWDVISASDKSPLQGARVLNGSSPFALCFDSPGGSA
FT                   EPLGVLVPNCQIRDALFKIIRLQGHARLLCGHSVVRATNSRQGAMITLSTGRQLSARLL
FT                   VAADSRFSATRNLLGIGADINRLGNSMLICRVRHERPHHQIAIEWFDHHQTVAMLPLAP
FT                   GVSSLLLTLPSNEADGLLALDDELFLRELTKRCRGRLGNMSLASQRYIYPLVTTWAHRF
FT                   RAPSAALIGDAAIGMHPVTAHGFNIGLGGQKQLARGIETAWRDRRDIADPDMLHRYESR
FT                   LRLSAAPLYHATNILVGLYLSEHPAARLARHVGLRLGQHLPFVRHGIAAMLRR"
FT   gene            complement(160113..160421)
FT                   /gene="msi133"
FT   CDS             complement(160113..160421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi133"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31538.1"
FT                   /translation="MLRRIAVRIPTYLSDIRENPAWLPMFVLARTMPARRMHWRGAKPV
FT                   RVSQKAHDTMFAGVDRQEIVEALRSDGLFCGLVLPTFIHEEIAAFARYVIRRRLGLD"
FT   gene            complement(160468..160620)
FT                   /gene="msi134"
FT   CDS             complement(160468..160620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi134"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31539.1"
FT                   /translation="MPGAREPSPLFLRQAQAVSAIRLRPLARAACRLLTVAALSAGAVC
FT                   LLAEP"
FT   misc_feature    160938..161594
FT                   /note="GABD FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(161797..164943)
FT                   /gene="msi135"
FT   CDS             complement(161797..164943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi135"
FT                   /product="PUTATIVE DNA METHYLASE PROTEIN"
FT                   /function="macromolecule metabolism; macromolecule
FT                   synthesis, modification; dna - replication, repair,
FT                   restr./modif."
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31540.1"
FT                   /translation="MSLGAAGLTPITPAAFIKKWRKSELGERQAAQEHFLDICSLVGHP
FT                   SPSDEDPTGAFFAFEKGANKLGGGKGFADVWKKGHFAWEYKRKKGNLDEALLQLMRYAP
FT                   ALLSPPLHIVCDIERLRIHTAWTNTVPSTYVITLDDLAEPSAREMLHNVFFSPEKLRPT
FT                   RTRAAVTKEAADKFSAIALRVQGRGTPDEIAHFVNQLVFCFFAQSVSLLPDGLFTKLLK
FT                   RSARAPERAMSYLDKLFEAMERGGEFDLTDITWFNGGLFDGRRALRLDDGDIGLLVAAD
FT                   SLDWGLIDPTIFGTLFERFLDPEKRAQIGAHYTDPEKIMRLVDPVILRPLRQEWEQARR
FT                   EIVELLNGNRKPPMRRQQSRRMKREEAAAEVRSRFTERLRKLRILDPACGSGNFLYLAL
FT                   QGVKDIEHRANLDCEMLGMPAQLPLVGPEILRGIEINMMAAELARTTIWIGDIQWQIKN
FT                   GIRSKSIPILRKLDAIERRDALVRQAQDVDTARDAQGDLLAALQPVSEDAEAEWPEAEF
FT                   IVGNPPFVGVRLMRQALGDPTVDRLFDVYDGRVSREADLVCYWVEKSRAAVAADRTRRV
FT                   GLVTTNSIRGGANRRVLDRIIAESRLFEAWSDEPWVVDGAAVRVSLICFGHGEDPLCLD
FT                   GRTVAQINADLTAGVTDLTKARRLSENQNVAFMGDTKGGAFDVPGSLARAWLSMPMNPN
FT                   GRPNSDVLRPWRNGMDVARRGRDMWIVDFGWEMSEQEAALYEAPFQHIREHVFPERSKN
FT                   RRDAYRERWWRHVEPRPAFHASLQGHSRYMATPRVAKHRTFVWLDQAIVPDSRIFAFSR
FT                   SDDVFFGILHSRFHEAWSFGTCSWHGVGNDPTYNSAGVFETFPFPEGLTPDIPAVRYEK
FT                   DSRAIAISKAAKRLDDIRNAWLNPSDLVQIKPEVVPGYPDRILPKDIASDAILRDRTLT
FT                   NLYNRRPQWLVDAHSDLDAAVAGAYGWPADISEDEALANLLELNLAREAFNEHAKSGLK
FT                   TRKPRRRPTPEEVRRAPQMKLPIAGGRKSVVGPQQLTTKDRENQPTSAERPRNTKRRTS
FT                   "
FT   gene            complement(165301..166326)
FT                   /gene="msi136"
FT   CDS             complement(165301..166326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi136"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31541.1"
FT                   /translation="MVALNEPGGASVGYEKKGYARGLILGLTMAETMLLLVFCLLLVAG
FT                   AIVAKKKAELETALERVSRSEAVVQQLKQENKNLLAQVAELMERFTGHKVPDEEWRKLV
FT                   LAKKAIEQIEQKGLSADEAVQLAEATVAVRDNNLSADDVRKLVSADQRATEAERKLAEA
FT                   EKELAETTRQPKDLPPIINLSEAKGYSFEVSSAELKPAFKAKLEGAIAEQIADIVAKYD
FT                   VDVVEVIGHTDEQRLSRQSNMDFVLGRVLSGDESVSEMEPGDNAGLGLARAISVASVLK
FT                   KIPAFDHLNILPMSGGQLILPDDRLTDGAQSGDAPERRRIEIRVRKSKQKLAAEGHHEG
FT                   N"
FT   gene            complement(166314..167576)
FT                   /gene="msi137"
FT   CDS             complement(166314..167576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi137"
FT                   /product="HYPOTHETICAL TRANSMEMBRANE PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31542.1"
FT                   /translation="MAARRQSFLDTWIFPQAFYIALTVGGCVFIAVTKTAGISPVISST
FT                   VPIGIMIGYFAFSWYVGKLRVHDEQTGDNLYYMGFLFTLSSLGTSLYQFGTDASTDEIV
FT                   RNFGIAVTSTITGIALRIFHNQVRRDPADVERAARHELADMTRRVRTEMESVAREFADF
FT                   RRVCNQMLEEGFDEIARQAEKNGDQVRQAFEGMAAKAIKPVQETSEKIAKSLDDTFGRI
FT                   ESRFSGVAEKVDTVAASLDTANASMAGTISKFEAQADIVAGKLANVVIPDEVLKTDVVT
FT                   VLKVLAASVGRFTERAEALSKEQGERTDKLSDTVLRMAAHQKLLLERLEKQAEQNASTT
FT                   NLLSRILDRDRVSVPHEIPPVAPLHANEPSVEPPIFIPISAATAQGEKPGATATANGAD
FT                   AGQQASQPIVEKVQPRPRWWR"
FT   gene            complement(167580..168413)
FT                   /gene="msi138"
FT   CDS             complement(167580..168413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi138"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31543.1"
FT                   /translation="MARPRSRRRAGSSRGKGVGAIVGAILLGLASLAMFSGYVWLNVKA
FT                   RDVLETDAKTGCPTKAGPNSVTAVLFDTSDPVPQATMEDLANKFRQIAGSIKQGGYLWV
FT                   GTLTAVPGDLKELYARCNPGDGSTVDVWTSNPGKHQRIWEEAFDKPLKELPEHLPADSQ
FT                   ADQSPIMAGIQKLKLSLFDNGMFDNVPKRLVLVSDMMENTPAYSQYKAGADYNAFKKSP
FT                   ANSRFRTDLLGADVTILYFNRPERKFPSVDHANFWTQWFSENGGNLSDFTKLEGM"
FT   gene            complement(168400..169893)
FT                   /gene="msi139"
FT   CDS             complement(168400..169893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi139"
FT                   /product="HYPOTHETICAL TRANSMEMBRANE PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31544.1"
FT                   /translation="MPQACVFQGWIVGVKTLVARFEALEKLRNRIMEANHDYRVGADIF
FT                   PSLNVDKIARDMDLDDQGTAHGEKDQPSSSSKALDEVEHSIVERVQDEKKAAHQILEDQ
FT                   LHLFSGRVANLGLEEQFGLLQQANTSSLSDFKGEIAVGLDTLHAKRTDLHEATTELSSF
FT                   RKNHRLERVARLQQGTAHLFRVALLIFLLLVETYLNGSFLAKGNDQGFLGGATEAFAFS
FT                   FVNIVSALIFAIFCVRWVTHRSWGGKLVGTVFILLYAAIALGINLLLAHYREVSGTLAD
FT                   GAGNIAVQRMLHNPLGLEEVRSWMLFLVGLLFSIIAFIDGWFVLDPYPGYAGVEKRRRE
FT                   RRQDYTDTKADLIDRLIELRDDHNTKVEDILKGLSSRRREHAAILSSRARLLALFNEHQ
FT                   EQLERSCNQLLSKYREANIRARKTPAPKHFSQPFKLQKTKPIVQNDGEIKDSDLASSIA
FT                   AAQQALNEQMLQVGKECESGIEKYRDLDKLYPETLDGQA"
FT   gene            170308..171081
FT                   /gene="msi140"
FT   CDS             170308..171081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi140"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31545.1"
FT                   /translation="MGRSRAWRRASVPLKLVFLTVAAATALATQSAMQHTDRIPDIGVS
FT                   NWFGSKPEPIAGVASVIDGDTIEVHGQRIRFNGIDAPESKQYCSDAKGFDYSCGRRSAD
FT                   ALDAFLAASRPVHCTFVTWDRYHRFVGDCQRADGVSVASWMVEHGQALDWPRYSHGAYS
FT                   AQQAKAEAAKLGLWLGTFQAPWEWRAVHAGDARPSSQPLGISSRPQVAQSFSCQPRRTC
FT                   SQISSCDEAQWYLNNCPWGGKLDRDGDGIACETLC"
FT   gene            complement(171365..172096)
FT                   /gene="msi141"
FT   CDS             complement(171365..172096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi141"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31546.1"
FT                   /translation="MGANRLSLTKARDGPPNEKGVQMTQSQLSKVWFVFSALLLYYTLN
FT                   SWVVAQGGEEIFGAKLVMKARVPAVMIAIPICSILLALTSLVGRVYAPRGGSHWHARIP
FT                   VVGFDAIETGSREGRVYQGAMIVVFSVLPAIALVYFWCTFLSATVMLNDGKKDPGASLW
FT                   DWSELRTLNDPARICTEFDKGLDKPCIGSATVLPGLEPTIFGALTLAGIIALAMHWRAV
FT                   AMGQRHEASPITTQGKQESAD"
FT   gene            complement(172139..173812)
FT                   /gene="msi142"
FT   CDS             complement(172139..173812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi142"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31547.1"
FT                   /translation="MSMTARTRPDTKLRVAHFAAAARRFAPGLLILVGVSGCEKNLFQA
FT                   PPHGGTADVPPAPVSDSVLTLLAQIPYETLVQAAQSKIPQSVPVQGDGQIGCVGIPHIN
FT                   PGHVGHHTECRWIGVRICAEVPDITAPSLGTTNQCAEYHWHADIKTDGPLVVAQAGNGV
FT                   HVEQPLFVSGQAGVGGDLAKLLSLSGKNFEARLVPGVDLQLDMNDKWCPVLTGTPTGRW
FT                   VSSASVEVVGKNCLGFDFGSLGHPEVCAGPINLGLADVLNGQINDHRAKIQDAITKALP
FT                   CGALRSKVEAQWHAIAIKIDRPDSTPVYLNIVPTAASFSGLVGEAQGMKMTVRVAAKTS
FT                   LAAEPVATQSLSLPPLGKTSADRSQADITVQAAAPYGLLLDELSKNLKGRDFQQQTPAG
FT                   AVDVKVEDVDLYPSASSVVVGLKVQAKLPGEFLNTTGWVYLSGLPRVEKTGTAISINEL
FT                   HFATVLDNAFWKAAQSLFETQILADLEAHSRVDLNKQFNDASDEILKAVHNTNVPGLKI
FT                   SADTPSIELLDITVGPKNLIASARLKMNFDMALSADLVGQ"
FT   gene            174230..176314
FT                   /gene="msi143"
FT   CDS             174230..176314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi143"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31548.1"
FT                   /translation="MVTTNLFDERRRAVMIAAAKRWKAQPPTPATTQVTPSEQARYDAR
FT                   RSSFDQASELKAQGRLPVFVERKMGPTLDWYTLPPDDAARAAGRPVARIVANVDPKVDP
FT                   VGFATGFMVSPNVLLTNWHVFPDPGSVRGTGANFLHDETASGVARGIIFEFDPDALFFS
FT                   AEDLDFALVAVKPKAITGELLSSVNFLAINGSRSKILPGMPIRMIEYPDGGPKRYAMEN
FT                   CRLLELREDGFLRYETDTEEGSSGSACYSEMWEVVGLHHASIPKMRGNTILNKDGSAWS
FT                   PGQPDDGIDWIANEGVRISALVKAFGGLVPTTPASKHLLDELLANTTDPTDEVAKLATP
FT                   RAPEALSPVLPDPSKIFANTKGNVMGGVTMNFSGPVTIFVGSGVPASQLPQATAAVATD
FT                   EALEKALRFDPNYDDREGYNPDFLENDITVPLPRISQERDQEMYKENGQIVVLKYHHFS
FT                   LAMNASRRMQMWSAVNVDYDASKRTSSGRAFFGQDRWVFDPRIPQKYQLGDPDIYAPAK
FT                   QIDRGHIVRREDNAWGDAPTEIEFANSDTFHFSNCTPQHAAFNRSQPGKQWPGVQGLWG
FT                   GFENHIQRDLQSGDTRACIIAGPILHPNDPSEDFGTGPVQYPLVFWKVVAVSTRDTNGR
FT                   RSLRTYGFRLSQKDVVDRFGVEFAPGEYARYQVALSAISDEAGVIFDDVLLRADTHADA
FT                   "
FT   gene            176543..177079
FT                   /gene="msi144"
FT   CDS             176543..177079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi144"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31549.1"
FT                   /translation="MNRTHWAIKDVNLPKELHAARGIALPSWTRQASRAVDITQHHFDV
FT                   GLSFPGEARGLVEQVARELEASLGPNAYFYDNNYVSQLARPSLDTLLQDIYRNRSKLIV
FT                   VFIGADYQRKDWCGVEFRAIREIIMARDEQRVMYVRVDDGAVDGVFRTDGYVDARRFNP
FT                   AEIAQFITERLALIA"
FT   gene            complement(177076..177831)
FT                   /gene="msi145"
FT   CDS             complement(177076..177831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi145"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31550.1"
FT                   /translation="MNAQELLDKIKELPNKPVDVPTPPAIELVAMVVRWGRHLKQWKAT
FT                   TLADFARVSLSTVERVERAKKVSDEALDRIAQALGHAPGAFTTPRLPIGPDKAAEQHLV
FT                   EAFGHLEPVAVSPMKTHKAIRDAAKCDAYLIHRPGVPDTHDDHIANLGEWLDLASFILS
FT                   DIVEEPLSSGRGRRQLYNDILAAVSELERRGLTVLSGVMAAPQPGMPDWKVAIVSVTPR
FT                   LTDPGAPRRRRVLVDRRTVAVTPGWLTDD"
FT   gene            complement(177901..178875)
FT                   /gene="msi146"
FT   CDS             complement(177901..178875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi146"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /note="predicted by FrameD"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31551.1"
FT                   /translation="MSPLVVAPVEEDGGSQCRSTCDDFVEVGSKGVTLEYEPHFGGNAW
FT                   VTRELKAAGKVTLSRVFFFRSSDLVAETAHGAAHDDEADEDDRPLYRFRFATTKDGYHR
FT                   IPGRILGIDNDVLIVAEGIAPDRKVFVAERNISIFRRIAKLKPGSEIVVGGDRVDSIAV
FT                   EAFGELLEIRLYRGNSVPTKELSGTIMQAEKYLFHLSKWGVEGERELSKRYGSALPAGL
FT                   QIRVTNPKALLLLGRDRRTDGTGGLTENQSFDLEVIKRKYVNMMDIVPYDDLLRRLDRI
FT                   IVSLTERAGSAGLGQRADKRGTDRRDSTDRCAGGGDASGADAC"
FT   gene            complement(178847..179545)
FT                   /gene="msi147"
FT   CDS             complement(178847..179545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi147"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31552.1"
FT                   /translation="MTVRGQLLLMLQTVAEALGEDFRERLVFVGGCTTALFITDEVTLE
FT                   DVRATDDVDLIVDLAGYGEWAQLREELRQRGFAESPEDNVICRMRLRDLKVDFMPDDAG
FT                   ILGFTSHWYAAGIETAVTHELTDTLRIKKLSPELFVATKLEAYLGRGAGDLFMSRDMED
FT                   ILLIVDGRPEIVDEILAAEAEVHRFIAEQFTVLLQNGDFEYFLEGNVRGPAGRTDIVRD
FT                   RFVAISRGAG"
FT   gene            complement(179542..180120)
FT                   /gene="msi148"
FT   CDS             complement(179542..180120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi148"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31553.1"
FT                   /translation="MIGMKSQDIVVLLKLVSLQEQGEFAGHGEQRRGFAGEDPFSVRGL
FT                   ESLTGISKTEINASLKRSLSSGLAIKDRDTGRANPHRRNLYEFIVHGLKFVFPAKAGAM
FT                   TRGIPTAFAAPMLKGLLVSGGEYIHIWPYAQGRDMGQSVAPLFKSVPEAVQKDERLYEY
FT                   LALVDAIRLGNQRQAGLAGQRLSERFLKK"
FT   gene            complement(180597..181571)
FT                   /gene="msi149"
FT   CDS             complement(180597..181571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi149"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31554.1"
FT                   /translation="MTLSSPDKSGAASLEAIARNGGVLRRIAVRIPTYLSDIRENPAWL
FT                   PMFVLARTMPARRMHWRGAKPVRVSQNAHDTMFAGVDRQEIVEALRSDGLFCGLVLPTS
FT                   IHEEIAAFARYTPCFGNFDRRLEFMAEDHAEAEKRFGRSLLSGHFFEHILGCKAAVAIQ
FT                   NDPLLLDIAAHYLGAQAKLITTRVWWSFPTGQASDADKNRASLGKYHFDLDDWRMLKFF
FT                   FYLTPVDEGTGPHVYVRGSHNRRAIKHQLTLLVGHPAQEVLKVYGDDSPVTLTGEAGLG
FT                   FVEDPFGFHMGTVPSRTPRLMMEVGFGVSPPSRRRFHGEPVIR"
FT   gene            complement(181815..183545)
FT                   /gene="msi150"
FT   CDS             complement(181815..183545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi150"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31555.1"
FT                   /translation="MQLAHIPLDKLNISALNMRHSKRAPDVSDILPSVRARGVLVPLLV
FT                   RPNGTPESFEIVAGRRRYFAAKSLADERGQRNALPCAIMEDGDDADALEASLIENFARL
FT                   DPDEVSQWETFSRLIREGRTIPDIAATFGVTELLVKRILALGDLLPKIREAYRREDIDA
FT                   ETARHLTMASKGQQKDWLALYADPEQYAPQGHQLKQWLFGGQSISTKMALFAIEDYPGL
FT                   IVCDLFGEDSYFADADLFWQKQNEAIAAKRDAYLEAGWPEVAVLEPGQHFQSWDHEKTP
FT                   RKKGGKVFISVSHRGAVECHEGWLSRKEARRARAQGEGGEPDETPARPSRPELTGPMQN
FT                   YVDLHRHGAVRTAMLDHPDVALRLMVAHAIAGSGLWQVRREPQRTANEAVAASIAASRA
FT                   EAVFAEKRRAVLALLGQPDEEGAIAGGNGDAFALAAVFARLLALCDDDVMRVLSLAMAE
FT                   TLEAGSAIVEALGNHLGIDMGAWWQADDAFFDLLRDREIANAMLADLAGKPVADGNVAE
FT                   KVKTQKKIIRDCLSGENGREKIDNWLPNWMKFPVESYTKRGGFRTADQWASVQPLFVRQ
FT                   "
FT   gene            complement(183623..184042)
FT                   /gene="msi151"
FT   CDS             complement(183623..184042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi151"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31556.1"
FT                   /translation="MILITDELCARLLANGATDTETDHVPVVKLFDPTGPATWLLTELD
FT                   ADGDTLFGLCDLGFGFPELGSVSLAELASVKGRLGLGIERDLGFKAEFPLSVYAQAACS
FT                   AGHITEAERLLRQAAEALGNAHSKLPPDTAEQTRR"
FT   gene            complement(184246..185208)
FT                   /gene="ardC"
FT   CDS             complement(184246..185208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ardC"
FT                   /product="PROBABLE ANTIRESTRICTION PROTEIN ARDC"
FT                   /function="cell processes"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31557.1"
FT                   /translation="MRAKHQRSGSREAGAGRGGRPGASLYQEITDRIIAELERGTVPWV
FT                   KPWGSAKADLGLPSNAATGRRYSGINILILWGAVIERSYPGQNWLTFRQALALGGNVRK
FT                   GERGTTIVHADRFVPKGEQERARTDGDEPQAVPFLKRFTVFNVAQCDGLPAHLYRNVEP
FT                   LPEREIIPQAEALIRASGADFRIGGDRAFYMPGSDTIQVPPQPAFFQQIDYYRTCFHEL
FT                   GHWTGHPARLARDLSSAFGSKAYAREELVAEITAAFVCSTLGIEPSVRHADYIGAWLTM
FT                   LREDNRAIFRAASLASKAADFLLGFNAEAQGAQQDEIAA"
FT   gene            complement(185633..186601)
FT                   /gene="msi153"
FT   CDS             complement(185633..186601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi153"
FT                   /product="PROBABLE OUTER MEMBRANE SERINE PROTEASE PROTEIN"
FT                   /function="macromolecule metabolism; macromolecule
FT                   degradation; degradation of proteins, peptides,
FT                   glycopeptides"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31558.1"
FT                   /translation="MKLYAKVFGGAAALLAAWPAMASDAVASEPAPYNPNFSFVGGVGV
FT                   IDIEANELVYQAPGSGSKLSHLIWESTSAVISAEMTARSEAGWTAKLSGQIAFSGNSYM
FT                   EDYDWIPPFSTNDGWNDWSDRSRHSDTDLDYFYSATVALGHDFQVSDQLLINVNGGFKY
FT                   TSVKWTAYGGSYVYSVAGFRDSVGDFPGDAKAISYQQKLPVAFAGIDATYVQDRWNFGF
FT                   ALKGGTTFSAGATDHHWMRDLRFEDDFEAAPVLMVGGSVGYQYNERTSFFVSGSYEKVF
FT                   TARGDYNTYDIATGAETGGEDDWIGGDFAAATVMVGIKTSF"
FT   gene            complement(186939..187394)
FT                   /gene="msi154"
FT   CDS             complement(186939..187394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi154"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31559.1"
FT                   /translation="MPSISTRRANATDAGTVVRFIHALLDELTGGKAPAPDDVRQSAQI
FT                   MLADAGVVAVIASADDEPVGIMVLNECTAIYAGGKFGYISELYVRPEKRSKGIAPHLLE
FT                   VASREGRARGWKRLELAAPRQPKWKRTLDFYLRNGFEELGPRLYRII"
FT   gene            complement(187586..187744)
FT                   /gene="msi155"
FT   CDS             complement(187586..187744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi155"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31560.1"
FT                   /translation="MSSLLDCIVRAFWPHEHLRLHLLSQALFDLQLHLTSARGFTVQLR
FT                   CDRVDFL"
FT   gene            complement(187784..188899)
FT                   /gene="ltaM"
FT   CDS             complement(187784..188899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ltaM"
FT                   /product="PUTATIVE LOW SPECIFICITY L-THREONINE ALDOLASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31561.1"
FT                   /translation="MDETSVKTMSDSKQTRPRGFTSDNIAGVSPEVIAAITACASGQAL
FT                   PYGNDELTHTVERQLAEVFEHAVDVFLVSTGSAANALALAAITPPWGSILSHADAHINR
FT                   DECGAPEFYTAGAKLVQLPGEAGKIAIDALAANATRMVGDIHSVQPSSVSITQATEMGS
FT                   VYALDEIRAIGHICRSANLPLHMDGARFANALVTLRCSPAEMTWKAGVDLVSFGATKNG
FT                   TFGVDAVVSFRRDLASTIAFRRKRAGQLSSKMRFMAAQMDGYLRDGVWLRNAVHANAMA
FT                   SALARGLALVPGVKIQQRPEANILFCRLPTSLIRGLLDMGFRFYHDRWEPGIVRFVTSF
FT                   ATTEADVSDLIGAATSLCAPVGSARVPAGAE"
FT   gene            complement(188947..189822)
FT                   /gene="msi157"
FT   CDS             complement(188947..189822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi157"
FT                   /product="PUTATIVE TRANSCRIPTIONAL REGULATOR ARAC FAMILY
FT                   PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31562.1"
FT                   /translation="MADTAVECDEKARGRSEPPGRPPRNRAVMKHSDVLGGLDYLAADY
FT                   HRQDFSKHIHNEYLIGLIERGVHDVWCRGEVWHAGSGTVATFAPGEPHFGGAGDDLGWS
FT                   QKIFYMPEGLVRQVLEDSSQTEPGTIDFKSPFQENAPVAHGLSAFWRLLEHEHSSALEI
FT                   EEHLIRFLRRVFAQVGGSRVAGPKFVPPRFRDVRDFIHAHFDEVLQLAALAALAGCSKA
FT                   TLIDGFKAHFGLPPTRYLIQVRIDEARRLLRRRQQVAEVAVAVGFADQSHLTRHFKAVL
FT                   GVTPARYLSV"
FT   misc_feature    190069..190353
FT                   /note="TRANSPOSASE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            190586..191278
FT                   /gene="msi158"
FT   CDS             190586..191278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi158"
FT                   /product="PUTATIVE OUTER MEMBRANE PROTEIN"
FT                   /function="structural elements; cell envelope; membrane,
FT                   outer"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31563.1"
FT                   /translation="MARARIGVARAMTAAVVLIVAGQAGAADVGQAASVPQAEACVAEA
FT                   PSPWQIRLRALGVITEDSGYVNAVPGSGLSYSNTVTPELDISYFFTDNIAAELILGTTY
FT                   ANIDGQGAIGGLGKVGKVWLLPPTLTLQYHFTDFGAFEPYIGAGVNYTIFYHQQAGSAD
FT                   DLKVKNTFGAALQVGFDYMVDEHWGVNFDVKKLFLKPDFDVTVAGAKLTGKAKLDPWLI
FT                   GAGLTYRF"
FT   gene            191375..192607
FT                   /gene="msi159"
FT   CDS             191375..192607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi159"
FT                   /product="PUTATIVE MONOOXYGENASE CYTOCHROME P450 PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31564.1"
FT                   /translation="MRVENDHCDVIGVPAAPTQLDRLSSAILRQGGMARVSLPGDVVTW
FT                   AAARHQTLRQMLSDQRFNKDWRQWRALQDGEIPEDHPLIGICKVDNMTTAHGADHRRLR
FT                   GLLSSSFAPSRIALLAPRIEQCVDRLLAEMAQRGGSADLMCEFAAPLPTNVIAELFGLP
FT                   DEQREEIVALTYSLANTSATAEEVRQTRQRIPEFFRRLIALKRGQLGDDLASALIVARD
FT                   KGELVSDTELIDMLFMVLSAGFVTTAGVIGNGVLALLTHPQQLHLVRSGQVPWSQAIEE
FT                   ILRWGSSAANLPFRYATQDVEIDGCMVRRGDAVLMAFDAANGDEKAFGPGADRFDVTRR
FT                   HNPHLSFGEGPHSCLGAALARLELRCAFPALFGRLEDLALTIAAEDVVYMPSYVIRCPQ
FT                   RLPVSFRPSVA"
FT   misc_feature    192604..192958
FT                   /note="CYTOCHROME P450 FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            193379..195787
FT                   /gene="metE"
FT   CDS             193379..195787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /product="PUTATIVE
FT                   5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE--HOMOCYSTEINE
FT                   METHYLTRANSFERASE, METHIONINE SYNTHASE, VITAMIN-B12
FT                   INDEPENDENT ISOZYME PROTEIN"
FT                   /function="small molecule metabolism; amino acid
FT                   biosynthesis; methionine"
FT                   /EC_number="2.1.1.14"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31565.1"
FT                   /translation="MPPARAFLVPTPQPSGYGMTVSQQIPVATLGVPRIGRRRELKFAL
FT                   ESYWSGKSPAADLLATAKALRAASWREQHDRGVSKIPSNDFSLYDHVLDTVAMVGAVPA
FT                   RYVWTDGEVPLDTYFAMARGNQDQAADCGHAGDEHAANGHGLAAMEMTKWFDTNYHYIV
FT                   PELTDDQSFALSSAKPVDHFLEAKALGIHTRPVLLGPVTFLKLAKSPEEGFNPIALLPR
FT                   LLPVYEELLRRLKLAGADWVQIDEPALVVDLVPNERDALQFAYCRLSKAAPELKIMVAT
FT                   YFGSLGDNLETAISLPVAGLHVDLVRAPEQLETVGRLAQKDLVLSLGLIDGRNVWRANL
FT                   PAMLDRIKPIVAGWPRDRVEIAPSCSMLHVPIDLDMETALDADVKSWLAFAAQKTDELV
FT                   VLARALAEGRDAVAAELEASAEAAAARATSAKVHDPLVEGRVASIKVAMTRRKSAFDVR
FT                   SKLQGDTFGLPSFPTTTIGSFPQTAEVRKARAAHAKGELSYVDYEAFLKKEIEAAVRWQ
FT                   EEIGLDVLVHGEFERNDMVQYFAEQLRGFAFTQHGWVQSYGSRFVRPPIIIGDVSRQQP
FT                   MTVHWWRYAQSLTPKPVKGMLTGPVTILNWSFVRDDLARSAVCRQVALAIRDEVSDLEK
FT                   AGAGMIQIDEAALREGLPLREAEWQAYLDWAVECFRLASTAVGDATQIHTHMCYSEFGD
FT                   IVDAIAAMDADVISIETSRSQMELLDTLRTFKYPNEIGPGVYDIHSPRVPEVGEISNLI
FT                   MLARDRLLDGQLWVNPDCGLKTRRWEEVRPALVNMVAAARAIREKARTA"
FT   gene            196274..196639
FT                   /gene="msi161"
FT   CDS             196274..196639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi161"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31566.1"
FT                   /translation="MAPSPLAAITITATAKPSGRSWLADPCVLMVEDQAPDQESRRGKS
FT                   GVGLLLADAGRGIRTALNRDAQMAEIHERRPKSQSLRRMRASSAAATKARRAAGGWVLP
FT                   RNTCRQVSIAILRLSVA"
FT   gene            complement(196808..197014)
FT                   /gene="msi162"
FT   CDS             complement(196808..197014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi162"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31567.1"
FT                   /translation="MFETGEARQTVHYVQVSQLDHANEKQFLTIDCTTADRTQADHGRT
FT                   RLMAIACPPMARLNGAGAAVAFG"
FT   gene            197571..198035
FT                   /gene="msi163"
FT   CDS             197571..198035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi163"
FT                   /product="PUTATIVE TRANSCRIPTIONAL REGULATOR PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31568.1"
FT                   /translation="MTEETESKADSLIELTAHVVSAYVSNNPVPVGELPGLIGQIHIAL
FT                   KGTAGGAAPEKPEALKPAVPIRKSVTPDYIISLEDGKKFKSLKRHLATHYGLTPDEYRA
FT                   KWELPADYPMVAPNYAAARSALAKTMGLGRKPKEPETPAPAKRAGKKAAA"
FT   gene            complement(198292..198894)
FT                   /gene="csp2"
FT   CDS             complement(198292..198894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csp2"
FT                   /product="PUTATIVE TRANSCRIPTION REGULATOR COLD SHOCK
FT                   PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31569.1"
FT                   /translation="MGKYKDHREPRRHRHDDDAASFTERPSEPSYFQRPSIVTADPVDA
FT                   EVVWFNTSKGFGFVKLPQGIQAYLHIRVLEAAGSRGVSEGTRLKVTTEESPRGGHQVAQ
FT                   VLEVGDQTARTQLHTRCAGESTAGTSAQLESEATVKWYNPEKGFGFIAPENGEKDIFVH
FT                   ATALTRSGLSMLMEGQKVFVQCGQGKKGLEVRSIRLA"
FT   gene            complement(199264..200256)
FT                   /gene="msi165"
FT   CDS             complement(199264..200256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi165"
FT                   /product="PUTATIVE SUGAR KINASE PROTEIN"
FT                   /function="small molecule metabolism; degradation; carbon
FT                   compounds"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31570.1"
FT                   /translation="MPDYDVLCIGNAIVDIIAQCDEEFLETNGIIKGAMNLIDTHRAEL
FT                   LYSRMGPAIEASGGSAGNTAAGVASFGGRAAFFGKVSNDALGEIYAHDIHAQGVAFDTR
FT                   PLAGLPPTARSMIFVTPDGERSMNTYLGAATELGPEDVEADKASGAAVTYFEGYLWDPP
FT                   RAKEAIRQTAKLAHAAGREVSMTLSDSFCVDRYRDEFLKLMRSGTVDIVFANSHEIKSL
FT                   YQTASFDEALAQIRKDCKIAAVTRSEKGSVIVRGDETVVIQATAIKELVDTTGAGDLYA
FT                   AGFLHGYTQGRDLKTCGDLGSLAAGLVIQQIGPRPRQNLRREAEQAGLL"
FT   gene            complement(200357..201532)
FT                   /gene="metK"
FT   CDS             complement(200357..201532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /product="PROBABLE S-ADENOSYLMETHIONINE SYNTHETASE PROTEIN"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; amino acids"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31571.1"
FT                   /translation="MTRQFVFSSESVGAGHPDKMADNISDAILDAILRTDPKARVACET
FT                   LVKTGMVVLAGEITSHAEIDYTQVARDTILDIGYDDDAIGFDGRRCAVILALTEQSPDI
FT                   SQGVDEGRGQDLEQGAGDQGLMFGFACNETDTLMPLPIQLAHHLTKRQAEVRKTGQLGW
FT                   LRPDVKSQVSVRYEGLRPVALDTIVLSTQHDGAVSQDTVREGVIEEIIKPVLPTHLDTS
FT                   EIRFLVNPTGRFVVGGPAGDCGLTGRKIIVDSYGGTGRHGGGAFSGKDPSKVDRSAAYA
FT                   ARYVAKNIVASGLAEVCEVQLAYAIGVASPVSVMVNTFGTARIDEKRIECLVLELFDLR
FT                   PKGIIKMLDLLRPIYRKTATYGHFGREEPEFTWEKTDRADDLLREAGPAAA"
FT   gene            complement(201590..202927)
FT                   /gene="glyA"
FT   CDS             complement(201590..202927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /product="PROBABLE SERINE HYDROXYMETHYLTRANSFERASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31572.1"
FT                   /translation="MNNSADVAIAEPGTFGRSSLVHVDCRVHELLLRQRRQERTMLKLI
FT                   ASENFASSAVLEATGSIFANKYAEGYPGARYYAGNEIVDELETLAIERLKALFGSEHAN
FT                   VQPYSGSPANQAVYRALLSPRDKVMGLPLPEGGHLTHGWSVNFSGTDYQRVPYGLHEKT
FT                   QQIDYDRLRETARRERPKLIWVGGTAYPRVFDYAAMAEIAAEANSYLVADIAHISGLVV
FT                   AGVHPTPVRHCDVVTSTSHKSIRGPRGGFILSRDEDRYQPLYHPKTKHNLAKRIDRAVF
FT                   PLLQGGPHMNTVAALAVALQEAANPSFRVYGQQIVNNAKALAEALLDRGYDLVTGGTDN
FT                   HMLILDLRGRPLSGKAYAERLARAGIITNFNMVPGDPRDPAVTSGIRLGSPAVTSMGMR
FT                   EGEMVQIAAFIDLVCRQPDDEEVHANVRRDVADFCAAFDVPGISDR"
FT   gene            complement(202924..203310)
FT                   /gene="msi168"
FT   CDS             complement(202924..203310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi168"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31573.1"
FT                   /translation="MMILVDRLMTAAHLDRLRILGLCAHADLTVRELAEILDLRRERVA
FT                   RHVRMLARADFLCGNGQRPWSSYHLNAGGKDGGLVQFLVDLLPHDDGYHKRDLERLEAV
FT                   QTRGRRGLLLNREKIRLGGSEKLP"
FT   misc_feature    203637..203830
FT                   /note="TWO FRAGMENTS SIMILAR TO  REGULATOR Y4DJ FROM
FT                   RHIZOBIUM SP. NGR234 PLASMID PNG234A"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    203995..204120
FT                   /note="REGION CONTAINS TWO FRAGMENTS OF A  TRANSCRIPTIONAL
FT                   REGULATOR LUXR FAMILY"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(204711..204923)
FT                   /gene="msi169"
FT   CDS             complement(204711..204923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi169"
FT                   /product="PUTATIVE TRANSCRIPTIONAL REGULATOR PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31574.1"
FT                   /translation="MDLTEVMAINMRRLRHDQDLTQEELAARAELSMRYVGSIERARVS
FT                   ASVSVLGRLAKAFDVDPCELIRPPQ"
FT   gene            205049..205300
FT                   /gene="msi170"
FT   CDS             205049..205300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi170"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31575.1"
FT                   /translation="MKRKVQDEVPWSDSLTAYDNEHFTIYMRLLDASADDASEDEMAQL
FT                   VLGIDPMREPERARMAVRSHLDRANWMVTTGYKELFAR"
FT   gene            complement(205330..205872)
FT                   /gene="msi171"
FT   CDS             complement(205330..205872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi171"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31576.1"
FT                   /translation="MFWCSRQCPHVLPVIAKKALSPETLSFDLARLPCRAALMITADGR
FT                   QHVMLRNAHRDLQLVVEGAEVLRPVRLSVDAIWPADRMRQHLNALECLNAFHATGQFPD
FT                   RLFPPEARASRLRFVLQALDGSLGGASHRQIAMALLARQRVQADWTDPRNHLRDRIRRA
FT                   VRRGHMLMDRGYRDFLV"
FT   gene            complement(205880..206131)
FT                   /gene="msi172"
FT   CDS             complement(205880..206131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi172"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31577.1"
FT                   /translation="MAMIGNDADWPDWQDEKSYRYTRHLTRRGWAWEFLRRNPAFQRDC
FT                   RHALEHAEFAERWFEVELVRSSLDLTQWGLLFRKLVEA"
FT   gene            complement(206133..206765)
FT                   /gene="msi173"
FT   CDS             complement(206133..206765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi173"
FT                   /product="PROBABLE AUTOINDUCER SYNTHESIS PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31578.1"
FT                   /translation="MIELIAPGWHGAFAYELHEMHRLRYRVFKERLDWNVSTTGGFEID
FT                   SFDSLKPHYLVLCDSAGRVGSGVRLLPSTGPTMLRDVFSRLLEERTAPEEPSVWESSRF
FT                   ALDLPPSSPKGSGSIAVATYQLLAGMIEFGLSRQLTHIVTVTDLRMERILRRAGWPLAR
FT                   IGPPQTIGTTCAVAGCLDVSEASLAAVRHSGSLGGPVLWAPVLCTGA"
FT   gene            complement(206866..207591)
FT                   /gene="msi174"
FT   CDS             complement(206866..207591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi174"
FT                   /product="PROBABLE TRANSCRIPTIONAL REGULATOR PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31579.1"
FT                   /translation="MQLVFETLLEQLSLSVDEVDFHNALASAAGAFDIPAFAYLSLVSD
FT                   RVTKPRLISNYHSGWTSHYLRHQYERIDPVIEWARCSEYPFQWGPDFGHAGISTRQQQL
FT                   FDEAAEFGICCGLTIPLVDRRGGVAAMTFAADRLDPTFLRVAEKYEQALEIMAMCFHIG
FT                   VRRKLSCGLAVDGVSLTPREYECLEWTAKGKSAWEIGCILGIKERTAAFHLDNAKKKLG
FT                   VRTKNQAVTLLASSRSSIL"
FT   gene            complement(208264..209670)
FT                   /gene="msi175"
FT   CDS             complement(208264..209670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi175"
FT                   /product="PROBABLE AMINOTRANSFERASE PROTEIN"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; amino acids"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31580.1"
FT                   /translation="MRLSNLGTEQLREKDRSFVFHPSTHLAKHSRGETPNRIMAGAEGV
FT                   YIWDTEGRKSLDGFGGLYCVNMGYGCTEIAEAIARQAHEMPFAHIYASQGTEPVALLAE
FT                   AVVEYFGQNMRRVFFGLSGSDANETNIKLVWYYNNILGRPEKKKIISRHRGYHGSGLVT
FT                   GSLTGLAFFHNFFDLPLDLVRHTTTPHHYRQAHDGESEQAFSKRCADELEALIVAEGPE
FT                   TVAAFIGEPVLGTGGIVPPPKGYWTAIQSVLDKYDILLIADEVVCGFGRTGEKFGSHLY
FT                   GMRPDFVTIAKGLSSAYLPISGSIIGDRVWSILEQGTEKHGALGHGWTYSGHTLCAAAA
FT                   LANIRLLKERNILEHVRDVGPYWHARMNAELAGHPIVGEVRGVGILSAVELMRDPKQRI
FT                   PFESDLQVGVRAAAALFENGVIGRAMPHGDILGFAPPLIITRKEIDIIVNATAKSVETT
FT                   YRALKAEGAI"
FT   gene            complement(209829..210326)
FT                   /gene="msi176"
FT   CDS             complement(209829..210326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi176"
FT                   /product="PROBABLE TRANSCRIPTIONAL REGULATOR ASNC
FT                   (LRP)-FAMILY PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31581.1"
FT                   /translation="MKSKPNPARLDAWDFRILSEIQSDGRISKSELAKRVHLSASACSE
FT                   RLRALETAGIVEGFYARLSPALIGGMVFVMVEVVLERHRLEDQRHFETAIGEFPEILDC
FT                   WAIGGRIDYLMRVASPSMAAYQDFMERLLQAGLGIDQYYSLVVTKPIKSNSPIPLSALR
FT                   RR"
FT   gene            complement(210394..211938)
FT                   /gene="fumA"
FT   CDS             complement(210394..211938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumA"
FT                   /product="PROBABLE FUMARATE HYDRATASE CLASS I FUMARASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism; energy metabolism,
FT                   carbon; tca cycle"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31582.1"
FT                   /translation="MGSRTRTIAGKDIIRSVADALQYISYYHPPDYIRSLSQAYAREQS
FT                   PAAKNAIGQILLNSRMAAFGRRPICQDTGLVVVFAKVGMDARIKSTASFAELVNEGVRQ
FT                   AYLDPDNPLRASIVADPLAGRVNTRDNTPAVVHVDLVLGNQIDITIAAKGGGSENKARF
FT                   TTLNPSASVSDWVVDTVATLGSGWCPPGLISIGIGGSAEKAMLLAKEAMNQPIDMAELI
FT                   ARRPSSAEEALRIELYDRINALGIGAQGLGGLTTVVDVKVATYPTHAASKPVALIPQCA
FT                   ANRHLKFTLDGSGPIMLEPPDLREWPDIGTDELSPAGVRRVNLDALTKEQTASWRCGET
FT                   LLLSGKMLTGRDAAHKRMVELIDAGKPLPFDLQGRVIYYVGPVRAVRDEVVGPAGPTTS
FT                   SRLDDFTDKVLAETGLFAMVGKAERGRAAIESIVRHKTPYLIAVGGAAYLISKSIKSAR
FT                   LIAFEDLGMEAVYEFEVQDMPVIMAVDVEGNSIHNSGPLEWRKRMAADSIARNIGV"
FT   gene            complement(211945..213378)
FT                   /gene="msi178"
FT   CDS             complement(211945..213378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi178"
FT                   /product="PROBABLE ALDEHYDE DEHYDROGENASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31583.1"
FT                   /translation="MSEARSYELFINGKWRAGGSRVTLPVINPATEKVVASVASATVSD
FT                   LDEALASAERSRKAWCSRPAKERGEILVAAARVLATQIEPAARDLSAEQGKTIAEATGE
FT                   YARAVETLEWNGTHAEELSATIPLGPNRMIVPEPLGVVAAFTPWNYPAVLITRKLAPAL
FT                   AAGCPVILKGAEETPSVAVHIVESLRQAGVPDGVVNLVFGVPVHISRHLLSSPIVKVLT
FT                   FTGSTAVGKQLAMLAANNLQRCILELGGHSPVIVCEDADLAKAIPAISEYKFECAGQSC
FT                   NAPSRILVARTLYEEFLSRMTEAARKIRIGLPDDPATEMGPMANARRIEAMQRLTKDAV
FT                   DRGAHIETGGTRLDGAGFYWPPTILTGVPKDARVLHEEPFGPILTVAPFDTLDEAIGEA
FT                   NDTEYGLAAYFFTDAADTQRKLTNSLSAGAVSVNYLKGVSADAPYGGVKQSGYGYEGGE
FT                   QGVRSFQILKMVNGLGSFG"
FT   gene            complement(213576..214505)
FT                   /gene="msi179"
FT   CDS             complement(213576..214505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi179"
FT                   /product="PROBABLE TRANSCRIPTION REGULATOR LYSR FAMILY
FT                   PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31584.1"
FT                   /translation="MMEIRQLKYFVGVVEAGSFTKAAAFLNIAQSALSLHVRQLEEGFG
FT                   TQLLIRDRSGVSVTASGAKLLERARAILREIRLTEAELTNTAASPAGEVTIGIPSGAAR
FT                   VLSGPLLESVRAELPRVSLKMIEGMTGPLEEWMAAGRFNLAVLYRTADSVARMTVLARE
FT                   ELCLVVPSGEPPFEASISLADLHAFPLAVPMRNNNVRRSVADVVAQHGCALDVKFEVDS
FT                   LSTIINMVIEGKAHSILAPSAVQKEATQGLVRTVKIVDPVITRSVVLAVNPKDERSAAV
FT                   SAVRKLIPKVARELIESEAWAAAAPDAT"
FT   gene            complement(214675..215589)
FT                   /gene="msi180"
FT   CDS             complement(214675..215589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi180"
FT                   /product="PROBABLE SIMILAR TO BETA SUBUNIT OF CITRATE LYASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; pool of unassigned individual reversibles
FT                   reactions"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31585.1"
FT                   /translation="MIKDTFPAIESPMSVPRWRSLLFVPAHVPRFVKTAHERGADGVIL
FT                   DLEDSVPQDRKDQARRQLRGSVAKVGRNGASVLVRVNRGLRALAADLEAAVVAGVNALV
FT                   LPKVESAEWVMEVADAVTELEHERNLDAGSIRFVAQIETPGALTRLAAIASAHPRMAAM
FT                   ALGPEDFSAAAGGTPSPELLLGPNLSVLFAARARGLLPLGFVGSIGQFSDTQKFRDVVI
FT                   QARRLGFVGALAIHPTQVAILNEAFSPSAEEFEWARRVLATERDAAAEGRGAFALDGKM
FT                   VDAPVVRRAREIIAMGPKAELGV"
FT   gene            complement(215711..216880)
FT                   /gene="msi181"
FT   CDS             complement(215711..216880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi181"
FT                   /product="PUTATIVE RACEMASE/DEHYDRATASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31586.1"
FT                   /translation="MKARCSMQNSLEGITVVAVEQAVAAPYASSRLADAGARVIKVERP
FT                   EGDFARNYDKLVRGQSAYFVWLNRGKESVCLDLRTEGDRAVLDTLIAGADVLIQNLKPG
FT                   SIEKLGFRSRDLRRRFPRLITCDISGFGDTGPYSHLKAYDLIVQAETGLCAITGTQQGP
FT                   ARVGVSVCDISAGMNAHSAILQALYHREVTGEGTSIQVSLFDAVADWMNVPVLQNDYSG
FT                   YHTVRAGVKHPSLAPYGAYRCADGKEVIFSVQNDREWVNFCEKFLKLPKLIRAPGFADN
FT                   MERLGHRAQLDEIIERRFSKLLCHEAMQELEAAGLAYGRLNEVADVSKHPHIRKVQVGT
FT                   PEGTIETIAPAAIFNAEHPLLRPVPALGAHTEAVREEVLGRLRERATSA"
FT   gene            complement(216877..218148)
FT                   /gene="maaL"
FT   CDS             complement(216877..218148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maaL"
FT                   /product="PUTATIVE METHYLASPARTATE AMMONIA-LYASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /EC_number="4.3.1.2"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31587.1"
FT                   /translation="MNRVTELQIKDVLLTLGNGAFFYDDQAAIRAGASQDAFIYVGEPV
FT                   TPGFTSIRVPASSLSVGLVLSDDTVVWGDMMGVQYSGAGGRDPLFETSQISDLTSRVVA
FT                   PRLLDVDVSRYLVACAKVLEPHEHKRLPLAIEYGVSQALLRAAAYLQRATMAEVVCAEF
FT                   DLPLPTRRVPIYCQSGDAREINVDKMILKAVDVLPHGLINSRQKFGINGQTFMEFVKWV
FT                   ARRTREIGCPGYHPVLHFDVYGWIGQEIGLEPQNIADFICQVANTVPDFTLNIESPADF
FT                   GSTQAQIENYAKIVSILDNRGSNARIVVDERCNMLEDIRLFAEAKAAHLVQIKTPDVGS
FT                   IADTARAVLICKENQVGAYVGGSCTETDLSAQASVHVSVATQADMMLAKPGMGVDEAFS
FT                   IVGNEQNRLLAMLNRRRAQNENVG"
FT   gene            complement(218174..219178)
FT                   /gene="msi183"
FT   CDS             complement(218174..219178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi183"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31588.1"
FT                   /translation="MSEAPHLTFDSDMPGVSRGHLVVPGGADRGELSLPVFSLNRGEGP
FT                   RLLVTGGNHGNELEGPLVARRLIEWLPEAQTCGRVIVLPMLNPLAVQAWSRNTPLDGLN
FT                   LNRVFPGRAGGSVTERIADAVSRILLPMADTVFDLHSFGPTWDFPPAATTHPIADLDLM
FT                   ARTVRMAEAFKLPLTLVWEYNDTVGMFDIVAQNQGKVFVCAEFGGGTVGADNLAIYEAG
FT                   VRNALIALGLVEGKAEYPTFRQQKSGQTLETHPSDELKSPAPGIFEPRASVLDEVKQGD
FT                   LIGILHPMDSLSVESIDIRAPGTAIVFAIRSGGHVGVNEWVAAVARPLRLECH"
FT   misc_feature    219560..219751
FT                   /note="FRAGMENT OF ABC TRANSPORTER ABC BINDING PROTEIN"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            219903..221633
FT                   /gene="msi184"
FT   CDS             219903..221633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi184"
FT                   /product="PROBABLE TRANSMEMBRANE TRANSPORT PROTEIN"
FT                   /function="cell processes; transport of small molecules"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31589.1"
FT                   /translation="MAAVCACTSSAQASLYVRREAALRNMRRMAGADEGAGSPATFAPL
FT                   RNPTFRSIWLATQVSSLGWLMQTVAISWLMATISTSDLMVALVQASSNLPAFILSVFAG
FT                   ALADNYSRRGVMFAGRCLMVIASVALAAFVALGFVSPWMILGFSFLIACGGALHDPAWQ
FT                   ASVGDIVDRRDVPAAVTLLSVGFNTVRTVGPALGGIVVASFGLLAAFTVTTLTYLVPLG
FT                   TVWRCKWKVRSSPLPRESMKTAIYDGLRFTAMSSEIKAAIARGTIFGLASIAILALLPL
FT                   AVRDHLGGGPLAYGTLMAGFGTGAVFAGLANGTFRRSLSQERLMRLACVACAACSLSLA
FT                   LTSSIAVAALALALGGAGWVTAWSGVGVSVQLASPRWVVGRTISIYYALIDGGIAAGSW
FT                   VWGTVSQNHSLTWALEGSAGALLLVAAAGVLFPLRERRESEPDPLEEFDAPAVALNLKP
FT                   RSGPIVVKVEYLIHEENVEAFLDLMRERRHVQTRVGARQWTLQRNLQKPVQWIETFRTP
FT                   TWTDYLRLNHRLTEADKELDERVLQIHKGELPPQMTLLIERPTSLARKPEQSAPYFPHR
FT                   "
FT   gene            complement(222175..222384)
FT                   /gene="msi185"
FT   CDS             complement(222175..222384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi185"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31590.1"
FT                   /translation="MAMNRSLARHLRRFSSDELKPPADGIFEPRCSVLDKMKQGDPIGI
FT                   LHPMDTLSAGSIDIRARATLSVAV"
FT   gene            complement(222573..224003)
FT                   /gene="msi186"
FT   CDS             complement(222573..224003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi186"
FT                   /product="PUTATIVE AMIDASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31591.1"
FT                   /translation="MRLMNSETMGFTPAVELAELVRSKKISPVEYMRTLLARITELEPK
FT                   INAFAYLAADHAMDEAKKAEGALMSGGRIGRLHGVPVTIKDHSITKDMPTQHGSKIYAG
FT                   HQPTEDAPLVQRLRAEGAIIIGKTTVPEMGWTGVSRSPLTGITSNPWKLGYNAGASSAG
FT                   AGAAAAAGYGPLHQGSDGAGSIRMPAHFCGIYGLKPSFGRIPNYPVPGSDMTTHNGPMT
FT                   RTVADAALMTEVMAGPHSLDHTTLEAGPASYLGRMHEGIKGRRIAYSPDLGFARVDPEV
FT                   AELVKAAAARFTELGAVVEEVPTPWAKDGPELIRFFWSAHLTGLAQYLPKWEAEMDPGL
FT                   VACIKHSENVSVARYQEMRYRKMTYVANIHRWFQDWDLLLTPSASVAAFQADKLMPDHW
FT                   PTHAWDWIMWAEFSYPFNMSWNPAASVPCGFTPAGLPVGLQIVGKRFDDLGVLQASAAF
FT                   EQLQPWKDKRPRLSTKNM"
FT   gene            complement(224352..224669)
FT                   /gene="msi187"
FT   CDS             complement(224352..224669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi187"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31592.1"
FT                   /translation="MSQSFDASRSLAALKQDNTIIAVIEMSKAKWRVAALVRGLKRQPL
FT                   KKLDADAPALLKLLQRWRDEAGRAGHTVKRIAVAYEAAAVVPPSRSMDDNLAARVNRAH
FT                   T"
FT   gene            complement(225203..226312)
FT                   /gene="omp2b"
FT   CDS             complement(225203..226312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="omp2b"
FT                   /product="PROBABLE PORIN, OUTER MEMBRANE PROTEIN"
FT                   /function="structural elements; cell envelope; membrane,
FT                   outer"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31593.1"
FT                   /translation="MNIKSLLLGSAAGLAAVTGARAADAITVAEPEPAEYVKICDVYGA
FT                   GYFYIPGTETCLRIGGYVRWDASAGQEGSFNERRAVDHEDGSINDTWHKKARLSLRTWT
FT                   GQETELGTLKTYTETKFNYSDGSNSSSLNFAWIQLGGLRVGKDESAFDTFIGYAGDVIN
FT                   DSLVPYGDFDTNVVQYYFDAGNGFSAVVSLEEGSGVVGTIDSYVPHVVGGVKYTQGWGA
FT                   ITGVVAYDSNYEEVAGKVRLDVTATEALSLFIMAGYGTDDNLNDPTYAIPAGDRGFYKQ
FT                   WGGNWAIWGGGTYTVNEKTAFNLQVSYDEAKEFGLAANVAYKIVPGLTITAEVDWAHND
FT                   HDSNGYNWTGIPAGKSNAVGGILRFQRSF"
FT   gene            complement(226695..227336)
FT                   /gene="msi189"
FT   CDS             complement(226695..227336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi189"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31594.1"
FT                   /translation="MVAKEVQRVLAQHQEVMKGRSSISSHVGNGNIAAPDLLSDCEQAI
FT                   HDDLTALASKFVHGLAAEAARRFDASARETPPLTAQTKGAHGSAVLKGPDQQSNSLRIE
FT                   DWAGAVAGPTFLEEHFGIPRSTLHWWQRHNDVVALRKGARKHVFPLAQFIDGRPAPGIR
FT                   QVLSLIANPRPAWLWLTSPSPRLDGRIPIEMLRQDLAAEVICAARDFSST"
FT   misc_feature    227481..227603
FT                   /note="TRANSPOSASE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(227664..229067)
FT                   /gene="msi190"
FT   CDS             complement(227664..229067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi190"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31595.1"
FT                   /translation="MEKHLHENGRYPVRRADGYDAIGSTETNVADGFTMVAVGDLIVSR
FT                   ALTNGHHPGFGDIVKILCNADVTFGNMETLIFDIRSFKGSPEAEHGGAYHISVPELGPD
FT                   LKAMGFNIVGRANNHTLDWGLEGMRETSRVLDESGIVHAGAGENLAQAGAARFLETARG
FT                   RAALVSLATTFAPMARACDPAGEAPGRPGLNALRLAQSIVVPPEMLESLRRVRDALPGY
FT                   KAGETDPSRVMVGGATYKTGNKAGYSYEADQRDVADILRNVRRGKQFSDFCIVTNHAHE
FT                   PGGWSQEPADYEQSFAHQIIDAGADAYVGHGPHLLRGIEIYKGRPIFYSLGNFFYDDLR
FT                   TPAGADMFEAYGKDPRVDTDAEVTVDEEAKGYPIGEGLFYAALSAPVYYESVVTVSRFE
FT                   QNHLAELRLYPIELGFSNRFANRGVPQLAPTTQAKAILERLKNLSKPFGTEIVIENNVG
FT                   VIRLSPTSP"
FT   gene            complement(229161..230192)
FT                   /gene="msi191"
FT   CDS             complement(229161..230192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi191"
FT                   /product="PROBABLE ABC TRANSPORTER ATP BINDING ABC
FT                   TRANSPORTER PROTEIN"
FT                   /function="cell processes; transport of small molecules;
FT                   amino acids, amines, peptides"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31596.1"
FT                   /translation="MSDPLLKVENLTKHYPLGAGYLKKTIPVIRAVEDVSFTVDAGETL
FT                   CIVGESGCGKSTVARLLMRLVEPTGGRVLIEGTDIAGLKKDALRAWRRRMQMVFQDPYS
FT                   SLNPRLTAGQIITEPVENFERLSRKQRQALAADLLRKVGMSPEMMHRLPSELSGGQRQR
FT                   LGIARALALEPSLIIADEAVSALDVSVQAQILNLLLDLQQKMGIAFVFISHDLGVVEHI
FT                   AHRVAVMYLGRIVELAPSEALFAKPVHPYTEALIAAAPVPDPTRVRLEAPVEGEVPSPI
FT                   NPPSGCAFHPRCPLAVERCRIEVPPLVPMADGRIVACHVRAPATGMPHLARASTNSSFT
FT                   PMA"
FT   gene            complement(230189..231196)
FT                   /gene="msi192"
FT   CDS             complement(230189..231196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi192"
FT                   /product="PROBABLE PEPTIDE ABC TRANSPORTER ATP-BINDING ABC
FT                   TRANSPORTER PROTEIN"
FT                   /function="cell processes; transport of small molecules;
FT                   amino acids, amines, peptides"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31597.1"
FT                   /translation="MRIHQTAGNDVLLDVRNLETHFYGEESVTRALGGISFQVKKGETL
FT                   GVVGESGCGKSVTALSILRLLPKLTARTVAGEIRFHGRDLLELSHREMRKIRGDQIAMI
FT                   FQEPMTSLNPVYTVGHQIAEVVQIHTKGPRSVAMAKAEEMLRLVRIADPERRVNNYPHE
FT                   MSGGMRQRAMIAMALACSPELLIADEPTTALDVTIQAQILRLILDLKERMGTAVMFITH
FT                   DLGVVAETCQRVIVMYAGRIVEQANVIDLFARPAHPYTQGLMRSVPDPRRGRQRRLPEI
FT                   PGIVPSLREPIVGCSFAPRCPFAIDICRERTPVLDDVRPGHAAACWRAEEVMGA"
FT   gene            complement(231198..232073)
FT                   /gene="msi193"
FT   CDS             complement(231198..232073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi193"
FT                   /product="PROBABLE PEPTIDE ABC TRANSPORTER PERMEASE ABC
FT                   TRANSPORTER PROTEIN"
FT                   /function="cell processes; transport of small molecules;
FT                   amino acids, amines, peptides"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31598.1"
FT                   /translation="MTILSVEYVPTGRLRISDLPRLAKRHPLVIAGGGLLALLIILALA
FT                   APLYAGNPVNMDPFKRLQPPSAEMWLGSDNLGRDVFARTVFGARISLMVGLMSAACAAM
FT                   TGLLIGIIAGYSRSFDNVVMRVMDGLMSIPTILLAIALISLTGPGIGILIIAIAIPETP
FT                   TVARLVRSVVLGVRERPYVEAALCGGARLPRVLWRHILPSTIPALMVQGATVCASAIMT
FT                   EAALSFLGAGVPPEIPSWGNMIANSRLYLAIAPLTIFAPGICLAVTVLAVNLLGDGLRD
FT                   LFDPRAKRRR"
FT   gene            complement(232075..233016)
FT                   /gene="msi194"
FT   CDS             complement(232075..233016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi194"
FT                   /product="PUTATIVE OLIGOPEPTIDE ABC TRANSPORTER PERMEASE
FT                   ABC TRANSPORTER PROTEIN"
FT                   /function="cell processes; transport of small molecules;
FT                   amino acids, amines, peptides"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31599.1"
FT                   /translation="MAAYILRRMVSTIAVMAMVGVFVFLLLRLAPGDPAAMIAGRLATA
FT                   EMIAGIREKMGLNDPMPVQFIRWVRDMLGGDFGTSIFAGRPVLELISQRLEPTLSLSIL
FT                   TMILSVMVGVSFGILASWRTGGLVDRFLAAFSALGYSVPVFVIGYFLIYFFAIRTHWLP
FT                   VQGYAPIDGGLGPWFVHLILPTVALGIGYIAFIARVTRASMLEVLSEDYMRTAAAKGAS
FT                   SYAILFHHALRNAGVPILTVIGISFAYLIGGVVLTETVFNIPGIGRLVVDAINNRDYPI
FT                   IQSVLILTSGLYVLINLTVDLAYTLIDPRIRY"
FT   gene            complement(233023..234615)
FT                   /gene="msi195"
FT   CDS             complement(233023..234615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi195"
FT                   /product="PROBABLE PEPTIDE ABC TRANSPORTER PERIPLASMIC
FT                   BINDING ABC TRANSPORTER PROTEIN"
FT                   /function="cell processes; transport of small molecules;
FT                   amino acids, amines, peptides"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31600.1"
FT                   /translation="MIITRREIIKAGLAAGTAMSIPSVLRAQTAPTAARTVRMVMGDLS
FT                   VFDPVVTTASVTFNHCLAIYDTLFGADSKFMPQPQMVSKWNVSDDKKTYTFELRDGLGW
FT                   HDGSPVTAADCVASIRRWGQVAPGGQLLMARARDISKKDDKTFTIALQEPLGILLDLLG
FT                   FQGPFIMREKDANLSPTEQVTANIGSGPFKFNQALAKPGASFTYDRSDKYVPRNEPADG
FT                   LAGGKVAKVDRVIWENIGNQQTALAALQAGEIDFVGTPPVDLFPVIESDPNLELQVLDK
FT                   TGQDMFLRINCLQKPFDNVKARQALLHLVDQEAIMRAAFGDPKYFRSVTSMFGNETPAS
FT                   NDENTGWHKTGGDPEKARQLFKEAGYAGEKVVILDPTDWREADNASQILVAALQKIGIN
FT                   AELAPSDWGGLVARRANKGPVEDGGWSLFMSSEAEWIRGNVVTAVTLSMNGEKGWFGWP
FT                   QNDEYETLRVKWADVETLEERKALARKMQRIWWDYVPEVLLGQYVTPIARRQTLTDLIS
FT                   MPELIPIWNMQKA"
FT   gene            complement(235082..235294)
FT                   /gene="msi196"
FT   CDS             complement(235082..235294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi196"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31601.1"
FT                   /translation="MRRMRWSGQDVGRCRRICVFISITRAADLDDAQTQRVELGDAKLE
FT                   RFRIAARRPGARILSVKRLWPRERM"
FT   gene            235836..237071
FT                   /gene="msi197"
FT   CDS             235836..237071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi197"
FT                   /product="PUTATIVE LIGASE/CARBOXYLASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31602.1"
FT                   /translation="MARSALILVEGHRSISLLYVKAAQCLGLHPITLSADPAQYDYLAA
FT                   EGIEAIRVDTDNLDALIHECSRLRATYEIAGITGFAGDDESVSATVGKLCRHFDLPGPN
FT                   PASIERCCDKFTQRQLLSEAGVPIPAYRLAANATEVESCAAEIGLPVVLKPAVGSGSIG
FT                   VRLCRSVEEVAEHTTYLLDGKHTWQSSPKILVEEFAQGPYYCTLVMGNEVLGIGAADFG
FT                   PLPHFVFLRSIFPAPVTDDEHRRIADVSLSCLRALGLGWGPTNIELRWTRRGPVVIEVN
FT                   PRLVGGTGPRLAQAAHGIDLVTEHIKLVIGDEWDLRRRHSHIAAARFLLVDRDGILDWI
FT                   DGDSRAAALPGVAEVKFYVEPKTPIIRKGDYRDCIGHVVAVSPSLAQTEIALQRAVDSI
FT                   SWSITPFPTLGE"
FT   gene            237302..237718
FT                   /gene="msi198"
FT   CDS             237302..237718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi198"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31603.1"
FT                   /translation="MPEPPKILYASEPDLDAAEFCRVLVESGFGGGHGELRLKAMLSHA
FT                   DLVLTARLDRRDRKLVGVLRGVTDFFWVCYISELAVSKSAQGLGIGKGLVGDARRQLGP
FT                   VVAMALISEPDAVGFYERIGMTRIPAAFWFSREC"
FT   misc_feature    238174..238374
FT                   /note="HYDROLASE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    238539..238589
FT                   /note="TRANSPOSASE FRAGMENT SIMILAR TO M. LOTI MAFF303099
FT                   MLR6220"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    238908..239219
FT                   /note="TWO FRAGMENTS SIMILAR TO A CONSERVED  PROTEIN OF M.
FT                   LOTI MAFF303099 MLR6217"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(239506..240843)
FT                   /gene="msi199"
FT   CDS             complement(239506..240843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi199"
FT                   /product="PUTATIVE AMIDASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31604.1"
FT                   /translation="MTDSRSIKTIVAALEGGNRSAVEIVRECIAAAERTNSSLRSFITV
FT                   AADHALKQAGKSDARRRAGRVLGPLDGIPYAAKDMFETRGIRTTGGSRVLENNVPDTSA
FT                   AAICMLDAAGAALIGKTNLHEFAYGATGENRWAGTVVNPHDETRLAGGSSSGSAAAVAA
FT                   GIVPFALGTDTGGSVRVPAALCGIAGYKPSYGLISLDGVIPYCWSLDHAGVLATSVEDL
FT                   ELVVRHIAKLPPATQPSAALRVALVEGFEEKCEEPVQDAFLATKGHMRRLGAMFGAIEL
FT                   PDQSVARTVSLTIQLAETLTYHGPNRARARDRFGADMRGGMVLGQFLSAESYIQCKRML
FT                   GTYRRAFAQAMQMFDVLLTPACPIMAPQVGTVDVDIAGQTIPLGNALTLFTSFFNLVGA
FT                   PALVLPVASPSGGLPVAVQIVGSPGSDSQLFGIALILENVCRACRS"
FT   gene            complement(240836..241261)
FT                   /gene="msi200"
FT   CDS             complement(240836..241261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi200"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31605.1"
FT                   /translation="MAAPPAGAGGDQGRPHVRGSPRQPRRSFSVGYHTGQPVGQPFPEA
FT                   PQLKRAIDVGMMWVTTLPWCERGTMAKPRLETLKSINAEFLGNQWVDGDLEQLATSPFG
FT                   IVSSFESLLSDLRSIVARDLGHIAPDGVAQASHSGHD"
FT   gene            complement(241872..243149)
FT                   /gene="msi201"
FT   CDS             complement(241872..243149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi201"
FT                   /product="PUTATIVE LIGASE/CARBOXYLASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31606.1"
FT                   /translation="MARRALILVEGHRSIGLLYVKAAQCLGVHPITLSADPTQYDYLAA
FT                   EGIEAIHVDTDNLSALIHECSRLGATYDIAGITGFTGSDESVSATIGKLCRHFDLPGPN
FT                   PASIERCCDKFTQRQLLEKAGVPIPAYRLAANAIDVECAAAEIGLPVVLKPAVGSGSSG
FT                   VRLCRNIDELAEHTAYLLNGKHIWRSSPRILIEEFARGPFYGVDIMGNEVIGIEAGDFG
FT                   PPPYFVFRHLTCPAPLTGDEHRRIADVSLSCLRALGLGWGPTTVELRWTKRGPVVIEVN
FT                   PRLAGGTSPRLVQAAYGIDLITEHIKLVIGDAWDLRRRHSHIAASQCLDADRDGVLDWI
FT                   HGDGRAAAVPGVAEVKLYIKPKTPIVRKGDFRDRIGHVIATSPGRAQTAAILQHAVDLI
FT                   SWSIAPFPASGNCVPSSAAPAHVRPD"
FT   gene            complement(243443..243598)
FT                   /gene="msi202"
FT   CDS             complement(243443..243598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi202"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31607.1"
FT                   /translation="MDGSKAHRLWIGPGHFEARLSVENIRLMRAATIVSPVFHAAISTW
FT                   TGNMRG"
FT   gene            complement(243612..246311)
FT                   /gene="msi203"
FT   CDS             complement(243612..246311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi203"
FT                   /product="FUSION PROTEIN CONTAINS PUTATIVE LIGASE AND
FT                   PROBABLE ARGINOSUCCINATE LYASE"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31608.1"
FT                   /translation="MDQNSFLFVESNTTGTGELLMKRARVLGFEPYLVTRNPSRYPFLK
FT                   VCGARVIEAETRNPDEIIRFAAKLTGLAGIFSSSDYFVESASRVAKAIGLPAARPEAIA
FT                   NCRNKWKQVTELQRQCISVPETRLVSSIRDVEKALVQTIFPVVVKPVSGSGSSGVRLCE
FT                   NTSEVVEAFEGAKRVLLDQVDLRSPEILIQQYVEGQEYSAEIIAYNGSLHCLGIIAKHK
FT                   GAAPCFVEIGHDFPAPLPEPSRHELASFAAGAVSALGLDFGPAHVEFVITESGPVIIEV
FT                   NPRLAGGMIPVMLSHALGTSIPDMMIKLYSGEAFVPLRASKKSAAIRFKLAHRSGKIKR
FT                   LVFFKTLGPNTPEAGLLKSEGEDIQINGDFRDRVAYAVGVADEVNMAASAAERMIDSIM
FT                   LDIETLARKPDNSRDAGSSEPTWTLHPEAMKLLAPPIEISRDGRVLQFQAAIDEAHLVM
FT                   LADHGLVGQAVAADLLTSILDLQGEGFKSLDGRDAPRGLYLAYEAELAARAGEDRAGWL
FT                   HLARSRNDLNATISLLVLREAVCSVSREIGIAQDALLQRAEEASNLVAPLYSQYQIALP
FT                   GSPGHYLLGVFFALARERQRLHCLLEEIRSCPMGAGAGGGTSMPIDPLETASLLGFELP
FT                   SFNSLDAVASRDLHLNGLSLFTSVSILLSRVAQDLQVWTTREFALIDVPRNLAGGSSML
FT                   PQKKNPYLLEHIKGSASTVMGAYVSAASATCKAPFSNSIESSNYGCSPISLAEGALKRA
FT                   IILTSLIVKFMSFNVSAMLENLEDGLAMTTVAAERMAVRGVPFRSAHTQIGEIAARLSQ
FT                   DSCLANRRGELACHLGGVLPASPEECREALEFGGGPAKASTDAQLSVARSLFRETQLKC
FT                   AEIRERWASAEMYRKRRVKELIDGRLSP"
FT   gene            complement(246298..247365)
FT                   /gene="msi204"
FT   CDS             complement(246298..247365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi204"
FT                   /product="PUTATIVE CYSTEINE SYNTHASE PROTEIN"
FT                   /function="small molecule metabolism; amino acid
FT                   biosynthesis; cysteine"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31609.1"
FT                   /translation="MNLDRTPLPFSQYSAAYALPRIIRCGSNLYLAQFAFMKLLPAKYI
FT                   IGQAVARGTLTHDTIVLETSSGTFALGLAVVCREYGFSLEIFTDPVMDKGLENRLRSLG
FT                   AEVFIITEKAKEGGYQRSRLDAMHARMRQLGESHFWPRQYETPDNPAAYRCFADQISEL
FT                   LGADVTLVGSVGSGGSTCGTIERLRQKALGARLIGVDTFNSVIFGQLDGERKLRGLGNS
FT                   LVPKNVKHELYDEVHFTSASLAFAATQALHERHAIFAGPTSGASYIVGRWRARQHPEET
FT                   VVVICPDEGHRYAEAVYDQEWLRQNECVLEGVLLDAPASEEHPSTALPPWNRYRWKRKT
FT                   REAVLSALEGCNGPE"
FT   gene            complement(247379..248428)
FT                   /gene="msi205"
FT   CDS             complement(247379..248428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi205"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31610.1"
FT                   /translation="MVNQDSTYRVAPSGCSASLDMTKINEAAADELWRPYMLHQRFDAE
FT                   AAAEVALQNGQPRVHSGDGVALCCGTFGELLQGQLPVSPHSHDSHFLVTMPIALFARAK
FT                   FMPITGTRSVTVYPPHKIKAQRLAENLVIALGVSGGDLILQSELPEGKGLASSSADLVA
FT                   TARSIASSFKLRVRTSLMEKLMAEIEPSDGVMYPGVVAYHQRSCSLLSFLGQMPPLAVV
FT                   GIDEGGTVETMHYDQRRGEINASQRAQYCELLDRARIAIPQGDTVTMGRIATASALLHQ
FT                   QRAPKKYLNSMLKASEGTGALGVIVAHSGTMTGIMLDRRAPEFSQKLRSVVHHVSLFGK
FT                   SPKIYLTMN"
FT   gene            248756..249019
FT                   /gene="msi206"
FT   CDS             248756..249019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi206"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31611.1"
FT                   /translation="MAGAQPSLDCCRRSKRGSVPTLNGRQNLRPHDAKHGIVRPVALRH
FT                   DVMRRLGRSLDTTKLHRAAIGSTLLRSPSKKQQPRAGATRSV"
FT   gene            complement(249163..249861)
FT                   /gene="msi207"
FT   CDS             complement(249163..249861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi207"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31612.1"
FT                   /translation="MSAVDKQNALRQAAQMRIKASHALKGDANLLAQHYFEWADSYELD
FT                   MDRERYSGPSIVAEMAGALQAAYIGGDRAATAVLDAGCGTGLVGVQLDHIGFRFIVGFD
FT                   LSETMAEMARQTGVYRHVEGEIDLNRSLSEYASASYDMIVCCGVFTLGHVHPDGLRELS
FT                   RLTRPNGFVIASTCKSYTQAMSFEDEVLRLQEASVLAPAQCLNDGRFLDGEDAHYWALR
FT                   VLEKSTKQRR"
FT   misc_feature    250686..250742
FT                   /note="TRANSPOSASE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    250878..251001
FT                   /note="TWO FRAGMENTS SIMILAR TO CONSERVED  B. JAPONICUM
FT                   ID613 AAG60954"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            251234..251560
FT                   /gene="msi208"
FT   CDS             251234..251560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi208"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /note="predicted by FrameD"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31613.1"
FT                   /translation="MVVNPSFALIAGVMVLSEVECLMIMFGLGASTCATRFEVDVSRFN
FT                   EVTTSTVPAGHHGFRKQARDWDRVQICQFAAPLKAGAVNPEAVEQNRDLASYRHFCLFH
FT                   TYPL"
FT   gene            complement(251682..252857)
FT                   /gene="msi209"
FT   CDS             complement(251682..252857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi209"
FT                   /product="PUTATIVE HYDROLASE/PEPTIDASE PROTEIN"
FT                   /function="macromolecule metabolism; macromolecule
FT                   degradation; degradation of proteins, peptides,
FT                   glycopeptides"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31614.1"
FT                   /translation="MEKELHFERSEFATRVTSVKKEMEKRDIDTLLLSEPANANYLTGY
FT                   DAYSFYVPQMVVVALDREEPIWVGRGMDGISAFMTTYLSDDSIRTYADAYVQSALSPYD
FT                   FVAEIVKEIAGRKTRVGVEMGGYYYSARAHSDLMKALPEATFIDADLLVNWIRLVKSPA
FT                   EVALMRQAGRIAEAMMYRAVDTIEPGARECDIAAVIYHQMMAGTPEFGGTYTCSPPYLC
FT                   VGEKALAPHAAWTDKPLLPSTIVNLELFGNRHRYQVNLARTICVGKPSPNYQKLADVVV
FT                   ESLNAGLDAVAPGKSAEEVHAAFAKTLAKHGHEKDSRLGYSLGLGYPPAVGEKTVSLRK
FT                   GDKTVLRPGMCFHMMSGLWLENDGITITQPFVVTETGHEPLTKIPRQLFVK"
FT   gene            complement(253257..253565)
FT                   /gene="msi210"
FT   CDS             complement(253257..253565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi210"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31615.1"
FT                   /translation="MSQITHRLVHTGRCFMIKEMEGCSSPPFDTKCRLLAEPAKIPIHL
FT                   NCAGICLHSIFDHHLASEEWRIDDMVLKTIRTWPEGHSAVPIPMIWLCMAVSSSTMI"
FT   gene            complement(253740..255125)
FT                   /gene="msi211"
FT   CDS             complement(253740..255125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi211"
FT                   /product="HYPOTHETICAL CONSERVED TRANSMEMBRANE PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31616.1"
FT                   /translation="MQIFCGHFIHQRTRSAQVRAITELANFVSSYPASALPTATRRTIS
FT                   SLMLDLIGATAAGLRSLLAHAARQTALEAYGEGPISIWLTDDHSSVVGAAMANSAAASS
FT                   LDIDDGHRGAGGHAGAGVIPAALAVAQAVDASVPETMVAIGLGYEIGLRIASSRPVTTI
FT                   DTYATGRWVAYGAAAAACRLLGLGAAETAHALAIAGSEGPIVFLTASSKFEGTTIKEGI
FT                   PPAVVAGITAAYRAWAAATGPLDLLDDNDRFTRHVLTNNLGSSWEVQKCYLKPYSCCRY
FT                   IHAAIDAILAMRRDGQEIRKLRIETFPQAMRLANERAPSTLEGGQYSFYFSCAVAALYG
FT                   REALQPFQMERLADARVLDLAARIELEPSPDFASAFPVGTPARVVIDQGNGPEEMIVLH
FT                   PLGDVANSLSSDQVAEKFKNIARKNVHPRWQDEILAATASLETAGIPRLLTALLPPDAR
FT                   NLE"
FT   gene            complement(255128..255316)
FT                   /gene="msi212"
FT   CDS             complement(255128..255316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi212"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31617.1"
FT                   /translation="MAKLMRPVIGIVSNVNKNKGGQEVTFVRLPYLRQSKKLTHFRSSC
FT                   PKFKADKASAALNRIAY"
FT   gene            complement(255328..256488)
FT                   /gene="msi213"
FT   CDS             complement(255328..256488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi213"
FT                   /product="PUTATIVE HYDROLASE/PEPTIDASE PROTEIN"
FT                   /function="macromolecule metabolism; macromolecule
FT                   degradation; degradation of proteins, peptides,
FT                   glycopeptides"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31618.1"
FT                   /translation="MTEHTNSGMDFPVEEYKTRLQRTQEEMAKHDLDVLLLHQPENIQY
FT                   LTGLDAGAGFFSYHAVAVPSHRDPVLILRDVEIPAAHLTSWVTSHTSYADSSDPIRVSL
FT                   DAARRALEGLGLAAGRVGVDEHSWFLTLERWKMLQALLPNATFVREPRIVDHLRLIKSP
FT                   REIDYLRGAARCVEAGIYAGIEAVTPGITERQLAGTVFGALVNAGAEMPLSGVITSGNR
FT                   TNLLHGSYTDRQLERGDTVYLELSGIHRHYWARLMRTAIVGLPSAEQQHIAETIIRVQD
FT                   DAIALMRPGTPASVIDRACREPLLATGLRKTYTNRSGYSLGLNYRPSAGEFIREFVPGV
FT                   EWVLEPGMVFDMLMMAGGMGFSDMVLVTEQGPERLTCMERKLFSCT"
FT   misc_feature    256537..257672
FT                   /note="2 FRAGMENTS OF ABC TRANSPORTER PERMEASE"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(257676..258524)
FT                   /gene="msi214"
FT   CDS             complement(257676..258524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi214"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31619.1"
FT                   /translation="MRWTMAPASGLHSSIQGAKQDFTAAYNRKWPHAYFRAHLALDYMI
FT                   PDRAKPVFERIFADYRRVRNKTWLKIIDVGCSYGVNAALLRTDLDLDDLYAAYLEPSGS
FT                   LSRRQETEHRAFFRDRGLRDDIQFVGVDPSFRAVRYARNLGLLKAGITGDLETRDLTPN
FT                   ERCALAGADIIISTGCVGYATARTFARVYKASATSHPWVVAFAMHPFSYDDIARTLRGF
FT                   ALETKVVDRLRQRQRRFSTPTERQAILKAMAKLGMEDRLERTTGYIYASCYISAPSREV
FT                   L"
FT   gene            258590..258802
FT                   /gene="msi215"
FT   CDS             258590..258802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi215"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31620.1"
FT                   /translation="MDLTCCFPSFHRSRSDPRHEHPLAPCRLMLKEFQKSYQLLRKAQK
FT                   TFLLGIMGYMRVRPVSEPNTTVSDT"
FT   gene            complement(259131..259811)
FT                   /gene="msi216"
FT   CDS             complement(259131..259811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi216"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31621.1"
FT                   /translation="MTEIDRIKTRLKLSQQRTFPLRMQEFGLDLAVHEGVYPPQDFHSW
FT                   RWYTDNFPPVEGKSILEIGCGFGLPGLYLAKLGAASLVACDIDPKAVANALENAARNGI
FT                   KNVEVIESDIFTNVPPHRKFDFIFWNYPSVFAPDDYQYEDNIERGAIDPGYGLLCRYLS
FT                   EGPKFLTEAGSILLGFPGGARDDLLSEIIGANDLTAEFLGAGNHPRVSQINRMFSLRKR
FT                   GLSV"
FT   misc_feature    260169..260698
FT                   /note="REGION CONTAINS TWO FRAGMENTS OF METHYLMALONYL-COA
FT                   MUTASE BETA SUBUNIT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    260752..261130
FT                   /note="REGION CONTAINS TWO TRBL GENE FRAGMENTS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    261214..261477
FT                   /note="TRBF FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            261793..262200
FT                   /gene="msi217"
FT   CDS             261793..262200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi217"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31622.1"
FT                   /translation="MLHPGAGKLARPETRTGYKRKFKQLIWALLNNGAIPDSAILEILS
FT                   TKLDKLAPKPGKVPVVDEVEEFEGAIVQEFAADGRAIALRHICAYRDRTSKSVLSGSKN
FT                   YSKPGWSLGQSRTSGPWPGSIRRVGRQNASS"
FT   gene            262379..262636
FT                   /gene="msi218"
FT   CDS             262379..262636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi218"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31623.1"
FT                   /translation="MGKRVAGQAHRRRYLAVGETFEQVFTSREYDSASRTCVRILIETF
FT                   NAERLELDDVLKLLAVPTSRTAVRRFISSLMPRPPSATSQ"
FT   gene            262652..262957
FT                   /gene="msi219"
FT   CDS             262652..262957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi219"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31624.1"
FT                   /translation="MGAVFAEAAKHSTEKTLHELWGRVFPHKTNEAISKGLGELNGSKE
FT                   VSHAARLIDFSKDHQATPFEFVEACSRESPTATAAERTELNAYLLIMCSQWDLADR"
FT   gene            263055..263252
FT                   /gene="msi220"
FT   CDS             263055..263252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi220"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31625.1"
FT                   /translation="MSHTWDLNKRLLKLLRNACRDGANIEGLIEPLAFSEIELLYVFDE
FT                   DNNNDLKTLISRFLWPVYRA"
FT   misc_feature    263621..263911
FT                   /note="FRAGMENT OF ORFB IS3 FAMILY"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            264154..264351
FT                   /gene="msi221"
FT   CDS             264154..264351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi221"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31626.1"
FT                   /translation="MPRQPTTYQFDLFSNPHDAPTAQMPPWQALPEETRLTLRTLMVRL
FT                   ILDHVDGERAVPREEARHGA"
FT   misc_feature    264354..266358
FT                   /note="REGION CONTAINS TWO FRAGMENTS OF AN IS ELEMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    266436..267174
FT                   /note="REGION CONTAINS 3 FRAGMENTS SIMILAR TO ORFB IS3
FT                   FAMILY"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    267279..268061
FT                   /note="REGION CONTAINS THREE TRANSPOSASE FRAGMENTS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    268066..268251
FT                   /note="TRANSPOSASE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    268542..268828
FT                   /note="INSERTION SEQUENCE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    268739..269523
FT                   /note="REGION CONTAINS TWO FRAGMENTS OF AN IS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    269531..271073
FT                   /note="REGION CONTAINS TWO TRANSPOSON FRAGMENTS SIMILAR TO
FT                   RHIZOBIUM SP. NGR234A PNGR234A Y4BL"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    271245..271421
FT                   /note="FRAGMENT OF ORFA IS3 FAMILY"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            272057..273277
FT                   /gene="msi222"
FT   CDS             272057..273277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi222"
FT                   /product="PUTATIVE TRANSCRIPTION REGULATOR ARAC-FAMILY
FT                   PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31627.1"
FT                   /translation="MAKAFIFATTDRTSTRARLEVSINEALMRNMQTASFRCNFYLLPA
FT                   FSLYAFSSAIEVLTLANEATGQNAYSCQVVSGDGQPVTSSCGITISPAVGLRSERDRNL
FT                   RSTPAPIAIVCGGRSLPRNDSKLEAWLRECRHRRARLVGIGGGTFVLARAGVAEGRRCA
FT                   VHWEQFPLFQEQFLSVIATQAAFERDGDLYTCSGGDASFDTFLDLVGRDHGVAVVNRIC
FT                   EKAVACRVRSAGDRQRLPPNSRIRFNHKAVVQIIDQMEAHICDPKSINGLVAAIGLTRR
FT                   QVERLFKRELGRTPSRYYLELRLERAQLLLRTSRLSVIEIAIACGFVSASHFAKVYRIM
FT                   HGCAPHQTRLFLREVGQDHPYNPLVGGQLGEKPGHIPATANRRLGDDIAEVAACASRLS
FT                   SNTQRSS"
FT   misc_feature    273662..273790
FT                   /note="REGION CONTAINS FRAGMENT OF IS SIMILAR TO RHIZOBIUM
FT                   SP. NGR234 PNGR234A ORF Y4QI"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    273890..274629
FT                   /note="REGION CONTAINS TWO FRAGMENTS OF
FT                   INTEGRASE/RECOMBINASE SIMILAR TO M. LOTI MAFF303099
FT                   MLR9324"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    274636..275491
FT                   /note="REGION CONTAINS TWO FRAGMENTS OF
FT                   INTEGRASE/RECOMBINASE SIMILAR TO M. LOTI MAFF303099
FT                   MLR9323"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    274866..275826
FT                   /note="REGION CONTAINS TWO FRAGMENTS OF
FT                   INTEGRASE/RECOMBINASE SIMILAR TO M. LOTI MAFF303099
FT                   MLR9321"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    276950..277593
FT                   /note="REGION CONTAINS 3 FRAGMENTS OF IS SIMILAR TO
FT                   RHIZOBIUM SP. NGR234 PNGR234A ORF Y4QI"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            277743..278984
FT                   /gene="msi223"
FT   CDS             277743..278984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi223"
FT                   /product="PUTATIVE INTEGRASE/RECOMBINASE PROTEIN"
FT                   /function="elements of external origin; phage-related
FT                   functions and prophages"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31628.1"
FT                   /translation="MNASDYLQRSTLYRKLIHGPYGEFARVYAGRLSDEGFGRQCTWRS
FT                   LSLFRELRDWHVGNGHDLQDLSEVHVERFLEHRSKHWSIDSGDRSALRRLLAALRQEGL
FT                   IPTALPIERTEYEQIVDVFAAYLTNERGLAASTVESHKLLSRRFLQEVCPAGADGFAAL
FT                   TPEIVIGYVERHALDGSADSGKAMCGVVRAFLRYLHLKGFISVALADCVPSIRRWRLAG
FT                   LPTFLPPQKVQVVLDACDLTTAMGLRDYAVLMALAKLGLRAGEVAALSLDDIDWQLGSV
FT                   LIHGKGRRQAMMPLRHDVGAAIVAYIRHGRPASPCRRLFLRMLAPHVGFASGCAITMIA
FT                   KEALERAGIHGYAHHGAHLFRHSLATDLLRSGASFAEIGQLLRHRSIDSTRIYAKLDIE
FT                   KLRELSLPWPGGVQ"
FT   gene            278981..279904
FT                   /gene="msi224"
FT   CDS             278981..279904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi224"
FT                   /product="PUTATIVE INTEGRASE/RECOMBINASE PROTEIN"
FT                   /function="elements of external origin; phage-related
FT                   functions and prophages"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31629.1"
FT                   /translation="MSRLRTALERYVGMRQGLGYKYHGPARRLSDFVTFMEARGAETVT
FT                   TALAMKWVTLIGQQPSWSIRLTDVRCFAQHLAHFDPMTEVPPQDAVSPARRAKPYIYND
FT                   AEITALLAAALSLPPANALRRWTYHCLFGLIAVAGLRHSEALDLRRDDVDLDQGILTIR
FT                   ETKFGKSRLVPLHATTVAVLSDYAARRDVHLVAPRSPYFFVAEQGGRLLHQYVHRVFWQ
FT                   LSRQIGLRQRGQRNGPRIHDLRHRFAVQALTNWYRAGEDVERELPVLSTFLGHANVRDT
FT                   YWYLSAAPELMTHAARLLDERWEVRS"
FT   gene            279901..280902
FT                   /gene="msi225"
FT   CDS             279901..280902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi225"
FT                   /product="HYPOTHETICAL INTEGRASE/RECOMBINASE PROTEIN"
FT                   /function="elements of external origin; phage-related
FT                   functions and prophages"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31630.1"
FT                   /translation="MSASNDLAVLIERWFTDRLMRHRGVSSNTIASYRDTFRLLFAFAQ
FT                   TRLGRSPSQLTLRDLDAPFIGAFLEDLETLRSASVRTRNLRLTAIRSFFRYASFEEPAH
FT                   SAQIHRVLAIPSKRCDKRQLQFLTRPEIEAILACPDRSTWLGRRDHTLLLLAAQTGLRV
FT                   SEIIDLDRHSVMLGHGAHVRCVGKGRKERSTPLTKVAQQALRGWLNEPRKRGATALFPN
FT                   MHGSKLSADGVQALLNKYVAKAREHCVTLRSKRVSPHVLRHSAAMELLQAGVDCSVIAL
FT                   WLGHEAMETTLTYLHAHLELKESALAKLKPYERAKAERFRPNDRLLEFLNAL"
FT   misc_feature    281018..281125
FT                   /note="REGION CONTAINS FRAGMENT OF IS SIMILAR TO RHIZOBIUM
FT                   SP. NGR234 PNGR234A ORF Y4QI"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    281162..281506
FT                   /note="REGION CONTAINS THREE TRANSPOSASE FRAGMENTS SIMILAR
FT                   TO M. LOTI MAFF303099 MLL5967"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    281396..281500
FT                   /note="GENE FRAGMENT SIMILAR TO M. LOTI MAFF303099 MSL5966"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(281867..283045)
FT                   /gene="msi226"
FT   CDS             complement(281867..283045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi226"
FT                   /product="PUTATIVE HYDROLASE/PEPTIDASE PROTEIN"
FT                   /function="macromolecule metabolism; macromolecule
FT                   degradation; degradation of proteins, peptides,
FT                   glycopeptides"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31631.1"
FT                   /translation="MNTSPTLNEPVNTEMNFPAEEYRARVQRTQEEMVKHDLPVLLLHQ
FT                   PENIYYLSGLHGVGYFSYHALAVPGSGDPVLILRDVEVPAAQSTSWVKSHATYSDVADP
FT                   LAAWLDTARRALEGLGSAEGRVGVDDHSWFLTPERRTVLQRVLCDASVVAEPRIVDHLR
FT                   LIKSPREIDYLRGASRLVEAGMHAGIEAIALGVTERQIANEVWSALVKGGSPAMGLGGV
FT                   ITSGNRTNLIHGGYSDRRLERGDTVYFELNGLHQHYWARLMRTAIVGQPSAEQQHIAET
FT                   IIRVQDDAIALMRPGTPASVIDRACREPLLATGLRKTYTNRSGYSLGLNYRPSAGEFIR
FT                   EFVPGVEWVLEPGMVFHMLMMAAGMGFSETVLVTEQGPERLTCMERKLFSCT"
FT   gene            complement(283052..284863)
FT                   /gene="msi227"
FT   CDS             complement(283052..284863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi227"
FT                   /product="PUTATIVE CONTAINS TWO ABC TRANSPORTER PERMEASE
FT                   DOMAINS PROTEIN"
FT                   /function="cell processes; transport of small molecules"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31632.1"
FT                   /translation="MATPYHVVRSAIAWPVNNREASLLLAPAALLLGVFFFIPLSGLLS
FT                   LSLLDPGPTFAHYHEFLDNPTNWIILARTFALATKVTLICLLLGYPLAYWIVSARTWVA
FT                   AALLLAVVLPFFTSYLVRTYAWMVLLGRFGVINQLLMATGLTERPVDLIYNQFSVLVAM
FT                   VYILMPYTVLVLISVMKGIPYSLTRAAASLGASAAQNFWRVFFPLSAPGVIAAGLLVFV
FT                   FALGFYITPVLLDGPNTMILPMQIDSYVNGTLNWPLAATAATVLLAITLVLYSISNRFV
FT                   DSERLLSSNQSTAHSAGHTARHSTSAYIQLIDFVAALVRGVGHGIRFPAGIGRGWERLA
FT                   PGRKLLRGLSLLLVAFLVSPILIIVPISFSSSRFLDFPPPGLSLQWYQAYFTSAAWVSA
FT                   TWESLGVGIAVACLSLAIGSAAAMALVRGSPRMRRIGYQLLLAPMIVPSIVNAVALYFL
FT                   FARLHLINTSFALVTAHSIGAVPLVVLIVAASLQSQNIILEYAAASLGASRVVTIWRIV
FT                   LPLIRPALIVSGFFAFLSSFDEVVLSLYLSGPDTTTLPIKMWSGIREEITPTIAAVSSL
FT                   LIAFTIFIYVSVAIFRQAGERQAQQVR"
FT   gene            complement(284863..285978)
FT                   /gene="msi228"
FT   CDS             complement(284863..285978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi228"
FT                   /product="PUTATIVE ABC TRANSPORTER PERIPLASMIC BINDING
FT                   PROTEIN"
FT                   /function="cell processes; transport of small molecules"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31633.1"
FT                   /translation="MTYNINPSRPTRRQTLKLIGTATSGAALAIGAPGILRAQESKLVV
FT                   VSGGGSYEESIRKAIIDPFQQETGITVTYVSPEDDAKLKAQVDSNNVQWDVAEVDTFAF
FT                   RPDASKYLEEIDYGVFDKETLDNLVPEAKTTYGVGSYVYSTVMAFSTTEYPANKPRPRS
FT                   WAEFWDADKFPGPRSLKTCSNSDVTTIEFALLAAGVPKDKLYPIDFDSGFASLDRIKSH
FT                   ITKFWSVGAEPGQLLSNREVSMSSAYNGRMAALKTQGAAVDYQWNEGELSPVYWVVPRG
FT                   AKNRAAAMRFVAYQASAQAQARLNNLIFYGPMNRAAFKYIDPKVAADLPTTPENIAKQF
FT                   FRDLSYWETKDLSGKSNTEILVERWIKWTAS"
FT   gene            complement(285991..287178)
FT                   /gene="msi229"
FT   CDS             complement(285991..287178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi229"
FT                   /product="PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN"
FT                   /function="cell processes; transport of small molecules"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31634.1"
FT                   /translation="MPRGEPLRLERLCKQYGSVRGVNDLSVQIEAGEFVSFLGPSGSGK
FT                   TTTLMMVAGFETPTSGQIFVGARPITGLPVPRRNIGVVFQNYALFPHLSVFENVAFALK
FT                   MRRVSGSELRAGVAEALDLVQLSGYEARMPHELSGGQQQRVALARALVFRPGVVLMDEP
FT                   LGALDKQLREHMQLELKRLQKSLGITVVFVTHDQSEALTMSDRIVVMNKGNVEQIGTPE
FT                   EIYETPQTRFVAGFIGESNFLRTHIVESRKDGPLLDLAGLQIRAMWQGSDSLQGAVTLM
FT                   IRPDKIIPLDPGVRTDNEFEGVVEEAVYQGNVIKYRIRLRAKIPVFLTLAAPSHARSQR
FT                   FHVDQQVRIGWDARDGRLLSDEGEQSIPGKPNNRVAVSAFAGVTATADRMAIVSL"
FT   misc_feature    287435..288254
FT                   /note="REGION CONTAINS TWO TRANSPOSASE FRAGMENTS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(288656..288913)
FT                   /gene="msi230"
FT   CDS             complement(288656..288913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi230"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31635.1"
FT                   /translation="MAKLMRPVIGIVSNVNKNKGGQEVTFVRLPYLRQSKKLTHFRSFS
FT                   LLKAEEVMTVLHCIFSVVLRGGGKFSTEFLAQLRAVLFHE"
FT   gene            complement(288925..290139)
FT                   /gene="msi231"
FT   CDS             complement(288925..290139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi231"
FT                   /product="PUTATIVE HYDROLASE/PEPTIDASE PROTEIN"
FT                   /function="macromolecule metabolism; macromolecule
FT                   degradation; degradation of proteins, peptides,
FT                   glycopeptides"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31636.1"
FT                   /translation="MQKVRTSRGGATTKEPTTVTEHTNSGMDFPVEEYKTRLQRTQEEM
FT                   AKHDLDVLLLHQPENIQYLTGLDAGAGFFSYHAVAVPSHRDPVLILRDVEIPAAYLTSW
FT                   VTSHTSYADSSDPIRVSLDAARRALEGLGLAAGRVGVDEHSWFLTLERWKMLQALLPNA
FT                   TFVREPRIVDHLRLIKSPREIDYLRGAARCVEAGIYAGIEAVTPGITERQLAGTVFGAL
FT                   VNAGAEMPLSGVITSGNRTNLLHGSYTDRQLERGDTVYLELSGIHRHYWARLMRTAIVG
FT                   LPSAEQQHIAETIIRVQDDAIALMRPGTPASVIDRACREPLLATGLRKTYTNRSGYSLG
FT                   LNYRPSAGEFIREFVPGVEWVLEPGMVFDMLMMAGGMGFSDMVLVTEQGPERLTCMERK
FT                   LFSCT"
FT   misc_feature    290602..291384
FT                   /note="REGION CONTAINS TRANSPOSASE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    291978..292981
FT                   /note="REGION CONTAINS TWO TRANSPOSASE FRAGMENTS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(293025..293606)
FT                   /gene="msi232"
FT   CDS             complement(293025..293606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi232"
FT                   /product="PUTATIVE INSERTION ELEMENT TRANSPOSASE PROTEIN"
FT                   /function="elements of external origin; transposon-related
FT                   functions"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31637.1"
FT                   /translation="MGPPDGRHQRRPRRRHTDDRQHFHPGAPAGCDGKKGGPDHCLGQS
FT                   RSGLTTKIHVVDDAQGLPIRLGLTAGQAHDGQIADRLLDHLGPRTIVLADKAYDADRIR
FT                   ALIQGQGATPNIPAKSNRKWKPCFSKRLYRERNLIERFFSKLRHFRRVSTRYEKLADNF
FT                   LPMVQLASIRLWLRAYESSCNLWLLPSGLG"
FT   gene            complement(293402..293821)
FT                   /gene="msi233"
FT   CDS             complement(293402..293821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi233"
FT                   /product="PUTATIVE INSERTION ELEMENT TRANSPOSASE PROTEIN"
FT                   /function="elements of external origin; transposon-related
FT                   functions"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31638.1"
FT                   /translation="MSRYDLTDFEWRVIEPLLPNKPGGMPRVDDRHVLNGIFWVLRSGA
FT                   PWRDLPERYGPRTTCYNRFARWRKAGVWDRLMDAISAAHDGAIQMIDSTSIRAHQQAAT
FT                   AKKGGQIIVSVNRAVGSRPRSTSSTTRKGSQSGSV"
FT   misc_feature    294262..294720
FT                   /note="TRANSPOSASE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(295006..295530)
FT                   /gene="soxG1"
FT   CDS             complement(295006..295530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxG1"
FT                   /product="PUTATIVE SARCOSINE OXIDASE GAMMA SUBUNIT PROTEIN"
FT                   /function="small molecule metabolism; degradation"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31639.1"
FT                   /translation="MSDFELIHRPAISTKPVGSSDAFAMKAMPEGTLIHILGKPGAENL
FT                   TATLQGLFGGEANRIRTFGPGQWLVVRDEPTSRSDMQALFERLDTRAFAVDQTHGRIRI
FT                   EVAGRAVQSLLAKGTAIDLNAVAVGQSAMTLMGHISVHITRVALNRFELIVLRGFGQSL
FT                   WDEIAHLNADF"
FT   gene            complement(295523..298489)
FT                   /gene="soxA1"
FT   CDS             complement(295523..298489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxA1"
FT                   /product="PROBABLE SARCOSINE OXIDASE ALPHA SUBUNIT
FT                   TRANSMEMBRANE PROTEIN"
FT                   /function="small molecule metabolism; degradation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31640.1"
FT                   /translation="MTSYRLPKGGLIDRQSRLGFSFDGQSVTGHAGDTLASALLANGRQ
FT                   LVGRSFKYHRPRGILTAGAAEPNALMTIGSGGRTEANTRATMQDLYDGLEARSQNRWPS
FT                   LDFDIGSLNGLLSPFLAAGFYYKTFMWPAKLWEGLYEPFIRRAAGLGKATYEADPDRYE
FT                   KRWAHCDLLVIGAGPAGLAAALSAGRAGARVIILDEHSLAGGSLLSEAATIGGESAPAF
FT                   AKRLADELETLPNVRVLTRTTAFGWYDGNVVGAVERAQKHVRHPDPNKPVERMWRIVAK
FT                   KALLATGTEERPLVFGGNDIPGVMIAGAMRCYLNRFAVAPGQRTAIFTTNDSGYALARD
FT                   LEAAGVQLTAIIDSRAESQFVYTGKARLLKGAVVSDAKGGKALSSVNVTAANGATEAIA
FT                   VDALAMSGGFSPIIHLACHRGGKPQWSDVHGAFMAPSETRGLVLAGAVTGTTGLSASFA
FT                   EGAARGATMAQDLGFAAQPFDAGPVDGDIVASPASPLWNIRGVKGKAFVDFQNDVGRKD
FT                   LGLAVQEGYGDVELAKRYTTSGMATDQGKLSNVTAIGLLAEARGVSPAEVGTTTFRPFY
FT                   TPISFGALTGPHHGHHFQPVRKSPLHDWAKKHGAVFVETGLWYRSSWFPRAGETSWRQS
FT                   VDREVLNVRTNVGICDVSMLGKIEVCGKDAAEFLNRVYSNAFLKLPVGKARYGLMLRED
FT                   GFIYDDGTTSRLADDRFFMTTTTAYAAGVMTHLEFCAQGLWPELDVRLASVTDQWGQMS
FT                   VVGPKARATLQAIVDGDISDTAFPFLAAKEVSLFGGRLHGRLFRISFSGELAYELAVPA
FT                   GYCESVADGVLQAGKEHGIQPYGVEALSVLRIEKGHVTHNEINGTVIPSDLGFAKMVST
FT                   AKPDFIGKAMLGREGLVAQDRPSLVGVVPLDPTTTFRTGSHILAKGAAQTLENDQGYVS
FT                   SSAFSPHVGSTIGLALVKSGHARHGEEVVVWNGLSKEFTVARLCNPVFFDPANEKLHV"
FT   gene            complement(298489..298764)
FT                   /gene="soxD1"
FT   CDS             complement(298489..298764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxD1"
FT                   /product="PROBABLE SARCOSINE OXIDASE DELTA SUBUNIT PROTEIN"
FT                   /function="small molecule metabolism; degradation"
FT                   /EC_number="1.5.3.1"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /note="predicted by Homology"
FT                   /note="predicted by FrameD"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31641.1"
FT                   /translation="MASLIPCPHCGSRPKEEFTVKGAALARPAPDAGTAAWIDYVYLRD
FT                   NPRGAYEEYWHHTSGCRRWLVVSRNTATHEISGSRDVVLKLSAEAL"
FT   gene            complement(298783..300033)
FT                   /gene="soxB1"
FT   CDS             complement(298783..300033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxB1"
FT                   /product="PROBABLE SARCOSINE OXIDASE BETA SUBUNIT PROTEIN"
FT                   /function="small molecule metabolism; degradation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31642.1"
FT                   /translation="MRYSALSIFLNGLRGNTGWGPAWRAPQPKSHYDVIIVGGGGHGLS
FT                   TAYYLAKEFGVANVAVLEKSYIGSGNVGRNTTIIRSNYLLPGNNPFYELSMKLWEGLEQ
FT                   DFNFNAMVSQRGVLNLYHSDAQRDAYTRRGNAMLLHGVDAELLDREAVRAKLPFLDFDN
FT                   ARFPIQGGLLQRRGGTVRHDAVAWGYARGADMRGVDIIQHCEVTGIRRENGKVLGVETT
FT                   RGFIGCGKLALAAAGNSSRVAEMADIKLPLESHVLQAFVSEGLKPFIDCVVTFGAGHFY
FT                   VSQSDKGGLVFGGDIDGYNSYAQRGNLATVEHVAEAGKAMIPGISRVRVLRSWGGIMDM
FT                   SMDGSPIIDRTHINNLYLNAGWCYGGFKATPASGLCFAHLIARGTPHETARAFRLDRFA
FT                   RGHILDEKGQGAQPNLH"
FT   gene            300129..301085
FT                   /gene="msi238"
FT   CDS             300129..301085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi238"
FT                   /product="PUTATIVE TRANSCRIPTIONAL REGULATOR PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31643.1"
FT                   /translation="MTVELDRQTQRFGFLLLPNFALMSYASATEPLRAANLLAGRSLYT
FT                   IRQLSQGGLPVQSSGGIDIACDDLSSAGAEFHTVFICAGGDPSNWAEADRLFRALRRLS
FT                   RLGVRLGAISSGAYILAAAGLLDNRDFTIHWEHAPILREAYPALALRQARYVIDGDRIT
FT                   CGGGVAPLDMMHALIAERMGAHFASRVSDWYLHTAIADPSDPQRGSAAERFGTHNPILL
FT                   AALEKMEATIENPLDREAMAHFLSISSRHLDRLFTQHLSAGFLQTYRRIRLDHARRLIE
FT                   QSPLAIAEIAFATGFSSTGHFSQAFKAHYGRAPSSLR"
FT   misc_feature    301117..301775
FT                   /note="REGION CONTAINS TWO TRANSPOSASE FRAGMENTS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   mobile_element  302454..303516
FT                   /mobile_element_type="insertion sequence:msi437"
FT                   /note="predicted by Homology"
FT   gene            302520..302786
FT                   /gene="msi239"
FT   CDS             302520..302786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi239"
FT                   /product="PUTATIVE TRANSPOSASE FOR INSERTION ELEMENT
FT                   PROTEIN"
FT                   /function="elements of external origin; transposon-related
FT                   functions"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31271.1"
FT                   /translation="MKRKRFTEEQIIAVLREHEAGAKAGDLARKHAISEATLYNWKAKY
FT                   GGMDVSDAKRLKALEDENAKLKKLLADQMLEAAALKELLSKKW"
FT   gene            302780..303709
FT                   /gene="msi240"
FT   CDS             302780..303709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi240"
FT                   /product="PUTATIVE TRANSPOSASE FOR INSERTION SEQUENCE"
FT                   /function="elements of external origin; transposon-related
FT                   functions"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31272.1"
FT                   /translation="MVGPAARREAVAHLQAVMGLSERRACSIVGADRKMVRYRSCRPPE
FT                   TELRGRLRELANERRRLGYRRLFILLRREGEASGVNRIYRLYREEGLTVRKRRARRRAV
FT                   GTRAPILVEARPNARWSLDFVHDQFACGRRFRVMNIVDDVTRECLAAIPDTSISGRRVA
FT                   RELTDLISLRGKPDMIVSDHGTEFTSNAILAWSKDHRVEWHYIAPGKPMQNGYIESFNG
FT                   RMRDELLNESLFFGLDHARCAITEWVEDYNTARPHSSLGYQTPAAFAEVLTATGSNAAL
FT                   DVGFASPPVAQPAPYGVTETVEALIAAG"
FT   gene            complement(303825..304691)
FT                   /gene="msi241"
FT   CDS             complement(303825..304691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi241"
FT                   /product="PUTATIVE AMINO-ACID ABC TRANSPORTER ATP-BINDING
FT                   PROTEIN"
FT                   /function="cell processes; transport of small molecules"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31273.1"
FT                   /translation="MTATDIDHLIGLNGGDSSMATGNVRRIPVSSQALSGQKQVPMSAD
FT                   KIIEATHVSKWYGSFRALTDVNLTVRKGERIVICGPSGSGKSTLIRCFNRLEANQEGEI
FT                   RVNGMLLHNKMRNVTEVRKNVGMVFQHFNLFPHMTVLMNCMAGPMWIKGVPEAQAKQTA
FT                   LKYLERVRIPEQANKYPVQLSGGQQQRVAIARSLCMEPAVMLFDEPTSALDPEMVSEVL
FT                   ETMTSLARDGMTMVCVTHEMGFARAVADRIIFMDKGRIVEEANPNDFFTNPHHERTRLF
FT                   LSQILSH"
FT   gene            complement(304688..305569)
FT                   /gene="msi242"
FT   CDS             complement(304688..305569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi242"
FT                   /product="PUTATIVE AMINO-ACID ABC TRANSPORTER PERMEASE
FT                   PROTEIN"
FT                   /function="cell processes; transport of small molecules"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31274.1"
FT                   /translation="MFNLSGTAFGDLMRPVIGDPLQSGIYGRVAIAFVIAVMFCVNIVL
FT                   IGFAPLRVQIGIVWAELLLLFLGFFNAFNLNMPFIWEHLPYLITQGVVTTIYVSAVSLI
FT                   FASIIAMIAAIAKLSSNGFAYALASFYTSFFRGLPLLIQIYLIYLGLPQLGIVINAVPS
FT                   GILALSLCVGAYMTEIFRAGIQSIDRGQWEASRSIGFGFGLTIRKIILPQALPVIIPPM
FT                   GNTFIAMLKDSSLVSVLGVWELTFLARTIGQPTFHHMEMLITAAMIYWILSACLEVLQS
FT                   RLEHHFARSKVR"
FT   gene            complement(305724..306557)
FT                   /gene="msi243"
FT   CDS             complement(305724..306557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi243"
FT                   /product="PUTATIVE AMINO ACID ABC TRANSPORTER PERIPLASMIC
FT                   BINDING PROTEIN"
FT                   /function="cell processes; transport of small molecules"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31275.1"
FT                   /translation="MKKIKMAVTAVLIALTSVAFGPSAHAGEVLDRILTSKTLRVAAGA
FT                   DWGLIAHLDEKNELVGYDIDVAKGIAKYLGVNAEFVTPGWDLIAAGNWAGRWDIGTGQM
FT                   APTKARADKFDFSVPYFYDRTVIVVHKDSKATKGSDLEGKKIGVNGGTVAEAYANQTYT
FT                   PDDPNAAPVPYDFKAGEVKTYGNSTIAFDDLRLGDGVRLDAVITDETFTEGAIKSGYPI
FT                   KIIDRLFALPAAIPMMKGDKELVEKVSAAIKSMRDDGTLSKLSVKWYGSDHSVAK"
FT   gene            complement(306612..306797)
FT                   /gene="msi244"
FT   CDS             complement(306612..306797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi244"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31276.1"
FT                   /translation="MTTANESLLGLETKTSGAMCERLDTVRSHLAWDLVSIGSHWLSVY
FT                   PHDSETSYHEEAGSEI"
FT   mobile_element  307015..308684
FT                   /mobile_element_type="insertion sequence:msi442"
FT                   /note="predicted by Homology"
FT   gene            307155..308489
FT                   /gene="msi245"
FT   CDS             307155..308489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi245"
FT                   /product="PUTATIVE TRANSPOSASE FOR INSERTION ELEMENT
FT                   PROTEIN"
FT                   /function="elements of external origin; transposon-related
FT                   functions"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31277.1"
FT                   /translation="MRQERTVQSSVFDLFAGHEIGCELKAMSQWLDGHRELLSLVTRDL
FT                   RRHDLKETGREGLPAEAVLRCALLKQHRQLSYQELAFHLEDSASFRAFARLPWGWSPKK
FT                   SVLHKTISAIQAPTWEEINKVLLASAGREKLEGGKVVRVDSTVTAALVHEPSDSSLLWD
FT                   AVRVMVRLLQHADALGSAIPWHDHCRAAKKRSRSIEYTRGRPKRVKHYRELLRITRTTL
FT                   GYLQQAAEQLTLAACPAVELWQAQVRHYRPLIERIIAQTERRVLAGEPVPAGEKLVSLF
FT                   EPHADIIVKGSRDVDYGHKINLTTGRSGLILDLVIEAGNPADSERLLLMLERHIAFYGE
FT                   PPRQAAADGGYASRPNLRQAKAWGVRDMAFHKKSALRIEDMVSSRWVYRKLRNFRAGIE
FT                   ASISCLKRAYGLARCTWRGLNHFKAYVWSSVVAYNLALFTRLRSN"
FT   misc_feature    308804..308995
FT                   /note="REGION CONTAINS INSERTION SEQUENCE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(309356..310585)
FT                   /gene="kbl"
FT   CDS             complement(309356..310585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /product="HYPOTHETICAL 2-AMINO-3-KETOBUTYRATE COENZYME A
FT                   LIGASE 2.3.1.29 PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /EC_number="2.3.1.29"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31278.1"
FT                   /translation="MTQTFLAHLRRELADLKSGGLYKSERVISSRQSREIRVANGNSVL
FT                   NFCANNYLGLADNEEIADAAKKALDRYGFGMASVRFICGTQEEHKQLEARISGFLGMED
FT                   TILYSSCFDANGGLFETLLGEEDAIISDALNHASIIDGARLSKARRFRYANNDMKALEE
FT                   ELKKADGARFKLIATDGVFSMDGIIANLRGVCDLADRYDAMVMVDDSHAVGLVGEHGRG
FT                   SAEYCGVEGRVDIITGTLGKALGGASGGYTSGNSEVIDWLRQRSRPYLFSNTLAPVIAA
FT                   ASLKVFDIVDRAGVLRQKLYDNGRRFRSEMTKAGFTLVGADHPIIPVMLGDASVAQQMA
FT                   EMMLLRGIYVIGFSFPVVPKGQARIRTQMSAAHTLADVDFAVECFVEVGKELGVIPLRL
FT                   PHLDQNPGTV"
FT   gene            complement(310655..311614)
FT                   /gene="msi247"
FT   CDS             complement(310655..311614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi247"
FT                   /product="PUTATIVE BRANCHED-CHAIN AMINO ACID
FT                   AMINOTRANSFERASE PROTEIN"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; amino acids"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31279.1"
FT                   /translation="MTLATTDATVGVPEVETTHKDTRRYPHGVAFMDGQYLPMSEAKIS
FT                   VLDWGFLHSDATYDTVHVWEGRFFRLDLHLDRFFRGMDRLRMKLPYHRREVERVLSNCV
FT                   ALSGHKSAYVEMICTRGGSPTFSRDPREAENRFIAFAVPFGSVANKEQLERGLHVGVSE
FT                   TVRIPPKSVDPTIKNYHWLDLVRGLYDAYDVGAETALIMDTNGNIAEGPGFNVFTVKNR
FT                   QLKTPAFGVLPGITRQSVFDLCGEVGLAVTAADLPRLELGEADEVFITSTAGGIMPVTR
FT                   VDGSSIGSGKVGVVTRQLMDLYWQKHSDDAWSTPVKYA"
FT   gene            complement(311937..312392)
FT                   /gene="msi248"
FT   CDS             complement(311937..312392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi248"
FT                   /product="PUTATIVE TRANSCRIPTION REGULATOR PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31280.1"
FT                   /translation="MLDDLDRRLIAALQKNNRLSFAELAELVGSSAASCMRRVNKLRAD
FT                   GVIIADIALVDPKALGKSLTVVVNVELDRERLDLVDEFKRAMRAAKEVTQCYMVTGEAD
FT                   FVLIVTVEDVEAFDVFVKTKLYTNPNVRKFRSMITLDRVKFEPRILV"
FT   misc_feature    312771..313034
FT                   /note="REGION CONTAINS D-ALANINE DEHYDROGENASE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(313141..314298)
FT                   /gene="msi249"
FT   CDS             complement(313141..314298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi249"
FT                   /product="PUTATIVE HYDROLASE/PEPTIDASE PROTEIN"
FT                   /function="macromolecule metabolism; macromolecule
FT                   degradation; degradation of proteins, peptides,
FT                   glycopeptides"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31281.1"
FT                   /translation="MSAAFTREEYRQRTRRLRQRMAERGIDTLLVLNESNMNYLTGYEG
FT                   YSDYVPQLALVSQDEEDPWLILREIDTFCATPTSYLPESRVLSYPEQYIGSSERTPWQP
FT                   IADLIRERSKSNRLGVEMGAKILGMKSYAALANNLDMSKAIDADGMVATLHRVKSPAEL
FT                   AYMEQAGKIADRALQAGRLEISVGARECDVAAAVQSALIRGTPEFPGGPCYGALTMPVG
FT                   SPANAPHLKWSDATYRLGCQTNFEIGAFRHRYACALSRTIFLGEPSARAQHLHRAALDG
FT                   FLSEFDAIRPGVKCSDVSHAFKRAFEPYGVRKESRSGYSTGIDWSGDLSFNPDDHTVIE
FT                   ANMTFHVLIGIWEKEDGYIFSETVRVTETGAKSLSNMSRKLLVNY"
FT   misc_feature    314628..314885
FT                   /note="REGION CONTAINS 2-AMINO-3-KETOBUTYRATE CONENZYME A
FT                   LIGASE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(315031..316431)
FT                   /gene="msi250"
FT   CDS             complement(315031..316431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi250"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31282.1"
FT                   /translation="MQPLLKLADFVATFPPKSLPVPTTQTISTLMLDLIGAAGAGLHSP
FT                   LARAARASALNAYGEGSVRIWLTNRTSSVVGAAMANSAAASALDIDDGHRGAAGHAGAG
FT                   VIPAALAVAEAVGGSSSEVSEAIALGYEIALRVASSRPAESVDTYASGRWVNYGAAAAA
FT                   ARLLKLTANETAHALGIAGGEGPIVFTAPSPKFEGSTIKEGIPPAVVAGITAAYRAREG
FT                   ATGPLDLFNDEVRFDRNVLLGGLGSSWEAQNCYLKPYACCRYMHAAVDAIISMRRRGTE
FT                   IKTLRINTFPQAMRLANERAPTNLEGAQYSFYFNCALASLYGAEELQPVALERLTDERV
FT                   LEIANLIELVPSPEFATAFPFGTPARVFLDQGDGVQEMLVLHPLGDVANPMSREQVIHK
FT                   FMNITENLGREWQEDLVAAALNFEEGGLSYLVSSLAAPRQHAYPTARGSRGDPSDLLML
FT                   ERTAGYRT"
FT   gene            complement(316633..317343)
FT                   /gene="msi251"
FT   CDS             complement(316633..317343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi251"
FT                   /product="PUTATIVE AMIDOTRANSFERASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31283.1"
FT                   /translation="MRPLVGIVSNFEVDKKGYFCLENYVRAIEQSGALPIILPYVSEGD
FT                   VGQLLDTLSGIVLTGGGDFPTEFYGADPHPTVQRMIPERDRFEFALARAAFERPVPVLG
FT                   ICRGMQILNVVAGGTIYPHTRDALPEVGDHRDGTPLEQTVHGINIEPNTYLSRLVESPN
FT                   LSFRVNSSHHQAIDRLAPGFVVSARADDGIVEAIEAPDRPFVIGVQWHPEAMFESEPAC
FT                   RSLIQNFAKACGVK"
FT   gene            complement(317365..318525)
FT                   /gene="msi252"
FT   CDS             complement(317365..318525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi252"
FT                   /product="PUTATIVE HYDROLASE/PEPTIDASE PROTEIN"
FT                   /function="macromolecule metabolism; macromolecule
FT                   degradation; degradation of proteins, peptides,
FT                   glycopeptides"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31284.1"
FT                   /translation="MTEAANSRMDFPLEEYRARLHRTQEEMAKYHLPVLLLHQPENINY
FT                   LTGLDDVMYVSYLALVVPSRGNPVLVIRDMEVPAAQNTSWVKDYVVYPDAAIDPLRVSL
FT                   DAAHKALHGLGLAGGRIGLDDHSWFLTAERWKMLQTVLPHANLVAEPLIVDHLRLIKSQ
FT                   REIDYLRGAARSVDAGMRVGLDAIKGGVSERELAVAVYSELTRACTQVPDGCQITSGDR
FT                   TNLIHGWSTDRRLERGDPVYFELNGIHKGYWARLMRTAVVGPATAQQRRVAEKIIGIQD
FT                   EAIALMRPGIPASVVDQACREPILVAGLRQTYTNRTGYSLGLNQRPSTAELIREFLPDV
FT                   KWVLQPGMVFHMVAIAGGMGFSETVLVTEDGPERLTGLDRRLFESA"
FT   misc_feature    319392..319996
FT                   /note="REGION CONTAINS TWO TRANSPOSASE FRAGMENTS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    320027..320356
FT                   /note="IS FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(320515..321069)
FT                   /gene="soxG2"
FT   CDS             complement(320515..321069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxG2"
FT                   /product="PUTATIVE SARCOSINE OXIDASE GAMMA SUBUNIT PROTEIN"
FT                   /function="small molecule metabolism; degradation"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : probable"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31285.1"
FT                   /translation="MANLRPLKALGAENPRYASFAALEIRENLDLALASLALRRKTVAP
FT                   QPFGLNLPRPGRWVADQEVAAFWTGPGQWMVEAEGRAEEDFAADLKEAARGCSVTEQTG
FT                   GWVAVEILSRAGTGPLDALLAKLINIDLAGFGPGRATRTVLDHMTCFVIRRSETHVAVL
FT                   GARSFGASLWHALEIASRRIE"
FT   gene            complement(321062..323995)
FT                   /gene="soxA2"
FT   CDS             complement(321062..323995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxA2"
FT                   /product="PUTATIVE SARCOSINE OXIDASE ALPHA SUBUNIT PROTEIN"
FT                   /function="small molecule metabolism; degradation"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : probable"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31286.1"
FT                   /translation="MTRLSGGLIDRTQTLNFKFDGKRYQGHPGDTLASALLANGVRLIG
FT                   RSFKYHRPRGVLSAGSEEPNALVELRTGPRQEPNTRATTVELFEGLEARSQNRWPSLGF
FT                   DAMAINDLFSPLFTAGFYYKTFMWPKSFWEKVYEPAIRRAAGLGSISMQADPDAYDRGF
FT                   LHCDLLVIGGGPAGLAAALTAARSGARVILAEEDFRLGGRLLCETETLGEAPPLDWISA
FT                   LESEFESLPRLRVMSRTTVFGVYDHGIYGAVERVSDHLAQPRGRVRQTLWRITAKRAIL
FT                   AAGAIERPVAFADNDRPGIMLAGAMRAYANRWAACPSERVAVFTNNENGHRTACDLAAK
FT                   GVEIAAVIDARPEAKARGDYRLIAGGVVTGSRGRLGLTSIEFQTKGRSEWIDCGALGVA
FT                   GGWNPNVHLASHHRGKPTWNELLLAFLPGEYGPSGLRAAGAAAGRFSTAEALRSGAETA
FT                   RCALADIGITAKSLNFPTPEEDAYKIAPVFHVPGRRRAWVDFQNDVTVKDIKLAHAENM
FT                   RSVEHLKRYTTLGMATDQGKTANVIGLAVMAELTGKTIRETGTTIFRPPYTPVALAVLG
FT                   GGDIGPHFHPPHLTPTHRWAEAQGAVFDESSPWRRADYFRRKGETHWRQSVDREAQAVR
FT                   SAVGLCDVSTLGKIDVQGTDAGQFLDRLYSNMMSTLKVGRVRYGLMLREDGFPYDDGTC
FT                   ARLADDHYVVTTTTGNAGLVFRNMDFARQCLWPELDVQLISTTEAWAQIAVAGPRSRAL
FT                   LERVVDGFDLSNYAFAFMACAELTVCGGLRARLFRVSFVGELGYELAVPARYGHALMNR
FT                   LMEMGEDLEVTPFGVEALSVLGMEKGHVGGAQLNGQTTAEMLGLGKMVSQKKDAIGAIM
FT                   SRREGLAGNKRRLMGLQPVEPGSKIVVGSHLFAEGAALNHDTDQGWITSACYSPHVGSM
FT                   IGLAFLENGYERLGEVIMAANPVEGESARLRVVSSHFVDAEGVRLRG"
FT   gene            complement(323992..324327)
FT                   /gene="soxD2"
FT   CDS             complement(323992..324327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxD2"
FT                   /product="PUTATIVE SARCOSINE OXIDASE DELTA SUBUNIT PROTEIN"
FT                   /function="small molecule metabolism; degradation"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : probable"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31287.1"
FT                   /translation="MKAALVRSRTYSEVKMLIPHPVLGLRDAREFAYLGDARLIDRPDP
FT                   SAPDAEAAFCDYVYLRDNPAGAHRELWFHEHGDHSWLVVTRNTITHEILGAELAHDVAL
FT                   ARKRSVK"
FT   gene            complement(324290..325540)
FT                   /gene="soxB2"
FT   CDS             complement(324290..325540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxB2"
FT                   /product="PROBABLE SARCOSINE OXIDASE BETA SUBUNIT PROTEIN"
FT                   /function="small molecule metabolism; degradation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : probable"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31288.1"
FT                   /translation="MRFSGFRVLSEALKGHSGWKPLWRNPDPQPFYDYVIVGGGGHGLA
FT                   TAYYLAKTFRQSRIAVLEKGWLGSGNVGRNTTVIRSNYLLPGNGPFYEFSLKLWEGLEQ
FT                   ELNFNSMVSQRGVIYLFHSDWQRDAYRRRANSMALAGADARLLSREDLKAMLPFLNYDN
FT                   ARFPIHGGFMQPRAGTARHDAVAWGYARGADLYGVDLIQNCEVTGFRIVDGNIRGVETS
FT                   RGFIGANKVGVAVAGSSSRVMAMAGMRLPIESHVLQAFVTEGLKPIIPCVIMFGAGHFY
FT                   ISQSDKGGLVFCGEIDGYNSYAQRGNLPMVEDVCEGAMAVMPMIGRVRLLRQWGGVMDM
FT                   SMDGSPIIDRTGIEGLYFNGGWCVGGFKATPASGHAFAHLLATDTPHETARAYRLDRFA
FT                   RGYLIDESGAGAQPNLQ"
FT   gene            325605..325799
FT                   /gene="msi257"
FT   CDS             325605..325799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi257"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31289.1"
FT                   /translation="MSECGRKGVPLRKWRGYRKKSEDLFVTCQKRASNDELRHADRTWR
FT                   IECCDGLGDLFWATLMRIP"
FT   gene            326635..327672
FT                   /gene="msi258"
FT   CDS             326635..327672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi258"
FT                   /product="PUTATIVE TRANSPOSASE FOR INSERTION SEQUENCE"
FT                   /function="elements of external origin; transposon-related
FT                   functions"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31290.1"
FT                   /translation="MKYFAGLDVSLEETAICVVDESGRIVKEGRAASEPRALYEVLRKI
FT                   DLPLDRIGLEACSLAAWLYDGIRAEGLPAICIETRLANAAMKTMPNKTDRNDARALAQI
FT                   MRTGWYRQVHVKSQQCRRWRSLLVARRTVLNEMRSIENVIRAILREAGIKLGTPSRAAF
FT                   ADRVRELIGADTVVMALVEPLLAIVATMLREFGRLTKQVLNIARKEQVCRRLMSGPGVG
FT                   PITALAFRATVDQPDRFRRSSDVGAHLGLTPARYQSGETDIQGKVSRCGDELARTALYE
FT                   AAHSLLVLSKKWSCLRAWGMNVAKRRGMARARVAVARKLAVILHRMWSDGTEFRFGKAP
FT                   GPVSA"
FT   gene            complement(328149..328991)
FT                   /gene="msi259"
FT   CDS             complement(328149..328991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi259"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31291.1"
FT                   /translation="MATNQARQTPAISPLTIEERTGSISTAEIISVLKGEITALHISQA
FT                   FSTEIAEEITAKFFGSPGLRERKDGVPGQYVGASHYRKDAATYFAEAETARPHVDALFG
FT                   NLVDPVRALFDALKRELHKQGIELRLARSEHGQANVCRALSWTGSGTFSLDPHDDVAQV
FT                   LRAGNDYELSAVAHNTVAALNFYPSMSEEGGNLRLWSHKPTVDDRKSQGVETTGYPYSA
FT                   VYLKDVPCRDIRLKAGDIALLDGGFVHGVTGQAGNGKRRVLLNSFFGFARPDLVLWWT"
FT   gene            complement(328981..330240)
FT                   /gene="msi260"
FT   CDS             complement(328981..330240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi260"
FT                   /product="PUTATIVE DIAMINOBUTYRATE--PYRUVATE
FT                   AMINOTRANSFERASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31292.1"
FT                   /translation="MDIDIFEAYESNVRRYGRSFPTVFTKSLGATIWDESGKPYIDFIV
FT                   GSGALNYGHNNQDIMAPAIQYLANQNIVLSLDMYTTAKRDFIEVFVNSILKPRGLSYKI
FT                   QFPGPTGTNANEAALALARKYTGRSSVMAFTNSYHGMSLGSLAVSGSASTRQLGGVARH
FT                   DVIRVPYENYPNQTFDSASYIDHVLGDPGSGIEKPAAIILEPIQAEGGMNTASAPWLAE
FT                   IQRICRKHDVVFIVDDIQAGSGRTGDFFSFEFAKVEPDIVCLSKSLSGSGNPLSIVLIR
FT                   PEMDIWKPGEHSGTFRGNNLAFVTSAAMCKMWSDRQFTKAVEGTAVKLQEHLDRLVAKF
FT                   PKCIEQKRGRGLMAGLKCRSQAVVGRVHDVAFENGLLIESSGPNRDVIKVLPPITISDD
FT                   ELDHGIAILDQALQEKTNGD"
FT   gene            330857..331090
FT                   /gene="msi261"
FT   CDS             330857..331090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi261"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31293.1"
FT                   /translation="MVFGTHEPTQNRLRPRGSAIDAAIDHPVFATALRGHDGAAFGAQH
FT                   DLRVPTLTLVNIHVIENAGSGDATGDVSDAAF"
FT   gene            331259..331579
FT                   /gene="msi262"
FT   CDS             331259..331579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi262"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31294.1"
FT                   /translation="MITLTENAVAAIKTALSRADEPAEGFRIMVEAGGCAGLKYLLGLE
FT                   SVSREGDAIMETDGFKVFVDANSQPHLAGMTVDFVTDLESSGFVFDNPNARDKCACGKS
FT                   FG"
FT   gene            331606..332067
FT                   /gene="msi263"
FT   CDS             331606..332067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi263"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /note="predicted by Homology"
FT                   /note="predicted by FrameD"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31295.1"
FT                   /translation="MRDNTDNVYLFNDKLYLINPHNVGALDTPNAAGEVGAVACGDGLK
FT                   LIMGFDPKTETITAATFQTFGRGSAITASSTFTEFIVGKTIDEALQITDQDMADFLGAL
FT                   PPHTTYSSLDRLILERGLRLMSEFFRAVRQAFEETPGFSRLVVVKASSP"
FT   gene            332304..332939
FT                   /gene="msi264"
FT   CDS             332304..332939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi264"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31296.1"
FT                   /translation="MPYAVKEIFYTLQGEGRNAGRAAVFCRFAGCNLWSGREGDRARAF
FT                   CEFCDTDFVGVDGPGGGHFATAQEFALAVEQAWRGSGTRQRLVVLTGGEPLLQIDEELL
FT                   EALHSLAFEIAVETNGTIPTLAGIDWLCVSPKCNARLVVMAGDELKLVYPRIGAEPEHF
FT                   EVLAFEHLLLQPMDGPEREANTAAAVAYCLANPRWRLSLQTHKFLGIP"
FT   gene            332936..333289
FT                   /gene="msi265"
FT   CDS             332936..333289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi265"
FT                   /product="PUTATIVE 6-PYRUVOYL TETRAHYDROBIOPTERIN SYNTHASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31297.1"
FT                   /translation="MKITQAFTFEAAHCLPRVPETHRCHRMHGHSYRVELRLEGPVDPD
FT                   TGFVIDFFDVGAVFGPLLQRLDHQHLNEVEGLDNPTAENIAVWIWNQTKPLLGQMCSVT
FT                   VYETPLCWAEYEG"
FT   gene            333294..334031
FT                   /gene="msi266"
FT   CDS             333294..334031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi266"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31298.1"
FT                   /translation="MQRDPGTALVLFSGGQDSTTCLAWALENFERVETIGFDYGQRHRI
FT                   ELDVRPYLLGRIRTDFPAWRGRLGEDHMIDMAVLGQISDTALTRDVEVALNANGLTNTF
FT                   VPGRNLLFLGFAAAIAYRMGAKHLVIGVSETDRFSYPDCRDDAVKAMQLALNLGMETHL
FT                   VIHTPLMRRDKAQTWALAGWLGGEVLVKLICEGSHTCYSGDREHRHSWGFGCGTCIECN
FT                   LRAAGWEQFRCCKEAPVAAHEMT"
FT   misc_feature    334126..334422
FT                   /note="REGION CONTAINS FRAGMENT WITH WEAK SIMILARITY TO
FT                   GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            334517..335557
FT                   /gene="msi267"
FT   CDS             334517..335557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi267"
FT                   /product="PUTATIVE TRANSCRIPTION REGULATOR LACI-FAMILY
FT                   PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31299.1"
FT                   /translation="MNRPTIADLAKAAGVSVSTVNRLLHGTGTLRPQTADLILSAAQQI
FT                   GFRSSGPLHERRRDNLPHRHLSFLMQQSHRPLCRIWAEALLGACARRTDAVIEPDVLFE
FT                   DDPSPEAVAANLLKIGGSADAIAVISADHPLVGQAIDELRLKGVPVIAYVTDLSAASRA
FT                   GFVGTDNWKAGRTAAWFISQTSGRPGKIFPLIGSNRYQFQDISDASFRSYMREHAPKFH
FT                   VSETLLTHEAPKNAYAIVRRLIAEEPELRGIFVNGGGISGVLRAMRELAAEQQCKIRVV
FT                   CRDIGPEARKGLSEGLITASLCHPVDRMPEELINVMLRMIERTDTRLIEQRIVPFEILT
FT                   PESIWT"
FT   gene            335596..335760
FT                   /gene="msi268"
FT   CDS             335596..335760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi268"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31300.1"
FT                   /translation="MPLRSEPLRGLNWGAKGSSALMILVATEIGQEDEEMEISEEADLV
FT                   ESWTPRSRQ"
FT   gene            complement(335861..336058)
FT                   /gene="msi269"
FT   CDS             complement(335861..336058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi269"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31301.1"
FT                   /translation="MTSGNVFADFGFDNSEEELRKAKLAREIRAIIMRRRLTQAKSAQL
FT                   LVMKQLDISAVVMGEQASSL"
FT   gene            complement(336249..336437)
FT                   /gene="msi270"
FT   CDS             complement(336249..336437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi270"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31302.1"
FT                   /translation="MITWRKRLFDPNLSFQWLSGVRLVDICSVMGVAINDAQMANSIWR
FT                   SKPSRDLAAASLRGSTT"
FT   gene            336563..337024
FT                   /gene="msi271"
FT   CDS             336563..337024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi271"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31303.1"
FT                   /translation="MSPVLLFLRRCPSCLAAANIPVKIGGSASRLALAGRSWSGLRSPA
FT                   SADRLGRCVDQARFLERQDSCPVSMISQSCVRGSSSAVSCSVEVAAPADADERPGDGNG
FT                   QMPLPVPGHQSTRHWTNAIKGISPPVGGEQEGEEDMERRLDDVIAALPE"
FT   gene            complement(337058..337435)
FT                   /gene="msi272"
FT   CDS             complement(337058..337435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi272"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31304.1"
FT                   /translation="MLIPIASVDETVVPSAILTETARSAGALPSGGFIHLALFQHYVRR
FT                   GLGYDVAEPLYTEGRARRGDDEVELSPDRLYVALKCRQIRIGLLLDLRDRGLVDLEGQG
FT                   NLRLGLPSRTAQTAEALDLRP"
FT   gene            complement(337894..338907)
FT                   /gene="accD"
FT   CDS             complement(337894..338907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /product="PROBABLE 1-AMINOCYCLOPROPANE-1-CARBOXYLATE
FT                   DEAMINASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31305.1"
FT                   /translation="MLEKFERYPLTFGPTPIEKLDRLGKHLGGNVEIYAKREDCNSGLA
FT                   FGGNKLRKLEYIIPDAIASDADTLVTIGGVQSNHTRMVAAVAAKIGMKCLLVQESWVPH
FT                   EDVVYDRAGNILLSRILGAEVRLVDDGFDIGIRRSWEKALYEVKARGGRPYAIPAGASV
FT                   HPNGGLGYVGFAEEVRAQEEQLGFAFDYMVVCTVTGSTHAGMLVGFAKDGRQRNVIGID
FT                   ASATPAKTKAQVLSIARHTATLVELGSELAEDDVVLLEDYAHPRYGIPSEETKEAIRLC
FT                   ARLEGMITDPVYEGKSMQGMIDLVQKGFFPEGSRILYAHLGGAPAINGYGYTFRNG"
FT   gene            complement(340200..340520)
FT                   /gene="msi274"
FT   CDS             complement(340200..340520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi274"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31306.1"
FT                   /translation="MRFIIFCRLLGLVLCGNAVAVYFASHSFRLAVVTTLGCSLLLQLG
FT                   YFVSVLFLIWRSSCAGKAGQGAELFDGSQEVRYQSRDDEHRNETQDVPQRNQTLGISLL
FT                   LP"
FT   gene            complement(340558..340875)
FT                   /gene="msi275"
FT   CDS             complement(340558..340875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi275"
FT                   /product="PROBABLE FERREDOXIN III FDIII PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31307.1"
FT                   /translation="MRSKFISRDGSIWVPEYLIAIDGKICIGCGRCFKVCSREVMHLYG
FT                   VDDAGEILGACGADDDDFDGELNRMIMVVDHAGRCIGCGACGRVCPKNCQTHLAADQIA
FT                   A"
FT   gene            complement(340872..341075)
FT                   /gene="msi276"
FT   CDS             complement(340872..341075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi276"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31308.1"
FT                   /translation="MSNLDEMAKKVRKLQLRAAIAKTNLRDLAEGLPVKWIEIEEVAEK
FT                   THAVYAELDGARRELAKMKTLR"
FT   misc_feature    341105..341508
FT                   /note="REGION CONTAINS TWO FRAGMENTS OF CONSERVED  SIMILAR
FT                   TO M. LOTI MAFF303099 MLR5912 AND RHIZOBIUM SP. NGR234A
FT                   PNGR234A Y4VQ"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    341857..341931
FT                   /note="FRAGMENT OF FIXW"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            342114..342317
FT                   /gene="msi277"
FT   CDS             342114..342317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi277"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31309.1"
FT                   /translation="MHDSAWKPYRPKTAGCFEPNMFSAAVSFWTRIMRQTLEGENGLAV
FT                   CPAAMLASAHLASFAAGDARAR"
FT   gene            complement(342635..344689)
FT                   /gene="msi278"
FT   CDS             complement(342635..344689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi278"
FT                   /product="HYPOTHETICAL, FUSION OF HYPOTHETICAL PROTEIN &
FT                   ONE WITH PARTIAL SIMILARITY TO MET-TRNA SYNTHETASES"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31310.1"
FT                   /translation="MLLRRQPKRPLFRQLRFVMRKSTFSRTQLSRVFGIDMAALGTGSA
FT                   GTGFSFGKVAPGVTSEPHRHDEIEAFVVLSGAGKVRTDLGEISVKAGDVVLFHPFEAHV
FT                   LHNDGDEELNFVDVYWRDGKAALEAAAQVATPRGPIFVFSTPPTPNGDLHLGHLSGPYF
FT                   GADVYTRFLRMKGVEAYHLTGSDDYQSYVATRADADQSTPAKVARNYADEIRATLALLD
FT                   CEVHSFLPTLGDSAYAEFQAACFRSLLSSTAVDLRRSPALFDAVTGDYLYEPDVIGLCP
FT                   YCGSSAGGNICEECGAPNLCHDLGAVRSRHSAEAPVVGSVRRPELALERCYDTIDRHLR
FT                   ASGAPVRIMDLFARLRQRGDFSVPITHPSDWGLPAEGLPGQVIWVWPEMAFGFLYNIQA
FT                   LATSLGRDWNAALPSKDWQIVHFFGFDNSFYHALLYPALYAEVFSHWTPRIRYHVNEFY
FT                   LLDGQKFSTSRGHAVWGKEVLGPKTVDVVRLHLGLTRPEGERTNFTLDALRRTKNEVFQ
FT                   GIWLNWLDALHREIKQDFGGCVPDAGDWAPADRAFFARIEIHRAAMERAYSDDGFSVRR
FT                   AAAQACDFVSDCVVYRQAQDYEAARRLYPARTRTSLALQTTAAAILAQTLAPLMPRFAS
FT                   TLARAIDGVSTETWPTSVRRLAPGTTFDLGPVLGFYARAELPVLHEEEA"
FT   gene            complement(344963..345742)
FT                   /gene="msi279"
FT   CDS             complement(344963..345742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi279"
FT                   /product="PUTATIVE SIMILARITY TO EPOXIDASE SUBUNIT A
FT                   PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31311.1"
FT                   /translation="MLTDAQREKWQKDGYIRLERFFDPAAVEGMSSFVEDISRWDVSDD
FT                   KWLMWFEKTTDDRKITSKAENFLDFHDPLRLLLLEDQRINSAVEDLLGEDSRRLKELLI
FT                   FHYPDSGGYRPHQDIYHIPHRLPDRMVHAIVAIGIDDSDPDNGGLFFSPGNHKKGVFPM
FT                   DAGGVIDPEVAETFSWEPVVWKAGDIFIFDDYAPHYSKPNKSNRSRRTLYLVFQRASTG
FT                   GPTRAEYNVLKRALNPPEGKVADLDNLKLPNGIFYRD"
FT   misc_feature    346080..346499
FT                   /note="REGION CONTAINS GENE FRAGMENT SIMILAR TO FERREDOXIN
FT                   REDUCTASE COMPONENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(346504..347994)
FT                   /gene="msi280"
FT   CDS             complement(346504..347994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi280"
FT                   /product="PUTATIVE AMINO-ACID MONOOXYGENASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31312.1"
FT                   /translation="MSSDLITEPASAGVTPDTTNARTNCCKSCGVDDACGEGKPTGYGR
FT                   HSPRTAPDWEASAGARHLELSCIGIGAGPSNLSLACQIHEQVGHGALFLDRQVDFRWHP
FT                   GSAFESSELQVSHIKDLVTLVNPRSAYTFINYLHENGRLYHFLNAQFDAVLRAEFEQYL
FT                   NWAFRRNPLVRGGETVREIRYDGEFRVRTDDAVLGARDLVVGIGKQARIPPQFQGWIGR
FT                   NLFHSSDLLHIHPEVRHKHVCVVGGGQSGAEVLLHLVGGPRERRPASITWVSQRENYLP
FT                   LDNSPFTNELFMPCFSDRFAAMSEPQRKLFLRRFVLASDGISDRTLRAVYQALYRHEFL
FT                   EPDLCDIALRPGCNVSRCINAGAGHNLTLQRGLGDVEEVTADIVILATGYENAVPSFLE
FT                   PMADQLQQTDNELVINEDFSVCWDGPRDRRIFVQNANPGQRGLADPNLSLLAWRARRIL
FT                   DSLLQRAPCANPEHPGFISRTTVESWPDPVAEEMGSGI"
FT   misc_feature    348536..349039
FT                   /note="FRAGMENT OF NODULATION GENE NOEL"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            350291..350503
FT                   /gene="msi281"
FT   CDS             350291..350503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi281"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31313.1"
FT                   /translation="MAQQKINRLAFLCGQPPLNIAASPAKAVPARLAAATARVGFEKPH
FT                   AQGGRWFWTRQFFVAVSFWTCISDA"
FT   gene            351239..351982
FT                   /gene="adc"
FT   CDS             351239..351982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adc"
FT                   /product="PROBABLE ACETOACETATE DECARBOXYLASE PROTEIN"
FT                   /function="small molecule metabolism; degradation; carbon
FT                   compounds"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31314.1"
FT                   /translation="MHQDTVRGKAFAMPLTSPAYPAGPYRFRNREYLIITYRTDPQKLR
FT                   DLVPEPLQVCEPMVKFEFIRMPDSTGFGDYTEGGQVIPVSFCGRRGSYTHCMFLDDHPP
FT                   IAGGRELWGFPKKLASPTLRTETDTLVGTLDYGPVRVATGTMGYKHRAADLASVRASLA
FT                   EPNFLLKIIPHVDGTPRICELVEYHLEDAHLRGAWTGPAALNLWSHALAPVAELPVLEV
FT                   VSAVHLVADLTLALGKVVHDYLPEA"
FT   gene            352007..352408
FT                   /gene="msi283"
FT   CDS             352007..352408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi283"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31315.1"
FT                   /translation="MNFYSDISLNQRDGELLDGFSTRNATDNLIQRLSSYLALEDIPPL
FT                   CSECRRLASKSDCPCPSSLLLVQHMLAAVYQRLDAIDCLSEQGPIRLKAFTDYLAAVVR
FT                   IASESGDAAPWIDLATRFSALFDPDEVAH"
FT   gene            352534..352869
FT                   /gene="msi284"
FT   CDS             352534..352869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi284"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31316.1"
FT                   /translation="MTTPIGAMRVGSGPRAQAWVRSHSAASYSRSRLCRAQANELERTA
FT                   PGCGFRQSLMELAGELARSAFGWKTGLRGANETELAKPRWSMPSLGSRPCTCCSAAFAK
FT                   PLASAPS"
FT   gene            complement(353127..353741)
FT                   /gene="msi285"
FT   CDS             complement(353127..353741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi285"
FT                   /product="PUTATIVE OXIDOREDUCTASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : putative"
FT                   /note="predicted by FrameD"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31317.1"
FT                   /translation="MTSVSLDNGDRLEVGIVVNSAGPNAGTVAAMAGLVLPVEPRKRNV
FT                   FVFEARDKYSDMPLLVDPSGIYVRPEGSVYLTGGAEPEEGDGSADPTDFEVDWPLFEEV
FT                   IWPVLATRIPAFEAIKPTRAWAGHYDYNTLDQNAVIGPHPQVKSFLFANGFSGHGLQQA
FT                   PAVGKALAELIVHGGYRTVDCSAFGYSRVAEGRAFRELNVI"
FT   gene            complement(353927..354814)
FT                   /gene="msi286"
FT   CDS             complement(353927..354814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi286"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31318.1"
FT                   /translation="MGFKTVLCLTGADHSDQDVRTAAGLCAEVGAHLSVLIIPPPMLLM
FT                   SHRRIGDGVPEWPVGRGQAIARLNDRFRQIDRFTQDVVRLEKRSKDIQKLLESMSLAYD
FT                   VDTDYCDPASLGEVARQRALCADLTIIGPGLLNDENLGPPVVNGCLFDTGKPVLVVPKG
FT                   AEATLWPRRVLVGWDSRVEASRAAREALGLLCAAEEVRVALVDPKANYNGNGAEPGADI
FT                   AAYLTRHGARVSVDLLPSAGKSAATVLAQHAIDISADMIVMGAYGSRRLRERLFGGVTR
FT                   WIFEKPTLPLFLAR"
FT   gene            complement(354913..355617)
FT                   /gene="msi287"
FT   CDS             complement(354913..355617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi287"
FT                   /product="PUTATIVE TWO-COMPONENT RESPONSE REGULATOR
FT                   PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31319.1"
FT                   /translation="MKPLVLICSQDAEFYLFLSHILEVDGFVSEPAGGAKEALAKADER
FT                   EFQAVVLDCGPTSLTGSAICARLKREPRTGGLPIIALIAPGAENQHLDLLKAGIDESFV
FT                   RPMAPAKLLDYLRTRLALPKPGSNAIENNSWLSYGSLEMKLDAHRVCGNGHDIHLGPIE
FT                   FNVLRHLLEAPGKVFSRDELIGGAWPANIHVGVRTVDVHISRLRRALEAASTGIVIRTV
FT                   RSAGYSLEKLDG"
FT   gene            complement(355723..356202)
FT                   /gene="msi288"
FT   CDS             complement(355723..356202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi288"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31320.1"
FT                   /translation="MFEVAISPAVNDDEAALASPFVKCLVRLIRAQDSHGSWDGTADGE
FT                   LLADFIVSKEQRRTIPIIGDPDPDVLWRLDKFYTAVALAIEERSGLMASPMIEMSHEGF
FT                   GRVLFTAGRLVVLSRTLRDAHRFGFETFCKLAAAGTKLVDDAIAAIDAYPEVARA"
FT   gene            complement(356220..356717)
FT                   /gene="nifX"
FT   CDS             complement(356220..356717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifX"
FT                   /product="PROBABLE NIFX NITROGEN FIXATION PROTEIN"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31321.1"
FT                   /translation="MSSVRRLSLVTDEVHAPMPERRVGALRVAIATQDMKNLNAHFGSA
FT                   KRFAVYDVTREEWHLVEAVAFDDVSDESGKRRTEGDDRVTPKVEALKGCHLLFCLAIGG
FT                   PSAAKVISAKIHPIKVPQPQTIQEVLLRTQMMLRTCPPPWLRKVLAEAGVAEKKPSFED
FT                   ED"
FT   gene            complement(356683..358065)
FT                   /gene="nifN"
FT   CDS             complement(356683..358065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifN"
FT                   /product="PROBABLE NITROGENASE IRON-MOLYBDENUM COFACTOR
FT                   BIOSYNTHESIS PROTEIN NIFN"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31322.1"
FT                   /translation="MVRILRKIKSAAVNPLKSSQPLGAAFAFLGVEGAMPLFHGSQGCT
FT                   SFALVLFVRHFKEAIPLQTTAMDEVATILGGADHLEEAILNLKTRTKPKLIGVCTTALV
FT                   ETRGEDCASDIANVKLKHAEELAGTEVVLANTPDFGGAIEEGWAKAVAAMIEGITRSGA
FT                   RTRQPKKIAILPGCNLTVADVEHLRDMVESFGLKPVILPDVSGSLDGTVPDRWVTTTYG
FT                   GTSVEEIRELGTAAQCIVIGEHMRHPAKTLHGLTGVPYAVFQSLTGLKAVDRFVSLLSA
FT                   VSGAAVPARVRRRRAQLEDALLDGHFHFGGKRIAIAAEPDQLYQLATFFTGMGCEIAAA
FT                   VTTTDMSKILQKVPADWVQIGDLGDLEVLAAGADLLVTHSHGRQASRRLGIPLMRVGFP
FT                   IFDRLGSQHKLTILYRGTRDLIFDVANIFQANQHAPTPEALDPFRKREMPDELRSSPLT
FT                   RH"
FT   gene            complement(358075..359565)
FT                   /gene="nifE"
FT   CDS             complement(358075..359565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifE"
FT                   /product="PROBABLE NITROGENASE IRON-MOLYBDENUM COFACTOR
FT                   BIOSYNTHESIS PROTEIN NIFE"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31323.1"
FT                   /translation="MTSLSAKIQDVFDEPACDNNRGKDAKARKQGCSKPLTPGAAAGGC
FT                   AFDGAKIVLQPITDVAHLVHAPLACEGNSWDNRGAASSGPTLWRTSFTTDLTELDVVMG
FT                   QGERKLFRAIREIKETYAPPAVFVYSTCVTALIGDDIEAVCKRAAEKFGLAVVPINAPG
FT                   LAGSKNLGNKLAAEALLDHVIGTVEPDDAGPYDINILGEFNLSGEFWLVKPLLDRLGIR
FT                   VRACIPGDARYIDVASAHRSQAAMLVCSSALINLARKMAGRWDIPFFEGSFYGITDTSE
FT                   ALRNIAELLVRKGADAEILERTDTLIAEQEAIAWKKLEAYRQRLQGKRVLLNTGGVKSW
FT                   SVVHALMEIGMEIVGTSVKKSTVEDKERIKRILKDENHMFEQMAALDLYAMLSKHKADI
FT                   MLSGGRTQFIALKAKTPWLDINQERQHPYAGYDGMVELVRQIDLAIHSPIWDQVREPAP
FT                   WDRQPAVEDNLASMKNGTATVNAFNEFAGATAHRFGNR"
FT   gene            complement(359626..361167)
FT                   /gene="nifK"
FT   CDS             complement(359626..361167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifK"
FT                   /product="PROBABLE NITROGENASE MOLYBDENUM-IRON PROTEIN BETA
FT                   CHAIN NIFK"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31324.1"
FT                   /translation="MPQSAEKVLDHAPLFREPEYRQMLAEKKLNFECPHPDQIVTDQRE
FT                   LTKTWEYREKNLAREALVINPAKACQPLGAVFAAAGFERTMSFVHGSQGCVAYYRSHLS
FT                   RHFKEPSSAVSSSMTEDAAVFGGLKNMVDGLANTYKLYDPKMIAVSTTCMAEVIGDDLR
FT                   SFIENAKNEGSVPCDFDVPFAHTPAFVGSHVDGYDGMVKGVLEHFWKGSERSQAAGTIN
FT                   IIPGFDGFCVGNNRELKRLLDLMGVIYTVIQDASDQFDTPSDGEYRMYDGGTKIEDVKG
FT                   ALNAEATLSLQHYNTRKTLEYCNEVGQATASFHYPLGVQATDEFLMKVSAISGQEIPET
FT                   IRMERGRLVDAMADSQSWLHGKKYAIYGDPDFVYAMARFVMETGGEPTHCLATNGTSAW
FT                   EAEMKELLASSSFGQDAQVWAGKDLWAMRSLLFTEPVDLLIGNSYGKYLERDTGTPLIR
FT                   LMFPIFDRHHHHRFPLMGYQGGLRVLTTILDKIFDKLDRETSETGVTDYSYDLTR"
FT   gene            complement(361295..362800)
FT                   /gene="nifD"
FT   CDS             complement(361295..362800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifD"
FT                   /product="PROBABLE NITROGENASE MOLYBDENUM-IRON PROTEIN
FT                   ALPHA CHAIN NIFD"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31325.1"
FT                   /translation="MGLDYENDGALHAKLIEDVLSQYPDKAAKRRKKHLSVATSKDEAG
FT                   GEDKGLSECDVKSNIKSIPGVMTIRGCAYAGSKGVVWGPVKDMVHISHGPVGCGQYSWS
FT                   QRRNYYVGTTGIDTFVTMQFTSDFQEKDIVFGGDKKLEKIIDEIEDLFPLSGGISVQSE
FT                   CPIGLIGDDIEAVSRKKAKEHEKTIVPVRCEGFRGVSQSLGHHIANDAIRDWVFDKDDV
FT                   AFESGPYDVNVVGDYNIGGDAWASRILLEEIGLRVVGNWSGDATLAEIERAPKAKLNLI
FT                   HCYRSMNYICRHMEEKYGIAWMEYNFFGPSQIEASLRNIAKHFGPEIEEKTEKVIAKYR
FT                   PLVDAVIAKYQPRLEGRTVMLYVGGLRPRHVITAYEDLAMVIVGTGYEFAHNDDYQRTG
FT                   HYVKNGTLIYDDVTGYELEKFIEGIRPDLVGSGIKEKYPVQKMGIPFRQMHSWDYSGPY
FT                   HGYDGFAIFARDMDLAINNPVWGLYRAPWKKMKDAPLRAVAAE"
FT   gene            complement(362905..363798)
FT                   /gene="nifH"
FT   CDS             complement(362905..363798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifH"
FT                   /product="PROBABLE NITROGENASE IRON PROTEIN NIFH"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31326.1"
FT                   /translation="MSGLRQIAFYGKGGIGKSTTSQNTLAALVDLGQKILIVGCDPKAD
FT                   STRLILNAKAQDTVLHLAAQEGSVEDLELQDVLKIGYKDIKCVESGGPEPGVGCAGRGV
FT                   ITSINFLEENGAYDNVDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALYAAN
FT                   NIAKGILKYAHSGGVRLGGLICNERQTDRELDLSEALAARLNSKLIHFVPRDNIVQHAE
FT                   LRKMTVIQYAPDSKQAGEYRALAEKIHVNSGQGTIPTPITMEELEDMLLDFGIMKTDEQ
FT                   MLAELQAKEAKLAVAQ"
FT   gene            complement(364377..364595)
FT                   /gene="msi295"
FT   CDS             complement(364377..364595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi295"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31327.1"
FT                   /translation="MTLFRYLNDDALLILSRKFRFLYEAALLDTYERFSLVVRPSPHRR
FT                   RSSTQSTVSSSERQSLPTTTLAKACLT"
FT   gene            364818..365123
FT                   /gene="msi296"
FT   CDS             364818..365123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi296"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31328.1"
FT                   /translation="MIKGSIAGCLLVLTPLPALAGDFGGLTLTSTCDQYNKSSGSNRAG
FT                   FVHDLIVGTSAATGKDYQSHRVDIQACVAATFAPPCVTGTTSIREVLAACMLMVGN"
FT   gene            365144..365674
FT                   /gene="msi297"
FT   CDS             365144..365674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi297"
FT                   /product="HYPOTHETICAL TRANSMEMBRANE PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31329.1"
FT                   /translation="MPVAVEAVWTSKEIILAIIATGLISALAGWVADFVKERWSEKRSA
FT                   RYAAMRCAIAFESYAADCWNNANMSEGHFHMAEEAYSESLPPAPVIPEDIDWRSVDPIL
FT                   ADAVLSFMTSSKIAESEAAYARVYEGNPFDFDDATRMLGRRALEISSKLRSRYGMRPSA
FT                   EYEKMHKRLKGSG"
FT   misc_feature    365930..366532
FT                   /note="TRANSPOSASE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            366573..366761
FT                   /gene="msi298"
FT   CDS             366573..366761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi298"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31330.1"
FT                   /translation="MDRRSMFATTLAISTHTNTIEGYFSIFKRGMKGVYQHCGKKHLHR
FT                   YLAECERCTGTTFRAWS"
FT   gene            366797..367243
FT                   /gene="msi299"
FT   CDS             366797..367243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi299"
FT                   /product="PUTATIVE TRANSPOSASE NUMBER 1 FOR INSERTION
FT                   SEQUENCE"
FT                   /function="elements of external origin; transposon-related
FT                   functions"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31331.1"
FT                   /translation="MTISELTLKSKDSEPARRFEVFTGSGRRRDWLPEEKARIVAESYD
FT                   AGETVSAVARRHALSPQQLFAWRRSARVPLANAPAPEPLFVPAVVAAQEPEPAGKRARS
FT                   TRKRKAARETGVIELEIDGVAMRVGRGADARTVAAVIRALKAPS"
FT   gene            367240..367596
FT                   /gene="msi300"
FT   CDS             367240..367596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi300"
FT                   /product="PUTATIVE TRANSPOSASE NUMBER 2 FOR INSERTION
FT                   SEQUENCE"
FT                   /function="elements of external origin; transposon-related
FT                   functions"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31332.1"
FT                   /translation="MIGPTGVVKVMVATKPVDFRKGAEGLAALVRETMGADPFSGAVYV
FT                   FRAKRADRVKLVYFDGTGVCLLAKRLEDGKFCWPAITDGVVRLSAAQLQALLEGLDWRR
FT                   VHDARETRAPVAAS"
FT   gene            367655..369184
FT                   /gene="msi301"
FT   CDS             367655..369184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi301"
FT                   /product="PUTATIVE TRANSPOSASE NUMBER 3 FOR INSERTION
FT                   SEQUENCE"
FT                   /function="elements of external origin; transposon-related
FT                   functions"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31333.1"
FT                   /translation="MSNPAEPQTNDPIALQAMLAAERAENERLRQIIKELQRHRFGRRA
FT                   ESLPVDQLLLGLEEAEQIEAEGFAAEDTADTAKREARARKRRANRGSLPAHLPRIEQII
FT                   DIPDYICPCCKGMLHVMGEDRSERLDIVPAQFRVIVTRRPKYACRSCEEIVVQAPAPSR
FT                   LVEGGIPTEATVAHVLVSKYADHLPLYRQAQIYARQGVNLDRSTLADWVGKAAFLLRPI
FT                   HERLFERLKASGKLFADETTAPVLDPGRGRTKTGQLFAYARDDRPWGGIDPPGVAYLYA
FT                   PDRKAEQPLRHLQGFVGILQVDGYAGYRALAERNAVSLAFCWAHVRRRFYELAQSGPAP
FT                   IATEALQRIGELYKIESEIRGRPAEERCAARQQRSRPIIDALEPWLRGKLALVSQKSKL
FT                   AEAIRYPLSRWAGLGRFLDDGRVEIDSNVVERSIRPIALNRKNALFAGSDGGGEHWATI
FT                   ASLVETAKLNGLDPYAYLADVITRIVAGHPQSQLDYLLPWAYAPAPLKAVA"
FT   gene            complement(369382..370266)
FT                   /gene="msi302"
FT   CDS             complement(369382..370266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi302"
FT                   /product="PUTATIVE DNA METHYLTRANSFERASE PROTEIN"
FT                   /function="macromolecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31334.1"
FT                   /translation="MPLATSPLRYPGGKAPLTGLVSQIIRLNKLQYGHYAEPYAGGCGL
FT                   ALGLLYGGYVSDIHINDIDRGIWAFWNVVLNQTDDFIDLMNRTPVTLDEWRRRREMQRN
FT                   QRGLSPLEIAFTTFFLNRTNRSGIIKNAGVIGGLGQVGDYKIDCRFTKSELERRIRRVQ
FT                   RYRDHIHLHRKDALDFLKHVERNLPERTFLCIDPPYFKKGSTLYTSFYDPEDHAAVATK
FT                   ILGLDRPWIITYDRCDEISALYKTRRQYEISLNYSAQVKRVGSELLVVSKGLKVPDELR
FT                   DAQVHKPQYRSAA"
FT   gene            complement(370334..371677)
FT                   /gene="msi303"
FT   CDS             complement(370334..371677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi303"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31335.1"
FT                   /translation="MSCSDDGQFLGGNAVATTRQPDSIEVNRIYLYEENPRHEPMESQD
FT                   EIIEYLCKDEQVFNLARSIAEAGPNPLQLVGLVQIPGSGSAATKKTYQVWEGNRRVCAI
FT                   KLLNDPDLAPPHLRKDFARLSSTSGHVPIKKLSAVVFGDHDDLKYWMGIIHDGAQGGVG
FT                   LLDWDAAQKARHFGSSRNRVALAVLDAAESLGFISKDERQGKLTTAQRFLNSSIVREAI
FT                   GIDSSSPDDVTYTRPSDDIKKQLARFVDDLKEGEKINSRRNRAQIDTYGRKLAASSDIT
FT                   GERTEPISLKTITPAVVKSRRKAQPQKPRPVSHLEYEKGLAKALEDNTNSKLEALYYSI
FT                   CAVHVEHTLLLTIGVWAFVESLAALAGKNADTDFNAFFSNQRMSDLGLASGRALNPIRD
FT                   ALMRIARNGNATKHHQTSANFDRLQLANDLATITPLLTKTAESIKPRK"
FT   gene            371943..372152
FT                   /gene="msi304"
FT   CDS             371943..372152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi304"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31336.1"
FT                   /translation="MYGELSLDGYDSKLVLHDVEHELYPGSLDLTIHGVVDHTVKISLV
FT                   DCIRMGSNRKADAKWTISKHFVTI"
FT   gene            complement(372360..373079)
FT                   /gene="phnL"
FT   CDS             complement(372360..373079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnL"
FT                   /product="PUTATIVE PHOSPHONATE TRANSPORT ATP-BINDING
FT                   PROTEIN PHNL"
FT                   /function="cell processes; transport of small molecules"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31337.1"
FT                   /translation="MTLKENCLVISSATDPALRAVGLAKTFTLHAQGGIVLPVFDNIEL
FT                   TVNAGECVCLVGPSGAGKSTLLRSLYANYKPDAGKILVVHRNETVDLLAAEPWEVVEIR
FT                   RSAIGYVSQFLRVIPRVPALDVVAGPAIAKGIPADQAKALSKTLLTRLNIPERLWPLAP
FT                   ATFSGGEQQRVNIARGFVVDYPIILLDEPTASLDAANRATVVDLITEAKARGAAIVGIF
FT                   HDEEVRRAVADRLFAVA"
FT   gene            complement(373109..374314)
FT                   /gene="phnM"
FT   CDS             complement(373109..374314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnM"
FT                   /product="PUTATIVE PHOSPHONATE METABOLISM PROTEIN PHNM"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; phosphorus metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31338.1"
FT                   /translation="MIIRTDTSPHRAAAKLSPNELTLTGARLVLPDEVYDGTVHIIDGY
FT                   IDDIAAGRSTVPGAIDLEGGYVTPGLIDLHTDNSEKHALPRAGVVWNHLSAVMAHDALV
FT                   IAAGITTVFDSLCIGSTTRDHTRQADRARILPVLIDGIREARAHGLLRADHFLHLRCEV
FT                   TDEEVMSVFTPLVGDPLVKLVSVMDHAPGHRQSPQLDRFREMQIKQYGWSAEDADRRIE
FT                   AWIDASRTIGPQNRSRIIALARARQLPLASHDDQTPEHVREANDAGVLISEFPTTRAAA
FT                   EIARSLGICILMGAPNIVRGSSHSGNISARELATTGHLDILASDYVPASLLHGAFQLTR
FT                   DPIGMSLTKAISTVSSVPASVTGFCDRGMIGIGGRADLCHIVEIADIPVVRGVWRQGRQ
FT                   VF"
FT   gene            complement(374315..375112)
FT                   /gene="phnK"
FT   CDS             complement(374315..375112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnK"
FT                   /product="PUTATIVE PHOSPHONATE TRANSPORT ATP-BINDING
FT                   PROTEIN PHNK"
FT                   /function="cell processes; transport of small molecules"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31339.1"
FT                   /translation="MRAAAQFQPARRQPLLSVRQLTKMYGKTVGCRDLSFDLFPGEIIA
FT                   IVGESGSGKSTLLSCLSGRLMPDQGSVIYDLNHKGPTDILTLSEPERRKLMRTDWGLVH
FT                   QNPRDGLRMEVTAGGNIGERPMAVGARHYGRIREEAQNWLAQVEIDLLRTDHRPKTFSG
FT                   GMQQRLQIARILVTKPRLVFMDEPTGGLDVSVQARLLDLLRCLVMNIGVAVVIVTHDLS
FT                   VARLLADRIIVMWRGNMVETGLADQVLDDPHHPYTQLLVSSVL"
FT   gene            complement(375109..376059)
FT                   /gene="phnJ"
FT   CDS             complement(375109..376059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnJ"
FT                   /product="PUTATIVE C-P LYASE SUBUNIT PHNJ PROTEIN
FT                   PHOSPHONATE METABOLISM"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; phosphorus metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31340.1"
FT                   /translation="MTGPHDNAAGRSFRQPYNFAYLDEQSKRMIRRCILKSMAVPGLQV
FT                   PFGSREMPLAYGWGTGGIQVTASVIGPNDTLKVIDQGADDATNAVSIRRFFKRVAGIAT
FT                   TEITEAATIIQTRHRVPETPLKEGQIIVYQVPSPEPLRRLEPRDSETRKMHAYAEYGLM
FT                   SVELYEDIARFGHIATTNSYPVMTNGRYLMSPSPIPKFDNPKIANNPAIQLFGAGREKR
FT                   IYAVPPYTQVQSLDFEDHPFRVQRWRQCCSLCGATDSYLDEIVMSDKGRRMFVCSDTDY
FT                   CTTRRNHGHLGPDRGDPADIELLLPSKIATGSESR"
FT   gene            complement(376056..377162)
FT                   /gene="phnI"
FT   CDS             complement(376056..377162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnI"
FT                   /product="PUTATIVE C-P LYASE SUBUNIT PHNJ PROTEIN
FT                   PHOSPHONATE METABOLISM"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; phosphorus metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31341.1"
FT                   /translation="MAYVAVKGGEEAILNSHGLVAEDRRGDPAVPELTVRQIAEQFGLA
FT                   VDRVMCEGSVYDRELAALALKQAQGDAVEAIFLLRAFRTTLPRLAVSNALDTARMAIQR
FT                   RVSATFKDIPGGQILGSTYEYTHRLLDFDHLDIVDCDMPKAKVADDPLDPTFPRAFDSI
FT                   SDEDLIEAELPEPDQSPVFDLTRDPLAMPAGRDQRLQNLARGDEGFVVGLAYSALRGYG
FT                   AAHPYVGETRVGDVTIEILPEELGFSVSIGDIIVTECQMLDFFGGSEDEPARFTRGYGL
FT                   SFGKSERKAMAMAIVDRSLRCREYGEEAKYPVQDEEFVLSHTDNLEAAGFVSHLTLPHY
FT                   VDFQGDLQFIRQLREEHNRRRSSKEAAE"
FT   gene            complement(377163..377768)
FT                   /gene="phnH"
FT   CDS             complement(377163..377768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnH"
FT                   /product="PUTATIVE C-P LYASE SUBUNIT PHNJ PROTEIN
FT                   PHOSPHONATE METABOLISM"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; phosphorus metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31342.1"
FT                   /translation="MISVLDTAGLEPGFANPVFDSQDTFRRVLDAYAYVGRPQTLVSAT
FT                   AAVGPLDPATAAVCLTLADCETPVWLDSRSNLPSVRKYLGFHCGVPFVDSVERSTFAIV
FT                   ANPMTMPRLAEFNPGTELEPQVSTTIVVQVPSLNGGPPVRWRGPGIQREVSVDVDGLAS
FT                   WFWEDWELNHELYPSGVDVLFTSGNAIIALPRSISGEI"
FT   gene            complement(377765..378220)
FT                   /gene="phnG"
FT   CDS             complement(377765..378220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnG"
FT                   /product="PUTATIVE C-P LYASE SUBUNIT PHNJ PROTEIN
FT                   PHOSPHONATE METABOLISM"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; phosphorus metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31343.1"
FT                   /translation="MRIEVEKRQRWMAVLARARCDELERAWDNLAIQPQFDWLRRPETG
FT                   LVLVRGRAGGTGALFNLGEVTMTRCAVRLADGMTGFAFVLGRDQRHAQLAAVFDALLQG
FT                   TDDSASGVLRFVTEFGIAQSARREIKSRKAASTKVHFFAMARGISPE"
FT   gene            complement(378458..379159)
FT                   /gene="phnF"
FT   CDS             complement(378458..379159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnF"
FT                   /product="PUTATIVE TRANSCRIPTIONAL REGULATOR PHNF PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31344.1"
FT                   /translation="MKRWELVRSALLNDIDAGAFQDGRLPGDFVLADRFGVNRHTVRNA
FT                   IKVLESEGALRVQHGVGTFVADDFVSHKLNSDPRFTYKLLGQNKSVKREILSINETSVE
FT                   PDIASHLNIAPSALVTEVRSTSFINDWPLATGTSYYPAARVPGLATAFEGMNSPTAALK
FT                   RCGIAEYKRKWTRITARRPSPQEAQLLRISSSSPVLFETNVDVTPDGLPIKYAFSVIRS
FT                   DRYEYLIETNE"
FT   gene            complement(379228..380457)
FT                   /gene="msi313"
FT   CDS             complement(379228..380457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi313"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31345.1"
FT                   /translation="MTHRKLLLIMIDGVSADYFQAHANRLPNLSSLAADGYLVRRMRSA
FT                   VPATSMPGRASILTGVGAEIHGIFGNRILSDGAFVAAEAEHLLVPTIATLASRAGLDVA
FT                   CIGHALIKPEDTSIYVPPCWLRGPGFIKIPSDGSTPSLLKIKDPRGRLGAIPLPSYVPE
FT                   FSGPDGVSSITRTLIGDQLTIAAAASLLESEEAPDLLITEINATDAFQHDFGYGSDEAH
FT                   FAIAFADSLVGRCLDSLRRAGRRDDYTIAIVSDHGHRNIKTSILPDLIIPGKVWQSEGA
FT                   TLHVLVESDMDRREVTKKLLQYGAEAWNSDHLPIELRNRIATFTAPPECDFEETPAHHP
FT                   ADQPVGCPKYKSTHGFRPGSAADDRVCIISGPAVPNEVAEGAEATRLTPTLSCVLGLPG
FT                   DTFSDCPLFR"
FT   gene            complement(380483..381511)
FT                   /gene="msi314"
FT   CDS             complement(380483..381511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi314"
FT                   /product="PUTATIVE ABC TRANSPORTER OLIGOPEPTIDE TRANSPORT
FT                   ATP-BINDING PROTEIN"
FT                   /function="cell processes; transport of small molecules;
FT                   amino acids, amines, peptides"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31346.1"
FT                   /translation="MNANISDIETPETGAVPITYGGKPLLEVDSLRVHLPLRNISPFRL
FT                   KRSIKAVDGISFCIAPGEIVGVVGESGSGKTTLGRSLLRLVTPSSGRIRFKGTDLTALS
FT                   SKEMYSFRRQMQMVFQDPYSSLNPRMTVAEIVGDPLSIHKAHLTTQARQVRIAELLSQV
FT                   GISPAHGSRHPHAFSGGQRQRIAIARALATEPDFVVADEPVSALDVSVQAQIVNLLLDL
FT                   KERHALTILFISHDLRVVSHIADRVIVMYLGKVVEIAPAEIFRNAPAHPYTEALVSALP
FT                   VPHPSLRRARVVLKGEVPSAVTPPSGCVFRTRCSIASAECAKVTPDLRQVGAGHWIACI
FT                   KR"
FT   gene            complement(381508..382524)
FT                   /gene="msi315"
FT   CDS             complement(381508..382524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi315"
FT                   /product="PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
FT                   OLIGOPEPTIDE TRANSPORT"
FT                   /function="cell processes; transport of small molecules;
FT                   amino acids, amines, peptides"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31347.1"
FT                   /translation="MKQSELLRVENLRTYFYSQGRTVRAVEDVSFSVQQGSTVCLVGES
FT                   GSGKSATAFSILNLIPKSMGRVVAGKVLYGGEDLLRISQRRQRTILGNEIAMIFQEPAA
FT                   ALNPVCTVGEQIAEVLRTHKQCSAREARRQAKAMLDRVGIPDAQRRLDDYPHQLSGGMR
FT                   QRAMIAIALSCRPKLLIADEPTTALDATVQSQILGLLHELQADTGMALLFITHDLSVVA
FT                   EIADRVLVMYAGRIVEEGDVMQIFDDPWMPYTRGLLKARPGLHSGDGSSRRLSAVPGDP
FT                   PDLANLSIGCSFRPRCCHAAADCAYRPPDLETVRGHSVRCMHWRQIVEAAGEPEAVL"
FT   gene            complement(382560..384074)
FT                   /gene="msi316"
FT   CDS             complement(382560..384074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi316"
FT                   /product="PUTATIVE ABC TRANSPORTER PEPTIDE-BINDING
FT                   PERIPLASMIC PROTEIN"
FT                   /function="cell processes; transport of small molecules;
FT                   amino acids, amines, peptides"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31348.1"
FT                   /translation="MRKLLLAIAMLLPTFAVAQEDTRPPLTVGVNTVRANFDPGLALGN
FT                   VDLPITYNMFDTLVARDFSKSKDRTSYELVPGLAESWKQIDDRTMEFSLRPDVHFHNGQ
FT                   PLTSADVKFTFDRILDPASDYVEARNLLKVIERIDAVDDLTVRITTKAPSPILLQLLAY
FT                   HTSEIVPKAYFESVGESGFGQKPVGTGPFDFVKLQPDESIDLKANDSYFRGRPTISRLT
FT                   FRSIPEVSARITALANGEVDIVNSIPPDQLKAVESLGCCKVRSVLMNHHFIQYNTYNPV
FT                   MADVKLRQALNLAINRQLLVDALWDGKATLPHSAQYEAWGPELYDPNRPTPPFDPDRAR
FT                   QLLKESSYKGQPIFYVTHPVYYTNGVAVAEAVVQMWKAIGVNASVRVDEGWTQLTKDNP
FT                   VLTARNSSDWVVPTDPAVTLYMTWSKDLWKDEAHFDELAEEGETTLDRRRRHDIYQKMI
FT                   DLFEEEAPGTYLYRAPEFYGVRSGIQWLPNTEYTMDFRPDNIHFTK"
FT   gene            complement(384145..385053)
FT                   /gene="msi317"
FT   CDS             complement(384145..385053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi317"
FT                   /product="PUTATIVE ABC TRANSPORTER PERMEASE PROTEIN
FT                   OLIGOPEPTIDE"
FT                   /function="cell processes; transport of small molecules;
FT                   amino acids, amines, peptides"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31349.1"
FT                   /translation="MIMSIDIRVSEPIVGETEDKLVLAPPRRGRPPAARIISLSILFLM
FT                   ILLALAAPAITPHDISEQSLLSRLQPPVFAGGTDDHPLGTDHLGRDVFSRLLFATRTTL
FT                   FIAFAGVFIGVVAGTLGGLISGTLGGWADQCLSAVVDAQAAVPTTLVALTAVALAGTHP
FT                   LVLVLIIGFSDYYRYARIVRGQVVALQGRSFIEAARCSGASPWRIAMRHVLPNTFSPVV
FT                   VLASLSFAEIVVLESSLSFLGVGVQPPNVSLGSLLGEARNYLISTPWLAIFPCVVIVMI
FT                   TVAAATIGDWLRASLDPRSRT"
FT   gene            complement(385050..385961)
FT                   /gene="msi318"
FT   CDS             complement(385050..385961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi318"
FT                   /product="PUTATIVE ABC TRANSPORTER PERMEASE PROTEIN
FT                   OLIGOPEPTIDE"
FT                   /function="cell processes; transport of small molecules;
FT                   amino acids, amines, peptides"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31350.1"
FT                   /translation="MFFISRALRSALTLWAILTIVFFATRLTGDPTGFLMPPEMPEAQR
FT                   IELRAKLGLNDDIATQYLRYGEALLRGDFGQSFFSKRPVVELFMERVPNTLLLTVPAFV
FT                   LSVAIGLCGGLWAALRHNSLFDRSLTTATVVMQAIPNFVVGIATILIFSLSLRLLPSGG
FT                   MGTWKHFILPVITLALATCANTAHLVRTCMLEVLAQDYMRYARSKGLSPAVVVLKHGLR
FT                   NAILPVLTIMGLQFGGLVAGAVVTESVFAWPGAGRLVIDAVMKRDFALLQFGILVFSAA
FT                   IIFANLLVDVAYGLLDPRIRER"
FT   gene            complement(386675..387376)
FT                   /gene="msi319"
FT   CDS             complement(386675..387376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi319"
FT                   /product="PUTATIVE TRANSCRIPTIONAL REGULATOR PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31351.1"
FT                   /translation="MKRWEVVRSAILSDIDAGAFEDGRLPGDFVLAERFGVNRHTVRNA
FT                   IKALESEGALRVQHGVGTFVADDFVSPRLNSDRRVTYKVLGQNKSVKREILSVYETSVE
FT                   PDIAKRLRIVPLVLVTEVRWVSFLNDWPLATGSSHVPISRAPGLAVAFEGVSSFTVALR
FT                   RCGILEYKRKWTRITARRPTQQEAQHLRISSSSPVLVETNVDVTPDGLPIKYEFSVIRS
FT                   DRYEYLIEIND"
FT   gene            complement(387480..387770)
FT                   /gene="msi320"
FT   CDS             complement(387480..387770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi320"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31352.1"
FT                   /translation="MCRHRKRRALATQLRSRLMLGLNRIDGLLAAGVAPVGYYSIDHMV
FT                   ACDVWRDGAPNKIITTKSAERMTTHVPNGPSALRSSHPPALRMTRAVRANQ"
FT   gene            complement(387776..388654)
FT                   /gene="msi321"
FT   CDS             complement(387776..388654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi321"
FT                   /product="HYPOTHETICAL-CONTAINS METHYLTRANSFERASE DOMAIN
FT                   PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31353.1"
FT                   /translation="MTCGNTKPVCATLAGDFRRACINILAGQAIEEDVMKDHAQVKDAY
FT                   TAYGEIWGDVYDEYVEALNESVENARAVNFLTPFARNGTTLELGVGNGHIALPLSATGA
FT                   SVHGLDNSQRMLASLRAKAGGDLVTTHLGDMAEFDLGTQYDLVYCVNSTFSLMVTVGQQ
FT                   IGCFESVAKSLKPDGRFVVHLYYPDTENFSGAGFYGDQRTTVIHIDERRAMVRFTRHDR
FT                   PRQLFVSQDLWITPGGSRTMPIKMRYVYPTELDLLAKISGLELLERYGDWHRRPFDNAS
FT                   WQYMSVFRKTP"
FT   misc_feature    388936..389088
FT                   /note="REGION CONTAINS THREE NIFH FRAGMENTS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(389717..391426)
FT                   /gene="msi322"
FT   CDS             complement(389717..391426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi322"
FT                   /product="PUTATIVE AMINOTRANSFERASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31354.1"
FT                   /translation="MVGTTRAVFILDFRTPKIHLWSGSYDAPLVPISGQPLLDRLVNAC
FT                   SENGIEDVALVENLSSGISERFCLQDSTNTLSWRAAHHSDLIERLRDHEGDTLLIWGTP
FT                   FFDSEVLDGIDTDSGLRGSAWRPDAPTGIYRLSADVLRNFLPESHGAASDVRRQTLSTL
FT                   AVGLSGLEMALPADELNAGSELLDIRDGVDASIAEFRCDKENLLRRLETSVGGYWRKPI
FT                   AEHMLLCNTRFPPTAFYDRLATRLEGVLTCYPSQQIDIVSVVGAMTSQQPDFIAVGNGV
FT                   TDLIQALYSVLNPTIAIPTPTFAGFQTPLDDERKNNFVLAPPYFDLDVRAFLEFATATG
FT                   ADTAIVVNPNNPTGRLVDYADVAWLAEGLGSRGLRLIVDESFIDFPADGRSNSVENLVQ
FT                   SCGNLIVVKSLGKVFGLGGIRLAYLLAGDPALVAAVRRKLPLWNINGIAEYTLFLLPEF
FT                   AEELEDSLRLLRKDRELLIQELQTVPGLDVVPSQTNFILCRLPENSVSAAELKRRLVLF
FT                   ESVLVRECGYQAMDDADRYLRLTVRSRAENERLAKTLRRTLSHSSTVSETNV"
FT   gene            complement(391570..393462)
FT                   /gene="asnB"
FT   CDS             complement(391570..393462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /product="PROBABLE ASPARAGINE SYNTHETASE PROTEIN"
FT                   /function="small molecule metabolism; amino acid
FT                   biosynthesis; asparagine"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31355.1"
FT                   /translation="MCGIFGIVLKNEGTPVCAAAVERCADALAHRGPDASGLYINQSVA
FT                   FAHRRLSIVDAHSRANQPYRDANTGVVVTYNGEIFNYREIKAELRDMGFSFSTVSDTEV
FT                   LILSYIAWGKSFLNRLDGIFAFALFDPRKSLVLIARDRLGVKPLYYTICDVGLLFASQP
FT                   NALIRWPGVMHGPDMIGALSFLSYRAVVGARTLFAGISKLEPGHLLEIRNGRHTSERWW
FT                   NLSARISRSKPDYSDIRRLFGSAVERQLVADVPVAALLSGGLDSSILAYEASARSQIRP
FT                   VCYTGKVETPDYDETAYAMEVAAEFGLTHRVVPIGEPSDINAVAELVRLRGHPLGMHNE
FT                   TAMFTLAKAISKEHKVVLTGEGADEIFAGYSRLFRTPYDYNRSKIITALPPALAQIARR
FT                   RLGLGVHCSQLQFFLERYSYFPADEIRSLAIDGQMRTEHEMELFDHFSTQFAEAGGDFF
FT                   SKISYVLVSTHLPALLEMVDNTTMAAGLEARVPYTDHQLVTAAMAMPGSQRLRWRSPIA
FT                   SAQALWHPVASFSERLDVSKYPLRREYRSVLPKSVLSRKKMGFPLPLGQWAVGEGATEY
FT                   RRLLFDKDSPLGDLFDPAALRRWFKAGRRNPSDSFGRKFWLLANLGIFFKEVFS"
FT   misc_feature    393952..394269
FT                   /note="METHYLTRANSFERASE FRAGMENT SOME SIMILARITY TO BIOC"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(394422..395024)
FT                   /gene="msi324"
FT   CDS             complement(394422..395024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi324"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31356.1"
FT                   /translation="MIRYLFDAANAITALGLILATTAIYFALIGRFEIGICFGLWALLA
FT                   DDADGMVAKSSPNRSALMAQLGGTLDGLLDLVYAAVFPAVLILSFNAFSVPALLAANCL
FT                   ILSGALRLSYFSTFGLDADGFGRGLPLNNNLFVLALLFVADRHLPVKGLGNLLIGAGFV
FT                   LSVLHLSNFKFPGTGSALRLGNLTLAAAGSVALLTKL"
FT   gene            complement(395021..395839)
FT                   /gene="msi325"
FT   CDS             complement(395021..395839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi325"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /note="predicted by FrameD"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31357.1"
FT                   /translation="MPPAAPRKAVILAAGFGSRLRPLTDLCPKPLVEVNGTPILHNALW
FT                   NLQAVGVEEVTIVVGYRKDAIRHACGKRFGRLEINYVESSVFDKTGSAYSLWLARDTLL
FT                   SGDCYLLEGDVFFEEDALRHLIRVEAANAAAVAPFDPSMEGSAAVLSGNGFISEVRLKQ
FT                   TAANLASGTPVLFKMMNLIRFSGAELQTVIVPVLHDLIGSGAIKAYTEELLAHLIEQRG
FT                   LQLAAARCDDLRWYEIDSEQDLRVAERIFALERPHRHSAGAPAAVAGVGG"
FT   gene            complement(395870..397060)
FT                   /gene="aatA"
FT   CDS             complement(395870..397060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aatA"
FT                   /product="PUTATIVE ASPARTATE AMINOTRANSFERASE PROTEIN"
FT                   /function="small molecule metabolism; amino acid
FT                   biosynthesis"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31358.1"
FT                   /translation="MLAHRTNLFGTSGTAAARAAAKAAADAGKEIIDLTAGEIWSELAP
FT                   TIRDGAIDAINKGVNRYTDSVGMVELREALARKISLDTGQIWKAEEVAVTSGAKQALFN
FT                   AAMVLLNPGDEVIIPAPYWTTFPAQVLIAGGTPVFVDTKSNGYVPRPEHIKEAVTERTR
FT                   AIVVNTPSNPAGAVYDVETLMAIAELAVSRNLWIIFDECYGDFVHGGHTHHPIVSVAPE
FT                   IRARALIVNSFSKSLALTGWRIGYLAGPKGVINAVKALQSHTTSNPNVIAQHAVLAHLQ
FT                   RGGSDYEGKLRSRLTSARRVGLDVLSSLTRVPVARAQGGFYFYLDLSHLLRPGAEDGAS
FT                   TTADDIVTGLLAEAGVAAVSGTAFGDPAGLRLSYGIPPEKLATGLARLVEFLNAWK"
FT   gene            complement(397108..398016)
FT                   /gene="pepM"
FT   CDS             complement(397108..398016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepM"
FT                   /product="PUTATIVE PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism; degradation; carbon
FT                   compounds"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31359.1"
FT                   /translation="MVERQSGAQTRESLRRMIASSELAFAMEAHDGLSAAIAERAGFKA
FT                   LWASGLSISSSLGYRDANEASWSQLVDVVERISDTVDIPVLVDGDSGFGNFNNARLVAR
FT                   KLRQHGASGICLEDTAFPKMNSFIGDRHPLADIPEFCGRLKAVKDQVPDAEFVLVARIE
FT                   ALIAGRGEDEALARAQAYAEAGADAILIHSRKSNAEQIFAFTRAWQNHLPVVIVPTKYY
FT                   RTPVSAYRAAGISTVIWANHNMRAAISAMRQVCDRILREESIAGIEDEVATLDELFDLL
FT                   NYQELSAAEEKYLPQTATSVR"
FT   gene            complement(398525..399568)
FT                   /gene="msi328"
FT   CDS             complement(398525..399568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi328"
FT                   /product="PUTATIVE MONOOXYGENASE OXIDOREDUCTASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31360.1"
FT                   /translation="MEFATFILAAQRGYHQSCDSVIGNSIEQTIASEQAGFNTAWFAEH
FT                   HFNNYSLVPSPLMMVAHCAGLTSTIRLGTGVCVLPLYQPQRLLSEIGFADIVSNGRLEL
FT                   GVGSGYQQFEFERFGVDVDQAPAVFAEYLDILLKGLNQKVFEHNGQYEKIPLTAISLRT
FT                   IQRPAPPIWIACGSARSMCRAYREGHNLFVTAFHNGLENLRTLRETIEAAAASRGKDVT
FT                   AAKVGLLRCCYASDDQAEFDSYLDNARFQRRLSEALHQRRQQSRDGYLLQETPTKQDLS
FT                   FETMRQNLPIGSVSRVIDRLLEEISILKPDQIAIQTQLGDFDQKTMLRQIELWGDKIIP
FT                   AINKSLG"
FT   gene            complement(399819..401459)
FT                   /gene="msi329"
FT   CDS             complement(399819..401459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi329"
FT                   /product="PUTATIVE SHORT-CHAIN TYPE DEHYDROGENASE/REDUCTASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31361.1"
FT                   /translation="MKQAGRVVIITGAAGGIGRALVEIVAADGDIVVAVDLPGSGVLEL
FT                   AGGLGHPHLGLECDVSREEDIVALYGHIEAQFAKIDVLVNNAAIGPAMAATIDTGFEAF
FT                   RRVLATNLIGPFIMAGEAASRMQPGAAIVNVASLAGVLGNPKRNAYASSKAGLIALTRS
FT                   LACEWASRGIRVTAVAPGYVRTPMVAELERAGKMDLAAVRRRVPMGRMARPDEIARAVR
FT                   FLASAQTGYITGSVLTVDGGWMSFNQPGDAHPPVDETPRAELFRPAERTGARTVVVTGG
FT                   ANGIGAAVVRRFAANSDTVVIADKDGAGAAELAGLLGGRHVAKSADLAVESEVVALFEE
FT                   IRGRFGRIEILVNCAAIADTFVRGIEIPRQIERVLDVNLTGTFTCAREAIKSMDAGGVI
FT                   LNLGSINSFLPFVPRHAYGASRAGMNILTRCMAAELGSVGIRTATVALGYIRTPDIAQL
FT                   IESGCIDSVAIKRRIPMGRMGEPEDVAEAVFFLASPDASYVNGSTLYVDGGLTSLADAR
FT                   NAQPTDQENPTECSPATGCGSSKPTRFED"
FT   gene            complement(401643..402182)
FT                   /gene="msi330"
FT   CDS             complement(401643..402182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi330"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31362.1"
FT                   /translation="MGQAKITELRDREAIRDCLYRYCRGIDRADEAALRSAYWPDAHDN
FT                   HGAYRGSAEGFFEFALGLFKTGPRLIHQITNVLIEFIDPPEAVVESYFTALQRGPDNDG
FT                   EARQVLLCGRYCDLFQKREGAWRIAERTVVYDWIEEQTPPAVPEAERFGLRQPIGAAHP
FT                   NDPVYALRKRRSSSSK"
FT   gene            complement(402394..402639)
FT                   /gene="msi331"
FT   CDS             complement(402394..402639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi331"
FT                   /product="PUTATIVE FERREDOXIN PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31363.1"
FT                   /translation="MRIIVHNAKCQGHARCWAQAPDIFKLDDDGYILPGDIQVAEGEQL
FT                   LASQGARSCPERALEVDRTSAARFGPAAMQPRTGEA"
FT   gene            complement(402678..403895)
FT                   /gene="msi332"
FT   CDS             complement(402678..403895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi332"
FT                   /product="PUTATIVE MONOOXYGENASE CYTOCHROME P450 PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31364.1"
FT                   /translation="MAINPVPDHVPPEMVRDFSLFTSPGMPPTPNGDPHAAVACAHDGP
FT                   PIFYSPYNTQDGRGTWVITRAADQRKVLQDTETFSSHRSIFSSILGETWPTIPLELDPP
FT                   AHGAFRSLLSPLLSPKRVTALEPAVRERAIALIDRITASATSCDVMKDFAFPFTVSIFL
FT                   RFLGLPDQGLDTFVGWAKDLLHGDDVERPVAARKIVAFIDELATNRRKDPVDDLMTFIV
FT                   QAQIEGRRLTDGEIRGIGVLVFVAGLDTVAAAIGFDLAYLARNLKDQELLRSEPDRILL
FT                   ATEELLRAYPPIQLIRVATKDIDFEGAPIRKGDYVSCATMIANRDPEEFESPNTVDLAR
FT                   EHNRHAAFGYGPHRCLGSHLARREIVIGLEEWLARIPTFRIKEGTAPITCGGHVFGIEN
FT                   LILDWS"
FT   misc_feature    404165..404245
FT                   /note="NIFQ FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            404577..404735
FT                   /gene="msi333"
FT   CDS             404577..404735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi333"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31365.1"
FT                   /translation="MLREHKAVFPSLQDRARLTQAQFRKMGMASLLMDVLAFLYPLSIS
FT                   KRSRGRR"
FT   gene            405380..405928
FT                   /gene="msi334"
FT   CDS             405380..405928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi334"
FT                   /product="CONSERVED HYPOTHETICAL-PEROXIREDOXIN 2 FAMILY
FT                   PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31366.1"
FT                   /translation="MTVKKKVPFVTFRTRVRDESIEGPNPYRWEDKTSDDYFSGKRIIL
FT                   FSLPGAFTPTCSTLQLPDFEMLYDEFEKEGIDAIYCVSVNDAFVMNAWGKALGLKKVQL
FT                   IPDGSGEFTRKMGMLVAKDNLGFGMRSWRYAAVINNGVVEQCFEENGFCDNSEADPYGV
FT                   SSPQNVLETLRAAKAVTAA"
FT   gene            406003..407457
FT                   /gene="rpoN2"
FT   CDS             406003..407457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN2"
FT                   /product="PUTATIVE RNA POLYMERASE SIGMA-54 FACTOR PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31367.1"
FT                   /translation="MESSASLLQRQKQSLVLTPQMMESIRLLQLAHPELHQFVEQEIEK
FT                   NPFLERASNRAPKDIPSISAGKPRIGPTTGGISDQASQWKSIRGKNNVQPGGNHAFEDT
FT                   WTSIETLHDHVARQIALSAFAPLERRIAGELAGHLEDTGYLPVNLAELARSLNVREAVV
FT                   ERVLGTLQQFDPPGIFARTLSECLEIQLRQLDRFDPAMAALVANLEALARRDFQSLKRH
FT                   CGVDEDDLLDMLHEIRALDPKPGNRFQSGGPESIIPDVLVQPSPGGGWQIELNPDTLPR
FT                   LLMNQNYFAQVSRLSAQNSKDQSFLNECLQNANWLIRSLDQRAKTILKVAAEIIRQQDA
FT                   FFEHGVAHLRPLNLRTVADAINVHQSTVSRVTSNKYMLTPRGVFELKYFFTVAIGSSEG
FT                   GDAYSAEAVRHQIKAMVAVELPDEVLSDDDIATRLKETGIDIARRTVAKYREALNIPSS
FT                   ARRRREKRVRLRCQSSPDGGGDESSS"
FT   gene            complement(407454..408107)
FT                   /gene="nifQ"
FT   CDS             complement(407454..408107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifQ"
FT                   /product="PROBABLE NITROGEN FIXATION PROTEIN NIFQ"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31368.1"
FT                   /translation="MSWGQDQQNGATFAHHRGCFSTSQWPPTDQAAAFDRHVLACVFYL
FT                   AFEEVEAGKATATEATGLSRADLRDVMTRYFPAVPVNAFALEKLTDPEPDMEEGLLRGL
FT                   LIGHARPGDPASTLFAKIIARRSLRNDHLWQDLGLFNRAELSRLMARHFPALAAGNTKN
FT                   MKWKKYFYRKLCEAEGFSLCTAPSCQECGDFESCFGPEEGESHLARIKNGFALD"
FT   gene            complement(408104..408421)
FT                   /gene="fdxB"
FT   CDS             complement(408104..408421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxB"
FT                   /product="PROBABLE FDXB FERREDOXIN III PROTEIN"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31369.1"
FT                   /translation="MTGAFVTRDGSPWTPHYLTAIDGATCIGCGRCFKVCSREVMHLHG
FT                   VDDAGEILGICAGEDDDFDGELNRMVMIVDHAGRCIGCGACGRVCPKNCQTHLAADKLA
FT                   A"
FT   gene            complement(408418..408621)
FT                   /gene="msi338"
FT   CDS             complement(408418..408621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi338"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31370.1"
FT                   /translation="MSDLALLQKKVRKLQSRAGAAKMELHDLAEDLPVNWTEIEAVAWK
FT                   AFEVFAELDAAKEELAALENSQ"
FT   gene            complement(409253..411184)
FT                   /gene="exsA"
FT   CDS             complement(409253..411184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exsA"
FT                   /product="PROBABLE SACCHARIDE EXPORTING ABC TRANSPORTER
FT                   PROTEIN, ATP-BINDING AND PERMEASE DOMAINS"
FT                   /function="cell processes; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31371.1"
FT                   /translation="MSGPDQPPAFRAMFSSSRRPSISGFLRPSGLLRSYKATRRFHIDL
FT                   RGAAFRDVFAFTMRHWSKQPVRLAIIMIAVLVATLLDVLTPLYSGRLVNAVAQGAAADA
FT                   VVWDAALAAFSMLIALALGAVVMRNIAFIAVNDFILKMMSDIASDAFHRVQRFSTDWHA
FT                   KTFAGSTVRKITRGMWAFCLLNDTILLALFPSLIMLVGSSVLLGWYWPMMGLIIACGSV
FT                   GYVALIIILSLGYVAPAANLANNWDTRLGGSLADAISCNAVVKGFGAEVREDHRLAKVI
FT                   SKWRHRTLRTWVRGTVSAAFQGIMLLAMRAALIGYALFLWSRGQTTPGDIALVLASFTV
FT                   LYGYLRDVSIHVRNIQRSVNEMEELVQTYSQPPDVADDPGAKPIRITKGHIDFESVHFH
FT                   YGNHWSPFYSDLSISIEAGARVGLVGPSGSGKTTFVKLIQRLYDLDAGRILIDGQDISR
FT                   VTQGSLRSQIAIVQQEPLLFHRSLAENIAYGRPGASRSDVEQAARLASAHDFIARLPNG
FT                   YGTLVGERGVKLSGGERQRVAIARAFLADAPILILDEATSSLDSESEVLIQKAMERLMV
FT                   GRTTLVIAHRLSTVRALDRLLVFDRGCITEQGDHDALIRRDGIYRRLFERQALELTKGW
FT                   DETNVQHG"
FT   gene            411876..413132
FT                   /gene="nifS"
FT   CDS             411876..413132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS"
FT                   /product="PROBABLE PYRIDOXAL-PHOSPHATE-DEPENDENT
FT                   AMINOTRANSFERASE NITROGEN FIXATION NIFS PROTEIN"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31372.1"
FT                   /translation="MRPVYLDNNATTRVDPEVVQAVLPFFTDQFGNPSSSHDFGASAGA
FT                   AVRKARLRVQTLIGAEFEDEITFTSGGTESDNAAILSALEVMPERTEIVTSAVEHSAVL
FT                   TLCAHLEKTRGIKVHRIPVDRHGRLDLDTYKAALTPRVAIVSIMSANNETGTIFPVVEL
FT                   AELAKEVGALFHTDAVQAVGKLAIDLKSTAIDMLSLSGHKLHGPKGVGALYVKRGVRFC
FT                   PLIKGGGQEGNRRAGTENTPGIVGLGVAADLALKFMDDANTRVKALRDRLEKELLQRIP
FT                   HAFVAGDLLKRLPNTANIAFGDIEGEGILHFLNREGIACSSGSACACGSLEPSHVLVAM
FT                   NIPNSAAHGAIRFSFSRNNGEEDVDRVLEVMPGIVKKLRELSPSASQARGLQSAPGLGD
FT                   KANPTTVSGPGECNAQLFR"
FT   gene            413113..413496
FT                   /gene="nifW"
FT   CDS             413113..413496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifW"
FT                   /product="PROBABLE NITROGEN FIXATION PROTEIN NIFW"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31373.1"
FT                   /translation="MRSCFAESRAIDVTDILARLKSLSAAEEFFAALGISYDPKVLNVS
FT                   RLHILKRMGQYLAEEDFAGLPDGVIAARARATLERAYEDFATSSPLTQRVFKVLKEHDP
FT                   DKPATRDHTFVPFESILRRFGTE"
FT   gene            413679..414530
FT                   /gene="fixA"
FT   CDS             413679..414530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /product="PUTATIVE ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT
FT                   NITROGEN FIXATION FIXA"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31374.1"
FT                   /translation="MHIVICIKQVPDSAQIRVHPVTNTIMRQGVPTIINPYDLFALEEA
FT                   LKLRGAHGGEVTVLTMGPPMAEDALRKALTYGADRAVLLTDRCFAGSDTLATSFALSRA
FT                   IVRIAETFGAPDIVFAGKQTIDGDTAQVGPGIAKRLGLLQFTYVAKIDSIDVDAREITV
FT                   KRRSEGGTQMLKSRLPCLITMLEGTNEIRRGSLDDAMRAARSQIVKWSAAEAGIEDLNK
FT                   CGLRGSPTVVKRVFAPTTKAEKATQIDMTDKTQHDLADELIAAIFTRQPALEHELAFDG
FT                   GQ"
FT   gene            414548..415657
FT                   /gene="fixB"
FT   CDS             414548..415657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /product="PROBABLE ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT
FT                   NITROGEN FIXATION FIXB"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31375.1"
FT                   /translation="MMSNANREAPPSAGRAGIKRELPEHFRDYRHVWVFIELERGEVHP
FT                   VSFELLGEGRKLADKLGIQLAGIVLGPPGEATQHAVAEAFAYGADLVYLVEAPLLADYR
FT                   NEPFTKAMTDLVNTHKPEILLLGATTLGRDLAGSVATTLLTGLTADCTELDVDVDGSLA
FT                   ATRPTFGGSLLCTIYTLNYRPQMATVRPRVMAMPPRTDKPVGRVIRHKLSMTEEEIITK
FT                   VLGFNLDRQSAKANLAYADIVVAGGLGLGSAENLQLVKNLARAIGAEYGCSRPLVQKGW
FT                   MPADRQVGQTGKTIRPKLYIAAGISGAIQHRVGVEGADLIVAINTDPNAPIFEFAHLGI
FT                   VTDAIRFLPALTEAFTRRLSPHSHDKLAS"
FT   gene            415670..416977
FT                   /gene="fixC"
FT   CDS             415670..416977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /product="PROBABLE ELECTRON TRANSFER FLAVOPROTEIN-QUINONE
FT                   OXIDOREDUCTASE FIXC"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31376.1"
FT                   /translation="MIEQEFDAIVVGAGMSGNAAAYTMASQGLTVLQLERGEYPGSKNV
FT                   QGAIMYADMLEQIIPDFRDDAPLERHLVEQRFWVMDDTSHTGMQYRSDDFNEAKPNRYT
FT                   IIRAQFDKWFSRKVRQAGATVLCETTVTELVRSASGKVIGVRTDRAGGPIYADVVVLAE
FT                   GVNGLLGTRAGLRKMPKPESVALAVKEMHFLPDEVIEQRFGLQGDEGCVIEAAGTISRS
FT                   MAGLAFLYTNKESISLGIGCLVSDFAQTMESPYVLLDNFKNHPSIRPLIAGSEVKEYSA
FT                   HLIPEGGYKAIPQLFGDGWVAVGDAAQLNNAIHREGSNLAMTSGRIAGEAIIEIKGRNQ
FT                   PMIRRNLALYKTMLDKSFVVKDLMKYKDMPALIHTNSRNFFMTYPQLMSQAAQNFMRVD
FT                   GTPKIEKEKATTAAFIKARSRWGLISDVVRLALAWR"
FT   gene            416990..417289
FT                   /gene="fixX"
FT   CDS             416990..417289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /product="PROBABLE FERREDOXIN-LIKE PROTEIN NITROGEN
FT                   FIXATION FIXX"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31377.1"
FT                   /translation="MTMAVTKLRVEEKLYQNRYLVDPGRPHIKVRPHERPSANLLALTH
FT                   ICPAKCYELNDKGQVETTSDGCMECGTCRVLCEANGEIVWNYPRGGFGVLFKFG"
FT   gene            417446..419206
FT                   /gene="nifA1"
FT   CDS             417446..419206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifA1"
FT                   /product="PROBABLE NIF-SPECIFIC REGULATORY PROTEIN
FT                   ACTIVATOR ATP-BINDING, DNA-BINDING NIFA"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31378.1"
FT                   /translation="MAHMLPDQVGEIVSRNTPPEPAVEAARNADSLLRGIYEISKILTA
FT                   PTRLEITLANVANILSSFVQMRDGAIVVLDAEGEPQISATTGGAVPKSAAGSVIPQAVI
FT                   DKIVATGVPIVIQDTSTSELFQADPQSSSGTVATAFIGVPLKAEEKIFGTLSIDRVRNG
FT                   TTRFRYEEDLRFLAMVANLVGRTIRLHRTLSTAGQRLIEKQPRPEQSLDEDRTHSARHP
FT                   HVKIDGIIGESPALKQVLEIVSVVARTNSTVLLRGESGTGKEFFAQAIHKLSHRREKSF
FT                   VKLNCAALPESVLESELFGHEKGAFTGAILQRAGRFELANGGTLLLDEIGEISPAFQAK
FT                   LLRVLQEGELERVGGTRTLKVDVRLICATNKDLETAVRNGEFRADLYYRINVVPIVLPP
FT                   LRERPGDIPRLANALLDRFNKENHRDLGFTPSALDLMSQCYFPGNVRELENCVRRTATL
FT                   ARSTTITASDFACKNSQCLSSLLWKGVDRSHGAYAVDEFARGNMMPVGSPLPAMRVGPS
FT                   QNEASPGETCDPHHPVCPAMNPRLTERDRLIDAMEKAGWVQAKAARVLGLTPRQVGYAL
FT                   RRHRIGVKKF"
FT   gene            419457..420938
FT                   /gene="nifB"
FT   CDS             419457..420938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifB"
FT                   /product="PROBABLE NITROGEN FIXATION PROTEIN NIFB"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31379.1"
FT                   /translation="MSAPMISLQGLSGTTVFDQSPARAKSGGCASSSCGSSAKPHEMDS
FT                   AVWEKIKDHPCFSEEAHHYFARMHVAVAPACNIQCNYCNRKFDCANESRPGVVSERLTP
FT                   DQALRKVIGVANEVPQLSVLGIAGPGDACYDWKNTKATFQRVAKEIADIKLCISTNGLA
FT                   LPDRVAELAEMNVDHVTITINMVDPRIGAKIYPWIFYDNRRYTGVEAATILHERQMSGL
FT                   EMLTARGILTKINSVMIPGVNDEHLIEVNKWVKERGAFLHNVMPLISDPAHGTHYGLSG
FT                   QRGPKAMELKALQDRLEGGAKLMRHCRQCRADAVGLLGEDRGQEFTLDRLPDKVTYDAS
FT                   KRETYRAVVARERGDRLAAKSEALGMVKTAGSGKSLLVAVATKGGGRINEHFGHAKEFQ
FT                   VYEASPKGISFVGHRKVEQYCLGGRAEDKRLDGVISTLEGVDIVLCARIGNCPEDRLKE
FT                   GGIRATDAYGYDYIETAIGALYAAEFGSEPLAATA"
FT   gene            420971..421165
FT                   /gene="fdxN"
FT   CDS             420971..421165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxN"
FT                   /product="PROBABLE FERREDOXIN-LIKE PROTEIN IN NIF REGION
FT                   FDXN"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31380.1"
FT                   /translation="MAFKIIASQCTQCGACEFECPSGAIKFKGEIYVIDPKKCTECEGT
FT                   FETQQCASVCPVSKTCVPA"
FT   gene            421256..421582
FT                   /gene="nifZ"
FT   CDS             421256..421582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifZ"
FT                   /product="PUTATIVE NITROGEN FIXATION PROTEIN NIFZ"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31381.1"
FT                   /translation="MSLGREQDIEIRTPPRFMPGERVRATRHIKNDGTYPGKEIGENLV
FT                   RKGDEGYVRDIGTFLQQFYIYAVEWVDRGTVVGMRARELMSLETARTPSSAEIGAGFNK
FT                   GTAR"
FT   gene            421579..421791
FT                   /gene="fixU"
FT   CDS             421579..421791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixU"
FT                   /product="PROBABLE NITROGEN FIXATION PROTEIN FIXU"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31382.1"
FT                   /translation="MRVMIRRTGAGLSAYIPKKDLEEPIIKVDNEHLWGGAVTLKNGWR
FT                   LVLPDLPWDTPLPITVEARKISGED"
FT   gene            421842..422744
FT                   /gene="msi351"
FT   CDS             421842..422744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi351"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31383.1"
FT                   /translation="MTSGHLVVIRDSFAERQLDLLKKALAADQVIPYLGPGLLEIRSAG
FT                   PPVPHTPEAVAAALNKRTPAPSKIRTNMWSVAQYIEQRRHRRTLQAWMAEIFAAPVVPT
FT                   ILHAWLATLPLSVIVDSWYDGAMRAALIQTRRTDVVEIQGVTRAHEIGDIWTKAYDLSG
FT                   ILLESAPAAKTVLYAPHGGARPAANFLVADSDYVEVLSEIDIQTPIPDLVKERRASRGL
FT                   FFIGCRFNDQMLRTYARQIMKRSNGPHFAAIDTATLTKNERRFLAASAITVIDMPTGQA
FT                   AARLVGLGETLHEAKRGIV"
FT   gene            complement(423078..423404)
FT                   /gene="msi352"
FT   CDS             complement(423078..423404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi352"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31384.1"
FT                   /translation="MLFNSRLAAGGIVSPCVVELAALVAVLSGMGRADRIGSVCVVSAE
FT                   LTRLKVMAPQARIRGAVVRAFTTHAAVGLVDGEAGCPEPIARVCGAPSCRNAIILTLWD
FT                   GSGR"
FT   gene            complement(423802..424770)
FT                   /gene="nolK"
FT   CDS             complement(423802..424770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nolK"
FT                   /product="PROBABLE GDP-L-FUCOSE SYNTHETASE (NODULATION
FT                   PROTEIN NOLK)"
FT                   /function="cell processes; nodulation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31385.1"
FT                   /translation="MENKKMKKVYVAGHRGLVGSATMRALEALGSYEIITRTHDELDLF
FT                   DRSETRRFFMSQRPDYVVMCAAKVGGILANASSPVDFLHNNLAIQVSVFDAAYASGVER
FT                   MIFLGSSCIYPRDCPQPIREEYLLTGPLEATNRPYALAKIAGVESCWSFNRQYKARYLA
FT                   LMPTNLYGPGDNYHPENCHVLPALIRRFHQAKMNGDSSVGVWGSGNPRREFMYSSDVGD
FT                   AIAFLLGLPDSDFDALTAPDTAPLINVGVGEDVTIREVAELVKAAVCWEGNLVFDTTKP
FT                   DGTPRKLLDVTRLRNLGWKAKTSLGAGLQATYEDFLRLHAA"
FT   gene            complement(424843..425943)
FT                   /gene="noeL"
FT   CDS             complement(424843..425943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="noeL"
FT                   /product="PUTATIVE GDP-MANNOSE 4,6-DEHYDRATASE NODULATION
FT                   PROTEIN NOEL"
FT                   /function="cell processes; nodulation"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31386.1"
FT                   /translation="MSKRKVALITGVTGQDGSYLAELLLEKGYSVHGIKRRSSLFNTGR
FT                   IDHLYHDPHESGVDLTLHHGDLTDSSSLTRVIQLVQPDEIYNLAAQSHVAVSFEEPEYT
FT                   ANSDALGALRILEAIRILGLVKHTRYYQASTSELYGLVRETPQTETTPFYPRSPYAVAK
FT                   LYAHWITVNYRESYNLYACNGILFNHESPARGETFVTRKITRALTRIKLGMQRTLFLGN
FT                   LNARRDWGHARDYVQMQWLMLQQEQPEDFVIASGEQHSVREFVTVAAAELGIDVRWVGE
FT                   GVDEEGYDAKTGALIVKVDPRYFRPAEVETLLGDARKAKEKLGWEPKISFIELVREMVR
FT                   EDLRMAEREAVLMKQGYYSHSPRELC"
FT   gene            complement(426086..427075)
FT                   /gene="nodZ"
FT   CDS             complement(426086..427075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nodZ"
FT                   /product="PROBABLE FUCOSYLTRANSFERASE (NODULATION PROTEIN
FT                   NODZ)"
FT                   /function="cell processes; nodulation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31387.1"
FT                   /translation="MLVDRSRNDRFVVSRRRTGLGDCLWSLASAWDYAHRTGRALAIDW
FT                   RGSCYLDNPFANAFPAFFKPIADIGGVRVICDDQINHVSFPGPFFPSWWNKPSIDCVYR
FT                   PDEQIFQERDELNDLFQAQDDCEANTVVCDACLMWRCDEKAERTIFRSITPRVEIEDRI
FT                   EALYQEHFDGHSIIGVHVRHGNGEDIMDHAPYWADPKVALEQVCTAIRMAKAQPHSRPV
FT                   RVFLCTDSAKVVDHLSGVFPELFTVPKRFQEDQAGPLHSAALGTDGGFSALVEMYLLGR
FT                   CDTVIRFPPTSAFTRYARLFVPRIVEFDLNDPRRLILIDNSFERPPAP"
FT   misc_feature    427108..427283
FT                   /note="REGION CONTAINS TWO TRANSPOSASE FRAGMENTS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    427457..427525
FT                   /note="NODD FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    427539..427812
FT                   /note="REGION CONTAINS THREE FRAGMENTS SIMILAR TO S.
FT                   MELILOTI  PROTEIN AAK65297"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(428006..429211)
FT                   /gene="msi356"
FT   CDS             complement(428006..429211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi356"
FT                   /product="PUTATIVE OXIDOREDUCTASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31388.1"
FT                   /translation="MIDTGGYRKGDKKVRYDIVIIGGAIVGSSIAYYLRDEGFSGSIAL
FT                   IERDPQFAHAATTLSCASIRQQFSIPQNIRLSQFTMKLFRRLKEEFGADADIGFREGGF
FT                   LILASENGLPILYANHEAQVAEGADILLEDADQLTRRFPWLSTEGISAGSYGRSGEGWF
FT                   DAHAMLTLFRKALRGKNVDFMTASVIGIERQGHRVTSVRLDNAETIEAGTVLNSAGPNA
FT                   GKVAALAGLALPVEPRKRNVFVFEAREKYADMPLLVDPSGIYVRPEGSVYLTGGAEPEE
FT                   GDGPADPQDFEVDWPLFEEVIWPVLATRIPAFEAIKPTRAWAGHYDYNTLDQNAVIGPH
FT                   PQVKNFLFANGFSGHGLQQAPAVGKALAELLVHGGYRTVDCSAFGYIRVAEGRAFRELN
FT                   VI"
FT   misc_feature    429309..429693
FT                   /note="REGION CONTAINS TWO FRAGMENTS OF
FT                   S-ANDENOSYLMETHIONINE SYNTHETASE, METK"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    430015..430238
FT                   /note="REGION CONTAINS TWO FRAGMENTS OF AN INTEGRASE"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(430603..431970)
FT                   /gene="dctD"
FT   CDS             complement(430603..431970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctD"
FT                   /product="PROBABLE C4-DICARBOXYLATE TRANSPORT
FT                   TRANSCRIPTIONAL REGULATORY PROTEIN DCTD"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31389.1"
FT                   /translation="MSAESGPVIFIDDDEDVLRAATQMLKLASFSPSVFGSAEAALARI
FT                   DGNFDGPVVSDIRMPGLNGLQLFERVKAIDPEIPVVLITGHADVELAVAAIKDGAYDFI
FT                   SKPYANDRLLVTLHRASEKRRLVLENRRLRDAVVRSAGDIPLIGEAPTMIRLRETLRQI
FT                   ADTDVDVLVEGETGTGKEVVADLLHRWSRRRTKPFVALNCGALPESVIDSELFGHEAGA
FT                   FTGAQRRRTGRIEHSNRGTLFLDEIESMPPALQVKLLRVLETRQITPLGTNETRSIDLR
FT                   VVSATKADLGDPAARGDFREDLYFRLNVVTLRIPPLRERREDIPMLFGHFLERASKRFS
FT                   RPVPDISAGVRDRLVSHNWPGNVRELVHFADRVALGLERLGTPIASGRKEQAVSSLHLS
FT                   EKVSLYEATVIRDALQECGGDVRRTIEVLGVPRKTFYDKLKRHGIDTADYRKTAIG"
FT   gene            complement(431967..433820)
FT                   /gene="dctB"
FT   CDS             complement(431967..433820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctB"
FT                   /product="PROBABLE C4-DICARBOXYLATE TRANSPORT SENSOR
FT                   PROTEIN DCTB"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31390.1"
FT                   /translation="MGNGAFQRAPLVFPGRSGGRSLWLVVLLAILGAALCFVVFATGRI
FT                   AGTRAEYALRDRALAAFPLAADSLKGEIEKQRMIPLVLARDGAVQEMLRSPSTANEAAL
FT                   DEKLRAIARDAGSSILYIINPEGVAVAASNAGEPTSFVGSDYRFRHYFTEAMADGAAMQ
FT                   YALGTVSARPGLYLSSRVDGPEGPLGVVVVKVELDRVESRWLESGFVVFTTDERGVVLA
FT                   TSVPQWRFGALSPLSAKEKQTARDRLQLPGVTFEPVPLSRRGDNLVTATPESRSAGFVA
FT                   VSQDLGKAVPGWRMSLLIPADTEISSAVMTARVTTLLALVLVGFVIFIIVRRRRAARQR
FT                   QEVLVLLNAELEHRVELRTAELQSSNAALAGEIAERENAEARVRRLREELAQANRLSIL
FT                   GQITAGVAHEINQPVAAIRTYAENAARLLGIGRSQETAENLTSIVAITGRIGTITETLR
FT                   SFSRRASGSMGPILADDAIDGALSLLSGRIRDSGVTIERKRIDPSPIVMASRMRLEQIL
FT                   VNLLQNALDALKDQPKPRVEIALAENGEMVAISLRDNGPGLAPDIRRSLFMPFVTNKEK
FT                   GLGLGLVISQEIARELGGSLRHDDAGHGRGTSFTVELRRAA"
FT   gene            434095..435528
FT                   /gene="dctA"
FT   CDS             434095..435528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctA"
FT                   /product="PROBABLE C4-DICARBOXYLATE TRANSPORT PROTEIN
FT                   TRANSPORT TRANSMEMBRANE INNER MEMBRANE SYMPORT"
FT                   /function="cell processes; transport of small molecules;
FT                   carbohydrates, organic acids, alcohols"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /note="predicted by Codon_usage"
FT                   /note="predicted by Homology"
FT                   /note="predicted by FrameD"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31391.1"
FT                   /translation="MLTPLAPSVKRAPRKTLFAKPYVQVLVAILLGVAVGHFYPQIGEN
FT                   LKPLGDAFIKLVKMIIAPVIFLTVSTGIAGMSDLQKVGRVAGKAMVYFFTFSTLALIVG
FT                   LIVGNVIQPGAGLNIDLTSLDVQAVNGYASKAHEQSVTGFLMNMIPTTIVGAFVEGDIL
FT                   QVLFFSVLFGIALAMVGESGKSVLSFLQDLTAPVFKLVGILMKAAPIGAFGAMAFTIGK
FT                   YGIGSVANLAMLVGTFYLTAFLFVFGVLGAVCRYNGFSIFSLIRYIKEELLLVLGTSSS
FT                   EAALPSLMEKMEKAGAKRSVVGLVIPTGYSFNLDGTNIYMTLAALFIAQATNTDLSVGD
FT                   QVLLLLVAMLSSKGAAGVTGAGFVTLAATLSVVPAVPVAGMALILGVDRFMSECRALTN
FT                   LVGNAVASLVVARWEGELDQAQLKAAFCGHQPAETSTGQPLRTPAPSNSAASLPVESPG
FT                   WSQTPDDRAAGSKQTLAGR"
FT   gene            435820..436875
FT                   /gene="msi360"
FT   CDS             435820..436875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi360"
FT                   /product="PUTATIVE TRANSCRIPTIONAL REGULATOR LACI FAMILY
FT                   PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31392.1"
FT                   /translation="MSFNQTRTMAKRPIIADIAREAGVSVATVDRVLNARHPVRKETAQ
FT                   RVLAAAQAIGYHAAGLIKQRLQPDLPQYRLGFILRKPTHHFYQGFAREVEAAVNAAKCF
FT                   HGTSLIEFAPSHMPCDLIPLLKEFGARCHAIAMVAPDHPAITAAVQELKAKGIPVFSLL
FT                   SDFAEGVREGYIGLDNRKVGRTTAWMLSKVARRPGKVAVFVGSHRFQGQELREVGFRSY
FT                   FRENAPAFELLDPLVNLEARQITYEATLDLMQREPELTGFYVAGGGMEGAISALREEGE
FT                   SRGLVAIVNEITPESRAALADGMITMSVATPQRLLCQELMTLMAQAIKVGTSETLGQTF
FT                   LPFEIYLPENI"
FT   gene            437434..439245
FT                   /gene="nifA2"
FT   CDS             437434..439245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifA2"
FT                   /product="PROBABLE NIF-SPECIFIC REGULATORY PROTEIN
FT                   ACTIVATOR ATP-BINDING, DNA-BINDING NIFA"
FT                   /function="small molecule metabolism; central intermediary
FT                   metabolism; nitrogen fixation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31393.1"
FT                   /translation="MHDTRNCEQSARQISSRCISLPKMKSPNSKSEMNNVVPIVPLHQR
FT                   APDIFETSTALTAPSGLEAALANVVDLLPSLVQVRHGIISLCDGAGIPDMTVGAGWSEG
FT                   SDERYRKHLPRAAIDQIITTGMALVAENIALDPAFNAADKDVLGASDNMKVSFIGVPIR
FT                   VDANVVGTLTIDRILDNKSGSLLDYDLRLLTTIANLVGQTVKLHRLFASDRERLMAEKI
FT                   RMQKQFGELKQPGHEGKRAHVKGIIGDSPALRGLLEKVALVARSNSTVLLRGESGTGKE
FT                   LVAKAVHEMSGRAKRPLIKLNCAALPETVLESELFGHEKGAFTSAFNSRKGRFELADKG
FT                   TLFLDEIGEISASFQAKLLRVLQEQEFERVGSNQTIKVDVRVIAATNRNLEDAVARNEF
FT                   RADLYYRISVVPLLVPPLRERRGDIPLLAAEFLKNFNSENGRTMVFDASATEVLMNCAF
FT                   PGNVRELENCVQRTATLAAAASIGRNDFDCCHGRCLSAMLWKHASKETAPKSEPIAPSS
FT                   LNPAMQSSGAFASAAFGGPPVDSEQALPAPVRLGLVSDATMTDRERLIAAMERSGWVQA
FT                   KAARLLGLTPRQIGYALRKYGIEIKNL"
FT   gene            439819..440778
FT                   /gene="msi362"
FT   CDS             439819..440778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi362"
FT                   /product="CONSERVED HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31394.1"
FT                   /translation="MDQAKGPRKGRTIGKTNDVNADLIAVVVAVNDAGPCVLTIEQGAA
FT                   LPSGPFELAHRSLQSGLRAWVELQTGQPLGYIEQLYTFADRDRVGANQRVISISYLALT
FT                   REEDAGASGRRSWASWYDYFPWEDHRSGRPPIVLEELRPRLIEWADGADDGATRFDRRR
FT                   RAAVAFALDGRAWNEELALQRYELLYEAALVEEAKRGGVLAILASVPGRSMIADHRRIL
FT                   ATAIARLRSKIKYRPVVFELMPPLFTLLQLQRTVEALSGRLINKPNFRRLIEQQELVEK
FT                   TGATTAETGGRPAQLYRFHHTILDERPVAGTKLPIARA"
FT   gene            440843..441817
FT                   /gene="nadA"
FT   CDS             440843..441817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /product="PROBABLE QUINOLINATE SYNTHETASE A PROTEIN"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; pyridine nucleotide"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31395.1"
FT                   /translation="MSAVLPSSASLYDRVRRVIPPIEWPVFVEDIDAILKLKRQRNAVI
FT                   LAHNYQTPEIFHCVADIVGDSLALARKAMTVDADVIVLAGVHFMAETVKLLNPDKTVLI
FT                   PDLGAGCSLADSITAEDVRMMRQRYPSVPVVTYVNTSAAVKAESDICCTSGNALAVVKS
FT                   LGAPRVIMLPDEYLAKNIAAQTKVEIIAWKGRCEVHERFSAADIRELREAHPGISVLAH
FT                   PECPPEVVAEADFAGSTAAMSDYVAWHKPARVALMTECSMSDNVAVEHPDVDFVRPCNL
FT                   CPHMKRITLRNIRTAIEENRHVVTIDPHVAERARWAVERMLFV"
FT   gene            441814..443355
FT                   /gene="nadB"
FT   CDS             441814..443355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /product="PROBABLE L-ASPARTATE OXIDASE PROTEIN"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; pyridine nucleotide"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31396.1"
FT                   /translation="MTADIHHIGGAPVIIGAGIAGLMTALHLAPQPVVLLSRSPLGTEA
FT                   SSTLAQGGLAASLGEDDSPDLHLADTLAAGDGLCDEQMARRVVEAAPQAVENLIRLGAP
FT                   FDRSLDGRLQLGLEAAHSRRRIVHAAGDATGRELFRALLGVARRTRSITIMEGMTALRL
FT                   VVAEGSIVGVVAALHGGVFALPTRRVVLATGGMGGLFCDTTNPLSTFGHGLALAACAGA
FT                   ELADLEFVQFHPTALDIARRPMPLVSEAVRGEGAVLIDEHGHRFLADTPGAELASRDVV
FT                   ARAISDQLAAGHGVYLDARHCLGQKFARRFPAIDAICKHAGIDPAVEPIPVRPAAHYHM
FT                   GGVAVDADGRTSVSGLWACGEVACTGLHGANRLASNSLTEAVATAAWVAESVAATAAGW
FT                   QWPRLPATVPIRPDPSPIRPIVSNALGIVRNGKSLRDTVATLLPISVCETAAADPALVA
FT                   LLMAIAALRREESRGSHYRSDFPGRDAAALPSRLTLCTAFENAVTLRWQASERSL"
FT   gene            443357..444238
FT                   /gene="nadC"
FT   CDS             443357..444238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /product="PROBABLE NICOTINATE-NUCLEOTIDE PYROPHOSPHORYLASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; pyridine nucleotide"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31397.1"
FT                   /translation="MTSLAPLPQIIMEPIVRCALLEDLGRAGDITSDAIIPADCKATLA
FT                   LNARQGGVVAGLDLVMFAFLLVDPGISIQLRCPEGGKVSAGQTIAIVNGPARSLLTAER
FT                   TALNFLCKLSGIATATATLVNAVRGHHAKIVCTRKTTPGLRVLEKYAVRAGGGANHRFA
FT                   LDDAVLIKDNHIAIAGDIRTAIERARSAIGHMVKIEVEVDRLDQLEIALTAGVDAVLLD
FT                   NMSVEDLAQAVAMVGGRAITEASGRVTRASAAAIAATGVDLISVGWLTHSAPILDIGLD
FT                   MPADRNCNRHLN"
FT   gene            444249..444596
FT                   /gene="msi366"
FT   CDS             444249..444596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi366"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31398.1"
FT                   /translation="MSRDRRNSFGRRLTCIGTSPVPPTADASLLGDKRHASTTEAGTTD
FT                   QQGTESRVAALGVIICRLDEMRQLAASHGLELLGYLLDVAFTESCDAIRKEHSCAQSKT
FT                   TETEIPTDDVS"
FT   gene            444743..445738
FT                   /gene="bioB"
FT   CDS             444743..445738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /product="BIOTIN SYNTHASE PROTEIN"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; biotin"
FT                   /note="Gene name confidence : probable"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31399.1"
FT                   /translation="MNELSPDLTSDPIGWALPPWTRAEAQAVYDLPFNDLLFQAQTLHR
FT                   HNFDPNKVQLSRLLSIKTGGCPEDCGYCSQSAHHESGLKASKLMEVRHVIAEATKARDA
FT                   GATRYCMGAAWRNPKARDMDAVVAMVEGVKALGMETCMTLGMLDLEQAARLKEAGLDYY
FT                   NHNIDTSERYYSEIISTRTFADRLDTLANVRDSGIKVCCGGIVGMGEEPVDRIDMLVTL
FT                   ANLPEHPESVPINMLIPIEGTPLAEAKPIEPIEFVRVIALARIMMPKSHVRLSAGRTAM
FT                   TDEMQALCFFAGANSIFVGDTLLTADNPGEDKDTLLFQRLGIEPMDLETQ"
FT   gene            445735..446874
FT                   /gene="bioF"
FT   CDS             445735..446874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /product="7-KETO-8-AMINO-PELARGONIC ACID SYNTHETASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; biotin"
FT                   /note="Gene name confidence : probable"
FT                   /note="predicted by Codon_usage"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31400.1"
FT                   /translation="MNEALLARYDASLRGLARKDRLRTLSPRAGLDFSSNDYLGLAASK
FT                   RLGDAVAAAIARGTPVGATGSRLLRGNSPEHEALEADAAAFFGAERALFFGSGYIANFA
FT                   LLTTLPQKGDLLILDELAHASMHEGARAGRAEFKLAAHNDIDAVEDAITRWRAEGGMAR
FT                   IWIAVESLYSMDGDRAPMARLIALADRHEAFLVVDEAHATGIWGPDGRGLAAAFEGRDN
FT                   IVALHTCGKALGASGALVTGPGTLCDYLVNRCRPFIYATAPSPLMAVAVREALAMLSDE
FT                   PQRRVQLQERVAFAGRQLAERCGVKPSGSQIQPFVIGDNRRTMAVAAALQTRGFDIRGI
FT                   RPPTVPEGTSRLRISLTLNVDEADISAMVEALVEVLAST"
FT   gene            446871..447506
FT                   /gene="bioD"
FT   CDS             446871..447506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /product="DETHIOBIOTIN SYNTHETASE PROTEIN"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; biotin"
FT                   /note="Gene name confidence : probable"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31401.1"
FT                   /translation="MTKRIVITGTDTGIGKTVFSAGLAGFLNGFYWKPVQSGLDGETDS
FT                   EVVARLAGLPPGRVLPEVYRLKEPLSPHRSAELDGVAIDVARLSLPDLPGPIVIEGAGG
FT                   LMVPLNRRTKFIDIFAQWRVPVILCARTKLGTINHTLLSIEALRARSIPLVGIAFIGDE
FT                   VADTQRTIVEFSGIRQLGRLPLLDPLTSETLREAMVAGFDLAAIAGGE"
FT   gene            447506..448771
FT                   /gene="bioA"
FT   CDS             447506..448771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /product="7,8-DIAMINO-PELARGONIC ACID AMINOTRANSFERASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; biotin"
FT                   /note="Gene name confidence : probable"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31402.1"
FT                   /translation="MSQSQVWHPFTQHALEPAIPEIVRTEGAYLYKADGTRILDAISSW
FT                   WVVTHGHRHPRIIRAIETTASSLDQIIFAGFTHEPAERLARALVGLAPTGLDWVFYSDS
FT                   GSTSVEVALKMALGYFRNIGAPRSRIVVMEHSYHGDTIGTMSVGARGVFNAAYEPLLFE
FT                   VDTIPFPASGREQETLDRFEAVSRDRRAAALIVEPLVLGAGGMLMYPASVLTELKKIAE
FT                   TSGTLLIADEVMTGWGRTGTMFACEQASISLDILCTSKGLTGGAIPLAATLATDAIFQA
FT                   HYSEDRTKTFFHSSSYTANPIACAAALANVEIWRDEPVAERIATLSAKQAAGLQRFRDN
FT                   PYFTDCRATGTIAALDLRTGSAGYLAEIGPKLRAFFLERGLLVRPLGNVLYLLPPYCIT
FT                   GEELDGLHDAIEEAGERFGTKP"
FT   gene            448768..449751
FT                   /gene="bioZ"
FT   CDS             448768..449751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioZ"
FT                   /product="BIOTIN PRECURSOR PIMELOYL-COA SYNTHESIS PROTEIN"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; biotin"
FT                   /note="Gene name confidence : probable"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31403.1"
FT                   /translation="MSRSSRVLGFGHHAPSRKVENPEIENRLGLEPGWIERRTGIRSRF
FT                   WATDQDTLSGLATQAGDMALANAGIDRSDIGLLLLATSTPDHLLPPSAPLVAHKLGLGR
FT                   AGAVDLTGACAGFIYALMFADGFTRLHGKASLVIAANILSRRINPAERASSVLFADAAG
FT                   ALVIGACEDPDLGILGASVDSDGSRYGLIQIPAGGSSIPFHDDLDLGQTRMTMTDGREV
FT                   FAKAVEMMTDCSTSALAVAGVRPQDIDRFVPHQANARIFDAVGRNLGIADEAIVKTIAE
FT                   YGNSSAATIPLSLSLAHRAAPFRPGEKVLLAAAGAGLSGGAIVVGI"
FT   gene            449810..450262
FT                   /gene="panD"
FT   CDS             449810..450262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /product="PUTATIVE ASPARTATE 1-DECARBOXYLASE PROTEIN"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; pantothenate"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31404.1"
FT                   /translation="MRKLVAGKLHGIHVTEANLNYHGSITLDPDHCEAAGILPMEFVEI
FT                   WNKNSGARISTYVILGERGSRCCILNGAAARTCQPDDPIIVCNSIYLDEAHITSLKPRI
FT                   VTFDQDNYILDRLSYSVDLDTDGRYSFSILDEANEALAIPALVSGA"
FT   gene            complement(450698..450901)
FT                   /gene="msi373"
FT   CDS             complement(450698..450901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi373"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31405.1"
FT                   /translation="MRAAMVAGEPNDVRVKRCSGGWVVHIVEDGKLTVLRFKTQFPAEN
FT                   YADGQRARLGLAAKPPIDEPDM"
FT   misc_feature    451334..451513
FT                   /note="FRAGMENT OF  TRANSCRIPTIONAL REGULATOR"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            451716..452012
FT                   /gene="groES"
FT   CDS             451716..452012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /product="PROBABLE CHAPERONIN PROTEIN GROES"
FT                   /function="cell processes; chaperoning"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31230.1"
FT                   /translation="MAKSKFRPLHDRVVVRRVESESKTAGGIIIPDTAKEKPQEGEIIA
FT                   VGSGARDEAGKLVPLDVKAGDRILFGKWSGTEVKLNGEDLLIMKESDIMGIIG"
FT   gene            452075..453733
FT                   /gene="groEL"
FT   CDS             452075..453733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /product="PROBABLE CHAPERONIN GROEL DF PROTEIN"
FT                   /function="cell processes; chaperoning"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31231.1"
FT                   /translation="MAAKDVKFSRDARERMLRGVNILADAVKVTLGPKGRNVVIDKSFG
FT                   APRITKDGVTVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQSIVQEGH
FT                   KAVAAGMNPMDLKRGIDLAVTDVVATLIKNAKKIKTSEEVAQVGTIAGNGDESVGKMIA
FT                   EAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNADKMVADLEDVYILL
FT                   HEKKLSNLQTMLPVLEAVVQTSKPLLIISEDVEGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKAMLEDIAILTGGQVISEDLGIKLENVGLNMLGRAKKVSISKENTTIVDGAGKKE
FT                   EIQGRVAQIKQQIEETTSDYDKEKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDA
FT                   LNATRAAVEEGIVPGGGVALLRASLSINAVGANSDQAAGINIVRRALQAPARQIAANAG
FT                   AEASIVAGKILENKGATFGYNAQTGEYGDMIAMGIVDPVKVVRTALQDAASVAGLLVTT
FT                   EAMIAEAPKKESAGGGGMPGGMGGGGMGGMGGMDF"
FT   misc_feature    453861..453947
FT                   /note="6-PYRUVOYL TETRAHYDROBIOPTERIN SYNTHASE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            453992..454177
FT                   /gene="msi376"
FT   CDS             453992..454177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi376"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31232.1"
FT                   /translation="MPDMSGRGSRSKNDTAVLLPTSAISMIDSAYASSSRALSALAYYG
FT                   AKALARLVIEAVIAMG"
FT   gene            454284..455777
FT                   /gene="gabD"
FT   CDS             454284..455777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /product="PUTATIVE SUCCINATE-SEMIALDEHYDE DEHYDROGENASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism; degradation; carbon
FT                   compounds"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31233.1"
FT                   /translation="MKGDDGLTVTQSLTRRLKNPELFDDLAGVPGRKAEQSTRRFSVFN
FT                   PSTGELLAELPDMDVRDVSKAIDKAEAAQEHWAALTARERSDILWEWHQLILDHSEDLA
FT                   AILTAEMGKPLAEAKSEIAHAAAYLQWYAEEANRIYGETISPPSNDRRMLVIKQPIGVV
FT                   GAITPWNFPASMVARKISPALAAGCAIVLKPAEQTPLVAGAMFTLARMAGFPDGVLNLI
FT                   YASEGDAVGRELCSNPKVRKISFTGSTEVGRLLMRECSDQIKRTSFELGGNAPFIVFDD
FT                   ADVDAAVDGALQAKFRNAGQTCVSANRLYVQSSVYNEFCDKFTKRVSALRVGDGFEPEV
FT                   AIGPLIDKCALAKIEDHIRDAVRQGGKIRCGGNRIGESGTFFEPTVITDVERTMRVAQE
FT                   ETFGPLAPIIRFNDPDQVVREANDTIYGLAAYFYASNLKRVWRVAETLEYGMVGINTGR
FT                   MSSEAAPFGGMKQSGIGREGSRHGLEDYLEMKYLCMGGL"
FT   misc_feature    455983..456064
FT                   /note="THIC FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(456085..456549)
FT                   /gene="msi378"
FT   CDS             complement(456085..456549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi378"
FT                   /product="PUTATIVE TRANSCRIPTIONAL REGULATOR PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /note="predicted by Codon_usage"
FT                   /note="predicted by Homology"
FT                   /note="predicted by FrameD"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31234.1"
FT                   /translation="MANPLDAESVEAATEHAPKGRTPETKKKTPPSRKAKTEPGRKNGA
FT                   NTASPAEATATGAAVRSARKVYSGKERAQMLAQVETSISGGTTLKSAVKQAGISEQTYY
FT                   HWKKAAAPRSDGDDLKDLVALEKENKRLKSLLAERLRTENAELKRKLGLQ"
FT   gene            complement(456782..456991)
FT                   /gene="msi379"
FT   CDS             complement(456782..456991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi379"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31235.1"
FT                   /translation="MTREPLFQLCKRIDMKTKLRPASDVARAFVDAHRKCRLLSGYLIH
FT                   IARRNRGSASCSVIVSRDLLCNSF"
FT   gene            complement(457095..458180)
FT                   /gene="msi380"
FT   CDS             complement(457095..458180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi380"
FT                   /product="PROBABLE CYTOCHROME C PEROXIDASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31236.1"
FT                   /translation="MASVQNAGRSLVKILFTTVAVALPAIAFAAQTIPVYLRETARATF
FT                   KPLPSITPTVANNPITPEKIALGKAMFFDPRVSASGVLSCNSCHNLATGGDDNHESSIG
FT                   HGWQKGPRNAPTVLNAVFNIAQFWDGRAEDLKVQAKAPIQAAVEMANTPGQLIATLKSM
FT                   PQYVEWFNSAFPGEADRVTFENVAKAIEAFEATLVTPAPFDAFLNGDDAAMTSEQKQGL
FT                   TLFMDKGCSSCHGGINVGGEGYSPFGLVEKPNTDVLPENDKGRFAVTHEADDSYVFRVA
FT                   PLRNVALTAPYFHSGKVWDLKQAVAIMGTTQLGQELTEKEVDLLVAFLNSLTGKVPEVA
FT                   YPVLPAETPTTPRPVLHILPQ"
FT   gene            458968..459228
FT                   /gene="msi381"
FT   CDS             458968..459228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi381"
FT                   /product="PUTATIVE TRANSCRIPTIONAL REGULATOR DNA-BINDING
FT                   REPRESSOR PROTEIN"
FT                   /function="miscellaneous; not classified regulator"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31237.1"
FT                   /translation="MTATPFALPEAVLTAISNGKPVIQACREHLGYSTEDVAVTSGLTV
FT                   EEVGLIESGHCFDKGYRDRIARALGLAESIFDEIWGIPNAA"
FT   gene            complement(459496..459702)
FT                   /gene="msi382"
FT   CDS             complement(459496..459702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi382"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31238.1"
FT                   /translation="MQTGPDAPQSSHFITTRASSVSYGLTSQLVQNGQGIAFIVTNLPD
FT                   GLGWFRRNLSSKRSTSQALIVVP"
FT   gene            complement(460248..461663)
FT                   /gene="noeJ"
FT   CDS             complement(460248..461663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="noeJ"
FT                   /product="PROBABLE PHOSPHOMANNOSE ISOMERASE/GDP-MANNOSE
FT                   PYROPHOSPHORYLASE NODULATION PROTEIN NOEJ"
FT                   /function="cell processes; nodulation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31239.1"
FT                   /translation="MKVVPVIISGGAGSRLWPASRQSHPKPFLKVADGLSLIQHTVLRA
FT                   ASMQHVVELVTVTSTGHLFLTKDVFDELDSVVLPRTFLLEPEGRDTAAAVAAATVHAKA
FT                   TQGPDAVLCVFPADHMIGDLPAFQTAMNRAIEQAQQGRIATLGITPDRPDTAFGYIEAD
FT                   GEKVVRFVEKPNAETAKSYVASKRFFWNAGIFCFKAQVMLDEMAAHCPQVIDAVLDSYD
FT                   NARVSHGEHVASVELSSEHFAMAPRISLDHAVMEKTHNLAVVPCEMGWNDIGSWNAMAE
FT                   LVAADGSGNRIRGDVHVVDTVGSYISSDKRVIGTVGISDLVIVDSPDALLVASRDRVQD
FT                   VKKLFEGLKAAGHEAHLLHSTVHRPWGTYTVLEESERFKIKRIEVKPGGRLSLQMHHHR
FT                   SEHWVVVSGTAKIVNGDQELLLTTNQSTYIPCGHKHRLENPGNIGLVMIEVQSGEYLGE
FT                   DDIVRLEDVYGRT"
FT   gene            complement(461663..463096)
FT                   /gene="noeK"
FT   CDS             complement(461663..463096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="noeK"
FT                   /product="PROBABLE PHOSPHOMANNOMUTASE NODULATION PROTEIN
FT                   NOEK"
FT                   /function="cell processes; nodulation"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31240.1"
FT                   /translation="MKFGSSGVRGLASELVGKASGLYTEAFAWRLISSRVQPNSSVFIG
FT                   RDLRDSSQAIANNCMAALAANGFQPIDCGTIPTPALALYACKHGAAALMVTGSHIPADR
FT                   NGIKFYGPNGEISKADEAAITRFVAERSIAYCLPTACLGTTWPMHREEAIASYRERAHD
FT                   MLEPGSLSGMRLGVYQHSSVAAELLVQVLRSLGASVVAVGKTGTFVPVDTEAVDAATIA
FT                   KLKKWVREFGLDAIVSTDADADRPLIADENGDLLRGDLVGLATALFLKADTIVTPVTSN
FT                   SGISKAFGFAVQRTKVGSPFVIEAMEALHGAGGVIVGFEANGGVLLGSDCVVNGKTLTA
FT                   LPTRDSFLPILAVLSTMASTKKKLSRLRGLWNLPVCVSDRLQNFPAESSRRLMDHLASR
FT                   NALQHFLASFGTVAEIDKTDGLRARMLSGEIIHLRPSGNAPELRCYSEASTESRAMAIV
FT                   ASTLQGAHAFALTDEIEDL"
FT   gene            463604..464017
FT                   /gene="msi385"
FT   CDS             463604..464017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi385"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31241.1"
FT                   /translation="MRRLQKVVSGIAFDQGPAQNLDAVVAAAIFAFGFVYIHPFEDGNG
FT                   RIHRYLIHHVLAMHRFNRREWCPVSAAILDQIDEYRRVLESNSKRLLPLVEWEPTPQFN
FT                   VLNDTGDFYRYFDATPHAEFLYACVRRTIERYL"
FT   gene            464578..465276
FT                   /gene="msi386"
FT   CDS             464578..465276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi386"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31242.1"
FT                   /translation="MNALVICSGGLDSVSLAHKVATEQKLIGLLSFDYGQRHKKELGFA
FT                   AICAKRLGVPHQIVDIRDVGRNLSGSALTDNVDVPDGHYAEDSMRITVVPNRNAIMLAI
FT                   AFGVAAAQKADAVATAVHGGDHFIYPDCRPAFIDAFQTMQNHALAGYADIRLYAPYVNM
FT                   SKADIVSEGAKYATPFEATWSCYKGGARHCGRCGTCVERREAFDLAGITDPTDYGDADF
FT                   WLHAIQTRSA"
FT   gene            465276..465632
FT                   /gene="msi387"
FT   CDS             465276..465632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi387"
FT                   /product="PUTATIVE 6-PYRUVOYL TETRAHYDROPTERIN SYNTHASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31243.1"
FT                   /translation="MFHITKEFHFSASHQLTSLPPGHQCARLHGHNYIVVVELSGGELD
FT                   EHGFVRDYQDLAAFKHYIDGTFDHRHLNDVLGHDHATAEYLARHFYDWCKVRLPETSAV
FT                   RVSETPKTWAEYRP"
FT   gene            465629..466366
FT                   /gene="msi388"
FT   CDS             465629..466366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi388"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31244.1"
FT                   /translation="MTCALHPGIRVSEIFGPTIQGEGVLIGLPTVFVRTGGCDYRCSWC
FT                   DSLHAVDRRFRHDWEMMSPDAVWQKVIALSGGQPVMVSLSGGNPAIQPLSQLIDRGHGE
FT                   GYRFALETQGSVSKQWFADLDVLVLSPKPPSSEMTTDWAAFDACLEAAQDKPQMALKLV
FT                   VFDDDDYAYAKDAAARYPQLPVYLQPGNHTPPRPGDEDAFIDMAGVMRRMEWLVEKVTR
FT                   DRWFEARVLPQLHVLLWGNRRGV"
FT   gene            466844..468703
FT                   /gene="thiC"
FT   CDS             466844..468703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /product="PROBABLE THIAMIN BIOSYNTHESIS PROTEIN THIC"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; thiamin"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31245.1"
FT                   /translation="MHEQRSLKMNALTPAVSTGPLPASRKIHKSGVLHPHIKVPMREIS
FT                   VHPTAGEPPVIVYDPSGPYTDPIVETSIENGLARLRNEWITARGDVEAYDGRHVRPEDN
FT                   GFATGERLTPEFLTRNRPLRAKQGKAVTQLAYARAGIITPEMEFVAIRENLGREMLRGK
FT                   LERDGEAFGAAIPDFVTPEFVRDEVARGRAIIPANINHPESEPMIIGRNFLVKINANIG
FT                   NSAVTSSMAEEVEKMVWAIRWGADTVMDLSTGRNIHNIREWIVRNAPVPIGTVPLYQAL
FT                   EKVNGIAEDLTWEVYRDTLIEQAEQGVDYFTIHAGMRLHYIPLTVDRVTGIVSRGGSIM
FT                   AKWCLQHHRESFLYEHFAEICDICRAYDVSFSLGDGLRPGSIADANDAAQFAELETLGE
FT                   LTQIAWAKDCQVMIEGPGHVPMHKIKENMDKQLAVCGEAPFYTLGPLTTDIAPGYDHIT
FT                   SGIGAAMIGWFGTAMLCYVTPKEHLGLPDRNDVKIGVITYKIAAHAADLAKGHPAAKVR
FT                   DDALSRARFEFRWEDQFNLSLDPETARSFHDQTLPKEAHKVAHFCSMCGPKFCSMRISH
FT                   DIRAEAQKEGMAAMAAKYRAGGDLYVPADKTGVALMTGAPEPS"
FT   gene            468700..469701
FT                   /gene="thiO"
FT   CDS             468700..469701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /product="PROBABLE THIAMIN BIOSYNTHESIS OXIDOREDUCTASE THIO
FT                   PROTEIN"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; thiamin"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31246.1"
FT                   /translation="MRVLVKGAGIAGLTVAFELATRGAAVTVAETRHGLGGNASWFAGG
FT                   MLAPWCELESAEQPVLDLGRDAADWWEAATPGQVTRAGTLVVAAPRDAGELDRFASRTS
FT                   GHRRVDEDEIALLEPDLAGRFRRGLLFSDEAHLDPRQAMALLHDRLAAMGVEFHFCADA
FT                   QAVSGFDRQIDCTGIATGDDRLRGVRGEMLILRTPEVSLSRPVRLLHPRFPLYVVPRAD
FT                   HHFMVGATMIESQSSGPVRARSMMELLGAAYALHPAFGEAEIVETGVGVRPAFPDNLPR
FT                   IEALGNTVAINGLYRHGFLLAPAMARQAAELVFSHDKPAEFAHESDRQRRTA"
FT   gene            469670..469867
FT                   /gene="thiS"
FT   CDS             469670..469867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /product="PROBABLE THIAMIN BIOSYNTHESIS PROTEIN THIS"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; thiamin"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31247.1"
FT                   /translation="MNLIVNGEPLETAATSLAALLAALDYEGDWLATAVNSDLVHKANR
FT                   AEFQLSDGDRIEILSPMQGG"
FT   gene            469869..470642
FT                   /gene="thiG"
FT   CDS             469869..470642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /product="PROBABLE THIAMIN BIOSYNTHESIS PROTEIN THIG"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; thiamin"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31248.1"
FT                   /translation="MFELFGTSLPSRLLLGTAQYPSPAILADAVKASGTSVVTVSLRRE
FT                   MAGGRAGEKFWSLIRALGTRILPNTAGCHSVKEAVTTAKMAREVFGTSWIKLEVIGNQD
FT                   TLQPDVFGLVEAARILCEDGFTVFPYTTDDLVVAERLLEAGCKVLMPWCAPIGSALGPV
FT                   NIMALRSMRGHFPDVPLIVDAGLGRPSHAATVMELGFDAVLLNTAVARAADPVGMARAF
FT                   GKAVEAGREAYSSGMLEPRDVAVPSTPTIGRAVFS"
FT   gene            470639..471244
FT                   /gene="thiE"
FT   CDS             470639..471244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /product="PROBABLE THIAMIN-PHOSPHATE PYROPHOSPHORYLASE
FT                   PROTEIN"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; thiamin"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31249.1"
FT                   /translation="MKLDPFYLIVDSAAWIERLVPLGVKLVQLRIKTMDEAGLRAEIRK
FT                   AKALCAQNRCQLIVNDHWRLAIEEGCDFVHLGQEDLQTADRSRIRVAGVRLGLSTHDDI
FT                   ELETAMAAGPDYIALGPIYPTILKTMKWAPQGLERISEWKRRVAPIPLVAIGGLNPDRL
FT                   NGVFAADADSAAVVTDITLNADPEARTREWIEKTERWR"
FT   gene            471235..472005
FT                   /gene="thiD"
FT   CDS             471235..472005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /product="PROBABLE PHOSPHOMETHYLPYRIMIDINE KINASE (THIAMIN
FT                   SYNTHESIS) PROTEIN"
FT                   /function="small molecule metabolism; biosynthesis of
FT                   cofactors, carriers; thiamin"
FT                   /note="Product confidence : probable"
FT                   /note="Gene name confidence : putative"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31250.1"
FT                   /translation="MALRREPHVLVVGGSDSSGGAGIARDIETVSAFGLRSCLAITAVT
FT                   VQTHSAVEHVKLVPSELVAAQMRAAFAANAVAAVKIGMIGTSAAVEAVGAVLVNRQVPV
FT                   VLDPVLASTSGRNLLADDAINMLRHDLMPICRLVTPNLVELAAFTGSSPAADEEGACRQ
FT                   AEELSRTVRTAVLVKGGHAQGTRCVDVLLQPNQRAVRFEAPRLPRGMRGTGCMMASAVA
FT                   ASLALGASLEASVRQGKQYVLDALAGSKDIGPIS"
FT   gene            complement(472267..473295)
FT                   /gene="msi395"
FT   CDS             complement(472267..473295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi395"
FT                   /product="PUTATIVE MONOOXYGENASE OXIDOREDUCTASE PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31251.1"
FT                   /translation="MDKAFPSGLAVGIFDHLDEDGPDIARQYEDRLMLAEACDHLGFYA
FT                   YHLAEHHCTPHGRGPSPNLFLSSVAQRTRRLRVGPLVMLLALYHPLRAFEEICMLDQLS
FT                   GGRLELGIGRGSLPIELGYFGIGSDAAPNHYAEASEILINALKGGTLSYQGRHFELNSV
FT                   PLTLRTHQRPHPPTWIATNRPESAGWAAANGMNIACVGPSSSVRRITDAFRAGREHTSE
FT                   ADDQAPFLGLLRMVVIGRSETDARSLAAPAYERWLKSFKFLYDLNGMPTPPNLPLTFDA
FT                   AIEKELCVVGTAASAGQALLDQLEAAGANYLLCQPAFGNLSLDASLYTATAIQSAIMAR
FT                   VG"
FT   gene            complement(473422..474531)
FT                   /gene="msi396"
FT   CDS             complement(473422..474531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi396"
FT                   /product="PUTATIVE AMINOTRANSFERASE PYRIDOXAL PHOSPHATE
FT                   PROTEIN"
FT                   /function="small molecule metabolism"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31252.1"
FT                   /translation="MSDAKLQSVLSSLSQVARQLDALPSDRPAPGSSWVKLNTNENPFP
FT                   LPAIIMQSAIAALERQYLYPEDDNISLREAAANAYSVSMDQVIAGNGSSELLGLVYRAF
FT                   LAPGDSVAMMSPGFSFNRKLATLQGAQFVEIKFSEDHSLPMEQLLFGPAKDAKFILLAN
FT                   PNNPTGTFVPVADIERLVAKSDRLIVLDEAYVDFAPENGLRLINRYSNLLVLRTFSKSY
FT                   AAAGVRVGFGFGHPEIIGRLRNIQNVFNMNVIGQAVGISVLAHRAAYADNHRHIRHERR
FT                   RVTLALSQLGFSVIPSHANFLLARVPTGQDGLWWQSAFARQKILVAVFPDKGLENYIRV
FT                   SIGTKEQMDAFLRAASRISRILNMSRPPY"
FT   misc_feature    474787..474946
FT                   /note="REGION CONTAINS TWO NIFA FRAGMENTS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    475193..475352
FT                   /note="FRAGMENT OF  M. LOTI MAFF303099 PROTEIN MLL5838,
FT                   CONTAINS A LACI MOTIF"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    475533..476254
FT                   /note="REGION CONTAINS TWO TRANSPOSASE FRAGMENTS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    476395..476517
FT                   /note="TRANSPOSASE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    477143..477416
FT                   /note="REGION CONTAINS TWO FRAGMENTS OF IS SEQUENCE"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   misc_feature    477448..477480
FT                   /note="REGION CONTAINS AN INSERTION SEQUENCE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   mobile_element  477499..478564
FT                   /mobile_element_type="insertion sequence:msi436"
FT                   /note="predicted by Homology"
FT   gene            477568..477834
FT                   /gene="msi397"
FT   CDS             477568..477834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi397"
FT                   /product="PUTATIVE INSERTION ELEMENT TRANSPOSASE PROTEIN"
FT                   /function="elements of external origin; transposon-related
FT                   functions"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31253.1"
FT                   /translation="MKRKRFTEEQIIAVLREHEAGAKAGDLARKHGVSEATLYNWKAKY
FT                   GGMDVSDAKRLKALEDENAKLKKLLADQMLEASALRELLSKKW"
FT   gene            complement(478583..479512)
FT                   /gene="msi398"
FT   CDS             complement(478583..479512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi398"
FT                   /product="PUTATIVE TRANSPOSASE FOR INSERTION ELEMENT
FT                   PROTEIN"
FT                   /function="elements of external origin; transposon-related
FT                   functions"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31254.1"
FT                   /translation="MVGPAVKREAVAHLQAVMGLSERRACSFVGADRKMIRYQSRRPSE
FT                   TELRGRLRDLANERRRFGYRRLFILLRREGEASGVNRIYRLYREEGLTVRKRRARRRAV
FT                   GTRAPILVEAKPNARWSLDFVHDQFACGRRFRVLNVVDDVTRECLAAIPDTSISGRRVA
FT                   RELTELITQRGKPGMIVSDHGTEFTSNAILAWSKDHRIEWHYIAPGKPMQNGYVESFNG
FT                   RMRDELLNESLFFGLDYARSAIAEWKEDFNTARPHSSLGYQTPAAYAEVITATGSDAVL
FT                   MEGSAPPPVAQPAPHGVTKTVEALIAAG"
FT   mobile_element  complement(478776..479841)
FT                   /mobile_element_type="insertion sequence:msi435"
FT                   /note="predicted by Homology"
FT   gene            complement(479506..479772)
FT                   /gene="msi399"
FT   CDS             complement(479506..479772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi399"
FT                   /product="PUTATIVE TRANSPOSASE FOR INSERTION SEQUENCE"
FT                   /function="elements of external origin; transposon-related
FT                   functions"
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31255.1"
FT                   /translation="MKRKRFTEEQIIAVLREHEAGAKAGDLARKHGVSEATLYNWKAKY
FT                   GGMDVSDAKRLKALEDENAKLKKLLADQMLEASALRELLSKKW"
FT   misc_feature    479842..480372
FT                   /note="REGION CONTAINS THREE TRANSPOSASE MOTIFS"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   gene            complement(480446..482221)
FT                   /gene="msi400"
FT   CDS             complement(480446..482221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi400"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /note="predicted by FrameD"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31256.1"
FT                   /translation="MITSKSRPLAIAAIPILRVSARVVLEKGRGWSAIDELVLWAFSIK
FT                   ARSATQMARELNLPRRVILEIVYRMMRFRLIEAVLLHGVPAFQATAYGSAIVLHGEEIP
FT                   TLQRRFSRKIAFVVDKITGTVFPKRDVRVENAGALTAFKESGAAVHEIEVRGQKVQTSP
FT                   SQNVARFQEILNPDETLIYFDGDTLIERDDEYIIVTADGHDLRGLPAKAPAQLKSQVVY
FT                   ALSLPVSGKKVVMNSLISKDDEPIVPLMARIDFDPRTDLIVGGQEHMDAFHAILATASR
FT                   RIYLHSSFLKKDSFDNVVDLMRGAVRRGARIDIFWGAGSSNEPKEKTLLEATAISKAIS
FT                   GDDSLRGSVTIHLRSTGSHAKLIVADDGLGGWIGAIGSCSWLFSKFDRLEVTAILRSPG
FT                   IVAQLVSSFCKLIAQPGFRPEVGSELYLLGNALRLQPQQGKMTAGVVSGQMHEALLRHA
FT                   SGTAEKRFLIASDRLGNAAFANAIIPAEHFHSRTGLTPVVVYSQNSGAIAEASAAMSVA
FT                   VEALARGVQVVSPTESFHAKFLLWGEDDVVITSLNMGSATISPDLPMGELGVHLSGSQV
FT                   ASHLIDRLRGRWAFL"
FT   gene            complement(482218..485799)
FT                   /gene="msi401"
FT   CDS             complement(482218..485799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi401"
FT                   /product="PUTATIVE HELICASE PROTEIN ATP-BINDING"
FT                   /function="macromolecule metabolism; macromolecule
FT                   synthesis, modification; dna - replication, repair,
FT                   restr./modif."
FT                   /note="Product confidence : putative"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31257.1"
FT                   /translation="MARRNQRIRLEDTFSLSEDYLQRPQVEELRPGLITAVVKETGEDR
FT                   TLKIWWKAGDQADGEFRELWNHERLQVDRVMNYPDADEVMVEIIEMIETADSFCVVYEA
FT                   AATPLAARLRTLSSRHWLKGLDIVSNRAILWSNLSRLAKAIGLLHARGLVHGRLDRHAV
FT                   FTNGSNSADFKLGGFEWCVGMGEAKPLDPMLAKARARIDRLIYSYGDDWKALGALFADI
FT                   LGVDVTRLRSDDPFQRGRPVIDLSEGEIDFLRRLTDPHREDAADARWVMRSVDALLREL
FT                   VRFGTTKAARFILLARPNRKMAEAIDQATDGGIPIDDLDGQIAYIEGDIASGAKIVVSN
FT                   QNDLETLDTLTIITEALSYRVRQFTDEGPPTWQIATVVSIVPRDRARLPGDREVHRLNH
FT                   EVLVARNKHDALALLGRLRSMAIDWTIPIVPAKVDDINRESVPLQRAVLLVQVVEALVK
FT                   SLDILPVSVASAKTDGGRNVVRLAPRLGTARDNLAAEIEERNTAEVMDRIFEKEDLGTD
FT                   VDWRLSVSGTLSSKNATEIRARFLGVVEGPNGSPLYEFDVLDLIRDEKNLFLKRSGEAG
FT                   TEALIRRRLRTTKALGEQRDLASLFVDLRRRIRSSQDVLVEDSEYRDLDGPKREALEQI
FT                   WKTLPNHLVVGPPGVGKTRLSAEVVRRRLEGDPAARILLSAQSHQALDHLLSTVRKKVV
FT                   AALPETIIVRSRGGDDSVSTDEDLRKTAASYLDRVLSSALINEAPGPLQLGISSLKEAV
FT                   LHATFDDEGKVTRPLNRREEIGLRALDALVLESANVVFSTSNSFDVERLCEDGAQFDWV
FT                   LIEEAAKATGPELIAPLSLSGRRLLIGDHHQLPPFDAERLTSILSNNTAVRNALQQVEH
FT                   VLGATFFESGLDELRSAVRDEAVLETTTQLALRMLEPFRSLVEEEERKRTVAGGQRRTV
FT                   SSELWCQHRMDPAIAELVSRCFYKNRLYTGDDRIESAKLPLPFTFDSKIPSSPIVFIDM
FT                   PFASRSGRAEPVEKGRPRWHNPSERKIVLEILRRLKVADLKPAPADLNTLAVLSPYRAQ
FT                   VERMARDLDVLRDSGASSIAQFSGFTHDSRMHGTVDSSQGSEADLVIVSLVRNNHRNGV
FT                   ASLGFLRDPRRMNVLLSRAKMQLIVVGSLEFLKESTRHASAVEQDDLAFIRLFLDTLEY
FT                   LTTQKAYRGGPAAVVTRAADALEGVTF"
FT   gene            485849..486466
FT                   /gene="msi402"
FT   CDS             485849..486466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi402"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31258.1"
FT                   /translation="MQPHPGRTTDPLLGKMWKTKSARFNAHTRLKAKQSLSTTATSFLA
FT                   FYLVIVALIPLLYEASLPPGGPKFLSVVSLIISIFLIIITLLESAKNYSGEADGMQKCA
FT                   LEISEIYNQFQALTLEEANSRRPEFSATYSDILKKHQLNHKDVDYIRFELMFHKDMQIG
FT                   IFSLTLMFIRYVALIIAEYWLYFVLIIGPTVLGYCYRSEIGL"
FT   gene            complement(486670..486894)
FT                   /gene="msi403"
FT   CDS             complement(486670..486894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi403"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31259.1"
FT                   /translation="MGMAMPYRQGRHGHQLPAAEFSLDHSSCDVLEQRSACFGPKKRAL
FT                   ELSLALKGAAPAVHWGRRCLRVRGIDKAA"
FT   gene            complement(487298..487549)
FT                   /gene="msi404"
FT   CDS             complement(487298..487549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi404"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31260.1"
FT                   /translation="MKEAGPLLCGRIGFNTSFEYLRDPINGRGQHDYHAEVDYALGASK
FT                   ATFGNDLCEGPEGGGLGTSTLALTYDNGTDKDSNETSS"
FT   gene            complement(487892..488338)
FT                   /gene="msi405"
FT   CDS             complement(487892..488338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi405"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31261.1"
FT                   /translation="MARKVSGATAPPGGARVEAKTRRRGISDQGALVTALESHTKALHR
FT                   ISDVLEKANFDTLLKKIPPPLDNAGILKVLATFFHRPDLKTGSAFNIISQGAPLSLIAN
FT                   VFNNIKEFNDRGLAIQSNDIDDINTVGELVGRIKVKLDEARGKL"
FT   gene            complement(488512..488832)
FT                   /gene="msi406"
FT   CDS             complement(488512..488832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi406"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31262.1"
FT                   /translation="MVPIPRGGLGLQGRDGRMVAVPKGALGLQGRDGRMVAIPKGALGL
FT                   QGKDGRMTAIPSGALGLQGKDGRMVAIAKGCLGLQGPDGRMVAIHPGKIGVPDANGRMR
FT                   NK"
FT   gene            complement(489022..490728)
FT                   /gene="msi407"
FT   CDS             complement(489022..490728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi407"
FT                   /product="HYPOTHETICAL CONSERVED PROTEIN"
FT                   /function="miscellaneous; hypothetical/global homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31263.1"
FT                   /translation="MGGTVMASNFQATGSNAKAAFTLKVHRGERMALVAMNWRTGKPPT
FT                   SFVGFAIQYQAPGAAKPSTVYNRLNFEGSPNPKGYKTFRTTEAPIQKFRWVVFPHDDPP
FT                   PGPYAFIVTPLFMDPAGALSPGKAQTATIDLGKETYPGQINVAFTRGYVASQAFVDRYQ
FT                   DGGSLKTLLPARVDQGTKFVPTHPKSAEAYEWMGLEARKEILALLDAAVADPTAKVSMV
FT                   AYDMSEKEIMDRLLALGPRLRIIIDDSDKHGLKTSGETQSETLLIASAGSSNVKREHMG
FT                   GLQHNKMIIVDTAVPRAVCGSTNFSWRGLYVQSNNALLLTGAQAVAPLKAAFEDYWKKD
FT                   GFIGSPSPDWHPLRLAGIDANITFSPHDKARARLAEIGKDVEKAKTCLLYSLAFLSITP
FT                   GAVTDAVEAATNSPIFTYGISDKNTGVIVHKPNGNMAPVYFARLNKHVPTPFKVEPSSG
FT                   MGPNLHHKFLVIDFNTPDARVWTGSYNFSAAADLQNGENLLLIRDQKIATSYMVEGVRI
FT                   FDDYHFRVTQEDAAKAKKTLSLQKAPQAGEDPWWAEDYKDPFKIRDRELFA"
FT   gene            490966..491802
FT                   /gene="msi408"
FT   CDS             490966..491802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi408"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31264.1"
FT                   /translation="MMKALRTAVCLLAAFGILAPARAKVRQLSPAMLQQRIAAWAEPHV
FT                   SEDHHEGQYMRQGCSHANLEQLPDWKGLPVKVCTYTDTQFPKNPVKATAYLLFPSADQL
FT                   ASWIVNACVDAGRDDLTTCTGRLASRLWMASNAQFPVAGYVVEPAQDKKWKYPNEPYCF
FT                   LFRDGVSVTTASYPDTTHAVDKACGPPAAAFEAPVKAFSYGRPVSATRKSYTAAGGTGD
FT                   VGDADLRSPQWAFAVGQAFRAGWRAERNLLFRAAVADLSACDGNIWTDERIPSSCQ"
FT   gene            complement(492154..494016)
FT                   /gene="msi409"
FT   CDS             complement(492154..494016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi409"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31265.1"
FT                   /translation="MRKIALLVALLLGAFVDDASAAYDCENHPVSVADADWCKYFDEFP
FT                   YTRQDDLGRKVNWLVKESMAAIDLPDKAIRSYAFVVSVWDYRKGQVDEDEVEGIKADKP
FT                   AILKFISGQGFDEAIVLNNGDATADRIRKIFTEYYIPKFESAAAAGQKIRFMFIFDGHG
FT                   WQPRTSGGTGALALAEITDDRDLDYDHRFSLAELRGLLQDVSQYTQASIALLGSCYSGS
FT                   VFEDGAGHEEDFAPGSAAWIAAAAPRGIEAWELKDRSGTVFFTNLFRAVETWHGASADL
FT                   VPQDPGGNIALDMTQYAPTLRDVTTLINTRNFFGGKNPETGQPYPPFMVDTIEFSGGKR
FT                   AAYRFVAGQDLADKVGQNIGLNLDKVAFTGSSIEGRSDITVVHTPATYSIRGIDLSPGN
FT                   IKDSFDFEKIKSEAGISFVYFKASEGQKPSNPEDQSKEDQKFGLVKRAWDKARAAGLSV
FT                   GTYHTFRFCEEAQDQFAYIKERVPRTEGMLPIAIDVEWYNGAPNPLVGNCGSTASKAHA
FT                   KIYELARDLEDYYGKKPLIYLVSSSVKEIVGDSADYPLWIANYSANAAAIGPGEPWTLW
FT                   QYTGRGRIPGSQNAVDFNYFFGNEAQFALFRKSGTNIAGEVASK"
FT   gene            complement(494055..495065)
FT                   /gene="msi410"
FT   CDS             complement(494055..495065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi410"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31266.1"
FT                   /translation="MCAVRLNRRSVLLSTLASAIYVGTNNSLAKKAPAGQLPTDDLTRS
FT                   EIFNEYLVKPWDAANPANGGTLAIPAKFSFPDDALYDCKVNARNECVTDPKTPRPADMM
FT                   FGIDISHYTDPNFSFNELRSQQVRFVQMKTSQRHDIRDKRFPDFWKRCGSLTGDAKVYR
FT                   GPYHFLAYGAKGKQQADWFIQCLENADPHGLGPEDMAPGVDLEWDVYKSTGKTDHWAGK
FT                   GADHIQEVALECLETLKSRLGRTPILYTGKSWFSDQTLPLDRFKNFADYPLWVFDYNPR
FT                   RKIQEKPVLPDASKPAALWQYTASAKVPDYKKTVDASVFYGTEADFRKTFGIAPV"
FT   gene            495419..497293
FT                   /gene="msi411"
FT   CDS             495419..497293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi411"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; hypothetical/partial homology"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31267.1"
FT                   /translation="MFGDYVELQSFSIEITICSHFAETAMGGTNVPTPPPDLAGLARYP
FT                   KMTGWFSPGLLLRLLWRVVLSDLFGQYADRRLIVAALDTVPEDELVKRARQFLPGQDNQ
FT                   EVWNFGPDSDGAVWVDFVADLGDGFDATYAIASLISQEKLTVGGQQTRRGQLLVMGGDE
FT                   VYPRAASETYQKQLRDPYDWAFPDPNPGLLKGPPVYAVPGNHDWYDGLVLFLALFCRKD
FT                   HMHLGGWRTHQRRSYFAVQLTDQWWLWAIDAQLVDDVDQPQKEYFLEIAKAMPDNAKII
FT                   LCGPEPGWLYTGKAGNRALRVMSYIGSIALKQRRGLTIPLVLSGDTHHYSRYVADDGSA
FT                   QFVTSGGGGAFLHPTHQVEPSVNLDRVSDGYSWLSGQIKGLRLGANEQGREAVYPSKAD
FT                   SLSMLRGNFVFVAYNPAFALVLGSAYWLISLMGKALTYDIYYIAPILLVAGFWGYTKNQ
FT                   EGGGAKTGLVSLANGIVHSLCVAATVTLVAWFNGRFGGLGGWPRTSFLLTAAETILIGG
FT                   LVGGSLFGAYLYVTSRWLNMNHNDAFSSMRRDSHRHFLRMRIKGDTVTVFPVGLTDVPK
FT                   RRDWRLNSEKLGNPAPVYTPQSALKPQLIEQPFSVGATPAQNDTDSLA"
FT   gene            complement(497476..498273)
FT                   /gene="msi412"
FT   CDS             complement(497476..498273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi412"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31268.1"
FT                   /translation="MGRLSRRAFLSASASAASSLLLPSGNVPTARADDKTPRTYSAVDC
FT                   YSYPGDDAIKQLREQLKFDIVGFYLNHVRGTPDLTWTYDRRSDLAMSGWGFFPTYIGGD
FT                   LSLMVSKPELGIKHGLEAAQFMTDVGFGQGSVVYLDIEKPAGELQLSPYLNNWIKAVKS
FT                   RKFYPGFYGSYSMADWLKNLSSALWSVELPAPVAAVSYDSDDNPTGLITSRCIATQYLQ
FT                   KQKLAIIKGTPGGDGTYDLSRSLAADPSDTACIAAALNIKTLK"
FT   gene            498481..499581
FT                   /gene="msi413"
FT   CDS             498481..499581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi413"
FT                   /product="HYPOTHETICAL PROTEIN"
FT                   /function="miscellaneous; unknown"
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31269.1"
FT                   /translation="MLRDPTIALHGLVKADDAYAVYYDETNNIRRLHVRADGLNERDPK
FT                   CFVIAGVAHRGPPRPISLEALRSELRIQASAKEIKLKHIATGSFLEALTSPKMEAFLAW
FT                   LSAQDLYTHFTVLDPLYWSIVDIIDSILAEAGENALLPWNQALKNDLYTVLRHDYETTV
FT                   DMFRRYTYPDVGRARRREFVNELLDLLTHRANLLPPLRRNMLKGVLQIATRLDALPFLE
FT                   DETPNVLIEGFGPFYLERIAMLKNSTHILDDEYGVEPYLSGLGLTNGAKPLANYRFASS
FT                   HDEPGIQLSDVVAGLLGKFFTYVCVTAGEELVQDRQNLSAQQTRTLERLAALMEQSVEE
FT                   NAVFAHYILSERDRHGAAFFLDRTGS"
FT   gene            499691..500620
FT                   /gene="msi414"
FT   CDS             499691..500620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msi414"
FT                   /product="HYPOTHETICAL CLASS I NUCLEASE PROTEIN"
FT                   /function="macromolecule metabolism; macromolecule
FT                   synthesis, modification; dna - replication, repair,
FT                   restr./modif."
FT                   /note="Product confidence : hypothetical"
FT                   /note="Gene name confidence : hypothetical"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAD31270.1"
FT                   /translation="MKVREIIAAAVVLASPTHAFAWGQEGHAAVAEIAQHRLTSSASDV
FT                   VQRLLRAHLGLTGQQVVSMASIASWADDYRADGHKDTSNWHFVDIPLASLPGGSSATTD
FT                   YDAIRDCADDATYGSCLLKALPAQEAILSDATKDDESRWKALAFVIHLTGDLAQPLHCV
FT                   QRVDGSQKDQGGNTLTVTFNVTRPAPDNSTFRDFTTFHSVWDTDLITFKYYDWGLAAAE
FT                   AEKLLPTLAADLLADDTPEKWLAECHRQAEAAYQALPAGTPLKSDIGHPVILDQAYFEK
FT                   FHPVVTQQLALGGLHLAAELNEALKGGK"
FT   misc_feature    500762..501305
FT                   /note="TRANSPOSASE FRAGMENT"
FT                   /note="predicted by Homology"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
XX
SQ   Sequence 501801 BP; 102663 A; 149033 C; 148324 G; 101781 T; 0 other;
     tcccctcttc tcccgacagt ctctttcgcc gaagcctcta cgcttctgtc tcggcaacta        60
     gctgaaatcc ttactgattt cggcgcgcaa agcgcggatg gtcgggtttt gtggaatttc       120
     ggcgcagttg gtccaacgag gcggggggct ggtattttcg gtggtattgg agatgctgat       180
     ggtatcgctg cagccaaatg gaggtcccga aaatggccct ttccgacgta aaatgccgaa       240
     atgcccgacc catttctaag ctcgtaaaat tgtctgacgg tggcgggctc cagctttggg       300
     tgcagcctac cggatctcgc ctatggcgcc tcgcctatcg ttttggcggc aaacagaagc       360
     ttctggcgtt gggcagctat cccctcatct ccctcgctga ggcacgcgag gcgcgcgatg       420
     ccgccaaacg tctcctccta cgtggcatcg accccgcaca ggagcgtaag tcgcaaaagg       480
     cttcggcgga ggacaccttt cgctcaatcg cggaggacta tgtcgacaag ctgaagaagg       540
     agggacgtgc cgaccggacc atcaccaagg tcaaatggtt gctcgacttt gcctatccaa       600
     cgtttgggaa caaaagcgtt cgggagatcg atccggccac aattcttgtc gctctccgca       660
     gcgtggaggt tcgcggtcga tacgagtcgg caaggcgact gcgctccacc atcggcagcg       720
     tgtttcgata tgcaatcgca accgcacgcg ccgatgtaga tccgacgatc gccctgaggg       780
     gcgcactggt cggtccgacg gtcaccccgc gtgccgcagt taccgatcct aaggccttgg       840
     gaggcttgct gagggcgatt aatgcatttg acggacagcc taccacccga gccgctctga       900
     agctgatggc cctgctgttt ccccgccccg gcgagctgcg cgcggccgaa tgggacgagt       960
     tcgatttcga aagcgcagtg tggagcatcc ctgaaggacg catgaagatg cgacggccgc      1020
     accgcgtacc tctttccaga caggccgtca gcgtcctgac ctcacttaga gaaatctctg      1080
     atggtggagc actggtgttt cccagtgttc ggtcgcgttc gcgtccgatt tctgacaaca      1140
     cgcttaacgc tgccttgcgc cgtatgggct acggcaaaga agaagctacc gcgcatggtt      1200
     ttcgagcaac ggcatcaact ctgctaaacg aatgtggaaa gtggcatccg gacgccatag      1260
     aacggcagct ggcccacatt gagagcaacg acgttcgtcg ggcctacgcc cgggcggagc      1320
     actgggaaga gcgcatcaag atgatgcaat ggtgggccga ttatctggat gaactcgaga      1380
     gcaaagacgc gggggtaatc tcgattgggg gacacggcaa atccaccgtc catacgccgt      1440
     cgcgagatct acgttgaatc caacatcgac ggtcgaccaa acgccgagac aaatctccaa      1500
     cctccgaaaa tcacactgaa ccccatcgaa aaaccgaaag tgggcgacca atgtgacaga      1560
     accggatggt catcgttttc cacattaaat caatatttta gcgtctggtt cgccacacat      1620
     ttccttcgta ttctctcgta tggtctggcg aacctaagga ccaggaggag gactagtatt      1680
     ccctccgcgg cgtctcgtcg gcccacaaga agggtcgatt aaccgtgacg aacgtggctg      1740
     gtttggggcc gagaccggaa cggcgacttt cgaaaggcga aaacgagtaa ccagccattc      1800
     cggtggttca gcctccaacg ggccagcatg atcatcattc ggtgttatgt tgccgccgtc      1860
     actgctgccg acgcggtggc tggaatcggc tcctcccatt ccccgcgtat ccacaacgag      1920
     tgaagttcaa aatcggcagt ttcagcattt tgctcgggat ctccatatac agctgtctcg      1980
     acatagggga tgcctacgtc aaagcggtcg ctagagccct ttccaaactt atgatcataa      2040
     cacgcgagca acacgccaat cgaaagcagc tttgatgaga gaggcgacac aaacagctta      2100
     cagccaccca taggtttgag agcttttttg tatcgttcca tggccgtaaa tatttggcgg      2160
     taagcctcga acggattgta ttcgcttgct agcaagatgt ttgccggctc caccttgaag      2220
     tcgtcgaaca gagtgtcacg gtgctcacca accacctcgt cccctcgccg tggctttctc      2280
     gtaggaaaag ggataaccgg gcaaatctca tccgggttca catggtcttg tatgagatgc      2340
     agtcggtcac gctgaccctc acccaaaaca ggaaaccaca cccgcggcca attctgagta      2400
     gtctgctctt caagatgtcc ggagaagcca aggacgaagg ttacgctgtc cctgagactg      2460
     ccttttgccg cgccgagatc cgcagaaaca ctctcggatg tggtcacgtg aagatttacg      2520
     cttgggccgt tggcttcggc cagcttatca agtttgaaga gaagaacgct gacagcggta      2580
     agtgccacca tgcgcggcat agcgctgatg tcgacaatga catcgtcaaa gtcgcgacaa      2640
     tctcccgctc tgtccaatga agctttggta tttcgtggag ttacagcagc gcctacgggg      2700
     cctccaatct cgatcggcac tgcaacgatc ttttccgcgg gaacgagttt caagagtcct      2760
     tcgtggttgg tcgccgtgag ttccgatcgc ttcgggctgt cgcccaatcc gttgtcgaac      2820
     accaactgcc agaccgatat atcggcgtcc agggcatgca agcgtcgagc agtttcaaga      2880
     gttctgacgt cgaaaccgcg accaatcacg agaaggacct tacgcttctt ggccgacaag      2940
     cgccgtcgcc agaacatggt gaaatcggag tcgagtgtga gggagtaggg atcccatcgc      3000
     attgccgggc tcggactaga caagagttgc ctcctcggcc acggcgattg ccttcgctcc      3060
     tgcttcttgc cagtgaagca agctcttcag tgtttgatgt ctccagccgc cgtaaccaag      3120
     tggcaggcca aaatgtacgc agagaagacg gttcagatag aacacgacat attcccgacc      3180
     attatttcta tggtcgagac gtggcatcag taggttatgc gacacgagag acgtcatgac      3240
     gtctcgaagt cgaataaaat gcgagatttc agcgtcctcg ctgtcaatta tcagttttcg      3300
     atcgtccatc gtgatcgcaa ttccggtgac gccgggtgcg tagggggcgc tgcttctgaa      3360
     agtctgttgg cggcagtatt cgccgattgc ttcgagcagg cggcgcgcct cgacaccacg      3420
     cggaaggcgg cgcggaagcc cgtcccaccg atccttcgca acgccccgga tcagtgcgtc      3480
     ctgtcgcgct gccgtgagtg gcaccggctg atctcggtga aaccggattt tcgcagagat      3540
     ttcttcaaac aatgcgcctg ccacctccag atactggtcc acattggagg atgatacggc      3600
     gctcaaagac tcacggccga aatagattgg cgctcccaca tctgttcgca gaaagtgttc      3660
     tgctgctcgg tccgtgccgc tgcctgatcg tgctccgaac tcatccaatg tcaatgaatc      3720
     gaaatcgaag cttgtctggg ttcgtctcgt atctcttatg accagaattt tgagcaactg      3780
     ccatttgaag gcgcgttcga gaaggttgcc gcttagcccg cgagcattgg caagccaatt      3840
     cgaataacga gggccaacgc cggccatctt aacaacttcg gcctcgatct ccgccgtacg      3900
     gccagtgaga gcggtctcca agctcggtat gtcgtcggtt tcaccaatga gcggaaacag      3960
     ctcgcgccct tcgaaaccat cagccttggc cgcccgaaga ttggcgatcg tttccacaaa      4020
     tttggtatag gacttggttc ttgttccaga ccaacgttct tccagttgca cgacgttctc      4080
     gtaatctcgt ttgcgaagcg cgccctcgga gagcagatcc ttatgcgtaa gagcctctag      4140
     cctttcagcg atccatactc cgcactgctc ccgcgcattg gttatgaatt caatcaggct      4200
     tgcacgctgt ggaggagcca gtgtctggag ttcgtccatg agaaggacgc gcttgacgtc      4260
     catatcaccc tgcgcgtcgc ttatgcgaac atgcgcaaac cacttgagcc cgtccaagcg      4320
     cgcgtgccca ccttttatcg acgcaggcga accgagatcg tccattcgat cgtagaaatc      4380
     tcgttcgatg cgcgacgccc aggtaaaaag ctcctttcct gtagcgcggc ccggaatagt      4440
     cgcgtctgat tccggctccc attcgaagct gtattggtca agatcgtcgg gaaattgacg      4500
     ttccgctcgt tccagcaccg acctgagtgt cgcgaccaca attcgagaat tcaatagctc      4560
     tcgaaagagt atattgccgc ggtcaaaggc actcagttcc ttgtactcac tggtgaagac      4620
     gaccatcgca ccaagcaatt tcggtccgtc gcgaccgatg gcgcccacct ccctcagcgc      4680
     gtcgcgcgtc gccttcacct gctggtgctg atcagcgagg ttgtcagtga gcttcagcgg      4740
     acgcggcgta agaatacgca gaaacgtagt ctttccgcca ccaggtgcac ttcgaagaaa      4800
     gacgagaccg ttccaagggt catcgaagga cttgatgacc tccaaagcac ccacgccgaa      4860
     gagacgaaca aactcatcgt cactcgtcga gcgctgggat gcgcgcattc ggaatggatt      4920
     tctcacctac tgtagctttc tgtggcggct aactctcgga aacaggccac gaaccgattg      4980
     gtcgtcctct gcccagagca gatagatcga gttgttggga gtgttgtgag ctagcacgag      5040
     cgggagcctg caattcgcga aaccgtagcg cttgcttgta ccgcctactt tagaatgctc      5100
     atcgtcggca tcgtcgtcaa aatatcgatc atctgcgacg agccccagga ttgggctgtc      5160
     gcttgcatca tcgagcggcg tcgtttcgcc cagtttgtga accacctcga actcgactgt      5220
     gcccttgccg aaggtcaact tgggcaaacg gctttcaatg tgctcgattg cctgatcgcc      5280
     ggcgacatag agaatgatga ttatcttgac gccggaattc gctatcgcgt ctccaaggtt      5340
     tcctgctttc attaagccgc taacgatctt cgctatcttc ccggtccatc caccttgccc      5400
     atcctctcga atgaaactcg taccactgcc agtgaaatca tcgagcagta cgatgtaccg      5460
     gaaccgggcc tcatgatcgt ggggttctcg acccaagatc ttcgttaggt gcttccgaag      5520
     gtcttggacc atgccctcgc ttttcggatc cgaaacgtca taggcatgaa agacttgctc      5580
     attggacatc tcttgcggat tcgcgcgacg aaaccagtct gttcgcgcac cgtcgctcag      5640
     gcctaggacc agtgtctggc gaagtcgagt tcgatactcc accgtgtcga cgattgcctt      5700
     cactttatgt ggatcgaccc caagttcggt cgcagtgtca gcgattagga ttgggcgaat      5760
     gatcgtcggg aaggtaagct ccaccagatg attcatttca tctgtggata tgaaaagcag      5820
     cctctttcgc acgaagttgt aagcctcgcg acgctcttca cccccggtga actgcccaag      5880
     ccagagcgcc agactctcga tgaaccgttt gcctggcgag aactgctgat attcgtcgta      5940
     tttgtaactg gcaaagcttt cgagataagc gcgttccgct gccttttcct cgtcagacca      6000
     ttccatgatt tttgccagca ggctttccgc caaatccttc ctcatcagaa ctccccatga      6060
     cacctctacc cgaccgcagc gatataccgc agggaggagt gcgttcgtcc agcgaaatca      6120
     acctggtcct taccttaatt cacgggattc acttgcgggt gatttcgcca accgcagcta      6180
     tgacttttgc aagccgctcc gcaccggccg gtgtattatc ccaagcacgc cgaattgagc      6240
     gctccagctt tgcccagttc ggatcggatg cgtgccgact gcgtttccat gtcgttcctt      6300
     caccctgcgt attttgcagc ccgagggtcg tgcaaattcg cacgacgctc gctccgaacg      6360
     taatgaattg cccccgacaa atacgcgaaa cttggctagc gtcgacatca gcaatgtcag      6420
     ccagttccgc gtaagaaagg cctgcttcta agcgcttttc attgatatgg cggaccaact      6480
     ccgccctttc aatttgcttc ggcttcatgt aaatttgcat gcactaaacg atgcaaattt      6540
     acaatggagt ttttcgtgac ggatgttggc caggaaatcc ggttctatcg tgccagcgag      6600
     aagccttacg gggccttcag caatctattc cggcgcgaga ttgaattcga aggcgagcgc      6660
     tttgcgacga gcgagcacgc ctatcaggcc ggcaaggcgc gtaagccgga agtcaaagca      6720
     tggcttatgg cggcaccgtc tcccgcgctt ctggcgatgg cggcgcacgg gctatattac      6780
     tgggatgtca gcccaggctg gtcacggaca aagtttgaca ggatgaggtg cgtgctccga      6840
     gccaagttca ctcagcatga agatcttcgc gaattgctgg tatcgacggg ctcagctcga      6900
     ctgattgaaa ctgcgaccgt cgacaatgag gtgaatcggc tctggggaga ggtgaatggt      6960
     cagggtcgca atatgcttgg agagctactg atggaactcc gtgcaaagct tcagaacgac      7020
     gacgtctcga aggcggcgta agaagagcca atgcaaatct gaaactgccg acatcgggtt      7080
     tacccccgca agacagaccg cgcgtattct gcaccacgct cgcggaagat gccgcgagca      7140
     ccgacatagg cgcagttctc ggcagccagg cgttgtccag cttcgattcc gacaacgaat      7200
     tcgtcaattg aaatcttccg ggtcgcgcgg tcgcggcggc tcagcagcca atcaatcacg      7260
     ccaacgctta ccatatcgcc agaaccacag gtgtcgcgca attcgggcgc cgggtaggat      7320
     ttgcaccacg ccttctcagc tccccgtcgt acctccagac cagcttctcc gtgcgtcacg      7380
     attaggaaaa gggcgtcgtg gggggcgacc tgccccgcca gtgttgccag acgctctgct      7440
     gagaacttga gaacggacgc tgcagcgact gcgcgtctga aaagctcttt atcgccaagc      7500
     gcggatggct cgaaatagac ggtggaccct gcgtcggccg cagcttccat cgcatcgacg      7560
     atcgctccgg ataatcgatc cgtatagaag acattgcagt tcttgatcgc cggcagagcc      7620
     cggctcacat cttcccagtc tatcggctca tatcgcggaa gatcgatgga agtttctgga      7680
     cacctaaatt cgaatgtatg taccccgggc ccatgcagac gctgagcaag gatcggcgag      7740
     cggatgtgtt ctgtttgtcg gatgtatcgc gtctcggctc ccgcgtgccg gaatgcgacc      7800
     acaagacgga tgccaacctc gtcttcaccg aggctcaaca ccggcgccac attccgctga      7860
     agcatggcga gcgaaatcaa aacgttcccg caagagccac caagatcctc ggacgacacc      7920
     gccaacgagt ccgcgtagat gcggtcgaga acagtaaatc ctgtgccgac cacgtcgact      7980
     gcactcatcg gactctcccg gtcataagct ggcccactct gttttttctc ggtcaccatt      8040
     tcaagagtgc tgatcgaggg tcagagcaga aagatcaatc atcatttcgc atcccttcgc      8100
     acgagcggcc tgcaaaatgc gcaggagagc atccggacct cgcaactttg atccaaacag      8160
     cgtccaagcg ccgcctgaag cgccgcaaac actgccaacg cttagacaat gcggtccgga      8220
     taatagctcc cgatcatttc ccaatggcga gccactatct ccgatgccga gaacggcctt      8280
     gctcgcatcg ccggatcgac gggcgagctc ctctacaacg cggagctttg acgtagatgc      8340
     caagacgata tcgacgctat ggtgagatct cagcaccttc acgctacctt cgactatctg      8400
     agggcaagca gccaagccat ccgcaaaacg ctcgacgtcg atgacatcgg cacagtcaat      8460
     cgacacctga attggacgcg tcttgatctc gactccgtcg cgaagcaggc ctgagcccgt      8520
     tagccaccgg gtaacctcgg caatgttcgg atttcgttgc ggggggtcct cagctatgtc      8580
     gacgtcgagc gttcgaatgt gggcgccgtt ataataaccc atgaggacat ttctatgtat      8640
     ccgcttcgga agggcgtctc gcaatttttc gccagcggag ccgccgcgtc ctgtcgcaaa      8700
     gcccacctgg atgccgtcat caacaagcct gaccagttcg tgcataatcg ctttgggagg      8760
     aggaccgagc cgggcttcac gcggatcgtt cgggacgacc gtcccatcat aatcgagcgc      8820
     gagaccgaca aagctcgcgc cccccaaact aagcagcctc tctcgcccaa cggaacaaag      8880
     tgatgctgat cgctcatcga taggatcaaa gtacatccgc gcggacgtct tgtgtcgaac      8940
     cgatgaagtc aaatctcgcg aaagcgtgtc gagcgcggga ttgtcatata tcgcctcggc      9000
     aaacgcgcct ctccccgggc gtcccggatc gatactcgta gcgtttccga ggtgctgaac      9060
     gaaggataga ccccacaaaa tgctgaccgc gttggccaat cggccaccgt gatcgaactc      9120
     agcatcttga atcctggtct gggaaggaag tgctgcacgg atgggcttcc aaacatcgcc      9180
     actttccgcg gttgtcaaag ccagcacgta catggtctct ggatgcttcg ccgcccaaac      9240
     atgacgaccg tgagcgaagt ttctgaaatc agtcctctgt actggcgcta ttccggtctc      9300
     ccaaagagaa gtttcaatca acgttgcagc tgctgcgttt tgcggatcgt gcagaacgaa      9360
     cagagtatcc ccaacctgga aatcgaagtc tgggctttga ggtgcactta gcacctcttc      9420
     cgcgcgcttt cggagttctt cggccaatct cccgcgttgc ggctgctcag tggtgagatc      9480
     tgacgccatc aacaaggcgg tcaccatcga aatcattgaa tgcgtcgcta gaaacccatc      9540
     cttgggatcg gcaactggcg taacaatcac tttggcgcga ggactatttg aggccacaat      9600
     ggttgtcgcg ccttccgatt gaactgtcat caactggagc gatttgcagc tggatgcatt      9660
     tgcgacacgg aaggctgccg cgatgtcagg attgttcgct ccggcgctga acagccagat      9720
     atcgcatcca tcccaatttt ccatcgatag gacgaactgc atgggtgtca tcaccatcgt      9780
     cggacccaat tgcaatgttg tccggcaccg cgagaagaat tctgctgtaa ctacggatcc      9840
     ccccgaggca atagcgacgg cgagccgtcc tttcccttgt gaaagagcga aagcaatgtc      9900
     gccagctccg tgcgcgctcg ccaactcgat tgtctcaggc aaccggcgca atttttcgga      9960
     gaagacagtc attctgctcg cctaacttca aacggactcg gagcaagcgg acgctgtagt     10020
     tcacgagaac ggatcgttcg cgaacgcggc ggggcaagca atctcaccgg cccgtgccta     10080
     agaaacatcg catatccaga gccgggccgc acgctatttt ctgccaacgt atgatggcac     10140
     ccatcttcca gataaagcgc ataaaaacac cagcttcctc acaccactgc accagtttgt     10200
     tcctgttatg ttcggttcag cgatgattct caagcctacc gatcgcaaat ttgtacatgc     10260
     tatcaatgcg ctgagcatgg cgaatatcgg ccatcatcgg catcgacatt ggcgtcatcg     10320
     atcaaccgtc tcggtgaagc tgaggtagcg cctaacatcg gccaaatgat cggccagtta     10380
     tgggcgctca gctaaaattt ctgttgacac atatgtactt agcgcaatct agcatcggcc     10440
     aatcatggaa gagaccgtac agcgcatcga gccggcgcgc ctggcagacg ttgcggagcc     10500
     tatctccgac gcgctggctg agctgtcagc aagctcggcg gttctcggcg ccaagctgca     10560
     tccgcgcacg cgtatgcatc gaccaggtca gtttcatgtc cagccttttc gattttaacc     10620
     aacttgcccg gcgcctgcag cggtttgttc aacgctacga cctgaagccg gaagctttcc     10680
     ggctgctcga ggaggcgctt ctgcgcggcg agttcgatcg cggtgaggcc tcacgtatcg     10740
     ctggcttgcc ggaacgtagg gcccgccgcg tgtttaccga ggtgctcgag cttggcctgc     10800
     ttgcgtccga taccccgaaa ggaccggtat cgctacgctt cccggtcgac acgttggacg     10860
     aactgtttcc taagctattt ccggaaactt agcgtcgcat aactgcgcct atagtgttgc     10920
     cgatgccctt gtcactccca cgagtccagc cgcggataga ttgggaaccg aaacaatccg     10980
     cagaaatatt ttggtatcta tgttggtagc gctgccgctg cgcaaatcac aactatttgg     11040
     aaacaaagaa tcttcttgga ccggattggg cctctgacgg tggcgggctc cagttttgga     11100
     tgcagtcctc cggatcccgc ctatgccgcc tcacctatcg atttgaaggc aagcagaaac     11160
     ttctgccgct agacagctat cttctcattt ctctcgccga ggtacgccaa gcccgcgatg     11220
     ccgcaaagcg cctgctgctg gttggcatcg acccggcacg atcgttattc cgagtcggct     11280
     gagggccggc gtcagcacag cgtcgggaat agcgctctgg ctcagcgttc cggcttgtcg     11340
     tcccggagga tgcgctcagc ggctccgtca agatcctcat attggccact cttcaacgcc     11400
     cacagaaagc cagtcagccc cagtgcgcca agaaataggg cgactggcat gaggtagacg     11460
     agtatcgtca tgatgaccgc gctgatgggt gaatgccgga atgtgttgcc gaagaagccc     11520
     tcgtcagctc ggcgagcata aagccctgca gccgcagccc gtttccgatc accagcagcg     11580
     atgaggcgga catcgcgacc gccgcgacca acggcgtgac gttgccgaag atggcgatcg     11640
     gcacggcaac ggcgttgtag atgatcgcga tggctatgtt ctggcggata agccgccctg     11700
     ccttccgcga gacgtccagc gcaagggtta ctgccgaaag gctttcacgc aggaacacga     11760
     aatcagccgc gttgcgacca atatcggcgg cggtggctgg agcgatcgag acgtgcgcag     11820
     cgcccagcgc tggcgtgtcg ttgagcccgt cgcccaccat caggaccttg tggccggctt     11880
     tggtcagcac ttcgatccgc tcaaccttcc cggacggcag cagcgccgga acaaaacggt     11940
     cgatgcccaa tattcttgcg acatcgccac aggcgtccgc ggtatcgccc gacagcattt     12000
     cgaccgcgac ccctgcatcg ttcaattgcg ccatgacgct cccggcatcg gcctgcaacg     12060
     catcctcgaa agcgaaggaa gcgacaatca tcctgttctt cgtcagaacc gtgccgtagc     12120
     catgtttgcc ttcgccgccg gttcgagcct tccatccagc ccatccgcgt cgaccgagcc     12180
     gccaggtgct gtccgcggtt gtggcttcga tcccgaaacc ggggtgctcg ctgacggcct     12240
     ccaatttcgg ttgaccgaca aaattcgcga aaccggctat ggcctttgag aacgggtggc     12300
     gggagtgcgc ggccatgtcg gctgcgatcg ccagcatcgt cggatcgatc gacgacgcat     12360
     tgaccagtcg gggctggccg agcgtgagcg ttccggtctt gtcgaacacc gctgtatcaa     12420
     tcgtcgccag gcgctccatg gccgaaccat ccttgaccat gatgccgttt tcgaacaggc     12480
     gccgcgcggc gactacctgc acgatcggca cggcgaggcc gagtgcgcat gggcatgtga     12540
     tgatgagaac ggcgatggcg atggttatcg cccggtgcca gtcgccggtc gccgccatcc     12600
     agccaaggaa cgtcgcgaag gctgtgagat gaaccaccgg ggcatagagc cctgaaacgc     12660
     gatcggcgat ccggcgataa tgcgcgcggc cgccctctgc ggcttccatg agccgaacca     12720
     tttccgccag aaacgaatct ttcgcggcgg ctgtggcctc aatcgtcagc gagccggtca     12780
     ggttgaggac accggcctgc acggcttcac ctgccgccac gtttcgaggc gtgctctcgc     12840
     cggaaaccag cgagcagtcg agatccgagg ccccttgaat gatcttgccg tcgacgggga     12900
     ttctttcgcc ggccccgatc aacagcagca tgccgggttc gatctcgcca accggcagat     12960
     agtcgcgcgc gccgtcgccg cgcagcacca tggcgccacg tgcggccaac tgggacaggc     13020
     ctttcacggc ggtccgggcc cgctcgcgca tcacgtgatc caacgtgcga ccgatcaaca     13080
     ggaaaaacag cagcgaaacc gacgcgtcga aataggcgtg atcgccgtgg ttgatcgtct     13140
     catagaggct catggcatag gcgagggaca ctccgaccgc gatcggaaca tccatgttca     13200
     tgcggccgtg acgcagcgcg ttccaggccg agcggaagaa gatgccgccg gcgaaggcca     13260
     gtgccgggat cgcaatcagc gccgagaccc aatgaaacag gtcccgcgtt gcgccttcgg     13320
     cgccggacca gaccgagacc gaaagcagca tgatgttgcc ggcggcgaag ccggcgaccg     13380
     cgaccgcgcg gatcagctcg gcaagcgtct tgtccttttc atcgatctcg gcggcgaaaa     13440
     ggtgcgcctg atagcccagc cttcccagcg cggcgacgaa gggtggcacc tcgtcgccac     13500
     gccaccggat cgcgacccgt ttcgtcgaca ggttgacacg cgcgccttcg acattgtcga     13560
     gctttgccag cgccgtctcg atcgtctgga tgcaggccgc gcagtgaacc gtcggcactg     13620
     aaaggtcggt ctgccaaaga ttgtcgccaa gcgaccggct cgccaacctg atctcctggc     13680
     tagacggcag gaccgatgtg gtaccggtca gatccagcgc cagttccgcg ctgggtgcac     13740
     aacagctcat tgcagcgctc cttgcgaaat tatgatccgg cgaacgtcgc gatagggctc     13800
     cgcgagaccg acgtcggcat cgacttcgac gatccagacg ccatccttgg gcacgtcccg     13860
     tgctgcaaac tcctgagccg aagcaagggt aagagtgacg gacttgtcct cggcctcata     13920
     agcgggatgg cgaaacagta tcttgacgcc atgcaagggg accggcttgc cggtggtatc     13980
     gctcaagctg tagcggacct caccccgagc gatcgtcagt ttgccggtcc agccgagtgc     14040
     cgcctgcgcg cgcccttcct cggcctttcg gttgaattgc tggctggcca cataggtgtt     14100
     ctcgacgaca aggccggtcc agctcgtgct ggcgagtgtc gccatcgtga gattgaccgc     14160
     gatgatcacg ccgaaaaagc cgagaatggt gagcagcatg tgcctgccgg tgaactcacg     14220
     cgtcttttgc gtattggtgc tcatctggcg atctccgggg cgttgaaggt ggcggtgtat     14280
     tcgtccgatt cgaagctcgc tctgtcctcg acgcggaact tgaaggtttg tgcagcgtgc     14340
     cgaacctcac ccgctggctg gcgcacgaag accttcagca tgtttagccg gtcgggttcg     14400
     accgcgatgg cgaagaagcg agctgccggc agatcactgc cgacgacgct catttcggct     14460
     ccctgcaagc cctgcatcgt gacgacgatc gtccttggct cggggatcat gttaagcagc     14520
     ttgacggtgt aaccgttgcg gatcgagccg tcggacaggg tcacgaattg cggattgcgg     14580
     tcgtgcagga cgttgatctc gagtcggtcg cgcgtcagca gcgaatagat caaggcaagc     14640
     ccgaccgccg tccacgcgcc catgtagaag aaggtcctcg gccggaagat cttgcgaata     14700
     tggaaatgcg ccaacctggc ggagaatgtg ctgtcggccg ttctgacgag tgaagggttc     14760
     acgggaccgg agccgcctgc ggtcgccacc gccatgttgg cgttgtagtc ggacagcgtc     14820
     gcataggaga tcagcccgcg ctccttgccg agcttgttca tgacgccatc gcaggcatca     14880
     aggcacagcg cgcaagtgat gcattcgagt tgctggccgt cgcgaatgtc gatccccatc     14940
     gggcagactg cgacacaggc attgcagtcg acgcagtcac cgaccggctg ccccgcagcc     15000
     tggaccttct tggcgtgccg cgaacgaggt tcgccacgcc agtcattgta ggtcacagtg     15060
     agcgaattct cgtcgagcat ggcagcctgg atgcgcggcc acgggcacat gtaggtgcag     15120
     acttgctcgc gcatcagccc gccgaacgtg taggtggtcg ccgtcagcac cgcgatggtg     15180
     acgtaggcga ccgaagcggc ggtgccgttg aatacgtcgc cgatcagcgt cggcgcatcg     15240
     gcgaaataga ggatccaggc gccgccggta gctgccgcta tgaccagcca gatgacgtgt     15300
     ttcgacacac gcagcaccag tttgcgcgcg gtccagcggc cggcgtcgag cttcatgcga     15360
     gcgttgcgat cgccttcgat cgcccgctcg acaactagga aaagatcgac ccataccgtc     15420
     tgcgggcagg tatagccgca ccaggcgcgg gcgacggtgg acgtgatcag gaagaggccg     15480
     atgccggcca tcatcagaag gccggcgaca tagtagaatt cctgcggcca tatctcgatg     15540
     aagaagacgt agaaacggcg gttggcaaga tcgatcagca cggcctgatc aggagcaaac     15600
     ggacctcgat cccagcgcaa ccagggcatc agataataga tgcccagcgt gatcgccatc     15660
     accagccatt tgaagcggcg aaagctgccc gaggcgcgtt tagggaagat tttcttgcgc     15720
     ggagcataga gcggctgtcg tgtcttggcg gagttgaccg cttttgcctc gagccgctcc     15780
     atctgcgttt tatccagcac gtgcatctcc actcgcgcgc ggcctatgac atcgttgtgc     15840
     gacggacttg tctgcttcga cagacgtccg gtctgcagtg agcccgcttc gccgtgtggg     15900
     ccgcgccgcc ttgctgcagg tcaatcgccg catgccggaa tggtgtcggg gcccgactcg     15960
     tgccgggccc cgtcgcttgg cggggagggc cgagaatagg cttccgttcc tattctccgc     16020
     cgccaagcga atggacataa accgcaagtt ccttaacctt cgtctcgccg agacgcccga     16080
     tccaggccgg catgacaccg tgcttcggcg cgcggacttg gacggcgatg gctgtctcgc     16140
     cgggtgcgta gagccagatc gcatcggtca gattgggcgc gccgagctct ttgttgcctt     16200
     tcgcattatc gccatgacag gcgacgcagt tttccacgaa taccttggcg ccgggctcga     16260
     taagacttgc atcctggacc ttgcccgaga ggctggcgac ataggcgccg acctgtgcga     16320
     tctgttcggg cgtgatgatg tcaccgaaag ggggcatttc cgactgccga gtatccgggt     16380
     cggatgcgaa acggatgccg tgcgcgatcg tttgctggat ctgctcggtc gtgccgcccc     16440
     acagccagtc atcgtcgttc aggtttggaa agcccttcga cccttgggcg cccgagccgt     16500
     ggcattgcac gcaattgacc ttgaaggtag ctccgccggc cgctatcgcg aattcacgca     16560
     gcgcgtcgtc ggctgcaatc tcggatacgg tcttctgctg gatggccgcg acatatttgc     16620
     ccttggcggc ttcggcagcc gccagctcaa tcttgacagc gttgcggctg gaatagccaa     16680
     gcacaccctt ggtcgcggaa gacagcatcg gccaagccgg atacgcaatt gtataagcca     16740
     ccgcccaagc gacggtgatg tagaaggtta tcacccacca tcggggcaat ggggtgttga     16800
     gctcccttat cccgtcccat tcatgaccgg tcgttgagat gcccgagact tcatcgatat     16860
     actcgctgct catgatcagt cgtccttgag tggaatctgg gcggcttgat cggcctgtgt     16920
     tttgccgccg ggacgcaagg caaaggcaat gcagccgacg aagaagagcg ccatggcaag     16980
     cagaccccag ctgtccgcga attcccgcat caaattatag ctcattgcgt ccccctcagc     17040
     ggtagccggc tgcatcgtca taggtcttga aatcgaccag tgttcccagc atttgcagat     17100
     aggcgacgag ggcatccatc tcggtcacct gctgcggatt gccgtccaga tcaccgactt     17160
     tggctttcgg atagcgtttc tcgacgccgg aggcatcggc attcgggtcg gcctggacca     17220
     tcagatcggc attggcgtgc gcgatcatct catcggagta cgggacgcca acacgcgcgt     17280
     tcgcaaccag atgcgtcgag aagtccttca cctcgatcgg agcgtccttc aggaaggcat     17340
     agcgaggcat gatagattcc ggcaccaccg aacgtggatc cataaggtgc tgaacgtgcc     17400
     attcgttgga atagcggttg ccgactcgtg caaggtcagg gccggtgcgc ttcgagcccc     17460
     actggaaggg gtggtcgtac atggactcgg cggccaggct gtagtggccg tagcgctcga     17520
     cctcgtcccg gaaaggcctg atcatctggc tgtggcagag gtagcagccc tcgcgcacat     17580
     agatgttgcg tccggcgagt tccagtggcg agtagggccg catgccttcg actttctcga     17640
     tcgtgttgtc gagatagaaa agcggcgcaa tctcgacgat gccgccgacg gtcacgacaa     17700
     gaagagagcc aacgagaaga agcgtggcgt tcttctcgat gatcgcgtgt ttgtccatca     17760
     agcccattgt ctggctccct attcggcagg ccggagggcg ggctcggaac ctggcattgg     17820
     ttgctcttcg cgctggtggc caagaatggt catggtcacg ttccaggcca tgagcagggc     17880
     gccggtgagg tacatcgcac cgccgatggc acgcatgacg tagaagggat gcatggcggc     17940
     gacggtttcg gcgaaggagt agacgaggaa accctgctcg tcgtgttcgc gccacatcag     18000
     gccctgcatg atgccggaaa cccacatcac cgcggcgtag acgacgattc cgagcgtcgc     18060
     cagccagaag tgccaggtga cgagccgcag cgaatagaga cgttcacggt tccacagttt     18120
     cggcaccatg tagtagattg cgccgaacga gatcatgcca acccagccga gcgctccgga     18180
     atggacatgg ccgatggtcc agtccgtgta gtgcgacagc gaattgaccg tcttgatcga     18240
     cataatcgga ccttcgaagg tcgacatgcc gtagaaggcg actgccatca ccatcatgcg     18300
     gatgatcgga tcggtgcgca gcttgtccca ggcgccagac agcgtcatca ggccattgat     18360
     cataccgccc catgacggca tccacagcat gatcgagaac gccatgccga gcgtctgcgc     18420
     ccagtcgggt aaggcggtgt aatgcaggtg gtgcgggccg gcccagatgt agagaaaaat     18480
     gatcgcccag aagtggacga tcgacaggcg gtaggaatag accggccggt tcgcctgctt     18540
     gggcacgaaa taatacatca tgccgaggaa cccggcggtg aggaagaaac cgacggcgtt     18600
     gtggccatac caccattgcg tcaaggcgtc ctggacgccg gagaaggcgg agtagctctt     18660
     cgagcccagg aacgacgccg gcatcgacag attgttgacc acatgcagca tcgcgattgt     18720
     cacgatgaag gacaggtaga accagttggc gacgtagata tgcggttcct tgcgcttcag     18780
     gatcgtgccg aggaacagga tgagataggc gacccagacg atggtcagcc agagatccac     18840
     ataccattcg ggttcggcgt attcgcgggc ttcggtgatg ccgagcaggt agccggtcgc     18900
     cgccatgacg atgaacagct ggtaacccca gaacacaaac caggccagtt tgccgccaaa     18960
     cagccgggcg cggcacgtgc gctgcacgac atagagagac gtgcaaagca aagcgttgcc     19020
     gccgaaggcg aagacgacgc cggatgtgtg cagcggccgc agccggccga aattgaacca     19080
     gggttggatg ttgaggtgag ggtatgccag ctgcagggca atgatcacac cgacgagcat     19140
     gccgacgacg ccccagaata ccgttgcaat ggctccgtag cggatcgggc catccatgta     19200
     ggcggaggtg tcgatcggag ccgccggctt gaaatctgtg ttgcgcagca ggatcgcggt     19260
     aaagccagcc acggcgaaga acaaaacccc catatgctgg cgaaaaggtc cttctacgcc     19320
     gaagccggca gccaccaggg ccgcaaaagc aaacaggctt agaacgacga tctccgtgcc     19380
     gaatttcatg acatgtcccc gaccaggatt ccaatgcgcg gacgccaaat ccgcggtgca     19440
     ttaattccgt agttgccgcc tgctcgccct gatccatgtc agagccgcac gattttgctt     19500
     cgggcagcat cgagttcggt gcaatcagaa ggtggcgatt tgaacaagga aacgcagcac     19560
     gggccaaccc gctcatggac aagtgcggct ttctcgcgcc aggccggcac agaggcgatt     19620
     ccgggcgagg tcatgaagct tgctcatcgg gaaaagctgg agctctgctt ctcgctggaa     19680
     agcattgccg atgcactgcc gaacgtcgac cgcctcaaat gtcttggaac ggccaagaag     19740
     atcgttccgc tgctccgtga cattcatggg tttgaggaga gggtgatttt ccctgcgtat     19800
     gaggcgcact tgaccccggc cgaggccaaa cttgcctcta ccagccggtt gcgcatcgag     19860
     caccttgagg atcaatgctt cgctggcgag gtggccgaaa cgctcctagc gatcggtcat     19920
     ggtgatccga tagagagcgc ggaagctgtc ggattcatgc tacgcggctt cttcgaaggc     19980
     ttgcggcgac acatcgcttt cgaacgcgag catgtcctgc cgcggatcgt aataagcgac     20040
     gaaggccccg acgcttaggt ctcattcaaa ggccggttgc cgcgcgcctc ggccgccgca     20100
     gcgctgctcc agccggctca tgctgtcgac cgttacatgg cgtttgttct cgatccggat     20160
     cacgccgtca gcccgcaatc gcgtaagctg gcggctcacg gtctcgttcg tcagtccaag     20220
     gaaatcagag atgtcggcac gtgtcagcgg cagatcgaag catgccgacc cagccgccgg     20280
     gtcgatactg gaatccatat tccgggcgat catgaggaga aagctcgcca ccttctccgg     20340
     tgcggtcttg cgcccgagag tcaccatcca ttcaagtgcc tcgtcgagtt cgtccagcgt     20400
     ctgcttgagc aggcgatgct cgagtcccgg tgattccttc attatccgtt caacggccgc     20460
     cttcggaaac gagcacaggg agacggaggt tgccgcttcc acattgatcg tgcttttcac     20520
     cttgaagggc cgtcccagaa aatccggtgc gaaccgaaga ccgacaatct gctggcggcc     20580
     gtccgaaagg cacttcgtca gcttcacaac gcctgaaagc aagtttgaat agctgtcgac     20640
     ggcctcggcg tcggtgatca gttcgacccc cggctcgagc ttgtgccgcg acgaagtttt     20700
     ggctagccca accaaatggt ttggatcgag cgcaccgcag acgccgcgat gtcgtgctgc     20760
     gcaagacagg caaagaacgg gaatgccgga actgtgaatg tcttgccgta ctgtcattac     20820
     gctcgcgcta ccgatctcaa gtttcgacag gatagcaagc gatggcagag aaatccttgc     20880
     ggcagtttgt ccgtgctgga ggctgaccga aatcagggca ttggctcttc gacgcgtcca     20940
     gacttccggc gaggcaaaaa cggcggacca ccaaatgaga ccggaattag ctgccaggct     21000
     tggcgagaac gtcccgcgtt ataccagtta cccgaccgcg ccgcatttcc atcctggcgt     21060
     cgacgctgat gtctatcgaa gctggttgaa ggcgctcgaa agcggtgacg aggtctcgct     21120
     ctacctgcac atcccttatt gcgaccggct gtgctggttc tgtgcgtgcc atacaaagca     21180
     gacccgccgc tacgagccgg tggcttcgta tctccgctcg cttcacgcgg agatcgcgac     21240
     tgtcgccggt cttgtcggca gcaaggccca tgtccgcgcc gtgcatttcg gcggcggctc     21300
     gccgaccatg ctgaagcccg aggatatgat agccttggga actgtcctgc gggatagctt     21360
     cgattttctt gccgatgcga agatcagcgt cgaaatcgaa cccaacgaca tggacgaagc     21420
     ccgccttgat acacttgccg agatcggcat ggcgcgggcg agcgtcggcg ttcaggattt     21480
     cgatccgaag gtgcagaagg cgatcaatcg cgagcagagc tttttgcaga ccaaggcggt     21540
     tgtagacggc attcgctctc gcggcgtagg gtccgtgaac ctcgatttgc tttacggcct     21600
     gccgcatcag accagggaga gcgtctgttc caccgtggcg caggcgctga ctctggagcc     21660
     ggaccggatg gcgctgttcg gctacgcgca tgtgccctgg ttcaagaagc atcagactat     21720
     gatcgacgag gcatggttgc cgggtccggc cgaacggttc gctcagtggc aaattgccgc     21780
     ccgtctgatc atgggcgccg gatacgaggc gattggaata gaccatttcg ccaggccgga     21840
     tgatgcgctt gcagtctcgg ctcgcgcggg aacaatccgc cgcaatttcc agggctacac     21900
     cgaggatcgc tgcgaaacac tgatcgggct cgggtcgtca tcgatcagcc ggtttcgaca     21960
     gggctattcg cagaacatgc cgtcgacagc cgaatataga cgcatggtcg aggggggaca     22020
     tctggccacg gtccgcggca tcgcgttttc cgaagatgac cgtgttcgcg gctggatcat     22080
     cgagcgcttg atgtgcgatt tcggcttttc agcagccgat ctggtggaac gcttcgggga     22140
     agccggacaa aagcttcttt tccaagcaag ctccatcgcc attggcgacc ctgctcgacc     22200
     gcttgaactc caaggtgaca gttacgtcgt atcggcggaa agtcgtccct ttgtaaggag     22260
     cattgcagcg aagttcgaca aatatttcga aagtggaacg gccaggcact cagtggcagt     22320
     ctgagtgcca cagacgaacg tcaccgtctt cagtcgatcg cgaacctcct caaaatcgcc     22380
     gaaaccagca gctaacaatt cgatagtgca tatgacgcca ctttacgatg ctgtgacgac     22440
     gcgggtattt cccaaagggg gtcgcatggc agagggctgg gacccgccgg aaccctgcag     22500
     gcagggctcc acttcgtatc cgcccaagca ggttggattg ttcggcccag tctttcactg     22560
     aatgtcagcg acgcacccca ttgcggcttt cgctactcag cgctgcggct cttgaatgcc     22620
     cctttgagat gggctcattc tgagtaacaa ccgcacggcg ttcccacgtg tctgaaacca     22680
     tgcatgagtg cggctagcac gccctgcgcc ttgttcgcgg tttccgggcc gcccaggcac     22740
     ttacttgacc tccagctgct cgaagttcgc gcataggcct tacatgacgg atcggtaggc     22800
     cgcgaccgcc gggaaattag gcacccgggc ggctgcgcca attgaccaac tttatgcttc     22860
     gattactcgg aatctgaacc tgacacgcgt cgcgatttct ctgacatgcc ggcggcaggc     22920
     aagctttcct ttctggcctt ggcaaacgct ctgtcacctt ccagaaaccc tgccagcatg     22980
     aaaggtatga gttccgctac cgtttcagac tcgccatagg tctggcggta aagcgccgca     23040
     tagtccttga gtgcttggtt caagtccgcg ctaacggtga tggtcatctt cgaaggtgtc     23100
     cggtctggaa gctttccaag tttcagatct gccatgatta ctcctgttca agtcgggtat     23160
     gggcgcagca caagatcctt gtgtacaatc acgcggaggg gccaaccggg gcggacgata     23220
     atggtgggtt gaatattcag gttcttttcg gtgatgcgct ggccggcttg actgatgttt     23280
     tgctgagtgg attcccggat cgccttaact aggtcgcttt cgttttcccc aaagctcaac     23340
     tcggtaccaa cgcccagtag cgtcgctaga gcaactccct tgatcagctg ccaggtgtga     23400
     aaatcgacct tgtcttcaag cccggcatag ccggcagtat ccgtcgctgg cagattgtcg     23460
     atttcgatcg aggaaccgtc gggcaggatt attcgctgcc agaccagcaa tgcgcgcctc     23520
     tgcccaaaag ccacgacgct gtcataagtg ccgatgaggc gtgagccttg cggaatgagc     23580
     acaatgctgc cggtgactgt gtcgtgcaca ttctcggtga cctgcgcgac gacaaggcca     23640
     ggcaagtcgg aatttatgcc ggtgacgaga ctggccgcga tcacgctgcc ggccatcagt     23700
     tggtagggcg aggccggcgt ctgcagcgca tgcggattgt agatcccgct tgtgtttcgc     23760
     tgactgacaa aatcgagctt gcgctgttgg ttgttctggt caccctcggc tggggcaacg     23820
     gaagctgacg cgcgcgtcgc tccggattgc ggaagcgcct cagacggctg ctgcgcactc     23880
     ggcccgccgc cggcgacatc tgtctgtctg ggtcgattgt cgatccggaa caagacttgc     23940
     gactcgcgcg cctcaattgc ttgctgggca aggcgctgct cctcggcgga gatatcctgc     24000
     cctggcgcga tgccgagctg acgttggcgt tcaaggatgg ggcgaccgag gtcgccgggc     24060
     agtggcggtc cgagcacagg ggccttcggc atgatcccgg aatagtcctt gggaagcgct     24120
     tctagtccct cggcgggtgg cttgcgctcg gtgttatagc ggtcctctgc ctggtgcttg     24180
     atacgccatg ccggtccttg aagcgccatc atcgtgacgc ccagaatggc accggatccg     24240
     actgcagcga tggcgacgat cacaccgcgc ctgaatcgga cagcgcggcg gggcgaggct     24300
     cgcaattgca gctgctcggg atcgagtttc ggcggcgcat cggatcggga agtatcggtc     24360
     atgagcgctc ccctcacctg ctggtccgcg caaagagcgg aatccgccgc ggcggttgcc     24420
     ggccgtcagt cctggtgatg cgcaccactt gctgctgttt ggcgccgagg cgcagttcgg     24480
     cggcagcaaa gaggcgatcg acgatgtaat agttgccgcg catacggaag ttgacgagct     24540
     ggtcattgcc atcggcgccg acgatgaaga gaggaggcgc ttcaccctga tcaatgcgac     24600
     gggggaattc gatatagacc ttgctgccat cgtcgaaagc gcgcgtcggc ctccagggtg     24660
     gtgtgtcgcc ggtgattgaa taccgaaagc ggatattctc gagcgccaca ttcgaagcta     24720
     ccggcatggc accctcggct tgagcgttgc gctggcgtag cgcgatgatc tggtcctcgc     24780
     tataggtcca ggagatcgcc gccatcgagg ttttctcggt gctttgaagc tgcaaatggt     24840
     aggtgcgtcg ttccgtggtg atcaccagat tggtggtaag ccccggcgcg aagggtttta     24900
     ccagcacatg ggtgcgctga ttgtcaccgg tgccgctgac agtatcgccg atcacccaac     24960
     gcaccgtgtc gccggccgac acggctgtta gcttctcgcc cggctggagt gcgatatcgg     25020
     tgacgcgctc cggtgcggcg tagagctgat agagcgcgcc atcggcgaat ggataaacct     25080
     gaaccgcatt catgtaccca tacctggtag gttgctgcgt cgctgcttta ttggcatcgg     25140
     agacccgttc ttcaggagag cgcttgtctt cggccaccct gcccggattg ggctgtaact     25200
     gaccgggtag cggcagcggc tttggcacct cgactatctt gaccggcttc tccggcggct     25260
     tctcgattgc ggctggtttg aaatcggcag catcatagga aatctcaggc ggcggtaccg     25320
     gcttcgacgc gcaggcggag aggactgctg tagaggccga caggatcagc acggcacgga     25380
     ccgacgacat tctattcttc attggtggac tccttttggg gaaacggacg tcggcgcagc     25440
     actgtcgagc tcgcgcgacc agtcgatcgc attgatgaag acgccgagcg ggttgttgcg     25500
     cagttggtca gtattacttg gcgggcggat cacgatggtg aggatcgcgg tccagcgcgt     25560
     cgtgctggca aggctgccgc gctcaaaaac ctgctcggcc cacttgacct ggaacgagct     25620
     gtcggaagcc ctgaccacgc tggtcacttg caccgacacg ctgcgtgtgc cgatctggcc     25680
     gaaaggatcg ttcgccttgg cgtactcgtt gagaaagagc gccgcgcggt cggtggcgaa     25740
     gtcataggcc gaaagccagt tctgccgcac cagcaccgga tcggtggaaa cggaacggac     25800
     attctgaatg aagcggccga gatgccacgc gatctgggca tcggagggct cgtagtcccg     25860
     gattgccggc gcaacggcgc gtgcctcgcc gaagccgtcg acctcgacga cgtaaggcac     25920
     gacgcggctc tgcatcgact gccacacgag tccgccggaa agtccggccg ccaaggtcag     25980
     acagccaaga gccatgaacc gccagttgcg ggcctgcact cgagatgagc ctatgcgctc     26040
     gtcccagagc tgcgcggcct tctgatacgg cgtgaccggc tcgggcgtct tgccataacg     26100
     ttgaatgggt cgcttgaata gcatttagtc gtccttgtcg ttgagagagg gattggcgct     26160
     gcctcccggc ctgtcgcctt cacggacggc ctgcatggcg gtgtgacggt gggcacgggc     26220
     tgtctgttcg gaacgcaggc gcctggccca gccgggcgcg gcatcagcga ccggaccagt     26280
     agggcttccg gtcatggatg cggtcggcgc accaccggtc gcggtccagg cagcttcgcg     26340
     cccggcatca acgctgcgcc cgaagccccc tgcggcagat cgtgccgccc gcattgcggc     26400
     gccgccggcg gcgctggtca caccatgcat tccagcagct acaccggaca ggccggactc     26460
     gggcgatgtt gcgcgcccga tctgccaggc cgtagaagcc gctgacccca tggtcgtgcc     26520
     ggcacggagt gcggtgagac cgctgccggt tgccgtgcgc gcgccggcaa atgctgcgcc     26580
     tgcggcaacg agcgatgcac cggctgcggc tgccgtggtt ccaagtgcgg cgcccgcgcc     26640
     aagctgcggc gcgcccgaga caagaccgga ggctatccca ggtccgaaaa tgccgagacc     26700
     aaggagcgcc aaggcgccca ggacctgtga catggcggcg gccagatccg gctccttgcc     26760
     ttgcagcgcg gaagcgaact cgccaaagag cgtggagccg atgccgatga tgacggccaa     26820
     caccatcacc ttgatgcccg acgagatgac attgccgagc acgcgctcgg cgagaaacgc     26880
     tgaccggttc caaagcgcga agggcacaag aatgaatccg gccagagtgg tgagtttgaa     26940
     ttcgaggatg gtgatgaaga gttggatgga gaggatgaag aaggcgatga tgaccaggaa     27000
     ccaggccacg agcagcacga agatggtgag cgcgttgccg aagatttctg ggaagccgag     27060
     aagctggctt gcctgatcga gaagcggcca ggcgccctcg aaaccggttg cggcaatgcg     27120
     ccccggatgc aggagattgt cggcggagag attgcctgag gacgcattga tgccgaggcc     27180
     agcgaaggac cgatagatga tgtcggcgag gttcttgaag ttattcaaga tgaaggcaaa     27240
     gacgccgaca tagagcactt tgcggatgag ccggccgaat atgttgggtt cgccgccgaa     27300
     tgcccaggcg aggccggcaa gtgtgacgtc gatgccgatc agggtcgtgg taaggaaggc     27360
     gacatcgccc gagagcagac cgaacccgct atcgatgtag cggatgaagg tctccatgaa     27420
     gcgatcaatg accccaaggt cgttcatgcc gccttcctcg tcgtcaagag attggtgatc     27480
     agttgctggg ataggccgtg cctgtgccga ggaagcgctt tgtcgtctcg cgcgcggcct     27540
     cctcggactg cgccttgcgc gccgcatcct cggcctcagc gcggaactgc gttgcgagca     27600
     gcgtctggat ctgcatctgc tgcttggtcg aaagcgcaag gagctggtta gtggcctgac     27660
     ttgcctgaag cgcaccggcc gcgccttggc tgcggttgac gagatcggca agcaggtcgc     27720
     catcaccgcg aacattctcg acgatctgcg actgaacacc catggtctga cggaatgcct     27780
     gcattgcgct ttgccagcgg tcacgtgcgg cgctcgctac atcgctgacc ttgatcgtgg     27840
     cgtcgtagct ttccggatat tgattacgcc actggtcctg aagcttgttg agatcaaagc     27900
     tcaggccact tgcctggtcc atcagactgt cgatccgttg gagcgagccg gtaagctgac     27960
     ccaccgaaga aaaatccaga ctctgaagat tgcgtgccat gttctgcagc acggtcgcct     28020
     ggttctggag cgactggatc tggttgttga tctgctccag cgagcgcgcc gccgtgagca     28080
     cgttctgtgc gtagttcgac ggatcgaaca cgatgagcgc gtaggccggc tgcacgtagt     28140
     cggccatcgg cttggcgatc aacgaaaggg tgatcaggcc cgagagaaag cggcgccgca     28200
     tcatgacgat tgctccttgg ttggttgagg gaattgctgg agaagctcgg ccccccaatc     28260
     gaggccgcgg gcgccgagga agcgaaagac aaagctgtcc tgcccgtgct cggacaggac     28320
     cctgtcgatc aggctttgcg cggctggacc cgaggcgccg caaagtgcaa gcgcgatggg     28380
     gccgagcccg agctcgaaga gacggttgcc gcagcgcgac tgcaaatagt agtgccgctt     28440
     cggcgtggcc cgggcgatca gttcaatctg ccggttgttg agaccgaagc gctcataggc     28500
     agtccgtgcc tgcggttcca cggcacgatc attggggaga aaaatgcgct gtgggcagct     28560
     ctcgatgatc gccggcgcta ttgcagagcc ggcgatgtcg gcaagcgact gcgtggcgaa     28620
     gatcaccgat acgttcttct ttcgcagcac cttcagccat tcgcggatgc gggcagcaaa     28680
     aagcggattg tcgagataga cccaggcctc atcgagcatg agcagcgtcg gtcgcccgtc     28740
     gaaccgctcc tcaaggcgat ggaagagata ggtgagcaca ggcagcacag cgctttggct     28800
     atgcatcagc tcctcggtct cgaagcactg cacatccgac aaggccagcc gatcgtcatc     28860
     ggcatcgagc aatcggccga agggaccgtc gagcgtgtag ggcattaagg cggacttcag     28920
     tgcattggac tgaagcagga ccgacagacc ggtcagcgtg cgctcctgcg ccggcgcggt     28980
     ggcgaggctg ttgagcgccg accagatcgc ctccttcacc tccggcgtga gggtgacgtt     29040
     ctcatgggca atcaggccgg cgatccattc agctgcccag ctgcgcctac cctgatcacc     29100
     gatattgcgc agtggctgga aggcaagcgc accgtccgaa cccaagacat gatgctctcc     29160
     acccatggcg agcgttgccg cgcgcgccga attgcctttg tcgaagacat agacctgcgc     29220
     gccggcatag cgacgaaact gcagggcgat cagggcaagc agcaccgatt ttccggcgcc     29280
     ggtcggtcca acgatcagca tgtggccgac atcttcgaca tgagaagaaa gccggaacgg     29340
     agtcgacccg ctggtttcgg cgatgaggag cggcggggcc tctcgtccag tgacttcagc     29400
     cagatgctcg ttcgccgcag gaccggccca caccgaggaa agcggcatga gatgggcaag     29460
     gttcagcgtg tgaacgagcg gctgacgaac gttggcatag acatgacccg gcagcgagcc     29520
     gagccaggct tcgaccgcat tgacgctttc gcggatggtg gtgaacccga gcccattgat     29580
     gatgcgctcg accgcgcgaa gtttctcagc ggcggcttgg cgatcctcgt cccataccgt     29640
     caccgttgca gtgagatacc cgaagccgac atgatcgccg cccaacgcct gaagtgcttc     29700
     atcggcgtcg agcgccttat tgtcggcgtc gctgtcgacg agcggaacgg gttcgttgct     29760
     tacaacctcg cgcaggattg cgacgatcga tttgcgcttg gcaaaccact gccggcgcaa     29820
     gcgggtcagc gtcttggtgg cctcggtctt gtcgagcgga atgaagcgcg tcatccagcg     29880
     ataggcgaaa tcctgatgat tgagggcatc gaggattccg ggccgggtga ggttcggaaa     29940
     gccgaggatg gtaagtgtgc gaagatgttg ctcacccagc atcggctcca agccgccggt     30000
     aagcggcaca tcgaccagga tgccgtccag atacattggc gtttccggca cggcgaccgg     30060
     atggcggcgg gtcgagatcg tgtcgtgcag gtatgtcagc gtctcggcgt catcgagcgg     30120
     acgcacttcg ggcatgaagc ccgacagaag atccagcaca cggtcggtct cgtcacggaa     30180
     ccgcgccatc tcctggcgcc agtctctttc gccttctgaa tgatgcgagt cgacgagcgc     30240
     gctttccgcc cgcgcctggg cgtccggtgg cggcatggac agcaaggtca ggtgatagcg     30300
     gctctcgaaa tgcgcgacct tgccttcgaa ggcagcacgc cgttcttcat caaccagcca     30360
     tgacgccgcg tccgggaaac gcgaggacgg atagcccagc gcttcgatgc gctcggcctc     30420
     gaaaaacaat gtccagccgg agccaaggcg tctaagcgca ttgttggccc gggcgcagat     30480
     gccgaggagt tcggcttcgg tcgagctttc cagatcgggc ccgcgaaacc gaagagtccg     30540
     ctgaacgctg ccgtccttgt tgagcacgat gccgggcgcc accagtgctg cccagggcag     30600
     atggtcggca agccggtcgg ccctgccgcg atattccgaa aggttcagca tgcgagccat     30660
     cccctcaggc gaaggtgacg gacaagcacg ctggcaaagt cgggatcgcg ccttgcggca     30720
     aagaccgcga gcgtgtggcc gccaagccag agcactagcc cggcaatcca ttgctgcaag     30780
     cctagtccga tggccgcagc caccgtgccg ttgaggatcg ccaccgcccg cggcgcgccg     30840
     cccagcagga tcggttcagt caatgcccgg tgaacgggaa cctcgaagcc ctcgatatgt     30900
     tgcactccgg cggtcatcag acgagcgccc cgccgccgaa ggagaagaac gagaggaaga     30960
     agctcgatgc ggcgaaggcg atcgacaggc cgaagacgat ctgaatcagc cggcggaaac     31020
     cgcctgcagt atcgccgaag gcaagggtca ggccggtggt gatgatgatg atcaccgcga     31080
     cgattttggc gaccggtccc tgcaccgatt ccaggatctg ctgcagcggc tgttcccaag     31140
     gcatgccgga gccggcagcg tgcgccggaa ctgtgagaag aaacgcgagc gcggcaaacg     31200
     aaagaaagcg gagcttcttg cgcataaggg ggcctttcag agttgctgga gttgcggagg     31260
     cgtgagtggg gagacggcgt agtcgccgct gccgtcgaga cctgtgacct cagcgattgc     31320
     atcgatgcgg cgcgacgagc cgcgccccgc gatgaagacg atgagatcga tggcatcggc     31380
     gatgaggcgg cgcggcacgg tgacgacagc ttcctgtgca agctgctcga tgcgatagag     31440
     ggcagagcgc gccgaattgg catgaaccgt ggcgatgccg ccggggtgcc cggtgttcca     31500
     tgccttgagc atgtccagcg cttccgcgcc cctgacttca ccgacgatga tgcggtcggg     31560
     gcggagccgg agcgtcgagc gcacgagatc ggcgagtgtg accgagcccc gcctggttct     31620
     cagggcaacg cagtcctttg ctgcgcattg cagttcgcgg gtgtcctcga tgaggatcac     31680
     tcgctcgtcg cattcggcga cttcggccag cagcgcattg gcaagcgtcg tcttacccga     31740
     cgacgtgcct ccggcgacaa ggatgttgcg ccgttctcgg actgccttta tcaacgcatc     31800
     ggcctgcagc ggcaacatga tgcgatcggc aacatagttg gccagcgtgt agagctttgc     31860
     ggctggtttg cggatggcaa agcaaggcgc cagcacgaca ggcggcagca gtccctcgaa     31920
     gcgttcgccc gacggcaatt cggcgctgac aatcggattg tccgcatgcg cctcggcacg     31980
     cacgtgggaa gcgaccaggc ggatgatgcg ttccgcctcg gaaggatgca tatgcacggc     32040
     cgtatcgatt cggccttctc ccagccggtc gagccgcagc gcgccatcgg gattgaccat     32100
     cacctcgatg accaatggat cggccagcgc ctcagtgatc gtcggaccca tggcggtgcg     32160
     cagcatggcg cggcgtcggt ggtcggcctc tggatgagcg ctcatccttc ccctcctccg     32220
     ccattgtctt tgccaagcga gcgtttcccc gatgcgatct ggcgaccgac ctgctcgacg     32280
     aatttgtcga aacgctcctg agcaatcgcc tgtgtcgcct tgtccggaac aggcgtgtgg     32340
     gcatgaagcg tgatcgaaaa gcggatgaag agcgccaagc tttccaatgt catgtcgaca     32400
     tcgcgcctga cgtgactgag gtcgcgggaa agacggtcca gcctcatgcc atagcgccga     32460
     tcgagttcat tctcgccacg ccgctcgatg aaagcttcta cggccttcgc gacgaccgcg     32520
     gattttgtgg tcgagggatc gcggctgagg ttgtccagct tctcgctcaa ttccggttcg     32580
     agcagaaact ggtgacgaat gcggtggggc ttcatgcgct tgttccaact ggccggcgct     32640
     ggcgggccgg cggcggaaca agcattatcg agatgcccaa aattgcttac ggccgttatc     32700
     tacgctgaga tacgcccgag ctgcggaaag cgttcagaag ccggggacga tatccttatc     32760
     atcgcccctt ccctcgttga tgccataggc acctgcgacg gtggagatcc ggtccatgac     32820
     gcgcttgtcc gccatcgcct cgctatcatc gtctgcgggt ctggacagat cgtcctggtc     32880
     cggttcctgg gtgacggcgg tatgttcttc gggtaggcca ggatggcgct gctgctgaac     32940
     acctccctcg tccgcaagcg cggcgccagc gctttcatcg tcggacgcaa gacgacggtc     33000
     gacgccgcgt acttgcccag tccaatcgtc cggccgcgac atcgggcagt ccgcgtaggg     33060
     tccgtcgcgc aacaccggcg aaggcagcac ccgctcggtg aaattgtgat cctcatagta     33120
     tcgcagcttt ttggcccgga tggggggcaa tcccgaaacc agcaccagtt cgtccgcggg     33180
     cggcaattgc atcacctcgc ccggtgtcag cagcgggcgg gcggtttcct ggcggctcac     33240
     catgacatgc gagagccaag gtgccagccg gtggcccgca tagttgcgca tggatctgag     33300
     ttccgtggcc gtgccaagcg cgtccgagat tcgcttggcc gtgcgctcat cattggagga     33360
     aaaggcaatt cgcaaatggc agttgtccag aatggcgttg ttgtcgccat acgctttgga     33420
     gatctggttc aacgattgcg cgatcaagta ggcacgaatt ccgtaaccgg ccataaacgc     33480
     gagcgcggtc tcaaagaagt cgaggcgacc gagcgccgga aactcatcca gcatcatgag     33540
     cagttgatgc ttgcggctct tctttgggtc accctcgagg cgctccgtca gccgcctgcc     33600
     gatctggttc aggatcagtc gcaccaaggg cttggtgcgc gagatgtccg atggcggcac     33660
     gaccagatag agcgacatcg gccactccgc atccatcaga tcggcaatgc gccagtcgca     33720
     gtccgatgtt accgccgcca cggtcggatc acggtagagg ccgagaaaag acatggcggt     33780
     cgagaggacg cctgaacgtt cgttctccga tttgttcaac acctctcgtg ccgccgaggc     33840
     cacgacggga tggacctgag gcttattggc cgcgccgaga tggttggtcg tcatcattcg     33900
     ccgcaaagtc gcggcaaacg agcgttgcgg gtccgacaga aaggtggcga cgcgggcaag     33960
     agtcttttcc tcttcggcgt agagcacgtg caagatagcg ccgaccagga gtgaatgact     34020
     ggtcttctcc caatgattcc gccgctccag cgcgccttcc ggatcgacta gaatgtcggc     34080
     gatgttttgg acatcgcgaa tctcgtccga acctttgcgt acctccagca gcgggttgta     34140
     gcgggccgat cgcggatcag tcggattgaa caaaaggcaa tgcgagaacc tcgaccgcca     34200
     gccggagctc agctgccagt tctcgccttt gatgtcgtga atgacggccg agccggacca     34260
     ggagagaagg gttgggacaa ccagtccgac gcccttgccg gaacgtgtcg gcgcaaaggc     34320
     catgacgtgc tcaggcccgt catgacgcag ataccggtcc ttcagtttgc cgaggaagac     34380
     gcctgccggc tgaaacagcc ctgctttctc gatctcccgc gtcgccgccc atcgagagga     34440
     gccataggtg gtgaccaagc cgcgctggcg cgcgcgccag agggaaccag cgatcgcagc     34500
     ggcacagccc atgaatccac tggtgcccgc aagcatgccc gccttgtcga atacctcggg     34560
     cgcataggca tcgaattgga accaccattc caacagtttc cacggctcgt agatcggcca     34620
     gccagccgcg acaaaccatg gcgcgccgag ttgttcctga aaggctagca tatgagcgca     34680
     ccattgcgtg gcagcccaca cgccgaggag aacgatggcg aacacaatgg cgatctgccc     34740
     aatcagaagc ttcgtgggcg tcactggctt gctccgctgt tctggagaga tggatcgagc     34800
     atcgcccggg acggccggaa caggaatgcg ccctatgtac gacttggtgc gatgagaggc     34860
     tgtttggcgc gccgttgctc tccttcgagg tgtatcaata ttcgcgcatt cccgaggact     34920
     gctatgtcgg aggggactca tatcgttcgt gcctatcgtg agcacgtggt cggggagctg     34980
     gcggtggcat gcgggcaagc cgctgaggaa attcgtaaca tcgagtccgg tctgaggtac     35040
     aacaagccta tcgagatcgg atcgcgaggt agccctgccc gccatgggaa ttcctcaggc     35100
     gagtaccgac atattgggcg ctgccttata agtggaaggc gccttcccgt tgcctctatc     35160
     gcagataagt taccttccgg ccttcgcgct gggtttccca gctggactgc gtttcagtct     35220
     caattcgctg tgcttctcgt gagccagaca ccatttctcg gactgtgaat tgacgacatt     35280
     cattgttcga caagccctcg ccggcgatct gttgggcaga ggcggctatc accccggccg     35340
     tggcacatcc gcgcgctgca gaacctcgat gagccgcctg ctcaaacgcc caggcgggtg     35400
     caaagatcca cagacgcgtt ccgccctagt tgcgaagcat atgaccggca tttcgcaacg     35460
     cgcctaggaa gaggccggca tggtgagtga catcgatttt ggcctgcatt gataccggca     35520
     tgttggtcca attctccaac ggtgcaatga agcgggagaa ggtaccgtcg acgacgcagt     35580
     agcggctaat aaggccttgt ctgtccaacg tcaccacacc aatctgccca cctcgatatc     35640
     ggatggctgc gagccgttgg acctcggcgt catcatcgat ccgcacatcg aaaagcaggt     35700
     ttccgcggct cctcgcggct atctccgccg ctttgtcatt gaagctcaag cagagtgagc     35760
     ggacgctttc cactgccatc tggaaaacca acaaatccag ttcattcacg gccatgtggg     35820
     cagttgagcc aataaatgga tgattgcaat gtcgcacacg gcttgttcac aggtgtcggc     35880
     gactgatcgt tcgtggcttt ctgtccgctg ccggcgatgg aatatttgaa ggacggcggg     35940
     tcccgtattt cctgtcgcgt tggcaaccgc ggcggccacc tgccgggcgg cagcggcaga     36000
     gataatgtca tagacaggtg gaagcgtggg ctttctgccc ttcaatagtt ccctgaccct     36060
     acagatttgc acgcgcggcc gcagcttgcc gcccgcctca acggattcgg cttctctggc     36120
     agcacgttcc attgctgcgg tcgccttgtt gagcgtcacc agaacgccaa gcttcgtggc     36180
     tggcaagatc gccaactcgc tcaagctcac gacctctatt cgatggacgg gcacggccgt     36240
     gcatcgccgc ggcaggggac aacatcgtcg tgaccgaccc tcaagcccta tatcgtgtcg     36300
     gcgggatcgt tcaccaggaa cggcgagatc gccgtggagg gcaagccctt ccacatcgtg     36360
     gccgtcggcg ggagcggcaa gatccacgat caagcagctg agaaagatca cgcatatagc     36420
     cacgatcccg cggtccagcc gatctacatt tgaggacgac cagatcaagc agcgcgccct     36480
     gtcgaatttg ggtccgggat tggcagttgg tctatccctt cctgaccatg gaacgctcga     36540
     tccagtcatg gcttataagg cggagagcgg cgaccagagc gcagatgagt acgcgctacg     36600
     agatcggcta tcgcaccaat tcgagcggat cacgatcgat ggcgacaccg tggctttctt     36660
     cgagggcggg aagccgcttg aggcctgcta cgccggcgac ggctgtgaaa tcctgacctc     36720
     gaagaaagga aaccgcatgg gcgtcaaatt tcgcttcggc gtcgccttgg cctcctcaca     36780
     cttgtttggc tgactcagcg ggcaacccgg tcgagaaaag cgtcgaatgc ggcagcgaca     36840
     acgcgcatcg caaaacgatg ctgccgccgt acgcggacaa aacccttttc gatgtccaca     36900
     atcccgtcct tggcaagcat cgccaagcgt tcagctgaat cgagaaaatg gattggatca     36960
     gatccgtggg cggcacagat tgccggcaca tcggcctcga gatcgcacat tagtcgctcg     37020
     atgattgcgg ctcgcgcgcg gtcttcgtcg gtgagacggt agccctttga cgtcgccaga     37080
     cggccagctg cgatgtgccg gcagtaggaa tcccgtgtaa cctcgttctg gacgtagccc     37140
     tcgccgacac gcccgatagc cgacgcgccg aaaccgatca gggttttgca ggtgtcggcc     37200
     gagtagccca gcgagttgcg ccgcaggcga ccggttttct gtgccagcgc gagatcgtcg     37260
     tccggcaagg cgaaatggtc gagcccgatc tctcggtagc cggcggcaat cagcgtcacg     37320
     gcaatggccg catcctgttc ggcgcgggca gcgctgcccg gaagcgatgc ctcctcgatg     37380
     aggcgctgat tcttaataaa ggacggaatg tgcgagtagc cgaacaccgc aagccggttg     37440
     gggcgcatgg cgaccgccgc cctcgtggtc tcgacgcaag actgcaccgt ttgatgcggg     37500
     agaccaaaga tgaggtcgaa gttgatgctt gtcactccat gccgacgcag catttcgacg     37560
     gcagccgccg tctgcgcctc actctggacc cggttgatcg ctttttgaac aatgggatcg     37620
     aagctctgca cgccgaggct cgcgcggttc acgccggctg cttgcaaggc ttcggccata     37680
     tcggccgtga acgtgcgtgg atcgatctcg acggcgatcg tagctgtttc cgcaagcgca     37740
     aagtggcggc gcaggaattc cgtcagggcg aggaactcaa ctggccccat gagagttggc     37800
     gttccgccgc cgaaatgcac atcgctcacg ggcagcgcct gcggcgcgtg ctccgagacc     37860
     aaacgtatct cgtcacgcag cgccgccaga taattaacga tcggcgcatc atggcgggtg     37920
     atggtggtgg ggaagccgca ataccagcac tttgatcggc agaacggaac gtgcaagtag     37980
     agtgacgccg gatcgttagc cggtaggttc ctgagccatt cctcataagc gtcggcgccg     38040
     accgccccag agaactccgc gacagtcgga tagatggtgt accaaggcag gcgggcttcg     38100
     cgatgttttg tggtctgcaa cagttaccgt cccatgttgt tgccttccat ccttaccact     38160
     gcgctctcct gtgtctttgc gctatatcag tccggtccgc tttgggcctg attatttcgc     38220
     agcgatagcc ccattcagcc ttggctggac agcgatggta tgagcacgcg ctggtcagcg     38280
     acaagcgcca tgggtttccc gtcgagactt tcccgcacac cgtttggtgc tactatccta     38340
     tcctatcccc tcccttcagc gtccgatgga acgcagcatg ccccgtccga ccagtcgatt     38400
     cggcgttggg accagacttt tgctcgccgg ctggtgcgta agacggcgtc acgtagcgat     38460
     acctggcatc tcgatgagtt cgtcgtatta attgccggca cgaggctttg gccgtggcgc     38520
     accgtctgtc agagcgggaa ttgtgctcga ggagaccgtc cagctccgcc cctgccaagg     38580
     ctgcaagcct gatgaaccaa tttagaaagt agcgctacgc caggcgcatg atcaccgaca     38640
     aatcgcgctc ctgtggcccg gcaaagcgcc ggggtgaagc gcaactcaag catcgctcgc     38700
     aactgacaat cgagcgaatt cgcatgtgct tccgtaaaaa caaaaatggc ccatgcacgg     38760
     cttccgattc agagagggcc ttacaacggc tcgtctcgac cttcccgcct ttcggaacca     38820
     ctttgtccgg actagctgga aagctggtgc acctcgccac cgccgaggtg tggcccttcg     38880
     ccctaacgag gacgcttacg cctaggcatg tcggcatcag tggggcatct cggctgacgt     38940
     accgagcggt gcactcgcat gatgtcaaca atgtcgaggc tcaaaacaaa caaaagctat     39000
     cgccattgaa cgatactgtc acgaagcgaa cagacgaacc atgtccgaaa catttgcttt     39060
     tcgtgctcag cttgaccctc agagcaaaaa aggaaacgca aaccaaggtc cgacggcaaa     39120
     cttgagtgtc aatcgtagct tggtcgtgag gttggcacgt catttgcggg gtgattttcg     39180
     aagccgttgt gacggtacgc ccgcagctat cggagatcat catggcgatc gactcggaag     39240
     tgtttgattc ctccccgggc atttcaagca agtaatatta gaacaaccaa cttattgtgt     39300
     tgaagtatga ttcagcttca tcgcccctgt tgttggataa ttattatgat ccgtgtgtca     39360
     cactgcgata ggcgcagcgc gatgtgcatc gttttcgatt gtggggacag gaagggctgg     39420
     ctcgttcgtt gacgtcccct tcttcaatat ttgaacggag atcaagaatg aacatcagga     39480
     gcctcctgct cggctcagct gcggccctga tcgccgtttc ctgtgcccga gccgccgacg     39540
     ccatcgtcct ggccgagcct gagcccgttg aatacgtcaa gatctgcgac gtttacggcg     39600
     ctggttacta ctacatcccc ggcaccgaga cctgcctgcg catcggcggc tatgtccgtt     39660
     acgacatcgg cctcggcgat gtcgtatcgt atgacaaagc tagaaccacg gatgtgaaga     39720
     ctggcgaggc ccagggcata tggcaaaacc acacgcgctt cacattcaaa acttggaccg     39780
     ggcaagagtc cgaactcggt acattgcaga cctacatcga gacccgcatg aactacggca     39840
     agcacaccgc ctattccggt tcggacagtc ctcgatacta tgccttcagc caaggcatca     39900
     cgttgacttt cgcctgggtt cagcttggtg gcctccgagt tggcaaggac tggtccgcct     39960
     tcgacatgtt tattggctac gcgggcgacg tgctcaatca gatgcttatc ccgtacggcg     40020
     ccttcgatac taatgtggtt cagtactact ttgacgccgg taacggcttt acggctgtgg     40080
     tttcactcga agaaggctcg ggcctggtcg gcaccatcga cagctacgtt ccgcacctag     40140
     tcggcggagt gaaatacaca caacactggg gcgcgatcac cggcgttgtc gcttatgata     40200
     gcaactacga atcggtcgcc ggcaaggtcc gcatcgacgt cgatgttacc gaccaactct     40260
     cgctattcgg aatgttcggc tatggctcca gcggcaagct caacgatgac gtcactaacg     40320
     caatcgacgc tcatggtcgc ggtttctaca aaagttgggg cggtaactgg ggtttctggg     40380
     ccggcgccac ttacaagctc aatgagacaa cttcgttgaa tcttcagctc tcgggtgatc     40440
     agctcaggaa ctatggtgtc gctgcaaacg ttgcctatgc gtttcttgca gatttcacaa     40500
     ttacagccga actcgactat gaccgctacg gcgacttcgc cgtcggcaag gtcgaccctt     40560
     ccattagctg ggctaatgcc aacaaaaaga gcagtgtcgg cggcatcctc cgtttcgaac     40620
     gttcattcta acgggaggaa gagcttcatc tcggtggcct caggcggcga atgacgatta     40680
     tgcgggggac ctgccacgcc tgcggcagat aagccctgac acgtttgcaa tcggatacag     40740
     ctgcgattag ggcgcggccg atgccccgct tgccgggatg tgacagctgg taaagcgttg     40800
     cggcaggttt gctggcggtc ccggcgcttg cgctgacgcg tgcggcgcag tccggcgaca     40860
     cggtggaggc cgccggcaga tgggtgggcg cgtgatcgcc gaagcaatcg ccgaactcgc     40920
     ccagtatccc agcttcgata acgactgaat cggcgttgac tcaatgcaac cttggcttcc     40980
     ggagaccgcg ctgaccgccg ccggcctgac cgcgctcgcc gcgcaggatg ccttcggaca     41040
     agcaaatcac ctgcgtcaag gcgcccttta agtcgctgat cgaccatgtc tttatctcgc     41100
     ccaatctcgt gccgggcggc cacgatttca tgatcctcgc gctcgaccga accatcgagc     41160
     ggttcctgga agtgtccgat catcgcccgg tcctcttccg actggccggg cctatcggtg     41220
     agcgttagat ccagaacgag gttacacggg attcctacag cccgcacatc gcagctggcc     41280
     gcctggcaaa gtcaaagggc aaccgtctca ccgacgaaga ccgcggcgag ccgcaatcat     41340
     cgagcgagga cgaaataggg acagcgaagg gttttatccg catgcggcag gaggatcgct     41400
     ttgtggttag cgctattgct gcgtattcga tgcttttctc gaccgggttt gccagtaggc     41460
     acagccaagc agcgtgaggg gaggccaaag ggataaccaa tcgtcgctaa acggcatgct     41520
     ccagcaaata acggcaaggc ggtagcggcg cgcttgagcc ccggttgaag tgcttggagt     41580
     tttttccgaa tgggcgagcg ttgcgactaa tgaaggcgtc acatcattcg acggtgactg     41640
     attttgccag gttgcgtggc tggtcgagat ctgtgcccat gaagagcgcc gtgtggtacg     41700
     caagaagctg tatcggcagc gagaagatca tcggcgcgat aatctcgtcg gtggccggca     41760
     gcacgatcgt gtgcatcgta tcgagtttcg atgcggctgc cccttttcca tcggtgatga     41820
     ggataatgcg ccctccgcgg gcggccactt cctgcatgtt ggagagggtc ttgtcgaaaa     41880
     agcgatcatg tggcgcgatg acgatcactg gcatgttctc gtctatcaat gcgataggac     41940
     cgtgcttcaa ttcacccgcc gcatagcctt cggcgtggat gtaggaaatc tccttgagct     42000
     tcagcgcacc ctccatcgcc agtgggaaat ttgtgccacg gccgagataa aggacatgat     42060
     gacactttga cagttcgcgc gacagaagct caatctccgg ctggatgctg tccagtacct     42120
     gcctcatgac gcccggcatt tcggcgaggc tctcgacgag cgcctgcacc tcatcttcgg     42180
     tcacggttcc gcgggccttg gctgcgtgga tggcgagtgc ggcaagagcg gctagctggc     42240
     aggtgaaggc cttggtggag gcgacgccga tctctgggcc ggcaaggatc gggaagacca     42300
     catcggcctc ccgagcgatg gtcgattcgc gcgcattgac gacagcgcca attttcagcc     42360
     caagctgctt gcagtacctc agcgatgcca gcgtatcggc ggtttcgccc gactgtgaaa     42420
     tgaacagagc cgcagactgc ggcgacaacg gaatctcgcg atagcggaat tcggatgcaa     42480
     catctatttc gaccggcagg cgcgcatagc gctcgaacca gtattttccg atcagcccgg     42540
     cgagatatgc ggtgccgcag gcagagatcg ccaagctcgg gatcttggcg aagtcgatgc     42600
     caaaaaccgc atcggcacca ttttcgatga aattgatata atgaccgagc gcatcggcga     42660
     tgacctcggg ctgctcgagg atttccttct ccatgaagtg gcgatggttg cccttgttgg     42720
     ccagagtggc cacggccacg gaggtctggc gcggacgcgc gacggggtgg ccgtcgtaat     42780
     caaagatatc agcgcccgtc ctgccgacaa ctgcccagtc accgtcgatg agataggtga     42840
     tttcattcgt gaatggagca agcgcgatcg cgtcggagcc caggaacatc tcgccgtcgc     42900
     cgtgaccgat cgccagcggt ggtccattgc gcgccgcaat gatggtcgac ggatcatcct     42960
     caaagaggat ggcaagcgcg taggcacccc tgacgctttt cagcatggca tgcaccgcct     43020
     caccacgcct catgccctcc cggcggtgcc ttgccaagag atgcgcaagg acctcagtgt     43080
     cggtgtcggt ctggaactcg gctcccgtcg ccgccaattc gtccttcagt tcggcgaaat     43140
     tctcgatgat gccgttatgg acgacggcca caccatccgt gaagtgcggg tgtgcattgc     43200
     gttccgtcgg tggcccatgg gttgcccagc gggtgtgggc gatgccgatg gtaccaccca     43260
     gcggctcttc cttgagtctc ctctcgagat tgacgagctt gccctccgcg cgccggcggt     43320
     gcaaggtgcc ctcggtgatc gtcgcaatgc cggccgaatc atagccgcgg tattccagac     43380
     gcttcaatgc gtcgaccagg cgttccgaca ccggctgttg cccaacgatg ccaacaattc     43440
     cgcacatgtt cttctccgaa ttcttcccgg cagccttagc cgacgcagac gagggacgcc     43500
     gcccggcatg cgctcagtta gagtcttcta atggaatcca gtaagttcgg taaaattgat     43560
     tgttgggata accatcatcc acgccatgga tgaactaaac ctcagtccaa tgcgggtgat     43620
     gtgaaccggg gcgtacgctt ccgccttcaa cgggctgcgc atgtcatggc cggcgccctc     43680
     acctgcgtta atagcatgca agccggccgg aggagacgtg gaatacttgg gccgagtgcg     43740
     aatgggtagc cccagcgcac tctttgatct cgccgttcaa ttgtgcggac gctgcttcat     43800
     gcatcattcc tcggcttgct tctccaggcc ggacgcaatg gctcctttcg gcgacgagaa     43860
     gcaaaccctc ttccgatccc tggggccacg caccacgtct tggctatccg catgggccgt     43920
     gcggcagccc gagaatcggt tgccacagta ccggcccatt cagacgtccc ctccagcgga     43980
     tgcgcaacag gctggcgtga gagatctcga gaaacccggc caccgcctcc gttttgccga     44040
     cgggctgcgg ctttccgatg cgcgacaatg gccacgttgc gaggcgaagg atccgttcca     44100
     tacgcgtatc ggtcaccgtc acgatccggg tgagattgtt ggccaagccg aattcgatca     44160
     tgccggcgaa gagctcgtag gttgcttggg caaggccgcc tgccgccttg ggcgttgatg     44220
     ggggcaaatc gagcgcgaaa cggctgcttt cccatatgtc gggactcgcg ggcgccacag     44280
     cctcacccag cagcgccggg aatgtgtcgc gcaacatggt cggcccagtg gttggcaaga     44340
     ggcgcacgca gccacgaatt cgccaatcgg atcccttgag cagcagatag acaggcttca     44400
     agtcgtcaaa ggtgtctgtt tccatttcgc ctcccgtctg aacttcccaa tcgagcctct     44460
     ccttgaaaac ccgatatctg agcccgtgca tctctttgag ctcgcctgcg aattcgctgt     44520
     agaggccagg tgtgatcagc tgaatcattc gtcgcctccg tgcgggttgt gttcccgcca     44580
     tcgaagggca aagcgcacag cgatgcagcc tgtagacgtt tacagctatc ctcgcggaag     44640
     gatccggatc tcgcctgacc ggaggcagcc agcctggcaa ccgcatggat cgtcctaacg     44700
     cgagctttgc ttggcatttt ccagatggaa ggtccccttg gcctttgaga cctgctttcc     44760
     aaggcgtatt cgcgagtttg atccatgcct ttatggtctt ggagagcgtg gcgggcaggc     44820
     tacacagtgg gtggccgaga ggtcgggaat cagttggaat ggaggaattc gtctcgccaa     44880
     agaggggatc ttttgcaatg cactgcctgc ccgacactcc cgcttcaacg tcacgcgcca     44940
     cataccgccg agtaacagcc ggaccggcga cgccggctgt gctggttgtt agcctgatca     45000
     gcggcagcac ggtgaatctg agccacgtcg ccagccattt ccacggaccg gcgagcgtag     45060
     cctccaacga tcgccggcgg cgacgcttct tccagtttac cagttcgacg aggactggct     45120
     ggcgtgtacg ctggtggcgc ggctcaacct acgcccgccc ttgcggctgt gccttgactg     45180
     caccaattgg aagcaagcac ataaggttcg catcaaggag cgaggcaata tgcatcgtcg     45240
     taacctgatt agaggattca tcgcgctggg cgtgtgcccg atctgcgccc agaccgcgcg     45300
     tgcggccagc gcccattggg gatatggcgg ctcggtcggg ccggagcatt gggccgatct     45360
     ggacacgaga aatttcgcct gttcggcggg caggcagcag tcacccatcg acatcgccgg     45420
     cacggtaaag gcggatatac cgcgcatcga catcagttgg ctcaagggcg gcggcaggat     45480
     ggtgaacaac ggccacacca ttcaaatcaa catgccggaa ggcagcacct tgacccgcgg     45540
     ggatcgcgtc taccaactgg cacagttgca tttccacgcg ccgagcgagc atcacgtggc     45600
     gggcatgagc ttcccgatgg aagcgcattt tgtccataaa gacacaaaga gcgatactct     45660
     gggagtgctg agcgcccttc ttacgcctgg cgcgacaaat aaaagctttg ccggtctcgc     45720
     caaggtcttt ccggcccggc ccggcgagga gatggcagtt gacgagttcg atcccaacgg     45780
     gcttttgccg gcctcgctcg gctactggac ctatgaggga tcactaacga ctccgccctg     45840
     caccgaaaac gtggagtgga tggttgcaat ggaaccggtc gaggtcgaca ccgcagacat     45900
     caagcggttt acgacgcttt acgcatctaa cgcgcggtcg atccgtccct ccaatcggcg     45960
     cttcatcctg ggcctcagct aaggtcatcg cgcgcgtcaa gcaaaaccgc ggtaacaatc     46020
     ggggggtttc gaacagtacg acgccaccct ggtggcgctg gcatcgacca taatgcccta     46080
     gggttcacaa aagcatgacc ggatcatggg gaacttgtgg gccgcttgct tgcggagaac     46140
     tgggtggcgt caccgacacc cgtacactcc ggcccggatc tgcttgatca gggattgata     46200
     aattcgacgc gtcgctcccg tgctgcgaga accctcctta tactggacca attaaaatct     46260
     ccaaaagtgg cagtttagtt tggaccagtg aactgcaata ttggcttgca gtcagggaag     46320
     cgatcgtgac tggtcgcgcc ggtcatggat tgcttgcgct cgaactgatg gagttgcctg     46380
     gatgtttgag ggtcccatca tcgacggtcg aattaagaat attgcatcgg gatttagagc     46440
     cgtgagcgtc tacgtcgatg ccacttcagc tggagaagga cgtttcgatc cccgattgct     46500
     tggtgaagcc tgcgattgcg cgttggcgga tggcccggct tgggcagaag ctcatctggc     46560
     gagttggtcc gacgcctacg tcgtctttgg cgcgaagcct aaccgtacgc cgtgctcagc     46620
     ccaggccctc agaaagcggg ttctgaaaga cggcactctt tcgacgatca acccgatcgt     46680
     cgatctctac aacgccatca gcctgaaata cgcagtcccg gtgggtggag agaattttga     46740
     cgcctatgtc ggaagacccc acctgacgat cgctgacggg agtgagacgt tcgacaccat     46800
     gatgaatgga gaggcggtca acgatcctcc cttgcccggt gaggtcatct ggcgcgacga     46860
     cattggcgtc acctgccgac gctggaactg gcgacagggc actcgaaccc gcctgaagac     46920
     cataacaggc cggatgtggt tcgtactgga ggcgttggag accatgccgg acgatgcatt     46980
     ggcagaggcg acggatgcca tggtcggagg gctgaatgcc ttgatgcctg gctgcaaaat     47040
     cgcgagccaa gaaattgcca tcgccggatg aggtttccgg tcgagcgagc ggatcgctgg     47100
     ccgcccgggg catccggcgc gatcgatccg atcgagatta tcaagggctg agagaatgaa     47160
     tgtcgatctc catcagttgc tcatcgtctt tgctgcatat gtcattgccg cggggagccc     47220
     cggcccgagc aacatgcgca ttatgggggt tgcgatggcg cgcggcagag gtgctgcgct     47280
     catgcttgcc tccggcgtcg tcagcggctc gatcttttgg ggttttatgg cctccaccgg     47340
     catctccgcc ctgttggcca ggtacgccca ggcactgctc gttctgcagg ttttcggggg     47400
     gctttacctg ctattcctcg ccttcagggc gggacggtcg gcgcttacgt cgaacgagaa     47460
     gctggcggtg cgcgcatcga ccgaccaagt cgctctttcg cggggtgagc tctataggaa     47520
     gggcctcttg atgcatttgg cgaacccaaa atccgtgctg gcatggatcg cgctcgtcac     47580
     gctggggatc ggtccgaatt catcgtggca aagcatcgcg gcgatattgg gtggctgcgc     47640
     catcctaagt gtcacgatat tctgcggcta cgccattgtc ttctccacac cgcctatggt     47700
     ggctctatat cgccgctgcc gccgctggat cgaaagtctg ttggcgatgt tcttcgcgtt     47760
     cgccgggctg cgtatgctgc tttcccgtat gtagtttcga aaggaatgga tgatgacttt     47820
     gtttcacggc ctgtcggcgt tcccccttac gccaaccgat gcggaagggc atgtcgacac     47880
     cgagggtctg gctcgttttc tcgagcgtat tcaacgcgcc ggagcggact ccatcggcct     47940
     tctggggagc acgggcggtt atgcttacct caccagggaa gaacgcaagc gtgccgttca     48000
     ggctgccgtg gaatgcatcg gcggcaaaac gcctcttgtc gtgggtgtgg gtgcattgcg     48060
     taccgatgaa gctcaggctc tggcgcgcga tgccaaatcc gctggcgctg acggcctgct     48120
     cctggcaccg atgtcctacg ttcccctgaa cgaggacgaa gtcttccagc acttcgtcgc     48180
     cgtggccgag gcgggggaat tgcctttgtg catatataac aatccaagca ccacgcgctt     48240
     cacattcagc gacgcattga tcgcccggct gtcagaggtg tccaacatcg tcgctgtgaa     48300
     aatgcctctg gcggcgaatg acgattacgc gggggaactg gcacgtttgc ggtcgatgac     48360
     gactgacacg ttcacaatcg gatacagcgg cgattggggc gcggcggatg ccctgcttgc     48420
     cggatgtgac acctggtaca gcgttgcggc aggtctgctg ccggtcccgg cgcttgcgct     48480
     gacgcgtgca gcgcagtccg gcgacgcggt ggagtccact cggttgaacc gcgctttcgg     48540
     gccgctctgg accttgttca aacactacgg cagcttccgc gttatgttcg tcatcgccga     48600
     ctacctcggt ctggcgcacg tccagccacc gcgccctatt ttgccgttgc cggaggacgc     48660
     cggagatgac attaggcagg cattggagaa gctcgaatag ccgagcacag ggcatgccca     48720
     gtgccactgc tagttaggca cccggcgcgc gggcgttccg cgcaccgttc gagatggaag     48780
     ttgggcggcg cagaattgga tcgggttggt cgcgctttgg ctttgcggtc tcttcggtgg     48840
     tgaaatggtc gcaacgttat cgtgctccgg tagcgccggg aagatgggcg gccatcgcaa     48900
     acgcgttctg cagccgcatc gaactttcat ccgcgaccaa acgaccggaa gtagaatttc     48960
     gagctgatcg taggccgctc gctgcctgaa gagggtgctc cgcgctacat cggtttcgtc     49020
     tatggctatg atcgcgagcc gcaacggcgc attctcgacc atctcaagaa gcagcccgtc     49080
     caagccaatc aggatatcac cttcatcacc gacggtgggg aagaacgccg actggttcca     49140
     tatcaccgtg cgcatcaggg tccttcggca gttcgtgcaa gggctcgaaa accaggatga     49200
     gcagaccgga caggacctgc tcgaaactct gcgcaggatc aaatggcatc tctggcatgt     49260
     tgacgtctat cgggcccgtc acgaaatcgc cgacctgcaa ttcgacgcgg aaggtctcga     49320
     aacaggctag ccgaacatgc gcaagttcct gaccgccatc ggcgagttca ccaggcctac     49380
     atcgcctcca acagtgccag cctgattatt acggcgagcg ttagcggtcc ggagatcgca     49440
     tctcttcggc cctcgtcaag gccaccgtca acgccgttcc aagcggttcg ccaacaagcg     49500
     gcagatgcag tggagcagga tcggcgcaca tcttctgctg caaacccgca cgcagatcct     49560
     cgatgaccgt cccgacgcgc ttggcgtgca gcccctcacc tcgcccgcgc cccgcggtgg     49620
     ttcttgccaa gagacgctcg ctcgcatcta acgaaaaccg ccgctgcatt tagctgcatc     49680
     cattgttcgg atgcgtgcga tccaaacaat caatttgttc aatcagcttc ttgaaagcta     49740
     acccttgttt ggtggaacat gggctctggt cgtcgacgct ggcttaatgc aggggctgca     49800
     cgcaggagat acaatgcaca gagatcgcaa gcgggttagc ggcataatgg ctggccgacc     49860
     ggtgtcatcc ccaggctgct gcagcgtgcg gcttgtctgt ccctccatga tctctcggaa     49920
     gacagttccg aatactgcga ccggttgccc gccttgtgtg tcgcctcgat ctcataaccg     49980
     atggtgagct gctcaatggg ctatccttca ccggataaga gatgaagtgc gaacgctcct     50040
     cggggatcat gccgatcgta cgtacgtcct gcttactctg gtcaagcata gagcgcaatt     50100
     tgttggccca gctatgaaac tcttgccgga agttagctct gccgcgtgcg tgatggcttg     50160
     agcggactga cgcaacgaag gctcacgagt attcggttcc tgccgtcatt atgacgagac     50220
     tcaacggtac cttcaacatc ggcgtggttc gactcgccgc gcgaaaacag gcaaatctcg     50280
     attgaatccg tcacgcggtg tcagcctggc attggtgcct tcccttctca acaactatca     50340
     aatcagcatt cacggatagc ccagtttctc acgtgccgta acgccgtgcc ttcagtttcc     50400
     acgttcgcgt cgagctcgcg agtggccaga gttcggaaca gaaccgtcga agtctaatcg     50460
     ccgcgaaatt caacggaggg tcagcggggc cacgggggca aagtgcgacg gtgtctaagc     50520
     cgtctttatg aggggagagg tatacatggt tttcctgttc cagcagcatc cggccgcaca     50580
     ccgaagcaat gaggagctag aattcagatc agactttcgc aaggcgcgca ccgcgcatca     50640
     aacgccgttt cgttgtgaaa aaaggctcag taccgacaac gtttttgtaa tcgccctggc     50700
     ggcctcgttt gcgctcttgt tcgggataca gaggcaggac ccacaggtcg acgaggcggt     50760
     cctaagtgaa ctgcgaacga ttcagatcaa ctacgcattg ctccagcgcg atgtcgcccg     50820
     cgctcgaacc gacatggtat tggacttccg ccccgttgat tctaccctcc aagcattgca     50880
     aaggaacgtt acaaacttgc aacgccttgc cgagatttcg cccgatgaga gctccggagc     50940
     gcactccagg ttgcttgcac agctcaaaaa gtccgtcgag aacacagagg ctgccatctc     51000
     ggcagcggct gcgcaaaatg agcttctgca aagctctctc gtacggtttg ctcgctcggt     51060
     taatcgcctt gagggggcgc cgtccaacag gcttgaactc tccaatttga tccttcagtt     51120
     ttcggccaga ccgggattca gcctcgcatc acagatcgat cagtctctca gccgacttcc     51180
     tccgagccag gaccaagcca cccacgatgt tgtccgcaac ggccgcgcta tcctgtccgc     51240
     gttgtcgaga gtggaccgcg cagccgatcg gatcgcatcc tttaacacgt tcgccaaggg     51300
     cgccgaactg gagcgcgaat atctgaaaga ctacagcttg gccagcgcgc aagcgcagcg     51360
     cacacgactt ttctttggct cggtgtccat atgcctctgc ttgtttgcga tcattcgggc     51420
     cttcaggctg catgtgcgga cgaaccggtt ggaaaggcgg ctggagcttg aagaggcaat     51480
     gcgtgagatc gaagctcgct tcaacgaaag taaagcaaag aacgcgtcgc cgcgcttttc     51540
     aaccgaagca gcgcttagac ttgttcaacg cgctttcgac gcggatcaat gcgcgcttgc     51600
     tcaggtggat ccgagtctca gcaggcatac cgagtgcttt gtgacgaaca cgtgcatgcg     51660
     tgtctggaac gtcgcgcttc ttgatgaagt cgtttcactt gtccgcgccg gacggccagt     51720
     gtttcgcgtc gttccggcgg cggaaatggt tcgcaccgcc ctagacactt ccggtgtttg     51780
     tcaaattgtt gcttgcaggg cctccgatca gcaggctgtg gtttgcatcc ttgtttttga     51840
     acgagatcgc tcactcccct cagcaggcga cctgtgggtt cttgccagtg ccattgggcg     51900
     tttgagcaac catcttgaaa tgcaacgtgt aaatgccgaa cgcgaccttc tggtgagtcg     51960
     atgggagcag gtggaaaggc tgaggaccgt cggcacgatc gcaagcggcg ccacacatga     52020
     gttcaacaat attttaggcg caataatcgg atattcagaa attgcccaag gtctggtgcg     52080
     tcgcccctcc agaatacgga accacatcga ccaaatcatc ttagctggac accgcgccaa     52140
     gctgatcgtt gaccagatct tgtcactcag ccgaaaccgc aagcgcgttg cattgccttt     52200
     caacgtctcc gaaattgtca tggatcttgc gccattgctg cgggttacag ttcgtgcggg     52260
     tgttcagttg aacttcaaga tcaacgagtg gcaaacggtg gtcgagggca gcccaaccga     52320
     gatgcagcag atcctcatga atctgtgcaa gaacgcgtcg gaggctgtct tgaacgaggg     52380
     ccgcgtcgag gttagcgttt ctcgcgccca ggtgtgccaa accaagccgc tggctcaggg     52440
     caccttgaga cctggagatt acgtcctcct ctccatcagc gacgatggcc caggaatcgc     52500
     aaattcgata cttccgcatg tctttgagcc cttttttacc acgcgctctc tcgtcggcgg     52560
     gaccgggctg ggtcttgctg cggttgacag gcacgtgagc gcgctcgcag gatgcctaga     52620
     cgtcacctcg gttgttggcc gaggtacgcg ctttgatatc tacttgccag cctccgagga     52680
     ggagccagtc agcgctgacg tcactttcgg cccatacaac ggatcaccgg ccaacggcgg     52740
     aatcattgca gtcgtggagc ccgatccagc agagttggag attcacaagg acaatatcgc     52800
     cgcgctgggt tatgagccga tcggcttcgc gaccttcgaa agtctttgcg gctggatcga     52860
     gagcgggaag gcagctgacc tgctgatttt ggcgaagacg cctttcctcg agcgaggacg     52920
     ggccgagtcc gtatgcccca ccatcatggc ggtgcctttc atagtcatcg gtgacatcga     52980
     ccccatgccg gtcacatctg acaatcaggc cttcgtcctt cggctagcga gaccggtctc     53040
     gtccaggaca atagagcatg cgatacgtat aatgatgatg gcgtgatgcc gccgactcgc     53100
     tcattctatg caagtaatgt gagaaggcct ggcaaaagac atcgaagcag aacaaaacga     53160
     cgcgtcgcat cacaatggac ttatcgatcc cgagacgttg ttctagcctt agtgcttgtt     53220
     aaggaggtcg gctactgtct ctccccgtcg ccgggcatcg gcggcgagcc atacctctcc     53280
     cacctcgtac aggtcacctt gggtgtggaa cggcacaatg acgtcaacgg cagccgacag     53340
     catgtcaaga agcgttcgat cttccacagc ggctccttgc gggctgctct tgacgaggga     53400
     aaagagcttt ttgaagccct ggaccggatc ggccccatgg atcgttgata ttgatcccgc     53460
     atggccggag acgacttcgc taaggtaggc ccatgcagca tcatcgcgca tctcgccgag     53520
     caatattcga tcagggcgca tgcgcaagct cgcttgcagc agttgctcgg ctgtcaccgc     53580
     acctacgccg gctcggtcct ttggatagag taaccggaca tggttctcgt gcgggattac     53640
     aagctccagc gtgtcctcga tacttatcag tctctcttgc gggggtatag cgttgatcaa     53700
     agtcttgctc attgtcgttt tgccgcttcc agtaggtccg caaagcagca tcgtgagccg     53760
     tcccgaaaca cacgcttgca aaaacttctc caagtcacca tcgtcgtatt gctgaagaat     53820
     agtttcgtcc tgccgctctt ggcgctgttt tcgtgaccgc cattgattcc aacgtgagta     53880
     ttcgtagcga gaagaaactt ccttcagttc ggtcacacga cttgaaggac gccgtatcgt     53940
     caggcttact gttcctgagg gaacagcggg cggcaaacag atctgtagcc gctctccgtt     54000
     cggcagctca gtcgcacaga gggggctttg cggtccgaca tcttgcttgc gcagcgctcc     54060
     agcgagaatc gcgatgtcct ccagatcgtt ataacctagc ggtagcggat gtttcgtgaa     54120
     gacgccggct tgtcgcacaa acgcttcccc aggccggttg atagcgacct cttcggtcct     54180
     cggctcctca agccatttca gaacggggtc gagaagcaaa cgcaattgag ggtcagcctc     54240
     cgatcgcatt gttgtctctc cggcgttggc gatgttgggg ggctggcgcc acgacagttg     54300
     ccgtgagacc gtatacatcc gagaaatcga ggtcgcgagc cacaaagatg gatacagcat     54360
     ctccctggtt tttcttcagg gttggcggaa tgttgaccgt cgctctcaat gtcgtctcga     54420
     cggcttgtcc gccattgctc tggaagctgt cgatgccgct tcctccgcca gagctcgccg     54480
     cgtattgacc ggccgcctgg aacgcgcctt gaaggacgct catcagcatt gctccgccaa     54540
     agcgttcccg gaagtgatta tccaccgtgc caggcactcc ggagcggccg agctcgtcag     54600
     cgcccggcga tgctatcgaa acgagggcat ggtcaggtgt ttcgatgcgc gtccacagca     54660
     cgaagacacg cgcatccccc tgttcgagac cgtgctggat ctcgccaatc accgtcgtcc     54720
     cacgatccaa gagcacgaca ttgttggtgg cgccgcggac gtctttaggt aagacgcact     54780
     tcacatagcc gggcaaattt gtgtcgaccg ccgtttgcaa aaggcaagga atgatcgttc     54840
     cctgagtaat cacgagatca gggtgcggca aaagtgtggc ccggctcggc tcctgtatat     54900
     ctggcttcaa tcggcctgac agatcgccac cggtcgagat ctcatccgcg gtcgcgggag     54960
     catccttgtg ggcgtcttcg ctccgctgag ccacgtcggg cttttgactg ccgctgctgt     55020
     aggcgaaaat tggtgattcc tcgggcggcg gttcagctgc tgcgggttgc ggcgtggatg     55080
     gcgcaggatc tgacgcctgc gccgcctttg caggcgctgg aggttcggga gcaagctcaa     55140
     taggcacggg gcggaacggc tcggcgttgg gggaaattgg cgggtttggc tgagagggtt     55200
     cgtcttgtgt gctgggacga cttccgagcc agatgagcga cagagatgag atgagaacaa     55260
     gaccggcgac ggccaatttc tgtggtcccg aaacatgccg gcgggccggc tccgagacca     55320
     acgatgcgga tgcatttaca tcgtgtcccg actgtgggcc ggtttcattc atcggcccga     55380
     gcctttcaaa acgcgccaca cgtcgggtct cactgtaccg gtgcccggcg ctcgtccaac     55440
     aggatcataa gccctgttga aaatcgacaa taccgtattg ccatctctca gacgccattc     55500
     ccgggcgact gcggatactt caacatagtc gcctttgact gtgaagttgg cagcggcttc     55560
     cttgccatcg ggattgatga tgtagaggga gggtatacgg gaattgcttg cgaagccaaa     55620
     tacggtggta aagccattgt cgaaaacctg cagcggcgcc agcgatcgat cgccctttgc     55680
     gacgtagtga aaattgcttt cgtcggaact ggcagttgta ccgggccgat tcaacaaatc     55740
     ctgaaccctc tgttcctgct gcacctttgc ccgggcctga ccaagaatcg agcgcttttc     55800
     tgctgcctgt ctcaaagcag cggcctcatc accgggatag gtgaactgca cactgtagta     55860
     taagtcaggt tgctgctcat ctaattttgg catcgctctc gttgaaatgc tgaagacata     55920
     tctgcgggta ccggactcac tgtcggccag aacgacgacc ggctgcggcg gcaggatccg     55980
     gctggccttg aagaacaggt agttggcgcg tgggagcgca gccaggtctt tgctattgga     56040
     aacggccacg gctgcgacgg tctcgttggc cgcgaatgtg acgaccagcg ttgcccccac     56100
     cgcggtcgac aggcgcacca cttcgtcggg acggtaagcc aagtagcgca tccgtgcatc     56160
     atgcttgccg gcaagcgggg tgtcttccgc ggaagcctcc agcgttaaga gtagtgaaca     56220
     ggccagtgcg agaaacgctc tttttgtcat ggctgcacgt cacccaggtt cgacacgcta     56280
     tcttccgagg tttgatagga agtgacgagt agacctcccg gattggtgag ccttgattgg     56340
     gcaggcagat ctgtcaggcg ctcgtagcgg atggttgcgg tccaggtggt caccaacggc     56400
     atctgcccat cgatggaaag ggtgcgtttg tatcggatct gttgaacgtc cggactgatg     56460
     tcgtttgagg aaatatgccc gacttcgagc ttgccgagct tgccgactgt gacttgcggc     56520
     gaggtgggat tcggataatt gaagaaatct tgatattgct gccgcacagc cggtgcgctg     56580
     aaactggata cgaggtcata gccgtattgg gcggaatcgg ctgtgtagct ctcgcgcagg     56640
     cgtacatatt cccacagcga agcatttatg acggctcgct cttgggttgc cggcagtcga     56700
     gagactgaca cttcgctgtc aactgttcca tccgggcgca cccagaggaa cacaggtacg     56760
     agcttggcca acgggaccat ggcagcgatg gtaaatgcct gcgcaacatt tcctaggacc     56820
     gccgctgccg caaaggctat gagggccttt gacaggcgcc gcgcagactt cgctcgtgaa     56880
     gtttgaaacg cttccacctt cttatagtgg gcggctagcg tttctctctc caccagaagg     56940
     gcatgttcag gaaatttcac ttgggctctt tcgcacattc gacttgaaga tcttcagggg     57000
     aggtttccca ttgtcccacg ttcagttgga atggcgaacc cgtgcaggtc gcaagcttat     57060
     cggttgtctt gcaggccgcc aaagccagta ttgacaaaag tagatagtat ttcatgttga     57120
     ggtaccgcgc ttgtcgattg attaaccacc tgccgttttg gcaatgcggc gattgaggct     57180
     gctaagagat tggttcgcac ctgcccaaga accgcctgct atgctgctgg cgatcgtcgg     57240
     aagcgcgacg atcaaagcgt caccagctag gaaaagcata tcgagctcgt aaagcccgat     57300
     gatcttggct gctgtcgtac ccttgtattt gatcaccgca agcatgactc ccagcgcgac     57360
     tgattctgcc gcgataacta tcgttgcaac gatgttgagg aggacaagca gcagcccgta     57420
     tgagagcagt tggccgatcc atctggtagc catgtctcga gtgtgatcaa aaagatagcc     57480
     tacaagaacg agggggccga tcgccaggag caccttcgtc agaattccaa cggcatcata     57540
     gatctcgaac gctgtccaga gcgagccgta caaaatccat tgcgctccct ggaaggcaag     57600
     tatgtcctgc tgattcattg gcccaatttc ggaagcaatc cgctgaaagg cactctgact     57660
     tgaagcgaac attacgtcga gcttctgggg gataccgatg aagggcaagg tgcttccgct     57720
     gatctggtgg gcaagctttg gaatcgtgtc gtcgaagacc gattcaatgt acagctgata     57780
     gttggcctgc cctaagatga gggcgacgac aatcgatacc gtgactacgc gcgagatacc     57840
     tccgcgcgcg tcgacttgac cgcgcatgac cagaaagcct tggattatga tccagagcgt     57900
     gacgcacgca accagaggcg cactgaccgc ctcttggacg tttccaatca ctttgtgcag     57960
     ccccgccgta aaggccacat gaaagatcgc gtgtatggcc gtgaatggcg caggaattct     58020
     gaaaaccatt gcgtgaacct tatttgcccc tgatcagcgc agatgagcca gatgaactaa     58080
     gcgtcgctac tcaaacattc tggcggtgtc ctggcgttcg cgacgctgca tcgcggcctc     58140
     ctctgcggcg tgaaggctcg cttgtgcagt ggccatcgtc agcagactcg tggcctggac     58200
     attttggata atcgcatcat gaatctgctt gaggaccaga ccgttggtga cggtggcctg     58260
     cacaatattt cccgagcggg aaagctgacc aagcgtgttg tcgttggcct taaggcgctt     58320
     gtccattacg cccagagtgt cggacgcaag agctgcggca ttgatggcac cagcgatttg     58380
     tccctgtaac agtttcgctt ctgaatccgt gccgtcgact ttccggtttg ggttgtccgc     58440
     aattgcacgc gctttaatcg aagttggcgc ctgaccctca aacatctgcc tctcaagctg     58500
     atagcccgac gggtagtgat ttccttggtt cagtgaactt agcagccccg tgacaccgaa     58560
     tgacgacttt agtatctcca ccatttccat cgtggaagcg agcgtctggg ctgactttat     58620
     caggatctgc gcagtggaaa ccgctgttaa gcccgcttgt gttactaccg ccgggtcgat     58680
     gacgacaaat tgcgaccggg cctgtccgct aaacagaaag gaagcggcaa gcgtcgttgc     58740
     tgcaagcgtg ggaaatctca tgaatattcc tccgttagtc ttgaatttcg ttgtaacgag     58800
     ccatgaactt gtcgagccac gcacttgggg catctccgtg ctggtcacga agctggtcga     58860
     caaagcgcac ggtgttggcc cgtcccgaga gtacggctac atactcgcgc atctggccaa     58920
     gatcgaattc gcaaacaaca ctcccgctct cgcgcttgag caaaaacttg cggctgccaa     58980
     ttgccattcc ctggcggatt gcttcgaact cctgcgtggt gcacttcaag ccatcgacat     59040
     acgcggcccg gtcggccgtc ggtgatgggt agaagatctt ggtcatgcat tgtgcaacga     59100
     gactggctcc gaggggcgat tcaagcacgt gttcaggctg ctgcgttgcg agtatcaaca     59160
     tgccgttgtt cttgcgcacg gtgagcagga acttgtcgat aacagccgag aactgcgggt     59220
     tgagcagata gaaccgaaat tcgtcgcagc tcatgacgaa ccgacggcca tcgacaacag     59280
     cgcccacgcg gtgcagaaga tatgcggcgg ccggcgcaca gacctcctca aattccagga     59340
     gctgcgtcat gtcgaagccg gtaatggagg catccagcct gacttcgtcc tcatcgccgt     59400
     caaaggccca tccaagcgca ttccctctac accaccgctg cagccgtgct cccgcgccct     59460
     ccgaggggct gtgcagcagg aattcgcgca ggcccgcaag tgagcgcatg gcgggttcga     59520
     acgaaagttg acgaagaatg ccacgttcca gtcgacggct ttcttccggc gagatcggac     59580
     cacggccgtc actctcgatg agggccatca gccattcgcg cagaaaatcc aacgaggcgg     59640
     aggtgttgtc cagtccgcgc agaggggcca agccgctcgg agcgcctctg cgcaacgcaa     59700
     ggtatgtccc tcccgtggct cgcaccagca gttcaccacc ccggtcttta tcgaaaaaga     59760
     cgatggcgcc attgcgatcg accacgcttt gctcaagcat cgcgaggata aaggtcatca     59820
     gcgtcgtctt gcctttgccg acgggtccga atatcgccgt catgccgacg tcattctcat     59880
     gggggatgta gtcgaaagac gttccaccgt ttgtgcgaaa gcgcgcaaca gctttgcccc     59940
     agtggccgga gctggaaccg ctggggaagt tctcaaatga gacaagcccg gcaaaattgt     60000
     acgaggtgat cgccccgggg cgcgtgcgcc acctgttgtt ccccgggagt tgggaccagt     60060
     acgcggcctc catgccgata ccctcttgga cgataacggc gcctgtgtcg gccagccttg     60120
     cgcgcgcatt tgctgcgcga tcggcaaggc tattgaggct gtcgccatag acgcacaggc     60180
     tcagatgatg cgaacccatg acgaactcgt tgcttgccag tgcgtcctct gcctcggcaa     60240
     gttcattgat ctgggtgaga gccttgtcgc cggcgctcgt catctggctg gatttaaggc     60300
     taagcttcgc atgagcttgt ggccgagtga ggaaggaaaa gctctggctc aggacaagcg     60360
     ggaagttggc ggacagtaag ggatttagca tgcctggccg cgtcgtcgcc ggatattcac     60420
     ggaacgaaaa caatgatccc acggagctat ccccgggtct tcgaatctca agcgcccgct     60480
     tcccgcagat gacccgatca gtgtagatcg aggcgccaag cgagccggta accatcggaa     60540
     ccggaagaaa ccggcaagtc attatcagcc gaagcgcctc accaatttcc gtgaagagca     60600
     cgttgccttt ctcgcgaata cccaaccggc gcagaccgta accgccgagt gagccagcaa     60660
     tgatctgcca gaggtcctcc aggcttcgca gttgtgtggc cagatcgttg tcattccgtc     60720
     tgggggattt ggcaatgcgc cagccgatct taccgattgc ggtgcggggg gacacgacga     60780
     tagtgaggaa gtgatcgttg cgaaagagct tgcccgacag cacatgtcgc tcataggcct     60840
     cgctcagact gccagcaaat gcactttgaa actggcgcga tgccggctcc ggcacatcgt     60900
     tgttgcgcac aagatgagcg tatagcgtga cattgtcatc cgcgatgttg cgcaagagag     60960
     tgttgaacgc gcggcagcgc gaattgcgca tctctgcgtc ttccaaatca aagggcaggc     61020
     cgttcacgtg tgccatggcc atgatcgatc cgtcttccag caggacaacc tgatcgctga     61080
     gatgaccgac atacggaaga tagatctcgc cagatctctc ggtccggcca ctggcgccaa     61140
     acattacacc attcctcttc cgcgtttcgg cactctgatc ggattgacgc tgacgctcgc     61200
     gccaccccag accggcccgt ccacgcttct gccggccgtc tgcaaataga ggagcgcgac     61260
     gcttgcggcg ttatagtcac gctcaaccac cagccgtgcc ccgaaccaga gtggcacgag     61320
     cacgatttca taaagtgggt tttgaaggac aatgatgacg agaccagcca acatcatcag     61380
     caatccggcc agcgtcagcg gcacccccag aaacagtgcg ggacgtgtcg ccgccacata     61440
     gagggtgctc acttccaacc ggtcgctcat cagccaccgc ctatgagcgc cttgcccagg     61500
     aagcttgcgc cgaacatgat gacgatccct ccaacgacac ccgcaaccaa gccaagtgaa     61560
     gcacgaccga acatccaaga gatgccgatg gccacgagtc cgagcacggc cagtgattgt     61620
     ccgaaggggc caagtatgaa ggtgcagata ttctggacca tcttggcggg atccgtccct     61680
     ccggtcacct gagccgaggc tggcccgatg gagaagaccg tccacgcggc gcctgcagca     61740
     gcggccggta catattcagc cgtcgtgcgc agcatggaaa aaggcgaagg aacacgcgtt     61800
     ttaagcgcac gaagtatttt gaatggcttc atcattgtat ctccatggtt caatcgaata     61860
     cgagtttgtt cgggttcgag ggttcccgct cttccgcagc ctggctgcct gtcggaccgg     61920
     agggatcggc cccggagcgg tttgactcat acgagcccca gatgtcccaa gaattttggt     61980
     tgggctgctt tccattggcc tgttggctct gttggagcag aggcggcacg gctttccgac     62040
     cggatgcctc aaggtgtggc gcatctgggg cggtcggctc cagcgttcgc tcgagatgac     62100
     tcgtgatgtc ctttgcggcc gactcgacct tgcgtacata accgttggtg aagccacgcg     62160
     tgacgtcgcc cgtgttgtag gccgagatgg cacggcgaag cgccagttgc tgcgccggag     62220
     cagtcgtgcc gccggcatac cggctttcaa gcaagtgggc ggcggccgat agcgaggcgc     62280
     agggctcgaa agccttttcc ggcgtgagat tgaggaagga aaagttcttg ctgtttatct     62340
     gcatcaatcc gacatcgacg gaatgttgtg cttcgaggcg gttcttgatg ccccgcgtcg     62400
     cttccaggtg gtctgtccag cgaagctgct cacctgtggt gttgtcatga gccaccagcg     62460
     tttcaaagcc actttcaatt ttggcaatcg cggcgagcgt ggacggcgca acccagggag     62520
     cgcatttgcg cgacaggcgg tggaattcac ggggcgaaag tggcgcgggc tcggctggga     62580
     atgacatgga tgtcaacagg gcgatggcca gcggccaagc tgcaataaac attcctatcc     62640
     cctacctttc caagcgtccg gaccggttct ggccctgtcc ggcacgcgct tatcgggcag     62700
     gtttgttact gcgtgatgtt caagttcagc ttttcggttt caactgaagc aaagagcttg     62760
     ttcatatccg ggtgcatggg caccttgcgc atgcgcgggt tgcgcgggcg cgatcagccg     62820
     gcacatctcg accatcgtgg tggatcattc ctgcgcggga ttgcccgccc cggccgtccg     62880
     ttgctcctgc agcgtcaacc gcgacttagc atgggcggtg atggaatctt gtgtcagcgc     62940
     ctggccgaag gacaaaatgg ggagcttggc ggcttcgtct caggctgcgg aagctggggt     63000
     cgatcgaacg cgagaaccga ctagggcgcc gagctgccca atgttgcggc atgctgccgt     63060
     tgttgcaaga gacggccatg cgccctgcat actcaggcat tggttgaaac cgcgagttcg     63120
     tccgcgaagc tcgtcggagg cgcaaatacg cggggacgag ggtcaactgg gaagacgtgg     63180
     cggcgcagcc ggcctggtgc gagacctggt tcagctgttc ggccgcgccg cgaactggtg     63240
     gtcacgcaca atcccatcgg cagaaaccgc aggcggattg acgcagtccg acagcgctct     63300
     cgacaagtac agtgacaggc tcaaaaggaa agtattgcac caactgagaa atgttagctc     63360
     gcaaggtaac cgtaaccgta atcggacctg ccgatcgccg ggaacaggat tggcgccgcc     63420
     ggccactgcc caatgacctg ccttgggcag gagacatagc gttggcacaa ggccactata     63480
     gcgaatcacg gtcgttcttc ggccaaccgc ctttgcgatc aatcaaacgc cgcgctgctc     63540
     caccgcgtcc gagccgcacg cacgagcggg aggatttcga ggtgatccag gtccgcaagc     63600
     gccagaaacg cgaagaagat gcaaggacat ggcaagcgat cgggcgtccg tgccgtcgta     63660
     atcaagtggt gttggcaggc ctgcaccaac ggcggagctc gcgaataagc gaaggaccac     63720
     acggcagggt cataccggcg cttggagatg tgtggtggcc accggctgcc tggatgcggt     63780
     caattcgctg tggatgaaaa gaccaggccg agcaacggcc tcacattggc cgcacgcacc     63840
     ggcgagtggt agcaaggggc agctgttctg cgtggtgccc caagggttgc tcggcaacag     63900
     ctttagacaa ggggattcaa gattgaaggt gagccgttga aacatgttct tgtcattgac     63960
     gatgatgccg caatgcgacg cctcatctcc cagtatctca tgatgcatgc cttgaaggtg     64020
     accgcagtca acgatagcaa gcagtttaac tacgttctat cgcatgagcc agtcgatctc     64080
     gtggttgttg acctcaacct aggccgggag gatgggcttg ccatcgtccg caacctggcg     64140
     acaaaatcgg atttacccat catagtgatc agcggcgacc ggcttgatga ggcggaaaaa     64200
     gtcgttgcgc tggagctcgg cgcaaccgat ttcatcccca agcctttcgg gctgcgcgag     64260
     ttcttggccc gcattcgagt agggctacgc cagcgcattt ccagtccgcg aacgaaagat     64320
     catcgctcat ttcggttcgg agcctggaag ctcagcgtca agcagcggcg actgatctgt     64380
     gcggagcgtg gcgaagtcaa gcttaccgca tgtgagttca acctgctgat cgcgttcctg     64440
     gagaaccccc gcaatgtcct atccagagaa cggcttttgc tcgcgagccg tgtgcgtgga     64500
     gaagaggtct acgatcgaag tatcgatgtc ctaatcttgc gcttgcgccg aaagctggag     64560
     gctgatgcgg ccaatccaag gctagtcaag acatgccgtg gtgcagggta tttcttcaac     64620
     gctgacgtag acgttagcta cggaggcacc ttggccgcct gacaggagct attctggaga     64680
     ttggctgacg aggctgatga agcgtggcgg tgttttctgg cggcctttag ctcggcgcct     64740
     ggatgtcgga cccaaggcag catctcgtcg atctggctgg gatggctgtt gacgatcctg     64800
     gtggtgagga cgtcggcgag ataaccgagt gactcgacac cattgagcct gcagctttcg     64860
     atcagcgacg caatgaccgc ccagtgttcg gcaccgccgt tcgagccggc gaagagcgcg     64920
     tacttgcgga cagattgagc gctcgacggt gttgttgtcg atctcggtgc gaccgtcgtc     64980
     aacgaagcgc gagaggcctt cgcagcgtga gagcatgtag cggattgccc cggcgacctt     65040
     ggtcttctga ccgatcaggc cgagctttca cgcagccaag gttcaagatg gcgacaatag     65100
     cgcggctatt gtcccgacgc gtcgcacggc gttcatcggc cgatcggccg cggatatcgt     65160
     cctcgatctt attgaggtgg gcgatcgtct cagcgcctcg ctggcgatcg gcgagttcca     65220
     ggcctacatc gccttccaac agtgccagtc cgatcaatta cggcgagagc taccggtccg     65280
     gagatcgcat cagcctctcc gtcgccaaaa gagctgttct gcttagccgt cgagctcaac     65340
     gcccagcgtc ggagcgctct ctgctcctga aggaagccat gaggtccgct cgggcttgat     65400
     cggaggcttg gccgacggac gttgtgtttg cgtcgctcgg ctgccgcccg atggcgaggc     65460
     tttgcgaatt gtcagtcctt tgccttttcg ctggtctcaa cggcgctgtg taacgttcag     65520
     tgttgatgat gacgcccccg ctgttcacgc ggttgctcct gtgcagtgta ctcgtcagct     65580
     tgtcctcggc ctcgcgcgtc tggcccaagt gccgttccaa cggcgctggc gcgacctgtc     65640
     tggcttgctg ctcttgcaag gcggcgtgtt gcacctgcga cccggctgct gccaaagctt     65700
     cggcggggct tgcggcaagc tcgtgcggca agcgcccctc tctcagtcgg ttttgcagcg     65760
     cctgccgatc ggcgacgagg tagttgaggt gcagcggcag ctgctggtct ggccgctctt     65820
     cgttcgccaa tcgacgaacc agctcgcgcg tgccgtccac cacgaagacg ccgcagtcaa     65880
     cagcgttttt ctgctgcgcc atgtcgggtg ttaccagggt cgcgtccagt cttgtagcga     65940
     gctttcgtgc aggcgcgtcg ttgtatcgct gttcattttg ctggatggag tcgtagtgat     66000
     aggcgaccgc tctttccgga tcgcggcgat ctacgaggag cagcgaccaa tgggtgccgc     66060
     ggtcaatacc caccccatcg ttcactggca cgaacaggaa gtcggatggg ccggcgtttc     66120
     gatcataaat cgactgcaat gtgcctcgcg cgtcttgctg ctccatgtgg cgcagcagat     66180
     gggagaccga cggatcgacc agccgcgtcc gggcggcgag cgctggatcg gcctgctgca     66240
     gctgctgctc gaggaattcg taatccctct ggatatgttc gtcgcccaac agttcggtgg     66300
     ccccgagcac cgccccccgg gggagattgg acaagcctga cggaagggct tcgatgtgtg     66360
     catcggagga ggtggtcaga tcgaccaacg gaaccccgag atgggtgtct gagagcctgg     66420
     cggtcgctgg caaggcgggt cccggagccc ttgccggtac tgctgccgct ccagcttccc     66480
     ttatcgctcc gcgatggagg agccaaacgt cattgccctc ctctggcctc cgggcggtgt     66540
     agccgtggcc tttaatctcg tagttccatt ccggcttgtc cgcgtccggc aagaggccat     66600
     aatggtacaa ggaagagagc atcgcctctg ggacgcgttg agtcccatgg gagaagcctt     66660
     tgggcacggc gaatgagacg tttatggagt tctcgatggc agcggggggt gcctcagacc     66720
     ttgcaaaggg cgcggcctcc gcatgcaggc ttccaatgtg ttcggaccct gggccttgaa     66780
     cgggtacccc tgccaatggc aattcaccca actgctgcat ggggggctgc atcggcacgc     66840
     ggccgccttc gctcggcggc tgctgaatgg cgatgctttg cggattatca gtcccctgcc     66900
     tctccgccgg ccgcaacggc gccgtcgaat gttcattgtt gatgatgaac cgctcgggtg     66960
     gcaggaggtt gccctggtca agcgcatccg gccagggccg gtgttggctg acagctaacg     67020
     ctggcggggc ggcggcctca actccggcgt gcccagagcc ggctgctgcc aaagcgtccg     67080
     ccacgatcct gtctgacgca ggcttcgcat cgcgaacccg ttcaagcgcc aagcggagat     67140
     aatcgttgcc tggaaacaac acctcggcga attcgatccg cgaatcatga tccagcccag     67200
     agatcgtctg gccccgcctc tcaagcgcct cagaaaatct gcgaagacta cgaccatagg     67260
     caacacgggt gcttggggcc aagctgctgt cactggtcac ttgttccaag acatgcgcat     67320
     ctgcctttga aggcaccgtc actcgccacc ggccagtcgc tgaatagccc ggctcatgat     67380
     acgcacgcag gacgttcaac gccggcctta tatcctttat gtcagtgtct ttcggaaaga     67440
     aggtatcgag gtgatcgacc agggattggt gattttttag atcagtcgct tggccacgag     67500
     cgccgagatc attcgccaat cggcgaagcg cattcgagta tattcgcagc gtcggcgcgc     67560
     tatggtgttg ctgagcctca gcatgggcga tcgccttatc aatcacgtcc cggtgttcgt     67620
     cggacaagtg gggatagcgg ttagccgggg caccaacagt cactgaatag cccggctcat     67680
     gatagacacg caggacgttc aacgccctct tcatatcatc gtttttcgga aagaaagcat     67740
     cgaggtgatc gaccagggat tggtgatttt ttagatcagt cgcttggcca cgagcgccga     67800
     gatcatttgc caatcggcga agtgcatacc tgtattttag gaccgtgctc tcgctatatt     67860
     tttgctgagc cgcagcgtgg gcgatcgcct tatcgataag gtcccggtgt tcgtcggaca     67920
     aatggggata gccggtggca cgggcgccac tcgcgacagg ttcggctcgg cgcggctcgg     67980
     ccacgtgctg ctcaaaaccc gcttgccgcg attggccagc atctggcaag aggccagggc     68040
     ggtccaagga agagagcatc gcgtctggga cgcgttgggt cccatgggag aagccttggg     68100
     ggacggcgaa cgaaacgttt atggagtcct cgatcgcagc cgggggcgcc tcggaccttg     68160
     ctgagggcgc ggcccccgca tgcagccttc cgatgtgttc ggaccttgtc ccttgaaccg     68220
     gtaccccttg caatggcaat tcacccaatt gctgcatggg gggctgcatc ggcatgcggc     68280
     cgcctgaatt gccgatttcg ctcggctgct gctgaatggc gacggctggc ggcctatcca     68340
     cggccctctg cctcttcgct ggccggaaca gcgctgtgga atgttcgttg ttgaggatgc     68400
     ccccctgggg tggcaggtgg ttgcgatggt caagcgcatc cggcgagggc cggatctgct     68460
     gttggctggc agccaagact ggcggagcgg gggcctgaac tccggcgtgc ccagatgttg     68520
     cgaaagcgtc cgacacgctt ctattggggt cctccggtcc agcacgcatc cctgggttgt     68580
     tgagcgaagg cgaggtggct tgatcaccct gccgctgctc aagcacttcg cggagcccct     68640
     gttccagtcg cagaagctcc tctgcattgg ttggcggctg gtgagctcga tcatcgacca     68700
     gcggccggag cgcctcggga acctgcgcgc tgaaagaaga cgaggtggct tgatcatcct     68760
     gccgctgctg aagcacttcg cggaactctt gttccagtcg cagaagctcc tctggattgg     68820
     ttggcggctt gtgagctcga ttatcgaaca gcggccgcaa ggcctcggga acctccgcat     68880
     tgtgaacccg ctgcagcgcc aagcggagtt tcttgttgcc tggaaacaac gcctcggcga     68940
     gttcggtccg cgacttgtga tccagcccag agatcgtctg gccccgactc tcaagctcct     69000
     cagaaaatct gcgaagaagt cgaccataga cgacacgggt gcttaaggcc aactcgctgt     69060
     cactgcttaa tttttccaag atacgcgcat ctggctttga aggcaccgcc gctggccacc     69120
     agccagtcgc tgcgtagccc ggatcatgat acgcacgtag gacgttcaac gccgttttaa     69180
     tgctctggtc attcggaaag aaagtatcga ggtgatcgac cagggattgg tgatttttta     69240
     gatcagtcgc ttggccacga gcgccgagat cattcgccaa tcggcgaagc gcattcgagt     69300
     atattcgcag cgtgtccgcg ctctggtttt gctgagccgc agcgcggtca atcgccttat     69360
     caataacatc ccggtgttcg gcggacagat ggggatagct ggcagcaggg ccgccagcag     69420
     tcgctgaata gcccggctca tgataggcac gcagggcctt caacgcgctc ttcatatcaa     69480
     cgtctttcgg aaagaaagca ccgacgtgat cgaccaggga tttgtgattt cttagatcgg     69540
     tcgcttggcc acgagcgctg agatcattcg ccaaccggcg aagtgcaaac gtgtattttc     69600
     gggccgtggt ctcgttatat ttttcctggg agtgggcgat cgctctatca ataaggtccc     69660
     ggtgttcgcc ggacagatgg tgatagcggg aagcacgggc gccactcgca acggggtcgg     69720
     ctcggcgcgg ctcggccacg tgctgctcaa agaccgcttg ccgcgcttgg ccagcatccg     69780
     gcaaggggcc agggcggtcc aaggaagaga gcatcgcgtc tgggacgcgt tgagtcccat     69840
     gggagaagcc ttgggggacg gcgatagaaa cgtttatgaa gtcctcgatc gcagccgggg     69900
     gcgcctcgga ccttgctgag ggcgcggctc ccgcatgcag ccttccgatg tgttcggacc     69960
     ctgtcccttg aaccggtacc ccttgcaatg gcaattcacc caattgccgc atggggggct     70020
     gcatcggcat gcggccgcct gaattgccga tttcgctcgg ctgctgctga atggcgacgg     70080
     cttgcggcct atccacggcc ctctgcctct tcgccggcgg gaacagcgct gtggaatgtt     70140
     cgttgttgat gatgcccccc tggggtggca ggtggttgcc ttggtcaagc gcatccggcg     70200
     agggccggat ctgctgttgg ctggcagcca agactggcgg agcgggggcc tgaactccgg     70260
     cgtgcccaga tgttgcgaaa gcgtccgaca cgcctctgtt ggggtcctcc ggtccagcat     70320
     gcatccctgg gttgctgagc gaagacgagg cggcttgatc atcctgccgc tgctgaagca     70380
     cttcgcggaa cccctgttcc agtcgcagaa gctcctctgc attggttggc ggctggtgag     70440
     ctcgatcatc gaacagcggc cggagcgcct cgggaacctc agcgctgaaa gaagatgagg     70500
     cggcttgctc atcctgccat tgctgaagca cttcgcggaa cccctggtcc agtcgctgaa     70560
     gctcctctgg attggttggc gactcgtcag cttgatcgaa cagcctccgg gcctcggcaa     70620
     ggtgctgctc aacgcccact tgcctggcct ggaccgcttg atcctcttcc aggccggcgt     70680
     cctgcacctg cggcaaagct gttacacggg atggattttt tcgctggtcc acattagcct     70740
     cgcatcaaac tgtatcgtca aagtcttgcg ccaatccacg cagcggctca tcgagtcgag     70800
     attctgcgga gaatccctcc tctgcttccg tcaagggtgc cggctccggg agggcgcctg     70860
     tctggctttc aaagatgcgt ttcagaatgc ggtccgaaaa atatcgcacc ttcctcagtt     70920
     gcaatggcgg cagacctttg atgagaacaa tctcgtactc gtcattgagc agccgaacct     70980
     gttcgggacg cagcagcggc gcaccttgaa acgaattctg aatgttccgg tcgaacgctc     71040
     gcgactggct gtaggaaatc gatttggctt caaacgtgta ttcaccgatg gctttggaaa     71100
     tgtagttcgg agtctcgtca tcggccgtgg ccatgaacac ttgcagtccg gtattgctga     71160
     gaaaattctg cttaccagcc tctccataag cccccgttag tgccgaaagg ctttggatga     71220
     tgagcatgaa acgccccttg tagcccgcga tagtcgtaat tgcggtctcg atcgcctcca     71280
     gcttccccaa gtgcttgaat tcatcgagca gaaagagaac ctcgtgcttt tcgtcctggc     71340
     ggggcagcga ccgctgtaga attgaaacga tttgctgaaa aaataagcgt atcaaaggcg     71400
     cgatcacctc aaggtcgttc ggaccaacgc aaagatagat gcacgttctg cgacggcgaa     71460
     gatcatagac cgaaaagtcc gagcgacttg tagctgcctt gacagccgga tccgcccaca     71520
     agttgagccc accatcgccg agcacggacg tgtaggaggt taggattttc gtgtcgttcc     71580
     ccgccatgtc gtcgaagatg cgttgtgcct ctttgttccg ggtctccatg gcgagctgcg     71640
     cgaagagctt gaacttctcc cccggctgag cgaacagatc atagacggcg ccgattgttg     71700
     gcgtgccccg ctcgatgcag gcaaggatcc ccgcgacaaa gatatctcgc gcgccggcga     71760
     cgaaaccttc cgccccctcc cccttggccg taatcaggtt cgcggccaag cggcgggctt     71820
     cggtgaattg ctgctgtgga tgcagtgcta tgagatccaa cagtggattg tagcagtttg     71880
     tgcgccgctc tgaatccagt ggcgcgaatt tgaacacttc gtggcctgcg gctttacgcg     71940
     ccctcgatgt gagctcaaag agctccccct tgacgtccag agctatcaca gagcctttaa     72000
     atgtaagtag cgttggaatg actatgccga cacccttgcc agcgcgggtc ggcgcaacaa     72060
     tgaggctgtg aggctgctcg ccattggtca ggtaatagcc aggccagaaa ggaccactcg     72120
     tcttcccgaa gaccggccct gtcacgccac ggtatcgtcg cagatatccc gtgcgtcgca     72180
     tttcatccac tcgagcccaa cgagccgtcc cgtgatgttc gagcttgcgg cgcaatacga     72240
     cctgctgaat cagcaagaca accgcggacg tcgagagcac gatagccgcg ccctgataga     72300
     aaacgggggt tgcgaaaccc aaatagaagg gcgtctcaaa ccaaaaggca cggacatcaa     72360
     acgccatcag agcctcgccg ctacccccgt ggcggaaggt tgcgtacaga cttgccgcac     72420
     agaaccccaa ggcgagtgag cacgcgatgc taatggctat gttgggggac gtcgtttttg     72480
     tagaagacat tgttccgtgg ccgaattagc ggtgctgatg ctgcgcttgc ttcagacacc     72540
     gaaccgaggt cgcgcgatgc cgacgctcga cagatcgatg ccgcagcggg tagtgcgatg     72600
     cttgcatcgc gccccccggc agacgtggat tttgaaagtt tcacgaagca ggtacgtcga     72660
     cggccagcga attggaaaca gcaaggccgt gaacggaatt catgagagga agcgttactg     72720
     ccatggccga gacctcaacg gccggtgcga tctctgcttc tcctagcctc cattagatcc     72780
     tctcgggcgt gattgtagga gtggcttatg tcccggccga cttgaccacc ccgctgcagc     72840
     tgttcgtggg aggtttgcgg gccaactgta tcacggactg cagccccaat acctgctatg     72900
     tgggcgtcca gatccgcact gcgttcctct gctgcatgcc gcggaggagg catctgcggc     72960
     aagatgtctt gcatgccggg aattgagtga gcttgggcct gttgatttgg atctaactgg     73020
     tgatacatcg cgtacatagc attggatgct gtcgacctga cgtggccatc cggatcggta     73080
     gccaattcag cggcctgatc aaaaatgcgt gctttatttt cagcgttaaa cttgctgaag     73140
     ttttgcgcag cgtaaagcgc tccgatagct tgcgaaggcg ggtccatgtt gccaatgcga     73200
     ttaacaatac tattttgtgt ctctggccga aggtaatgag acacattact gactgctctg     73260
     aattgctcca atgctacttc atccggggtg tgtcccaacc cggcagtcaa tttatccccc     73320
     agatcgacgg ctgatcgtcc aagctgattg gtccgcgttt caaacttcgc gaggtcagtt     73380
     tctggctcgg ttcgagtgcc ccgaacggct atgcgctctc gcctcccgag ttctttgaag     73440
     gtcccaagat ttcgcgctgt atcgcgcggg ttagcgctta ccagccgttc tgcaacatcg     73500
     gtcaatggtc cgtatggaag gtcacggagg gtactgcgat tccccacgtc ttgggatgaa     73560
     cttgcagctg cgcgtgcccg tttgttatcg cgatccattg ctcggcctcc aaagtcgtta     73620
     agttacccaa tcagggtacc accgacgctt gacctgctaa accgatatga ggttacagtt     73680
     gtagtctggc agaaacttct cccaactctg ggatacgccg agagccgtaa ccggggcaga     73740
     tttccgggcg gaagggtttg cggcgagagc gttcgtgatt caccgtttgc gtgacgcatc     73800
     aggatcgtct cgtataagag agtccgtcgc gatacgcccc gcgaatgacg atggtacctt     73860
     cggcttgact tatccttcgc gctctgcggg tccgacgaga aaatcagcct accttgctga     73920
     gactacctgc ggaggacttg ccgctacggc ggtcctgctc gatctcgtac ttgatcttct     73980
     gcccatcaac gaggtttgaa agtccagccc gttctacagc tgaaatatgg acgaaaacgt     74040
     cctgaccgtc gtcatcgggc tggatgaagc caaaaccttt ggtgctgttg aaccacttca     74100
     ctgttccggt cgccatatct gtgtattcct ctgtggccat gcgaaccaga cgggccgtga     74160
     agccgatcct gttcatattt cgtagagtta aacccagcaa aaacgaaaat tacaagccca     74220
     cctcggggtt gcggcgcgaa aagccattgc tctgtttggg aacgcaccga acaggtgccg     74280
     gtgagcttga gcgcaacgcg ctgcaagacg ctcgagtgcc gaggaatctc tccgacaagg     74340
     atacgtctga gccgcccagt atgccggctc ggcaaccacc cgaatggatc gaagccgatc     74400
     tgcaaaacgg atggcgagag cgttggctcg tttccaaccc atcctgtctc accagcgcgg     74460
     acgcctggac ggatgtcaac gccggaaaaa gaaccgcatc gattggtccc gcttgcggcc     74520
     agctccagtc ggccgctcga tcgcaagcgt ggttcgagga ggaagctctc ccaggtgcaa     74580
     tgcgaggaga cgctggtcca actccttgtc ggctgccgta aggcggtggt tcaggcgaag     74640
     gtagtccatc caggtcgggg tgcggaaggt ttctgtccaa cgcgaaggct gctggaggtc     74700
     gcgctggaga ttccagtgtc gcgcaccaac gccgctttgt actcgccgcc gttcccgcat     74760
     ctgctccagg aacgcttcga catttgcttc gggtattgaa tattcgatct tggcgacgat     74820
     cggcccgctt cggggcttca aatccagggc aacctgaggc gtttcgaagc caagaggagc     74880
     ctgatcggaa tctttccatt gacggatggg cagcaggaag ccggtgccag cgaccagcag     74940
     cagcgcgcca cctgaaagct ccagagccga gctcagcgaa tagctctcgg ccaccgtacc     75000
     ccacagccag ctgccagccg cgatgccgcc ggatgaaagg gcataataga tcgagagcgt     75060
     gcgaccaacg acccaccttg gactcgccaa ctggacgctt acgtccagcc cggtccaggt     75120
     cacgacccag cccgcgccgc cgagcgccag cgcgatagcc gccaccgcca ccgagggggt     75180
     gaaagcaagc gatagacaac aagccgcaca ggcgatgcac gacagtgtcg tcaaacgttc     75240
     ctgggacagc ctccgtctca gaatgttgtt gcagatgccg gcgaacaagg cgccggtccc     75300
     gaagccggcc atcaggatgc cgtaaacgac tggccctccc cccagctgat cgcgggcgac     75360
     gagaggcaag agcgctagta tggagatgct cgtcagccca aaaagggcac cgcgggcaat     75420
     tgctgccttg atttcggatg acagggcagt gaagcgcgct ccgtcatgga tcgccgtggt     75480
     caatggttca ctcggaagcg gtgacgagcg aacatgccat ttgcagcgcc ctatggtcca     75540
     cagcagcatc agatatgtaa gcgtcgccac tgcgaaagcc gtcaaagggc caaaggaagc     75600
     aacgacgacg ccaccgagag ccggaccgat gcttcggacg gcgttatatc cgaccgagat     75660
     aagcgtgacg gcggccggaa catcgcgctt tcgcaggata tcgccaaccg acgcgtgcca     75720
     ggcggggtcg gtgaaagcgg cgcctactcc ggccaaacag ctgaatgcaa gaaccatcca     75780
     tggattgaaa attccgagac ctgcaagaac agtcagcatc gtcgaggaca atgctatcac     75840
     gcaccagcca gcgaacatga gattgcggcg gctgtaattg tccgctaggg cgccggcgat     75900
     aattgacagg aggaatgtgg gcaaggttgt cgaagcctgc accaaggcga ccatcacatc     75960
     cgatgtcgaa atggtcgcca tcagccaact gatggcaacc atttgaatca gccaccctag     76020
     actggatacc tgtgtggcaa tccagatcgg acggaaagtt gaattctcga gcggcgcgaa     76080
     cgttgccgat gacaccggat taacttcttc acgcgccacc ccgctcattg ggccgagcct     76140
     cccttcgctg ccagttgtat gagatttctc cccgcccacg tgcccatgga ggaatggcag     76200
     gatcagggca ttttatccgc gcaacgcaag ttatttttgc ctggccgatg ctgtggcaga     76260
     accgaatgct tccggtggag ctatcgttcc gctatgcggg acgagaccgg ttcgatcctg     76320
     tcgctctcga tccccgacca cgttacaaga atcgtcagtt tgacgttcct tggcgtctcc     76380
     aaccaagcca cgtcctgggc atcgacttcc cttctggtga tcacgagctc ccgcgcattg     76440
     aaccgcctcg ccaaggtgga tcagtagtct atctttggcg taggtattca gcagcctgct     76500
     aggcgcccgc cgccacgtgc gggcgacgcc ggcatcaacc ggcgggcaga tgcgccgagg     76560
     gcaacaaccg cgcctgacgc aacgccgcca gatcagccga gccggtgcag aagcaggcaa     76620
     cggccaactg gcggatgacg atctcgaaat gcgcgacaac cgcctcggtg gacaccgtcg     76680
     ccgcgcgcag cacgccggcc gcctgcccgg cgatgtccgc gcccaggcgg atggccttgg     76740
     ccacgtcgac gccgtcgcgg atcccgcccg acgcgatcag cttcacagtt ggcagcgccc     76800
     gacgtaccgc ctgcacgctg gccggggtcg gaatccccca gtcggcgaac gccatcgcca     76860
     ctgcacggtc ggcggcatcg cgggcgcgct cgccctccac cgcggcccaa ctggtgccgc     76920
     cggcgccggc gacatcgatg accgccacgc ccgccttgac gagcgcgcag gccaccgagg     76980
     cggacagacc cgaccccact tccttggcca caatcggcac gtccacgctg ctcgcggcgc     77040
     gagcgatctg cgccaggacg ccgcgccagt cgcggtcgcc ctccggctgt accgcttcct     77100
     gcagcgcatt gagatggacg atgagtccat cggcctccag cgcatccacc gcccggcgcg     77160
     ccaggtccag gccgtcggcc tcgcgcagtt gcgcggcgcc gatattagcc agcaagggaa     77220
     tgtctggggc catgcggcgc agcgcgcgcg tcagcccctg ggagttgcgg gattgcaggc     77280
     tcacgcgctg cgaaccgacg cacatggcga tccccaaggc ttgtgctgcc tcgctcagat     77340
     gccggttgat ggcctcggcg cgtggcacgc cgccggtcat ggagctgatc agcagcggcg     77400
     cgcgcatggt cttgcccagc agcgaggcgc gcaggtcgat ctgcgtcagg tccaactcgg     77460
     gcaatgcgca gtgttcgaaa cggatgtact cccagccggc ggcgaccgtg gccggcgccg     77520
     ttcgccgatc cagcacgatg tccagatggt cgtccttgcg ccggctcggg atgttgtcgc     77580
     tatcgctcat gctcgctcca tccgtcgcat cgggggacgg cgttgcatcg gatcggaccg     77640
     acggcagcgc gcgcacgcag ccgcatcccg ccgttcaggc gggcgcacgc tggcctcccc     77700
     ccgcagcgtc gctgcggtag cggctggtcg aggtctggta gtactgcgcg cggatggccg     77760
     ccatggcctc gatcaacgct ccccacggcg ctggaaagcg ttcttccgcc atcacccggt     77820
     gcagcatgcg cgtatggccg gccaactcgt cgttgaggaa ctccaccaca ggcatagccg     77880
     gatagcgctg ccgcagcagg atcgccgcgt tgtcggcctc gcccgccgac ctgtccttgt     77940
     cgcgtccatg cagatcgttc tgcaggcgcc ctatcgcgga gatgagccgc aggacctggc     78000
     gaaacgccgg acgcgcgcgc aaggtcgcca tgtccagccc ccacagcaac gacaggcaac     78060
     agaacacgtt cgtgtaggcg atcgaatcga tgccgttgtg caggtactcg gcgtaggacc     78120
     agcgttccgc ccctaccgcc tgcgcgtgtc cggcgcgcag cgccgcgcag tagcaccgag     78180
     tgtcgtcgag cagccgagca tagtcgcgac gatcgtaggc gagcgcggcc agcgaagcgc     78240
     gcagcacagc gcagccctcg aatccgggga gcgcgcacgg cacgccctgc cccagcgcct     78300
     gctccaccgc ggcgagctcc tccggcgcga tcaggccaag gtcgttgcaa tcgtcgagcc     78360
     agaacagcag cgccagttcg cgatagaacg ccacgatcag cgtttcggcc tgcggatcgc     78420
     ggccagtgcg ggcgcaggtg tcgcgcaggc tcgggtggat gcgctgcagg atgtactggc     78480
     cgcccctgac cgcttccacg gcatgctcgt cggcgaaccc tgtcagggaa cgcccccact     78540
     ccagcacctg ctgcagcgcg cgttcggtct ggatcatgac gccgctcctg ctccctcggc     78600
     caggacgcgc cgcccccaac gaagcgccag ccacaacccg gcgagttcgg ccacgcggac     78660
     gacccgggtg gggcaataca gttccttgcc gatccacagc gccgtctgcg gcaatgcatg     78720
     cgccacatgg cgagcgagca tccactccag cgcacgcgcc accgcctgcg cgatgcgccg     78780
     gcgccctgtc ggctcttcgc tcccgtccat gacgtgcaac gcgaacagcg cataggcggt     78840
     ttcctcaaat gaggacgcgc gaccggcgcc ccagccgccg tcatcgcgct gcgcctgcag     78900
     cagcgccgcc agcgcgcgct cgtcgcgcca ctggggcttg ccttgcgcca gcgcagcgac     78960
     cgcatgcgcg gtgggataca gccacgaaac gtgccatttt tcgttgtccc atagaccgtg     79020
     cgggttgcga ttggcctcga cgtagtagct ggtgccggcg gcgggctttc ccaacagtcg     79080
     caacgcatgc agggcatgga tgttggtcga caccgaggca ttgcgctcgc cggggaaggt     79140
     gacgaatagc tcgccgattt cgaaatcgcg cagcgcatcg accggcgggt cgcgacctgc     79200
     aaggcgcagg acgcacaacg caacggaggt gtcgtcggca tcggctgcga agtgcaaggc     79260
     cgggcccaga ccgcgcacgc ccatgcgggc gtcgagctgc gcgacgatca cgcgcacggc     79320
     atcggcgaac gcgggatgcg cgaacagccc ggccagatgc agggtgtaca gcgaccagca     79380
     tggctcgaac acattgatcg gccagacgtt gggaacgaca ccttcgatgc cgctgcgcgt     79440
     cgcccgcgat gccgcctgca gatacgcgtc ggtgcgcccg acctgcggcg tgctcccatg     79500
     tgttacggcg tgcgcacgcc acgcggcggt ggccgccgga ctgatgccaa tgctgccgtc     79560
     gtcgtcgggg catgcggtgg tcggcgacgt tccccaggct tcccaggagt gcagcaacgg     79620
     atggccgctc ggcaacgtcg ccaccgcccc caacttgaca aggcacgcct gccgcaacgg     79680
     caacagcgcc gggtggcgcg gaaaccccac gccgcccagc aaggatgcgg cctcgccgca     79740
     caactgcggc aggatcagct ccgcgccgat cggcgcgtcc tccggcaccg aatgcgcgta     79800
     gggatcgggc tggcgctcga ggaaccgggt tgcagcctgg actgcgtcgg ccgcgccggg     79860
     aagaggatcg gcacgctgca atgtcagcaa cgccgcccag gtgggcgcat ggcggaacag     79920
     cgggaagtcc gcgcttcccc atccgccatc ggcctgttgt tgcgcgatga gccacgcgta     79980
     tgcgtcctgc cgaccggtga cgttgccgtg gaactgcaga gctcgcgccg tgtcgtagac     80040
     ggacggaccg acgctgccgc cgtcgctcat ctcgatcagc aggtggcgca attcggaaag     80100
     gatctgttcg gacagcgcgt tcacgcggta tgttccttct gcagacagtt gacgggaacc     80160
     tggatcgggc agacgccgcg cacgtcgccg caggcccgtc gcggcccggc gcacgggcag     80220
     cgccggacgg ccgccctgct ccggcgcggc gacgcgcccc atgctggggc cggtccgccg     80280
     cataggcttg cgcgcagcgc gccgcgtgag ccgcggccgt gctgggcaac cgctgcgatc     80340
     gccgccgccg acttggacac agtgcagcat gcaccgctca cgccggccga tcgatcgcag     80400
     cggcacaggg gcgactccat gcggacgggc gcgctcatgc gcatggcgcg tgcttgaaca     80460
     gatacgcgtt ggcccgctgc agcatctgcg ccaaccgttc cgcacgcgtt cccagcgggg     80520
     cgatggcctc cccggcgtcg cgcaacagat ccagcgccaa ctggcgcgct gcctgcagcc     80580
     ccatgatcga cgcacaggtc ggcttctgcg ccgccgcgtc cttgccgggg gtcttgccca     80640
     acgtcgcggt atccgctgtc gcgtcgagaa tgtcgtcgac cacctgtaac gccaggccga     80700
     aacaggcgga gtagcgatcg agcgcacagt acagcgcagc gtgggcggca tcctccgcga     80760
     tggcgcatag cgcgcccatg cgaacggacg cgcgcactag tgctccgctc ttcatccggt     80820
     gcatcgccac gatcctgtcc agctcgacgt gctttcctac cagcgacaga tccatggcct     80880
     gcccgcctgc ggcaccctcg gcggacaccg cctgcgccag ttcgcgcacg agcgcgatac     80940
     ggttgtcgcc cggcgcatcc aggctcgcca gggtcaggaa ggcgtgcgcc tgcagcgcat     81000
     cgccgaccag gatcgcagtg gcttcgccga acttgacgtg cacggtcgga aggccgcggc     81060
     gaagcacgtc atcgtccatt gcgggcaggt cgtcgtggac cagggtacag gcgtgcatca     81120
     tctcgatggc ggcgccgaca tcgtcgagca tgggcgccgg cgtgtcggcc agtgcgccgg     81180
     tagccagaca gagcaaggcg cgagtgcgct ttccgccatg caaggtggcg tagcgcatcg     81240
     ccgccatcag ctcggtctca ccgtcgtctt cggcgcagag aagacgcgcc agcgcctgtt     81300
     cgacccgcct tgcgccgtcc tgcatccaga tctccggcgg cagcctgccg gatgcgccac     81360
     gcgcctgcgc gtcgtcgtgt agcgtggaat cggtctgcat gtcgttcatg tccttgtacc     81420
     tggcacggcc acggcgagcg tccgagccgc cgcggtgttg gcggcgtcgc accgagcgcg     81480
     cgcgccaagt gcagcattgc cgcgcgtcgc cggcgcagct gcctcgccac acggggcatg     81540
     cgatgccagc tcatgagaat ccgatgcgga ttttcatgga cggatgtgcg gtcgggaaat     81600
     agcgccgacc tttttcgacg gcgctcagca accgcggccg caccccggcc ttgtgcatgg     81660
     tcagtgccaa ggcgatgcag aactgcacca tttccagcca taccaggtgg taaccgatgc     81720
     agacgtgtgg gccggtaccg aactgcagca tgtccaccgg ccggatcggc tccgtgcgtt     81780
     gcagccaccg tgccaggcgg aactgatcag gcgcctcgtg cagcagcgca gaggtcgaga     81840
     aatgcagcag cgggatgcac agatgggtgc ccgcaggaat gcgccgttgg ccgagttgca     81900
     attcctgcag cgcgcgacgc ggcaggagcg tggtcgccgg atgcacgcgc agcgtctcgc     81960
     ggaacagcgc ctcggcgacc ggacactgcg ccaggtccgc gtgccgggtc ggcaccgcgc     82020
     ccacgcgttg cgcctcctcg accagggcgt cccacagccc aggctgccgc gccagctcga     82080
     tcaccatcca ggccatcgtc gaggcggtgg tgtcgtggcc ggcaagcagc agcaagcgga     82140
     tattggcgac caggacgtcg tcggagagcg catcgtcgcc gcgatcgaag gcgctcacca     82200
     tgtcattgat caacccagtg cgcgcggcat gcgcgcgcgc gtcgcggacg aactggcgca     82260
     actgcgcgtc gatccagtcg cgggcggcgc ggccgcgccg caaggggagt ccgggcaggt     82320
     cgaccggggg cgcgacgatc aactgcagca gttgccggta tttgcgatgc catcccggca     82380
     agtcctgcgc tgggattccc atgaggctga agatgagctt gagcatcagg tcgccggtct     82440
     cgcgcaggat ggttacgtcg ccgcggtcgc gccacgcctg cacccgcgcc tggatgacgg     82500
     gcgcgaacag gttgccgatg ccggcttggg tcagcccctt gggcaggaac gccgccttga     82560
     tcgcgtcgcg cgcctgccgg tgcgcgccgc cgtcctgggc gaccaacgtt ccgccaagca     82620
     attcgggcgc gatctcttcg atcagcgccg aggacacgtc cttgtgccgg agcagtgcaa     82680
     acgcatccgg atccacgcag gtcatcaggt gtccggcagg gccgaaatcc agccagaagt     82740
     ggctgcccaa cgtccgttcc gcgcgccgca gcaggcgcgg caggtcgcat acgatggcgg     82800
     gaagatgtcc gaccaggggg aaagcgccgg gcacgaccgg gatgtcgtcc cgcagccggt     82860
     gccgacggtc cagcgggttg agcagcatgt ccatcagcag cgcggccccg cggccgcttt     82920
     ggcggtgtcg ccggcaggcc gcgcggcgcg gctgttgcca ccgtcggcgt acgtcggcac     82980
     atgcgccagc atgccgccgt cgatgcacag gacctggccg gtgatgaacg cagcatcgtc     83040
     ggagagcagg aacgccacca gcgcggccac gtcctcgggg cggccgacgc gctgcaggag     83100
     ttggtgccgg ctcagatgcc gttgcatgca ctcgtccagc ttggcgagga gacgctcggt     83160
     catgatgaga cccggcgcaa ccgcgttgca gcggatctgc gcatgaccgt actgggtggc     83220
     gagcgaggcc gacagcatgt tcatcgccgc cttcgacgcg gcgtaggacg tctgcgcggt     83280
     gtcaccgctg agcccctggc acgacgacat gttgacgatc gcgccaccgc cgcgggcgat     83340
     cattcgtggg atggcctgcc ggcagcagag cagcgtgccg cgcagattgg tcgccatggt     83400
     ctgatcccag accgccaggt ccaggtcgag gatcgtgcgg tcgcgcggtg tcagatgcat     83460
     ggcgctcgcg ttgttcacca gcaggtcgac cccaccgaag tgccgctccg ccgtctcgaa     83520
     cagcgctgcc accgcctgcg catcggcgat gtccatggcc agggccagcg cgtggcccgc     83580
     ttcggccgcg atctgcgcgg tgcaggcgac ggccgccgag ccatcaatgt cggccaccac     83640
     cactctgccg ccctcgcgcg cgatggcgag ggcgcatgcc ttgccgatgc cggcgccggc     83700
     gccggtcacc acggccacct tgccttcaaa ccgtcctcct gggttgcgtt ggtctttcgc     83760
     ggcatgccgc tcagcctgcg ccggagaagg cgcagggtcg gcgctggcgc gctcgccagc     83820
     gtcgctttcg atgacccgaa tggcggcgac cggacactgg ctggccgcga gccgcgcggc     83880
     ggcgtgcagc gcctgcggga ccgtcgccac gcacacttcc gccacgccgt ccggttcgcg     83940
     ctggcgaaag gtgcccggca gcgtcagcac acactgcccg gtggttccgc atagatcctg     84000
     atcgatcacg acgcgcatct cagcccccct gagcatgcag tcgcaccggc agcgcgcgga     84060
     acgtcctgag gaacgcggat ggctcccggg tcggctgctc ggccaatgcc agcgtgggga     84120
     agcgcgcctc gatccgcggc aggctctcgg ccaactgcac ccgggccagt tgcgcaccga     84180
     ggcagaagtg gatgccgtgg ccgaagctca gcatgatctt cccatcggtc gacatgccag     84240
     gagtggtgcc gtagaaccgc gcgggattga agcggtcggg atcggcgaag gcgtccgggt     84300
     cgcgattgcc ggccgcgatc agcacgcgca cgtccgcgtt cttcgggatc accacgccgc     84360
     ccagttcgat gtcgcgctgg gcgatacgcg gaatggagct gaacatggca ggcgcgtcgc     84420
     agcgcaggac ttcttcgacg aatgccttca cccccacggc gtctccctgc agccagtgcc     84480
     gctgttcggg atacgccagc atcgccagga ccgcatggtc gatggtcgca gcagtggtgg     84540
     cgaagccgcc cagcagcatg ccccacagca tgctgatcaa ctccgcatcc gacagcgtgt     84600
     cggcatcctc gtcgtgtgcg ccgaccacca tcgacacgat gtcgttgcgg ggatcagtgc     84660
     gcttgcgctg tatgagatcg ccgaagtagg tctgcaccct ggcgctggcc gcgtccgccg     84720
     cggcgagctg gggatcactg gcgcgtgggc tcaggccttc cagaatggcg ccgatgccgg     84780
     cggccagccc gaacatgtcg tcctggggca tgccgaacag ttcggcgaag accagcatgg     84840
     gcaaggccag cgcgaattcc caatgcaggt ccaccgcatc cccgcgctcc agcgcgggcg     84900
     ccatgccgtc caggcgcgcc gcgacgatgc gcgcgatgct cggccgcagg ttgtcgatct     84960
     ggcgcatggt gaaatcgcgc gagatcagcc ggcgcagacg cgtatgcgtc ggtggttcct     85020
     tcatcgctag cgtggacgcg aggagattga gtgacaggct ggtctccgca cgcgggaaat     85080
     agcgcgccag ttcgcccggc gccggtcccc gaaacacatc gcccgtggcc ttgagcgccc     85140
     agtagatgtc ggcgtggcgg ctcaacagaa agaggcccga cgccgcacga tgcaccggat     85200
     cgtgctcgcg caaccaccgc atgaacgtat acgggtcttg gatacacgct ggcgacgcaa     85260
     gttcggcgaa ggcgtcccgg catgctgccg tggtttcttg cacgtccatc ttggttacct     85320
     gttggctggc tgatctgacc ggcgcgtgct aggcgcgccg gcaaattgcg gagaagatcg     85380
     cgattccggg cggcgtccgc gcgtcaccag agcaccggga actcctcgaa cccgccagtg     85440
     atgatctcct tgcgcaactt cagttcttcg ggcgccacgg ccaggcgcag cgcgggaaag     85500
     cgctggaaga tcgagccgac caccaccttg agttccagcc tggccagcgc catgccgatg     85560
     caatagtgcg gcccgtgcga aaacgtcagg tgcggatttt cgtcgcgtcc gatgtcgaag     85620
     atttccgggt cgtcgaaatg gcgcggatcg aacgacgtcg ccggcaggcc gaccagcacc     85680
     ttgctctccg cgggaatatg cacgcccgcg atagtcacgt cggtcctcgg atagcgcatg     85740
     atgccgtccc agcccgcgcc cggcgggtac atgcgcagga tttcctccac cgccttgtcc     85800
     accagggatg gatcgccgac taggcgttcg cgctgttgcg gatggcggaa catggccagc     85860
     aggccgaatt cgatctgcgc gacggtgctc tcgtgccccg ccaccagcat gcccgccgcc     85920
     aggccgatcg cctcttcctc ggtcgcattg ccctgctcga ccgccgcgag cagatccgtc     85980
     agcaggttgt cgcccggatc ctggcgcttg tcccacatct tgccgcgaat gtaggcgcgc     86040
     agttcttccc aggccaggcg cgacgcgctg cgcgggccgc tttcatgctg gtgcgtcatc     86100
     acttcgtcgg acagcccggc gaaaaaggcg tgatcctcgt agagcacgcc catcagcgcg     86160
     ctgatgacca tggccggcag cggaaaggag aggtggcgcc tcaggtcggc gggctggggc     86220
     tgggccgcca gcgtctcgaa caattgcgcg gcgatcgcct cgacctgctg cgcgagcagc     86280
     ttcaccctgc ggttgctgaa ggccggcgcc acgatcgtgc gtaaccgggc atgctcgccc     86340
     ccctcgtgcg agaccagcca ccccggcgaa ccgagaatca ccgaatccgg ggtgaatgcc     86400
     gccggcggca ttcccgcggg ccggaacgcc gcgtcggaca gcgccgcctt ggcctcgtcg     86460
     tagcctgtca cccaccagcc ttcgtgcccg gacgggaagc gtacgcggtg gatcggaccg     86520
     ttggcgcgta gcgccaacat ctcaggcgag ggctcgatgt gatcgacgcg ccacatcggc     86580
     agcgtcggca agggttgttc ggacatggtg gcacttcact ctctaagcga tggaagggcg     86640
     gaaggcgctg cgggcagcga atgattacga cggcacgtag acgtcctccg gggagtagcc     86700
     cgactcgatg tcaagatcgg ccaacgtgta actgtctagg cataccgcgc ggcgagatgc     86760
     agaactttat cctgcgcctt cgagttcagg attaaggcga gtgtggtggg cccttgagtc     86820
     gcagccggcc atcaagattt cctgcgcaag cgtcgacaag gttggcagcc tgtttgggta     86880
     cgggcggttt cgccaaggcc cccttgccat aggatgctat ctgatgcgga tttgacatta     86940
     tgcttttctt tcttcgttcc atcgatcgcg gtgtcatcca cgaaatgaag atcggtcgtc     87000
     ggctcccggc tcccaacgaa ggagtttcaa aactcgtgcc aatttggccg acccagcaga     87060
     agaaaaacat tgtgattgct tttcagggga ttagcctgag gcagacaaga gctcgatgaa     87120
     atagcccggt gtcgcggacc caacaaaggc gacaaaacag tgtcggatag tatacggtcg     87180
     tcagacgcca gaccggcgac accttcttta ttagttgtcc tgtcgtggaa tgatggcagg     87240
     cgacctgacc gtattgcccc ataggagggg ctcctggttg gctcaggggt cacgtgcttg     87300
     ctccgggcgc gctcgaggcg gcttgcgggc tcgttgccaa tgcaacacag gcgatccgca     87360
     acaccgccat ctggggcgaa gccggcacgg cccaagaagt tcggcgcttg ggacggcaac     87420
     ctgatgacgg aatggcatgt ccgctatggc ggtcgcgccg tgatgatcta ctggcatgtc     87480
     gaaaagggct cgacctgcat tttctcgcag ctcaagcgct gttcgtcttc ggaggtcgcg     87540
     gcgatgacca aggtcttgct gcgacattac accaacgtgg agatccagcg ccaatatgtc     87600
     gacagccatg gccagagcgc cctcggcgtc ccttttgccg cctgctcggg ttcaacctgc     87660
     cgccacgcct gagggcgatc gcctggcaga agctggcgct gccaggcctg cgcgctgaat     87720
     tgccaaatgc ttcccattct ttccaaggtc ctcacttggg aggaggtcga gcagcagtat     87780
     ggccacagtc aatctgggcc ggccagaacg acatcggaat agcgtccggc cttcgttcat     87840
     ctcgaagaag ggatgaccga ccggtccgtt tttcgcgcat gcggcagctc cattgcgatc     87900
     gcggcaattt ggattggcgc gggcgccatg tgctccgacc ccgaggggct gtcccggtcg     87960
     acaagagcca tcgctcagcg gcgatcaagt catcggcttt cggaatgacc ggcgacgctt     88020
     ggtctcaacg actacgccgg tcgggctgtc ggccgtattc ttcgccttga acacggcggt     88080
     tcgcttcggt tttggtttgg gtagcgcttg aggctctgcc cttggctccg gcgtttgctt     88140
     gctcttttgt ttgtccttgc gggcgcaaag taaagccttg gcggtcgccg cgtccgcatc     88200
     cgagaccatg ccggccggct tgccattgag atcgatccgt gcggcgccgg catccagtct     88260
     tgccaagtat ctggccatct tggtatacgc cagcagggct ctcctcaatt catcatcaga     88320
     cagttcgccg tcgagcactc gaatgtcacg atggatgccg atcttgagcg gcctgggcgc     88380
     tttcggattg aacgccgcag gccacttggc cgatagatag cggaaaagct gtgcaggcga     88440
     tttgcctcgg ctacagctca acatcataag cctcgcccca ttttttcgtt tccaatttgg     88500
     accttcctag cgctgatata tgcaatgatt atgggaaaat gggcattcgc cccgcagggc     88560
     aaagcagcgg ccgcctcctc attcggacag acgaagtgcc tggtggaccg agcaggatcg     88620
     gcaccaatca cgccgagccg tccggattaa gttcacagcc atacagcagg gtcggtggaa     88680
     cgctgtttcc ccattctccg ccaaccattg acccttggcg gcgcatctga aacgccggca     88740
     gcgaaaagac tccctccgct gagggccgtc ggcgagtagg acccgaaacc gtcgcggctc     88800
     ccctcacccg ttcggccgtt ccgtagtacc agcgcgtcgc gcagcgcgaa agctattcag     88860
     gcgaccgttc cgtgatctcg gccggatcga cgccgtcctg ggacaggaag gcaggcgaat     88920
     ggctggcaaa aagcgttccg ccgtaaaccg gcgtcggtca ccagaacctg gcggaactgc     88980
     cgggcggcgg cctttccgga atagctgccg ccgatgacaa ttggcgcagc gaaattcgga     89040
     agattgcgag cgacaggctt cggactccca ttcgattgcc gactcggctc atgcattggc     89100
     gggcactgag aatgtttgca catcacgttg atggttaccg ccatggagat cgcctcagaa     89160
     gcggcgccca atcggaaaca ttagcacctg cgcgttttgg ctcggctgct tgaactcctc     89220
     gacggcaact gcctcaatta gcagatccaa ggcttcgcgc cccctctggc tcatcgggtc     89280
     atcgcctcgc agataatgat acgctcgatc tagatgcact cgcgcggcag aaaaatcgct     89340
     tgtcatatga ccctctcagt tgccgcccgc gttagccgtc tacgaggtga gggtcacgca     89400
     atcgtcaata tccacagacg gatttgattt aaatcgcaga tgatccggga gaaaccaaac     89460
     accggcttgt cctatgcgag tgccccttga ttatgtcgcc ggcggcccgg tggactctgc     89520
     aatagggttg ctaaagcgag cctgccaata tgtccccagc atcctccaat aagccgtccc     89580
     gagtttctgg tcagtccagc acttttgcgt ccgacgctgg atacggcgat ccacgtggtg     89640
     cgcgcgtcct gcggctggca cttgccgatt atctagcaag cgatcgtgga cttgcggcct     89700
     cgcctgatga gatactggtg acaaggggca gccagatggg gctgttcctg gcagcggctg     89760
     cggttattga ccctggccaa gccattgccg tggaggtgcc aggctatcct ctggtggacg     89820
     gcgtttcggg cagcaggcgc cagaatcatc gccgtaccag ttgacaccca gggtatcgac     89880
     gtcacgcaac tcgaaaatat cgcccagcag gaaacggccc cgaaagcgat ctatgtcacg     89940
     ccacaccatc aatacccgac gctcggtgcc ggtcgccggc taaaactgct cgacatcgcg     90000
     cgaaagcgtg gactggtcgt catcgaggac gactatgatc acgaataccg attcgaagga     90060
     cgacccgtgc tgccgctagc cgcacgggcg cacccggaac agcccaccgt ctatgtcggc     90120
     tccctgtcca agctgctcac acccgctatc cggatcggat atataaccgc gcggccgaac     90180
     atcctggcgc gtatagccga ccggcgagag gccatcgacc gccagggaga tttcccactc     90240
     gaacaagccc tggccaggct gattggagac ggagtgttgc aacggcaccc gcaaggcccg     90300
     acgcatctac gcgtcgcggc gtgatctcct ggccgaggaa gccagccggc atctcggcga     90360
     cgatgtcatg ttcgacctcc cggcgggtgg cctggcactc tggttgcgcc tgcgaaacgg     90420
     gctgagcggg gaaacctggg ccgcgaacgc ggccagcgcg ggccttgcca tcacgcccgg     90480
     gattcgcttt gcactcgacc ccgcgaacgc gcccgaggca ttccggttcg gctacgcccg     90540
     tcatgaaagc cgaacttcag cacatcgttc aactgctttc gcgcacgcgg ccgagccgat     90600
     agcggtgcag ctcggccgag agaaaaaatc ctgtcagtct ttccagaagg ttcctaggca     90660
     tcttcgtcac agcccgaatt tgctcggccg ccctgcgata ctcattcgat ttagggcctt     90720
     tgccccaatg aacccgcccg cagaccacgg tcggcgtgtc gggatttcag atagccacca     90780
     cggaggcgga aagatatccg gtcgacttcg tgcgtattat gacctcctgt ttcggtggaa     90840
     ttggctttgc ctccttgcga caggaccacc gcatggtgcg cctcgacctg ctgagaacgt     90900
     tattgtcgcc atgcgcacaa ggtcaacttg gccgttctga aaaactctaa tacgggatca     90960
     acattgttgt atcacgccat tggtgtggct ctgtcatcct gcgcgccgaa atgcggccgt     91020
     cgctcgaacg atatgtggag ttgcttctcc aacagaaaat ggcgagccag atcggtatca     91080
     cgctttccga tccgtgacac ccattccgaa aacaggcgaa ccgcgcgccg gttcatatgc     91140
     cgcgaaggac agaccagcca atagcccgga aactctatga cgtcgaactc ggttgagacc     91200
     ggcaccaggg agcccgacac caggtcctcg aatgcgatcg atgtgctctc caggaccacg     91260
     cctgccccat ccttagccaa ctgaaccgac atcgatgaac ggtcaaaacg atagggatag     91320
     gtcatgcggg ccccctggat ggcgttgcgc ggcagccagt aatcccaacg gaaataggcc     91380
     ttcacactgt cgatcaatcg cgcatggcga agctgctcgc gcggatccgg cgagatcgcg     91440
     tgcagttcgg caagatagga aggcgagcac atcggcagga tcaagtcgtt gacgacgcaa     91500
     tcggaataga ggccggccca gccgccgtcg ccgtaacgaa gatcgagatc gatgacctcc     91560
     gtttcgaagt cggagaagtt gggtgtcgcg tcgacccgca aattccagct cggatagtcc     91620
     ttgctgaact cggccaagcg cggtgccagc cacttctcac cgaaagaagg actgacacgg     91680
     atgctgagct ggaagctctc acgctgccgc acgatggcgt tgcgcacctc gcggatggat     91740
     tcgaaagcct gggtggtggt ctgaaagagc cgctcgccgt cgatcgtgag cgaaagatga     91800
     cgcttctcgc gttgaaaaag ccgcaccccg agctggtgtt cgagcaaccg cagttgctgg     91860
     ctgaccgccg aaggtgtcac gcgcaattcc tgcgcggcct tcgccacgcc tccgagacgc     91920
     gcgaccgcct cgaaatgggt catggaattg aacttgaaat ccgacatcgt gctcgtcagt     91980
     taagcttagc tacacaaaat gttaagaaac gagaattgag ccgaatgtca atcggtcgca     92040
     tgatccttcg gtattgggag gagatagagg atggaaccgg gttcagctca aagcttgggc     92100
     actaccggca atttaccggg cgttgggctg gcatcagcca ggaagacgct gatcgaagct     92160
     tccaacgtcg agaagagcta cggcgcgacg cgggtccttc ggggcgtcag ttttcaggtc     92220
     cgggctggcg aaatccatgc gctcctgggc ggcaacggcg ccggcaagag caccctcatc     92280
     cgcatcatca cggggctgac ctcgcgcgat gccggtggga ttgacctgcg ctcgtcgaag     92340
     gccgaccgca ccagcccgat catcgctgtg gtgcatcagg agctggcgct gttgcccgag     92400
     ctatcggtgg cggaaaatat cggcattgtg catgccaggt caggctggtc gctgatcagc     92460
     cgtcgccgca tgcgcgaaat tgcgcttggt gcgctccgcc tgatcgaccc agcgatcggc     92520
     gaagaaatca tcgatttgcc ggcacgcaaa ttgtcgcttc atgagggcca gatcgtcgag     92580
     atcgctcgtg cgctttctac tggagcggaa gtgctgcttc tcgacgagcc cacggccaat     92640
     ctcaccgccg gcgagacggc caaactcttc tcggtgctga agcggctggt gcgcgaggaa     92700
     ggcatcggca tcgtctttgt gtctcaccgt atgcgggaaa tccgagagct ctgcgacgtc     92760
     tgcactattt tgcgcgatgg cgtcaccatc gcgaatgccg cgcccctcgc ctcgctcagc     92820
     gacggggaga tcgtccagca gatgggacaa cccacgcagc gtcaggccac gcaccgcaac     92880
     ccgcagcaga acccccgcca gggctcacca atcgaactcc ttggcccagg cgacgtccgg     92940
     atctcaattt tgtccggcac catcctggga ctggccggcg cacccgcggg tccgaccggt     93000
     ctcattgctg cccttgtggg cgcgggaccc ggcgctggtt ggcgcctctc cggcgaaggc     93060
     ttcggggacc gcttcccgtc cccggcggca gcggcgcgcg ccggcatagg ctttgtctcg     93120
     ggcgaccggg cgaccaaggg tatcctttcg cagcttccga tcgtcgacaa cgtgctcgca     93180
     gcgcgcaggg ttcgcgagag gcggcggatc gtcgccgcgg ccgagaggca ggaatgtcgc     93240
     gatctcgtgt cggcgctgaa gttgaaagcc ggctcgattt gggacctgcc ggcctcgctg     93300
     tccggcggca atcagcagaa gcttctggtc gcacgcttgc ttgggctgcc gctgcgcatg     93360
     gtggtgctgg aagagccaac gcgtggcgtc gacatcggca ccaaacatga catttacggc     93420
     ttgatccggc agatggccga cgccggcgcg atcatcatct ggtggtcgac cgagaacgtc     93480
     gaactgctcg agctttgcga cgccatcttc gccttcgaca ccgatgggcg gccaaaggga     93540
     tttctgcctg aggatcgcta taccgaaggc gggctcgccg aactgacggg gatggccgca     93600
     tgaccgacgc aaccaacggc accacgacaa ccaacaagct ccggaccacc aggttccgcg     93660
     tcccagcagt tctcttttcg taccgcaccg aagtcgcgat tgccgcggca atcgtcgtcc     93720
     tgctgctggc cgtcggcatg ttcgtgcccg ccgcactcag catgggcaat ttgcaaaaca     93780
     ttattcaggc cgccgcgcct ctaatcatta tgtcgcttgg tgttttgctg gtcgttgtca     93840
     ccggcggcat cgatctttcg gtcggctcag ttttctccct caccggaatg gtaaccgcgc     93900
     tggcgatggc cagtggcgct gatggactga ccgcgagcgc tgccggcctg gcggtcggcc     93960
     ttgtgttcgg gtcgatcaat ggtcttctgg tcacggtcgt tgggctcgcg cctttcgtcg     94020
     tcaccctcat cacctacgcg gtggcgggca gccttgcctt catcgtcacc aatggtcgct     94080
     cgatgccgat cggtgcgccg gatttctggc tcctaaattc gggcgagatc attcccggca     94140
     tacccaacca tcttctgttc tgcatcgtat tgatggtcgc gctggaatac gtgctgcgca     94200
     aggtcgtcgt cggacgctgg ttctatgccg tcggctcgtc ggcaattgct gcccgactgc     94260
     tcggcatccc ggttctgcgc atcaagttcg cggcctacgt cgcatcgagc ctgcttgcct     94320
     ctttcgccgg gctgctgacc gttagttaca tccttaacgc cgaagccacg gccggcgcca     94380
     gcctgatgct gcaggcgatt gccgccgtcg tcatcggcgg ggcaagcctc tttggcggga     94440
     cgggcagtgc gatcggcgct gtgctcggcg cgctgatgat cacctgcatc cagaacggcg     94500
     tgaacctcat cggcgtgaac agcttctggc aggggtccgt cacaggcgcc gcaatcctgc     94560
     tcgcggttct gatcgaccgc ttcagcaaca agaaccgaat ctagatcatc aacgggagga     94620
     accaaaatga aaatgaagac aatcctgctt gcagcattgg cagcggccgc actgtccagc     94680
     gcatcatacg ctgaagacaa gaagaccgtc gcctatatcg ccccatcgct ggacatctct     94740
     tactggcaat gggtcggcta cggcgtgaag gagaaggcca aggaactcgg catggactat     94800
     gtcgagtata cgtcggagaa ttcgcctgcc aagcagatgg acaatgccag gacagccgtc     94860
     accaaaggtg tctcggccat tgtgatcggc cctgtcagct cgacgtcgac accaccgctg     94920
     ctcgactatc tggcgaagca gaaagtgccg atcgcctttg ccggcatcgg gccacagccg     94980
     ggcctcacga actatacgtc ctcggtcacc gcgaacaact atgagaccgg caaagcgcaa     95040
     gcgaaattca cctgcgagct cgccaaggag cgtggcagca agaaggtcgg catgctgtcc     95100
     ttgccgcagg atcgggagaa tgcgcagaag tacctcaaag gcgccaagga ggcgttcgcg     95160
     gctgcaggct gcgacctcgt ccaaatgctg gagacgcggg gcctgacgat cagcgaagct     95220
     gtaacccagg caaatgacct cttgacggcc aatcccgaca tcaaggccat ttacggcatg     95280
     tatgacgaag ctggcaccgg ggccgccaag gtggtcgaaa cccgtggcct gaacggcaag     95340
     atcggcatta ccgtcgccga cggctcgcca accacgattg cgctgctcaa gaagggggcg     95400
     atccagggca tcttcttcca ggaggctgtg ggccaaggta tcgacggaac ccaacaggtc     95460
     tacaacgcac tgacgggcgc gccggtgacc caggacatgg cattggtcat gcctcttgtt     95520
     accgccgaca aggtcgacag tcctgaggcc aagaaggtca tcgcccgcgt tttccccccg     95580
     agcaactgac cgccacccag tggacccgcc ggctagctgg cgggtcctga acccgagcga     95640
     ggaatcccga ccgtggccga gctgccgttc atcgatccgc accatcatct gtgggacctg     95700
     gagaccaatt actatccctg gctgaccgac ggggttaagc cgtcggtttt cggtgactac     95760
     gaggcgatcc gaaaaagcta ccttctcgat gactatctgg aagacgctag gaaccagaac     95820
     ctggtcaaat cggtgcatct cgatgtgggg ttcaatccca gcgatccagt gggggagact     95880
     cgctggttgc aggagatcgc gaacaagcgt gggtttcccc acggcatcgt cggttatgcc     95940
     gacctctcca aacccgatgt gggcgacctt ctcgaccagc acatggagta tccgaacttc     96000
     aggggtatcc ggcagtcgat gaattaccat cccgactccg ccaagacgta tcaggcccgg     96060
     cctgaagtga gccggacgcc acaatggcgg ctaggatttg gcgaattggc gaaacgccgg     96120
     ctgagtttcg acctgcagct ctattatccg cagatgggtg agttccttga gctcgcgcac     96180
     gattttcccg acgtccagat catcctcgac cacaccggaa tgcaagttga tggccctgaa     96240
     catttcgggg catggagaaa agccatgcac aagttggcgc aggcgccgaa cgtttcctgc     96300
     aagatctcgg gtctcggcat gggcgactgg cgatggacca ctgcatcgat ccgtccctat     96360
     gtcgaggaag cgatcgccgc gttcggcgtc gaccgcagca tgttcgcgac gaactttccg     96420
     gtcgacaagc tgttctcgag cttcgacgcc atcgttaatg ccttcaagga gatcacgaag     96480
     gcttaccccc atgagcagcg gcttgcgttg ttccacgaca acgccgcccg gtactaccgc     96540
     ctttagacca ttcgtcgcgt aaacagcagg agactttgac atgttgctga agggcaaggc     96600
     cgcggtgatt tcgggtgccg cgagccctag aggaattggc cgctccacgg caacgctgat     96660
     ggccgagcaa ggcgcgcgca ttgccattct tgacctcgat gagggacaag cccgtgacgc     96720
     agccgcgtcg cttgggcccg agcacattgg tctcgcctgc aatgtcgccg atctcgatgc     96780
     ctgcaagaaa gctgctgcgg aagtgactga ggtcttcggc aaggtcgacg tgctgtgcaa     96840
     cattgccggg atcacgcagc cagtaaagac actggatatc ggccccgctg attgggaccg     96900
     gatcctcgat gtcaatctgc gcggcgttct ctatctcagc caggccttca tcccgcatat     96960
     gcgcgagaat ggcggcggat cgatcatctg catgtcgtcg gtttccgcac agcgcggcgg     97020
     cggcatcttc ggcggcccac actattcggc cgccaaggcg ggcgtgctcg ggcttgccaa     97080
     ggccatggcg cgcgaattcg gacccgacgg catccgcatc aactgtgtca cgcccgggct     97140
     catccagacc gacatcaccg gtgacaaact gaccgacgcc atgcgcgccg atatcatcaa     97200
     gggtatcccg ctcagtcggc tgggcgatgc ccgcgacgtg gcgggcgcct atctcttcct     97260
     cgcgtccgat ctggccagct acatcaccgg cgccgtcatc gacgtcaatg gtgggatgct     97320
     gatccatggc tgaagggaca acggagatcg atatgcctcg ggccggcagc aatgtcggcc     97380
     ttgccgaacg tgcctatcgt atccgtcggc atgccgtgcg catgggtcaa gtccagggcc     97440
     agggctatgt cggacaggct ctgggggtcg ccgacgtgct cgccgtcgcc tatttccatg     97500
     cgcttcgtta ccggcctacc gacacgcgtt gggaggggcg cgaccgtttc ctgctgtcga     97560
     tcggacacta cgcgatcgcg ttgtacgccg cgctgatcga agcgggcgtg ctcccggagg     97620
     aagagctcga aacctatggc accgacgaca gccgcatgcc gatgtccggc atggcggcgt     97680
     atacgcccgg catggagatc accggcgggt cgctcggcca cggccttggc attgccgtcg     97740
     gcatgtgcct ggggctgaaa cgcaagcgga gcggcagttt cgtctacaat ctgatgtccg     97800
     atggtgagct cggcgagggc tcgacctggg aagcagcgat gtcggccgca caccacaggc     97860
     tcgacaatct catcgccatc gtcgacttca acaatcagca agccgacggc ccatcgaccg     97920
     cgatgctttc ctccgagccg gtgaccgaca agttcgaggc gttcggctgg cacgcacagc     97980
     gtgtcgacgg caacgacatt gaggcagtcc gcatggcctt cgatctggcg cgcgggctta     98040
     aggaacctcg cccgcgtgtc atcgtctgcg acactcgcat ggccaagggc gtgccgttcc     98100
     ttgaatcccg cgacattgca cacttcattc gggtcgagcc gcatgaatgg acgttggccc     98160
     tcgaagcttt ggagagggga cgttcgcatt gaggctgtca aagttcgcgc cgcgccacgc     98220
     cgtcaacgcg ggtgagcgca aaacgacgtc ggcaatgatc gcctcgattg cgcccgatgg     98280
     cattgcgacc cgcaacgcgc cgtttgggca cacacttgcc agattggcac acgagcggct     98340
     cgggatcgtg ggtttgacgg ctgatcttgc gaaatacacc gacctacatg tcttcgcgca     98400
     ggagcatccg gatcgcttct accaaatggg catggcggag caggtgctga tgagcgctgc     98460
     cgctggcctg gcgcgggagg gtttcacgcc cttcgccacg acctacgctg tctttgcctc     98520
     gcgacgtgcc tacgatttca tatgcatggc gattgccgag gagaacctcg acgtcaaaat     98580
     tgtctgcgct ctgccgggat tgaccaccgg ctacggcccc agccaccagg cgacggaaga     98640
     catcgcgatt ttccgcggca tgccgaacct gacgatcatc gatccatgcg acgcgctcga     98700
     catcgaacag gccacggagg cgatcgcgga ctacaagggg ccggtctaca tgcggctgtt     98760
     gcggggcaag gtccccgtcg tgctcgacga atatgattac acattccaga tcggcaaggc     98820
     gcggctgctg cgcgacggtg cggatgtgct gttcatttcc agcgggctga tgaccatgcg     98880
     cgtgctggag gccgcgaagg cgctcgaagc ggaccgcatc gactgcgcgg tgctgcacgt     98940
     gccgaccatc aagccgctcg atacggacgc aatccttgcc gccgcgcgcc gggctggacg     99000
     gatggtggtc gttgcggaga accacacgat gatcggcggg ttgggcgaag gtgtcgctgg     99060
     cctgctgatg cgcgagggcg tgacccctgt cttccgccag atcgcactgc ccgacgaatt     99120
     tctcgacgcc ggcgcgctac cgacacttca cgaccgctac gggatctcaa catcagagat     99180
     cgtgcgccgc gtacgcaagt gggtgaaata gatacgaggt cctgacgcgt aaccaggctt     99240
     ggggtctgac cctatggtgc caatgtgccc ctgaaacgcg gtttctagcg tgaaggcgat     99300
     ccgcggcatg gtcagcgccg ggaatgctcc ctgacgcgtc gctcctgcga tgctttctcc     99360
     ggcaagcgat cgcgcgtcag ccaggcgagc atggctcgtg aagcaacgct cccctcgcgc     99420
     atcccggtct tgtactccct tcgcatgttc ttggcgagct cgaccaatcg caagacagca     99480
     cgctatggac ggggccgccc ccgctgtagt tcggcgatga cagatcgacc aaatcgtcga     99540
     gcgcgcaggg cagccgaggc agcactgaag ttccccactg ccatttatgc gactttggag     99600
     ggcgcttgcg ttggtgccag gcggcgcgtc actgtcgcat ttctgacttg ctgcgccctg     99660
     tcctccgaaa cgaccttggc gacatttcta ctttgctggc agcgcgacat tccaacttgg     99720
     ttgcaacatg gaagcacaaa tcgcgaacac ccaaggccgg cgtctgttcg aatgccttaa     99780
     atccttgctg tagcgcggtg gagtccgaca tcgtcaacgc tgaaaccggt cgtaccggaa     99840
     cacagggctc gatttccgct ggatcaagtg tgtcgaaata ggcagaggtt ggcactgcgc     99900
     aagcccaccc ggactccaag aagcccacgc atcatgaatt gttcctttcc ggtcagaggt     99960
     ctggcgctcc ctgccattgc aatggtatgg ctacaacaag agtcttgggg gcgactttgt    100020
     tctttacggt attggctgcg ggcgtacgcc cgccaagtaa tgcgcgttca cgcgcgtttc    100080
     tggtcacgga caactgggac gactggttcg aattttcgac catgtacttc ctgacctatg    100140
     tcgatactgc tggcgagcag cacgatatcg gctccgtaaa aatcggccag gtcgggatgg    100200
     agaaaggtca gcgccgccca aacatcccta atcgtttcga tgccttggat gacccgttct    100260
     ttgccttagg gcaggatgac acgtattacg cggggttgaa cgacctaggt ccagagcttc    100320
     gcgaccgaat cctcgaaggc cttcgagatg tcgcgcttga tgcagatcta tttgagcggt    100380
     cactcgatga acgagtcacc ggaatatcct tactccgctc cgtaaccccg caagctgtaa    100440
     gaggtcagta ccgtcgtatg gctcgtggtg gcgcgcgtgt cacgccatac gaattgtcct    100500
     acacaactgc ccgtgaccgc cgctcggaca cgagtcggat cgagttgacg tttgcggtgt    100560
     ctcctgaagt tcagccgcca accaacatac acgtgatcac cggcaggaac ggcgtcggca    100620
     agacccacct gctcaattcc atgactgagt ccattctaaa cgacggcgaa cgcgcaaaag    100680
     ggaggtttgt agtcaaccat gacggtgacg acactggtac gttcaccggc cttgtctcag    100740
     tgagttttag cgcgttcgat gatttcacac cgctcagcgt tccgagagac aagtcttcgg    100800
     gactgcaata ctcctacatc ggtctcaaga aagtcgggct atctcctgag ggaaagccgc    100860
     tggcgccgaa gagtcccaac tatctaggtc gggacttcgc cgaaagcgtc cagatttgtc    100920
     ggcgcggtgc gagggcctct cggtggagac gcgccctcca gatgcttgag gcagatccca    100980
     ttttcaagga cgctgatgtg gcgcagctgg cagcagagga tgaagatgac gcctcctcag    101040
     aagcgtcacg cctattcggg cagctcagct cgggtcacaa aatcgttcta ctgacgatta    101100
     cccgtctggt ggaaaccgtt gaggagagga cactcgtcct tctggacgaa cctgaagcgc    101160
     atctccatcc accgctattg tcggcatttg tccgagccct ttccgacctc ctgatcaacc    101220
     gcaacggcgt cgcgatcatc gcaacacact cgcctgtcgt tctgcaggag gtgccaatga    101280
     gctgcgtctg gaaagttcga cgaaatggac gaactgtgat cgcggagagg cccgagattg    101340
     aaacctttgg agaaaacgtc ggaatactga ccagggaaat cttcggcttg gaggtcaccg    101400
     attcgggctt ccacaagatg ttgcgggaca aggtggagga gggtggagac ttcgaagaca    101460
     tcctcgagca tttcggtggt cgggttggct tggaaggcca ggcaatcatt cggggcctca    101520
     tcgccgcacg cgatgcggac ggtcacgaat aatgtggaaa ctaccaaagc cggaacttac    101580
     tgccgaggat gttttcatca cggctatcag tcgcgttgcc gatgttggtc taaaagggcg    101640
     acttgagagc gtcaccgcca cgatcattca ggcctcaatc gactttgacg aggcagcgtc    101700
     caacaacgaa attcatacta tcgagcctag cccaaacgtc gacggcgtgg tgacaatcaa    101760
     ggagatgtcg ggcgtgtacg ccggaagaat ggtcgcgaga gggagcccgg ggcgaactat    101820
     ctatgacgag ctactggccg cacctaaata tggccgatgt cctctatgcg ggcagcatat    101880
     tgtgtccact ctcgatcact accttccaaa aacccgctat ccagcgctcg cggtagctcc    101940
     ctggaatctt gttcctgcct gtcatgactg caacaaggcg aaatctgata cccggccgct    102000
     gacggcggat gaagaggcgt ttcatccata ttatgacgac atcgacggtg atctctggct    102060
     ggtagcccag gtcgtcgaaa gtgcgcccgc tgcactacgc ttccttggtt cgccttcacc    102120
     tggatggagt gacacgctga cggcccgggt attgcgtcaa tttcaaatgc tgaaactcgc    102180
     gcgactatat gctgccaagg gggcacaaga gctgaccgac ttgcacaacc tgctaaggac    102240
     acatcttgcc aatggcggcc cagacgaagt gcgtctgctc ctgcagcaat tcgcggatag    102300
     ctgtcgggcg gcgaatatga acgcatggcg cacggcaacg tatcaggccc tggcgaacag    102360
     tgactggtac tgccaagggg gctttgcgca cgtgtaggtc gaagtccatg ccggtgccac    102420
     ttagcaccac ttaaccaaaa ggcggctccg aggacagaac acctaacggg cgtctgggtg    102480
     ataccgaacg gagacctcgt ttgggtatac gccgagttag tcgccgaagc cgatcacctc    102540
     atccaccaag gccgcaggcc tctgctttcg aggtcctcac cgctcgacta tttgaaatcg    102600
     agttaatcgg ctcagatcct gtcattgaag ctgcgaggca atctgcggaa gtgctttggc    102660
     ttcgcacgca gctgaagatg ctaagccgag gcaggtcctc taagacctca aacagaattt    102720
     tgtctctgct gcacggcgtg aaatagctgt gatcgagagc ttatcgtcac cgaagttctt    102780
     tgcctgaatc gtatgctccg gtcgcacttg cagcagtcgg ctgctacgcc gggaacagag    102840
     tccgcacacg tgcgaacggg ttgcgatact ccgaggcgta ccgagccttg gcaacgatga    102900
     tgtcgggaaa cgaaatcctt cgcttcaacg catcgaaaat gtccatcccg tcggcgagaa    102960
     taattcgcct ggctgtgaat gcctcgagag ctccatccgt aaagccttcg aagctgacga    103020
     acaaccctct cgtcccttcg agacgctcgc tcagttttcc ctgaaaggca tgtaggtttt    103080
     cagctccagt cttcgcacga tgccacttcg cctcgaggag atatgtgatt gcgccatgtt    103140
     ggaacgaccc gtcgatctgc tcgcccgcca gccgggaccc ttccctcgcg tccatatccc    103200
     aggcattaaa caatgcagtc aggaggcgct cgaagtgata tcctcgagcg tgaggctcat    103260
     ccgtcatcgc aaagagcgct ataaagtcgc gttcgagacg atcaagtgcg gcatgatctg    103320
     ggcctgcctt cgttgcggaa tgtgattgtg cgggggacga accgacattg atgtcgaaag    103380
     agggcaatag ggccccaccc agtctctcga caatcgaact gagccgcgct cgggcattga    103440
     caacggtctc cggatctccc ctactgatgc ggatggtttc gcggtattcc cacaatgccg    103500
     tcagtgcccg gacaatggct cgtgggtgtc caatcgtcag aagcgcccgc aggcgcttcc    103560
     ccttgcttcc actcccagat gcatacgcat catcgtagat gtcgataccg acctccctac    103620
     ggaagaaatc gtcaaatgtt gcgttcgtga aatcgagtac ccatccggag cttattccga    103680
     acagatcatc caccagtttc agttcgacag ctctgagctg atccatcgct atggtccctt    103740
     gatccgcacc aaatgtctac gatgaatggt tgcattctaa aatctcggaa accgcaatcc    103800
     ttccgtcaag gtggtgggcg ttcgacctca aagccccagt cgagccgcga cgttctccac    103860
     gagctgagca tttgacggtg caccgtctcg ctgcgcgtgg aaaaccgaaa atggatcccc    103920
     ccatccaacc aaacagagag ggatgcatca aagtcccgca aagctacaag caacgagccg    103980
     cacatctctg cgagttctgt gttcagtcca cgtttcacgt gcaaggcact gtcgatgccg    104040
     acctgcaacg cagacgaaat caacttcgga tggacgagaa atgcgacgtc gccggcgcca    104100
     ccggccaagg cctgttcaca cctttccctc gaattcgaaa acagcgcacg gcagacggcc    104160
     ggccggcgat catagacgga acactgattg tccacgagaa gcggacaggt agcgtggctc    104220
     ccatatctcg catcagggtt caacggaagt ttcgatattt cggacaagcg acgctcgatg    104280
     cttgccagtt catcatctgt gcgcgtcgag agcagcagtt gcgcaaggat gaatatctcg    104340
     aacggactgc agagcaccat ctggtggcag cacgcggaac aaccagctcg gaaggcgacg    104400
     acaccctggg gattgtttcg agccaccaaa tcgagagaag cattccgccc cgcatatgaa    104460
     gcgatcagcg cgtcgacaat attatctgga taaacatcga acgcccggca cgtgttctga    104520
     taagcttgcc tcagaacttt ttcgccctgc tcagcgtcca tcgtcgaggc gagagctgca    104580
     ttctgctttc ttcttttggc ttcgcccacg agccccaccc ttcgagttcg gcgacttctg    104640
     cgccagacct accagacaca caatgcgaag ccgagcgcta tcctcgcgtc cggagtcgtt    104700
     gtgcgaccgt gatgtcggcg agccttaggc cgcgacgcaa tatctcggca cgaacctcct    104760
     cgtacactgg agcagtgccg cgtggatccg cgatggtcat cagaaccgcg aagcgcactc    104820
     cttcctcggg gtacagagct ccggcgcgtg ttaagccctt cagtgacagc ttccactcgc    104880
     ttgtcgtccc acaacccttc gggatgttct tttcatagcg ctttatcggc gtccacttga    104940
     gcccattttc cagaagatag cgctcagtgt agtcgagatg ctgtggcagc tggctgtcgc    105000
     atgcgttcag ccgctgttgc ggatcgggaa ccagttcgcc atcttcgttc tccttttcct    105060
     cgagctggtg gagaccaacg ccaagctgga cccgttggca ttcggcgtcg aacgccgcat    105120
     cgatgggagg cgtgtgagcc agtgttacgt cgatccggcc acggcatttt ccttccgtcg    105180
     ttaccaacga acgcggccac gtgaagataa aagacagttc gcgccgtggc ggcaatatgt    105240
     ctgcaaatac cagagttata ctgttcagat catccgacaa gcatgcatcg gcgtggcgtg    105300
     gcacgccaaa cccgacaaaa tctcgcgcga ccgtacgcaa gggcttcgca catagtatat    105360
     gcggcttttc ggccttgtgg acgctcagcg cgagaagcgt ttctcgtgga gcctgacctt    105420
     ccagccggtg gtcaagcgcg gctagggaac ccgtgacgag cggggtcgca tagcttgtac    105480
     cagaaccttc gaccaactgg ccgtcaacgc cgatggaatg aagaccgcaa gaacttccag    105540
     ctcgcggtga aaccccgcca atatgagcaa gttctggctt acgcgcgccg ccaggaccgg    105600
     gtccacgacg ggtataggtc gttggaacgt cagccaccgc acccaatacg ctcggagcgt    105660
     tgatcgctcc aaccgtgatg ccgaaaagat gctcaccagg cgccgtaata cgctcctccg    105720
     cgattgcgcg ggtggccaac atttcgagcg catcttcggc cgtggccgac cattcaggcc    105780
     gggcatcgcg accgcggaga ttcccagccg aaaccaaaaa gatcacgtcg tgcgttagcg    105840
     ctatacgatc gaggttggcg gcgaagctac tgtaccccaa cccttggcgc acgcccggag    105900
     caccgaggct catgttgaat acacgcacgc cctccgcctt cgcgacttcg atctgggttt    105960
     cgagttggtc aaaaaattcg tcaggggttt ggtaatattg accaaggaga ccgcggcgcg    106020
     gcaagacgtc aatatcaaaa aagcggcacg gcgttggctc cagacggttc gcgatcgttg    106080
     ggttcagccc accgccaccc gcgagcagcc ctgctatgaa cgacccatgc gcctcatcgc    106140
     gatccgccgg cgagatcaga cccgccgttc ctgctcgcca aggttcgagt tgggagatcg    106200
     cagcaacgcc cgcgtcgatg acaccaacca caggatagct ttgatttgca accggtggct    106260
     ggactaaggc ttcggctccg agcccaatcg aactggccga tcccgactcg agacgtagtg    106320
     gaagttcaac acggcgaacc agcggttctc gagccaagag gtcaagcagg gcttgatgac    106380
     gggccagtga cctgtcaggt gcgcgcgggc caaggtcggg tacgccctcc gtttgctctg    106440
     catccacatc cgggacgagc ggcaagctga tagcgcgccg gccatcactc cgtagatcga    106500
     tgctgagcgt taaggcggag gcggtcgctt tcgtggtgcg cgaactgaag ggtacggcaa    106560
     tcaagccacc aagttcgtta aggcggccgc gaaatcgagc aatcatcgcc tccaccgcct    106620
     gaggggtcac tctgggatca ggcctgaaca tttcgaccac gtagccgccg atgatcgttt    106680
     cttgctcgag ccacatgacc gcatctcgag cggagaaccc tagcctgtct gctggggtcg    106740
     gcaggcgtat ttcgtcgatg gcgccgactt cgcttcgata tgccgaaacc cgttcctcca    106800
     tcctgccagt ttccgggttc tccctcaggc gcggctgcac ttcagctcgc tgctcaatca    106860
     gctcacttag ccggtccaac gcatcggggg ttgtctggaa atacatttga ccaatcgcgg    106920
     ctccacccac gagcgcgaaa cggttcggcg tggtgaacaa cgcaccaaga ggccgatagc    106980
     ttttcgccaa cccttcctca cgcatttgaa ccaagacgaa acccgccgga tcagcctctg    107040
     tccttagagc cgaactcgct tgcaacagct gttggcgcaa gcgcgccttg tgccgttgaa    107100
     agcccgagtt gttgccggcg aaaaagtcgc gattgggacc gcgtgttccc gttgcctgaa    107160
     tttgtatcag ccgctgcgtg tcaaggaata cttggattgg tcgtgcaagg ggctcagcca    107220
     tcgcgatcac gcctccaatg gattggcggt gtcgcggcgg cgacgagaaa ctgtgctttg    107280
     cgagacgcct accaatagcc ctgcctctct ttgcgtcagg ccgccattat caaccagtgc    107340
     agctgcaagc tcttcattgc tacccaacag caaagcgcgc tgttcaacac tgaacagctg    107400
     accgctcaat gttgcctggc gccgtagccc gcctagaagc cccctgcgcc gcgagccaga    107460
     tgcgccgcta gcctccttca tcacaagaaa ccgctttcca ccgctgataa gtgtttcaat    107520
     atcggctcca ctcattcctt cggtcatcca gacgagcatc ttcatctctg cctcacccgg    107580
     agtgagcggc ggcagaaacc gtgctagcag gttctttcga gcatcggcat ccggcaaggg    107640
     aatctcaatc cggccatcaa atctcctcca caccgctgga tcgagaagat gctcgtgatt    107700
     tgtcgcggca agggtaaaac cgcgccggcc gcgagcgtcg aggcactgca ggagcgcgtt    107760
     taccactcgc ttgatctcac caacctcctg ggcatcatcc cgggccttcg cgatggcatc    107820
     gaactcatcg agaaatagga cgcaacgata gcggtcggca aagtcgaaaa gcgcgccgat    107880
     gtttctggcg gtggttccca gaaaagaaga caccagaccg tcgagtcgag cctcaacgat    107940
     cggcagaccc agtttggcgc caatgtatcg cgcgagcatg gttttgccga caccgggttt    108000
     gccgtacagc aaacagcgca tattaggctg tacgcctaga gcagcgagtt cctccgtgtg    108060
     agcccactcg ccaatgagac catcgagggc gtccgcgaga accggcgaca acacgggttc    108120
     cgcgcccaca ttgtcctcgg gaaaaactac ccgaacaagc ggcgtcgcag tctcgcgatc    108180
     gttcggtaac ggtgtgtttc ggcctagttt ctcacccgga atgactggcg gtgacgatcc    108240
     gctgacgcgc atctgttcta acgacattgg cgccaccgag tgtctgcgat cgtcgcgatt    108300
     gagaagtcgc gccagcttct cggcctgatc gggcttcgct ttgctgactg cctcccgaag    108360
     gcgctttacc tgatgggttg cccgctcgct gtcgccactc agggcaattc ttgcaatggc    108420
     gagaacgatg tcgaaatgtt ccatagcgca gcctcgactc tggagtatcc aaggctttaa    108480
     tatgcactat ttcatcaaat tatgcaatat gttctatttt tcattcctga catccaactc    108540
     tttatgcatc gcggtctcct tcgcaagagt ccggctcgcg atagcgtcct cctaggggtc    108600
     ggaacaagaa ctgctcaaaa tcgtacgcta aggtcgaacg gatgatgaac atcatgtgac    108660
     acgctttagc gccaccggga ggcgcagtgt cctaaagcct tccgggagat gctgcttgct    108720
     gtcccgcgct ggtgtcacat actgaataac tgtcaaacgg caatctggcc gttgaatcaa    108780
     cagtatacga aggcgcagag tagtcggcga ccgttcaatg tgcgttacga ctagctcccc    108840
     gcacctctat gcaccgccgc ggcgcacagc agcatcgatg gatcgttggt atttctccgc    108900
     catctgcttg gcctcagcga tagccgtcgg atacacttgg ttaaaccggt caaactcgga    108960
     tttgtgggcg agaactacct ccaggattgc ctcatcgtcc ccagagaaat cgggcatctg    109020
     gcgcacaggc ttgtcgccga caccttcctg gaaatgagag agtaacaggc cataacggag    109080
     caaagcatcc cgacgctcgg catcgccttc aagagccaac gcaagcgtga aggcgttgac    109140
     gagcgcttgc ttaggccccg gcaggacctt cacatcccta atttcgccaa ccatggtatc    109200
     ggcaccaagg tagtcgacga aggcggcaac ggccctctca gcaaccgctg ccaattccag    109260
     atccgcggtg ctgaaagcta ttggtgccga ctgcgccttt gcgggttccg tctgctttgt    109320
     tacaaatggc cagatcatac gctaggatgc tcctaaaggc cggcagggcc ggaagcttct    109380
     atttcaatgc tgaattgacg gctccgatca gtttgatcca ggcgtcacgc tcggcctggc    109440
     taagatcctg ggcggtatgg tcacgggtcc agcgaacgta agcctttgcg agcttgtatt    109500
     ttgaaaaatt ggcgccgccc tttgctaaca gcaggtcgac caagggcttt tccggcgtgg    109560
     ccgctgcttc ggctgtcacg tcgatgccaa gctcttttgc cgcaaggggt attagcacgt    109620
     cgcgcagcag gtcttcgatc tcggccttcg gtctgggtgg aacggtgaag tccatcgtcc    109680
     ggagaatgcg cttggcgccg aggcgatgca ccagcacctc ctgctttgcg gcctggtcgc    109740
     cggcgttgtc ggaatcgaga agagccgcga ccttcaaatt gtgggcgatc aggatcgtcg    109800
     cgaaatagac gaccttgctc gcggtgttgg ccgagatcag ggcgatcttg tcgttaagat    109860
     ccgcgacgcc gccaacccgc aacatttccg atgtggcctc gagataccag aagtcggtca    109920
     ggccttcgag gatcaggttg cgttgctgcg caaacaggct ctgcgcaaga tcgtagccca    109980
     atgcctcttg cagcggcagc agggcggctg gatccgccgc tgtgattgtt gtgtgcacct    110040
     tggtgccgac cttccggtcc gccatctcga cgacccgtac aagatcgagc tcattcgggc    110100
     cgaccaagaa gggcgagtgc gtcgtataga ctgtttggtt ggattccgag agcatggaaa    110160
     tcgtgttgcg gaaatcacgc tgcttcagcg cgtgcaggct catgcccggc tcgtcaagca    110220
     gcagaatggc gttcgcatgc ttgtcctcgg tctcggagaa aaagaccacg aagaacgaga    110280
     ccagccactg gaaaccctcc gatcgctgat ccagctcgat ctcaacgccc aagccatcct    110340
     cgaccacgac cttgaggtat tgaccgtcgg cggtgatcct aaggcggctg gcttccgccc    110400
     gctccgggtt agggttccag actttgacta tttgatccgt caggcgaaca ctcgcagcgt    110460
     tcagctggta agcgcgattg tcgagctggt cccggtactt cttctgggcg tccgtgtcct    110520
     tggcgcctgg ttcggccgcc ttaccgaggt ctgacagttc tcgcgccgtg aagcctagga    110580
     gcttgaggag acattggttt ccgtaatcgt actgggcgtc gtcgagcagg ttttgctcga    110640
     cgcgggtcgc gaggtgatca aggtggatca gcgggcgcac gcggaagtaa ttgctgaaca    110700
     ggacgaacac cggcagcttc gttcggagcg ccgtccgggt ggtctttagc cgatcggcat    110760
     atttgcagtg gccaagcagc ctggtgtagc gatcttcctc cttctcatcg tcttcatcga    110820
     cgagcgggta gtgcttttcg agccagtcga tcagcttcgt agcaacctca ccttggatgt    110880
     aatagttttt gtccttgtag cccgccagaa tgccttcgag ctctttgctg ggctggggtt    110940
     cgccgtcctt ctgccgacta tcgacgtgcg ctgcaaggcg ggcgaggtct ttttttaggt    111000
     cctcgatggt cggcttctcg ggaacaccct gaagttcatg cccccatgag ttgtccaggt    111060
     ttcgccagca gacataagtg gccgagtgaa actcggactc gatcgctttt ttgtcgtcat    111120
     cttcgagttc gaaatgtgcg acggcaactt tgatgtcttc gggcttgagc cgcttggaag    111180
     tgatgtcgtt atagtcgccg cgggggtaat cacggagagc gtcgaagcca gggacacctg    111240
     ccggtgggtt gatctgctga agggccttta gcagtgctga cttgccggcc tcattcggcc    111300
     caacgaggat tgtcttgttg ggctccaact caatagagcc ggaatccttc acgctgcgat    111360
     agtttgtaat tcgcgctttc tttagtctca tcagcccctc ccctgtacgc agaggattgt    111420
     atacgacgtg cttttttcaa agagaatggc cgctcgctcg atagccggtg aataacgaat    111480
     tgtatgttgt ggatcggtca ccggccgggg aagttggcaa ttgacatcct gctcccgcat    111540
     cttcgtccaa aaggccccta ttccatgcgc gggccgagat ttcgtacccg cgtagaatcc    111600
     tgttccaaaa tgccattttg caattgatgc gaccgccgcc ggttacgctt tgctgccgca    111660
     tgcggtaacg atgatgtcgc ggtcgtggaa ggagtattcc agttccggca gcccctcata    111720
     aaggctcttg aggcgggcgc gtagagttcg gcagtccgtt gacgccggcg gccggggaaa    111780
     tgacaaaatc gtacaggccg gggcagaccg ctcctcgttc aggacagtat ggaattatcg    111840
     gaacgagagg ctagccggtg tcaggatttg cttgatggta tgcttcacgg cctcgggaag    111900
     ctcgaccgca tcgataacat cgagaatcgg aactgcccta cttccctgat atcttgcgtg    111960
     ccgggcttcc cctagcagga agaagcccgc gttgcttttc ctgtcgaaat ccgtctcggc    112020
     gacggcgaac tgattgccta tccaaacaat ctcgccggaa tagatgcgcg gacgggtgac    112080
     tgttgcgagc agttgatccg gatcggtcag atttttcatc aatgctcgga tggcggcgcc    112140
     accttgaacc cagctcagcc aaaagtcagg cagggcttcc acgaggcccg caatatgtac    112200
     cgacagtcgc tcgaggctgt ccatagcctc atcatcgccc agggttagcc atggatgggc    112260
     cgcagcgaga cgtgtcgcgg caaaattgaa ccaggtccct gcctctggct tgttgatgag    112320
     atctgcgatc cagagcgtca tcgcagccgt caggtccgac gactgcataa gcgcgggtgc    112380
     ctctggatga gcctccacgt agagatcaag aagcgggcgg cttccgtttc cgaagaataa    112440
     cgcatgaaat agtcttgcac tggcgctgtc gactctcgcc ttgtccatgc cttcgcgccg    112500
     tctcgcgata cccaaaagca gagcaactgt acggatgtcg gcagcaaggc gtggcggagg    112560
     cctgctttcg aggaatgcca tcgacgacat ggatgacaca gctctatcga tcagccgcgc    112620
     gagtttctcg acttgcgttg gttcgagcgg cttggcaggt gcccgtggtt ctttcggctc    112680
     cggcgggttc ccgtccggat tgtcggttga attgtctgat ggatctccgt tgcgcgggcc    112740
     gaccccgccg agtctgaaat agtcattcat cagactccat tcgtcggtcg tgaggtatcc    112800
     cccacccgaa accggcgcat agctgcgccg gccaaaccca gtcgagaaca cgtcttcaag    112860
     attgtagtct atcgccgaag cgcccttcgc gcctcgcgtg ccggcccaag gtaccgggct    112920
     cttgtagtgc tcgacgacaa gcgtaaagat gtcgatgagg ccttcggagc tgatcgttcc    112980
     ctcgtttccg gcaagcctcg tttgaacgtc gaactctggc cgaccaacac ggagttcagc    113040
     ctcgtggtcg atccacatcg gagcgctgcg gaccgcgcca gcaggcgtgt cgatttcgac    113100
     ccaaaggcgg gttccgggac cgggaacaga cacacgaaaa gagccggtct cgtcagcgac    113160
     tgcaattagt gaacctgtat gcaaaacaac cctgatgtcg gacggggtat cgccgccggc    113220
     gaaggcacag cgcacgacca acgaacctgc gtcgaagctg gctgaaagca ctcgcaccgg    113280
     aggattttcg atttcgtccc aatctgcatt aggcgcggtt tctggtaagt cgggaggact    113340
     atccgatatt tggatgcccg aaagaagctc ttcgtattct gcgttagaaa gatgggaaat    113400
     cgccattagc tcggcgttgc cgttatcact acgcagcaat gcggcgcgcg agcaattggc    113460
     gctcccggct agtatcacca cgtgatcggt gtaacgcgcc gcgtaaagct tggcgtgaat    113520
     cgtttgccgt tccccggcgc ccggcgcaat cccaacaata cgtgcagacg agggcagttt    113580
     ggcccccgcc tttgaagaga gcccctcctt accatgctgg attagcacgc gcatggggac    113640
     gccgagacgg gctgcaagtt cgttcaccgc cgccccctcg gggtcgaaat aaggggccat    113700
     catgtcgaac gaggctgggg gttcctggaa ctgggaaagc attcgatcca tgagcggagt    113760
     gtccgcaggt agctcgacca ggcgatcggg ctcaggcagg tcggctgccc atgcttctga    113820
     gcggaacggg tcgaggactg tcgcacgcac ggcgtcgctc gccccagcca tgccacagac    113880
     cttttcgagg tagtcacgga aagcggcgat tgccggtccg ccttcacctg gaaagttgaa    113940
     ataggtccag atctcgcgat tgctgctcca tcccccatgg ccaaggttgc cgcttccgat    114000
     agcaagtcgg gtgccttcct cgcctgcgag gaagattgct ttgggatgga agcgccgccc    114060
     gactccaaga tcgatcggga ctacacggta tgaccgacca acgcggtcag cgatcacgct    114120
     ttgccgatta aaagatgcgg cggcacagcc tgcatcggcg aacaccgtga gccgcggtgc    114180
     gccgctcttg cgcaactggt tcaccaggat ggcttgcgca aacatgaagt cgatgttgtg    114240
     ggttaggacc acggccgtcg tggcgcgctt actcgcatcg accaagcgct ggagaacgtt    114300
     gacctcaccc atcagccgac cacatctgcg gcgatcacgc caccagagcc aatgttgagc    114360
     atccctatgt cgccaaggat acgcatcgta ttctgcagac ggctgccaga atagttgggg    114420
     ctgaagtcaa tatccgtggg aacgagaact ggaccttcag gatagaagcg cagcgaacag    114480
     tcctgatggt tacccatctt tcgcatcgta ttggcgatat ggcgctgcgc gacgcactca    114540
     tcgcagatag cgcggagcac cgccccgagt gtgccagttc cggctgccac cagctggatc    114600
     gctcgtgcag agggcgccga cgccccgctg cttgcgcctg gaacgacgcc gatggattgt    114660
     gcgtcccgcg cctgcgtcac cagaatttcg aaggcgcgga ttgcctggat gtgtggttcg    114720
     agatgaaagt cggcgggacg caacaggccg ccgctaaacg ctccaggctg cacagtaagt    114780
     gccgcgacgt cgaccggtga attccagtga tctgtgagcg gctcagaagc aacagcgtgt    114840
     gaggaccaga tggcgatcaa ctgcgcgacc gacatgctgc cgtcgtccag gagcgttctc    114900
     gtcatagccg cgaggagcaa ctcaagagca aaatgcacac gccggtgcca ctcgaagctc    114960
     gcccactcaa gttctatacc gtccgcaccc tcgagtactg cacgatcata gtttcgggcg    115020
     atcagctcgc tggcactggc tggctcgact tcgagttctc gatgcagcca tgaacgtgta    115080
     tcgatcatcc gctgataggc ttgagcaacc agctttgccg ctattgagct ccccggcacc    115140
     catggctgtt caaacgcttc tcgcaagaga tccacctcgc ggccaaaatc agcaattctg    115200
     gcgagagaga aggctgaaac cgcttcgcgc gccgtgtcgt agtcgaggtc gccgccgtcg    115260
     cgtagcaaat cgaccaatcg agagcttccg agcgccttgc tacgctcttg atacatggct    115320
     gtgccgcgcg cggacaggcc gaatggcagg ccacttgatc caggacgaga ttcgacaaaa    115380
     ccgagcgcgc tggcaggccc gaaatacgtc gcgagcactg cgaggttccc gacgtcgggc    115440
     atgcgcacgg tcttgccagt gacaagggtg gccatctcgt cgagatagaa gtccgacccc    115500
     atggtaccta tccgtgaggc accctcatcg acgaacgtcg ctgcgagcac aagaaaccga    115560
     acccggttta ggtggacggc aagcgcatct ttgtcatgcc gcacgcggcc gccagcactc    115620
     tcgtgaacaa aatattggcc gatcgcccac ggaaggaccg aaatgtatcg ggcacgaatt    115680
     gagatggtcg tgagcccatt ggtcagcgag gcctcgatat tttggtcgag tgctcggatg    115740
     cctataacat cgaggccctt agtctcgctg ctgagacgcg caccccaagc aatattcatg    115800
     ttcgatcccc aatgagttca ataactgggc tacgaaaaat ctgcagcgcg cgcatgaaag    115860
     ggcagtcgaa gcttggatag aacatctgca tcacagtcga acgcgaaatc aaagcttggc    115920
     ttcgacgtga tcccggattg ccctttcgtg ttcgcgtacg agttcttgga agctctcgaa    115980
     ggccgcgtag aagcgcatct gttcttgctc cagcagcttc acaatcttgg caagatcaag    116040
     cgggcaacgt ccaccgaatc cgtaacgaac ccgccccgta gacgcattga cggtgcgcgt    116100
     tacgaactga gtcatcccaa ccacgaaccg cggcgagaag cgatgattgt aggcgtggcg    116160
     gaagtccccg gtgccatcgc gaaaggcacg tgcgccaatg gcatcaagcg cgcgcttcag    116220
     ccgcttgtag cctttccacg atttgccata gctgtcagca acgtgaggat agatctcgca    116280
     gtcgagcggc aggtcgtcgc gccaagtagc tggaaacttt agcatgttcg cctggtgaca    116340
     caggtgagcc gcggcgaacg caaagcgccc cttcacaaca tagggaaggt tcactgcggt    116400
     ggttgcaagc ttgtcgatga attcgcggtt ggcctccaac tgactctgtt gcgtcagcgg    116460
     ctcgacaaca gtcgaccaag ccgtcaggct gtgaacgtcg ttagtaaatc cattgactgt    116520
     attggccagt tcacgaccga attcgtcgag catccacgaa tacgccatcc attgggcgtc    116580
     cagggggttg ggcaagctcg accagttgta gggcatatat cggccagtga atggcgtaac    116640
     cttcaaagat tgccggtatt gtcgatagag cacgatcccc attaaacaac ttctactcga    116700
     cagcttctaa aacgccatat ctgtcaacgt catttctgac ggattgcact agtatttttc    116760
     gacgcaggga ttgggtcgat gggtgttcac ggctatgaca tttccatggt gaaccaacgc    116820
     ggtagcggac catccactgg gctgacagaa ggtgtcgggc cggccgccgg aaaaaaagat    116880
     atgaataagc tcgtgccatc aaccggagga ttgatcggca tcaacctgga ttcagaaacg    116940
     gccggacgac gggcgatcgc cggcttcctc cttcagattc tgcggagcat caagcttggt    117000
     ctggacatga ccctgaccct gtcgccgcta gccgacggca cacaaatggt cctccacctt    117060
     gagccagctg agggcagcga tcatcaggtc gttggcggtg cgagtgacat cgtcgagcag    117120
     gtaaagatgc gcgccagccg tcgcaaatgg acaagtggtg aaatcgcgtc gaaagtcttt    117180
     ccagatctgc tcaaggccgt gaaactggct gccgaccagc agtttcgctt cgtgacaaat    117240
     aacgctgagg gcctcgcgcc gctccaagcg tatatcgcct cccgaggtaa aagctcggag    117300
     cgacagcatc gctggggcaa cgctcgtctc acaaccatcg cgttcgaaca gcggttggca    117360
     gaggccgccg gtcttatcaa agtcaatgcc gagctgcgac acctgctcga ccgatttgag    117420
     atcgagatca ttgccgccga cgttactcag gatgcaatcg acaaggccct aacaccactg    117480
     ctgaggaaag acgaggtcgc cagtgacaag cgtttccagc tgcttgggca gttaatgacg    117540
     ctcgcaaccg atggcgcgaa gctgacacct gcggaactgc tcaccctgat taatccgcag    117600
     gcccatcgcc tgctcgctca tattcagtcc ttgccagctc ttctcgcccg ccacgtagac    117660
     gaggacgccc agttgattgg ctacgtgcct tctcaacaag ctcgtctagc acttcccaaa    117720
     ctggtctcca actttgcgat cctctccggt gaatccggac agggaaaaac ctggacactc    117780
     gcccaactcg cgttcgacca gatcgcgcgt ggcgaactcg ccattgtgat gcgttcgccc    117840
     accaagattg aagacgttgt caactgtatc agcgaacgga tttggcaacc ggcgcatccg    117900
     gaccgcggga cgatcgcggt cgtcgcaaag gttctagggg acgcgtttcg cgacgaaaac    117960
     ggtaactggc taaccgtcta cattgacgat gttcaggatc gcgagttcgc gcagaggctg    118020
     gctcgatcga agtgggatga atacggcgtc cgcatcgtag tctccgcaca gccgcgcatc    118080
     acaaacgtga tccggtcgat ccgtgaggga gtccagatca tcgaaatcgg caattttcgc    118140
     agtgcggatc tacaccgctt tttgaggcac cacgaccttg cagaagcgtt ggagacgatg    118200
     ccggacgacg tcttcgagtt gctcctgaag ccggtccacg cgagcatctt cgtgcagcta    118260
     ccaaaacgag catcctgggc cggcgtttct gaatatgaac tcttcagcgc ctactgggag    118320
     tatgcaagtc tgcgagcacg tgagcagtct gatcatccaa ccgacaaata tgcgttgcgg    118380
     tcgctcgctg ctcggcttct aaccggaaag ggctactatc cttggcgcgt cactgacctc    118440
     catgcggtga acctcgacga tcacgcggta ctgaggcttg aacaggttgg gctgcttcgc    118500
     cggccagtgc ccgatcgctt cctgtttgct gcagaccgga tgctgaactg ggcgatcgcg    118560
     gagtcgttgg cggacaatat tcaggaggac gagctttcag ccgagcaagc tgaagcgctt    118620
     ttcgcctcca tcgacgggct ccagacaaag aagaaagaac cgattggatc gcgtctcggc    118680
     tatgtctatt tcgacgcgct ttggctgctc gcgcgtcaat ctgagcccga attcgttgcc    118740
     gacctcatcc aggaacatgt cgcacggctt cctgaggata cccactcaga agaccaatgg    118800
     cggaacggct acggcagtct cggaggtgcg atactatccg cgctggaggt tcttacgctt    118860
     ggtacgtttg acgagcggga cttgggcatt ttacgcaacg tcccgcacgc cctcgcggcc    118920
     gttgcggcat ccgaccctgg gccggttggc gacctgatcg cccgccaggt cgcgtctcca    118980
     aatgaggtgg cggtggacat agggctgcgt gcagcctgct tggtgcaagc gccagccgcg    119040
     ctgaccgcca tttgggatga gcatctcaaa cgcgctctcg cctatgagca ggcgaggtta    119100
     gcttcggacg tcgacacccg ctcgcaggca atcttcgcgc agcaattgag ctcggaggcg    119160
     cttcacgtag ccataagcgc gaacccaggt tggctagacc ccaagcttgc taccgagacc    119220
     aacgagatcg cggtcagtca actgctctgg atgctcaagg atgagaagac agtcgatagc    119280
     gacctcgccg ccgaaatttg ggagaggcac cgtgaacgta tcgtggcgct tatgccaact    119340
     cccagcgccg cgcttatcga agcgatcggt cattttcaag aagcgtcact ccttccgatg    119400
     ctggatgccg ccccgagctc aggagagtgg acgcatgctc gcgtcttacg aagccgcgcc    119460
     cgtgttgcac cgcacgaggc aattcgccag atcgcggaag gcaccgacag ctacggatgg    119520
     ggggcggcga actggtggtt tgacgaactg gcggcggtgg atcccgatgg tcttgcggcc    119580
     gcaattcgcg cacgcgccca cgccggtgac gacccgctca cggataccgt cttgtactat    119640
     ggcttcaatc ccgaggcgat ggatgcgcgg acccttgatg aggtgctcga cgccttcgcc    119700
     gaaaagctcc gcgtgtttag tgaaagcaat gcgaacaccg atgctcatga agggcgcctg    119760
     caccacccct tgaatttcct gccgcgcctt agcgagcgct ggcagtttga agccctgcgc    119820
     aggcgctcag gtacaaagct ggagaaggag cttgtgcagt tcgccgccgc acggcggggc    119880
     cgtatctcga tgactcgcga taacacgggc aatgagtgtg agcgtatcct cgcaatgatc    119940
     ggtgggtccg gttatgacga tctggtcctt gctgaactca gtcgaccaaa cgtctttggt    120000
     cgccaggacg ggttcatcgc cgcgcgctgg acaaacgatg accgggtcgc ggcggcgctc    120060
     gcaaagtcgc ccggtgatcc tgagaatcag acctttgatc aggtcgtgcg gatggaagca    120120
     ctggccgtgc actgttgcga cgagcagctc gaagcgatgg ttcgtgccgg caccccgatt    120180
     tacgtcaacg cagtggggat gcgctgttcg atcgatcgcg acatgtcggg cttgcgtact    120240
     cgcattgctg atctgctagc atcgggcgac atcgagtcac tcgacatagc ggctgctctc    120300
     accggcttcc tcgggggggc cgaggaggcg cagcctctgg tggcaatcta tctggcgcca    120360
     gcgacaaagc agcagactcg gcaccggact ctggcttcgt tccgcgcgct tcacttttac    120420
     acccctgagc tactccctat cgctcgagac atgattgcgg aacggatcga cgacgaggcc    120480
     cagttcgtag caacgtattt ggccgaggtc ggcgacgatg gcgcgagaca ggccgtgatc    120540
     gattggttgt cgagccaaga cctcggtagc gcttccgcgt cgcgaaggag gtatctgacg    120600
     gcactcgtcg aacatcccag cggcaaagcg gcagtggtgg agtaccttca acgatcccgc    120660
     gcgaatggtc atctcgtggt ggatggcggt cagctgcggc tgcttgccga ggccggcgac    120720
     ggctgggccc aagaacagtt ggtgcgcgcg agctatcgct attctggttt cgaccgaggg    120780
     aatgtaatcg cggcgatcga ctatctgcgg aaagaagaac ctgacgaggc ctacttcgct    120840
     gcacagcgcc tgctcagtcg ccatgcggtc gccgtagcgg gcgacctcat gcttgaaatt    120900
     aatcccgatc gggccggccc cgagttgatc gagcgttatc ggcatgcaaa accgtcgctg    120960
     cgcctccagc tcgagcgcag actgcgtgcg cacttgggag gcaatgtttt ggcggcgttg    121020
     gtgacgcctc tcgcgagcgc cttgccggcg gccgaccgca aaacagccgc acagttagcg    121080
     gctgtggttc cccctggcga agctctgccc tggcttgacc gactggcgag agactcgtcg    121140
     cccgctgtgc agcaagccgc ccgaatggcg cttcgtcaac gtcgcctcga gacgacagcg    121200
     atggctcacc gtgatcttct gctttcgtcc cccaagcccc ttcagtgggc caggcttttg    121260
     accatacttg aacttgtcga tcctttctat ctctgggctc gtgacgatcc cgcaaatctg    121320
     agcgaagtct tcgacgcgct tccattcgaa ttcctccacg agggacgcca acttggaaag    121380
     aagcagctga agcgccgaga agacgcagcc gcgaaagctg acaaggatca ttgagatttc    121440
     cggaactgcg atgacccagt tctgtgtcgc aaggccgcag ggatgggcta agaccaccgg    121500
     ccgccttgaa tcaaaaaggg gcagacggcc atttgggcag ccaattcgaa attagagcct    121560
     agcgcaccct cgaagtagtt gatccgcaag ggaattagtg cagttttggc agattgattt    121620
     gatccggcct aagacatcga agacggggtg cgggattatg agctacgacc tcagtgcact    121680
     tggttggaag gcattccagg acttagctgc tgccgtagcc gcggagatat tgaagcggcc    121740
     cgtacaaacg tttctcggat cgaatgacgg cggacgcgac gccgcgttct tagggcgctg    121800
     ggaagactcg gacggtgcca cctccaagtc aacaatccaa tgcaagtttc ttggaaagcc    121860
     gggagcaaac ctagctctgt ccgatttaaa agacgaactg cccaaagcgg aaaagcttgc    121920
     ggctgatggc ctcgcggaag actacatcat cctgaccaac gccggcgttt ccggtgatgc    121980
     cgacgctcag atctgcgcgg catttgaagg tgcgggcgtc aagagatgcc gcacattcgg    122040
     cggaacatgg attatccagc agctgaccga gaaccccaag ctgcgcatgc tggtgccccg    122100
     cgtctacggc atcggcgact tgtcccacat cataaccggt catggttaca agcaggccaa    122160
     ggccattctg gaatcgatgg ggtccgacct cagctgcttc gtgccgacgg acgcctaccg    122220
     gtcggcagtg aaagcattgc aggaacacgg ctttgtaatt ctattgggcg accccgcctc    122280
     cggcaaatcc acgatcgcgg caattttggc gctcggcgcc atcgatgacg gctgcctggg    122340
     cgccttgaag atcaactcac cggatcagct taacctgtgg cacccggggg agaggcagtt    122400
     cctctgggtc gacgatgcgt ttggtcccaa tcacttcgac gcttctcgga tgagccgctg    122460
     gaatgccgaa cttggtaccc tgcgcgccgc tgtcgaaggt ggcgcgcgta tcgtcttcac    122520
     ctcccgcaac tacatctggg aggccgccaa accccacttg aaaacaagtt ccttctctct    122580
     gctcaaggaa agccaagtgg ttgtcaacgt ccatgcgctc tccgacgagg agcgagctca    122640
     gatgctgtac aatcacgttc gccgcgccca gccccagcag atacgccatc gcctgaagcc    122700
     attcctcccc gccatcgccg tcagcaaagc gtttttgccg gaaactgctc gccggcttgg    122760
     cgatccgctc ttcaccaaga acctcatcat cggcgaggaa cgtctaacgc gcctagtgga    122820
     gcacccggtt gagttcctga ccgaggtgct ggcgcagctg gacgacgcgt cccgcgccgc    122880
     agtcgccctc atcttcctga attcgcaagc cggagtaccc tcccctatca ccgcgagtcc    122940
     agctctcgaa atggtcactc gtctcgtggg cgtaaagccc gccgatctgg ctcgtgcgat    123000
     gcagcatctc aacgacagtt tgacccgact aatatcggag gatgatggca accggtgggt    123060
     gttccgccat ccaacgatta ccgacgcctt cgccaccctc gtcgcagcct cgcccgaact    123120
     ggtagagctt tatgctcacg gcgctaaact cgaccgcctg ctcggtgaag tcgcgtgtaa    123180
     ttcaaaggca gcagaagacg ggcggatccg ggtccctccc gctctctacc cggggctcat    123240
     cgagcggctg aaggccagcc ctttggatga atcgttgaag tctttcctag gcgcacgctg    123300
     tgaaagagcc tttctcgcca tggtactgga ggcccggcca gacattttgg agtgggccgc    123360
     acgggcgcct gcgagcggtc aggcgcttgg cggaaaactc ctgatcgccg ccctggcgtc    123420
     gtggggcctt ctgccggaag aagtgcgcca gaaaatggtg gcggacatcc gcgagcaatc    123480
     gatcacttgg ctggacgcca agccgctgac ggacacattg ctccgacaga tattcaagga    123540
     tgctgagttc gccgactacg ccgaggcgtt tcgtaaggaa tggctctcag acattcccag    123600
     cgtattcggt gaatttagtc gattttcctc cgaggacgcg ccgggcatgt acaaggaatt    123660
     caaggaaaat ctgaaggtcg cgcaggccta ctttgagctg aaaagcgacg actcttttga    123720
     cgaactttac gccgagatcg acgtccacat cgaagaactt gagtccctac aatcggctcc    123780
     tgatagctcg gcctggagcc ccacctcgat ggagaaatcg gcagtactgc cctctgacgg    123840
     acctggctta attttccacg acgtcgacgg ctaggcggtc agttttccgg atcgggtttc    123900
     gcaggacccg tgatcgcaat cgagcgtatt ggtaacgatg cgttgccttc tggttaagga    123960
     gcattcgtca atgtccgacg actgtggcaa tggctgagcg gcgatcaatg ctcacgcagc    124020
     aggcatctac cgccaagccg catttccttg acgatctagc acgggaagaa tgggttagcc    124080
     gtcaattttc agaactggtc cgccgtaaaa tatcgtcggt actgacattc cacaattgag    124140
     ctttcgagag gatgagccgg cgagccaaac tttcaacgtt gaaaacctca tacgggccaa    124200
     ggaattcaga ggaatcgctg aatccatgtg ccgtcatgaa atttcgaatg aagctactga    124260
     tgtggagtgc gtcggggatt gtcaattcga catcacgaac aacttgaccg tcgctatacg    124320
     gagccggcgc cccaagcgtt ggcttgatcc tatcttccga cctggatatc tcgcccctca    124380
     cgatccaatt caccttttgg tcaacgtcta tccccgcctc ctggagtcta tccaaaatat    124440
     ctttcaacac ggcagggttc cactcgcccg ccagaaaccg cgctttagct gcgctagact    124500
     tcacttggag tttgatctct tcaatcgctg agaaggcaag attgattgct atcgaggtgt    124560
     ttacgtgagc tgagtggagc tgggagcgct tgtcgaagat ctggccatac ctagggtggg    124620
     ttgaccacca tgtgatgctc tccgtttcga agcttcgcga tagtttgtgg atcgcataca    124680
     ccagacgtct gtcctgccac gcagttgcag ccagcgccac tgcaagcggg aagtcgggat    124740
     catggctgaa ttgctcaaag aaaccatgac tccgaaacac atcgcagaaa acgcctgttt    124800
     gttcagatgg atcgtcaggc agttcaaaac ctcggcggaa tggggcgtct tgcttgtaat    124860
     ttccttcgat aacgtcgttc gccgcacgaa ccagcccaat gatgttgttg gccgtcgtct    124920
     cgtccgaatc gatgaccatt agttggccgg ctatagagcc ggtcggccgc atagtgagcg    124980
     cgtcaggatg cgagatttcc gtcaccccat ttttgtagaa ccaaaatcgt tctgacgggt    125040
     cggcaataaa gcgaattttc cagcccgcag ccgagcacat aaaatcgact gcctcaacgt    125100
     gagtgggatt gaatatgagg aaagtgcagt acgacgtcat cctattccta ctcagtgaag    125160
     ccgggcaaat tcttcaaacg gactatgatg agacgtccgg caggatcctt cctcgcgcat    125220
     ctctcgcaga aggtcatgcc ccttgacgag gaacgaacgt ccagagcgag agtgtacccc    125280
     tcttgccttg ccattcccgc cccgccctag tgaatccgga ccgctcaaga ttgtttctca    125340
     tggtgttgct gtcggtcgtg gcataggcag gctcgcggag ctctttgagg atagcctcga    125400
     cgaggccgcc ggagagccgt ttgccctgca tctctttggc gatcacaaca tatcccaact    125460
     ccggcgcagt ttcgtagcct gcgatcggag ccgccgctgc ggcgaacgta tttacccggt    125520
     atccggagtg ggggtttttt agcgtggcga cgccgacgat gcggtcagtc gccttgacgc    125580
     ggagtagcgc cagcgtccgt gtccgcccca gtcgcgcacc aatttgatcc ggggtgcctt    125640
     tgacggcgcc acccttaatc acgagttggg tcagcgacag tcgggcctcc gagttgagat    125700
     cgcggaagac gccgcaccac aggtaagtct cgttttcgtc cataaagaac gctcggcgag    125760
     taagagggta atccagccct atgttgggcc ctcaatgggc tttggctggt agtagatagc    125820
     atcgagcata gcaacacgga catcccacat ctccatttcc catgtcgtgg ggcgcggggt    125880
     cttgtaccaa ggtgcctgtt ggatggggtc gatcacccgc tcccagtagt tcttcaaccc    125940
     gatggtggtg ggcgcagacg agagggagta gcgagacctg ccgtgttgcc accgttcacg    126000
     cagacgaaga ggtcggggcg tttcactgcg aggagccggg tggccgccaa gacgcgcggt    126060
     acgcgggatt gcgagaatgc agcggtgaat gctgcacaca tttcggacac gcaactgccg    126120
     gcggttgcta cgcgccccgg acagtcaatc ctcgatctct gggtgggcgt ttcgatggtt    126180
     ggaagaaaac cccggcacga tgtcgccggc cagcagcttc tccttcgaca gcaggcctgc    126240
     atcctccagt gcctcgaatt cgggcagctg gcgcagcgtg tcgagcccga actgcgacag    126300
     gaaagtcttc gtcgttacat aggtgtatgg cgcgcccggc tgcggcgagc gcggccccga    126360
     ggcgatgagg tcctgccccc gcagcacgcc gatcaggtcg cgcgacacct ccttgccgaa    126420
     aaagctagac agctcgccgc gcgtgatcgg ctggaaatag gcaatgcaca tcaaaaccag    126480
     tgcctccgcc tgcgacagtt cttttgcccc ctcgcccgct gccgtgccga aggcggcgcg    126540
     gatggcgtcg ccaaaaattt tcttggtccg gtgctgccag ccgccagcga ccgcgaccag    126600
     ttcatagggg cggccggcga gctcggcgcg gatgtcgtcg atgaccagct cgatattgca    126660
     attccttccc accacccgcg cgaggacact gcgtgtcact ggttcatttg ccgcaaagat    126720
     caccgcctcc acccggccca tccactcacg ccagcgcagt tctggcggca ggtgatcgag    126780
     ctcggtgtca agcagcgccg gctgatcgtt cgacttgcgg cgggcagagg cttcgctcat    126840
     cgctagagtc caaacagccg gaaggtggga cggtcggaga gctcgcgcac ggcctccagt    126900
     tgctgcagcc gctcgaacag ccgccgggat gcaaagcgcg acagattctt cgtcgtcagc    126960
     gatccagaga cggcgtcttc gttgaacagc aggaagacca cctcgccggc gcctttggag    127020
     cgcaatttcg gcgccaccgc caggagtttt gcggcgcggc gcgacaactc ggtggccagc    127080
     cggcaggcat cggccgcagc gtgaaccagc gcgacgcaga ccgcccgctc aaaattcttg    127140
     tcccctggcc ggatgcgttt gccgccgccg tcggggcgaa aagccggacc aaaggcctga    127200
     gccatcagca gcggcagggg ctgcggccac cccaggcttt gcgccagcac taggtcggcg    127260
     agccaccaac caaaaagctc ggcatcgggc ctcatggcga cgacgtgagc gacgatcgcc    127320
     gcggcggcga acggcgccgg tcgctgcgac cgcgccaggt tttcaatgtc cctacagagg    127380
     tcggcgagcg ccgcgctctc ccaatggaac ccgagctggt cgagtatctt ttcgagccgg    127440
     tcaggggtag cgacgggcgg ctgtccggcc aactgccgcc aggcgccaaa gatggtgccc    127500
     gcgggtccgg agtcggcccc ggctgggcgc agataccagg cgtcgcgcaa ggcggccgcg    127560
     tcctcggcgc ggccggcgag ccgcatgctg gcggcggcgc agctcagcgc cagccgctgc    127620
     cgccaaacgc cggcccaggc aggctgtgcg cgggcgagcg tgtcgaggac acccagggcg    127680
     gcgccggccc ggaaggcggc ggcgccgtcg ctcggcgcgc cggcgcttgt gatcgcccaa    127740
     gccggaacgg agggcggcgc acccgagctg gcggtcgcgg gatcaaggcg aatcatgatt    127800
     tggagagtaa agtgccggtg cgcttatggc catgactttt gtgccaaaac gcacagcctg    127860
     tcgtgcgtca acaacgaatg ataatgttgc attatcagtc gcttaactct actctttcca    127920
     ctcgcaacaa gttagctgga taacatcact cttcgggcac acccggacga cggtttggtg    127980
     cagccactca cgtcaatccg gacagtcccg tcttctcgtc gcgactatcc cggtacccgg    128040
     tgttggtcac ggcgacctgc ttccgagcca cctttcgaat aggccgagct cggatcacca    128100
     actctaaagc tccgcgtgat tgcctattcg ataaaccctc cgtcaagatt gcagcggcta    128160
     ggagccgccg cagccaaacc gtcacagcgc ccgcccaatc gaacctgaaa tcataccggc    128220
     cggcggactt gcacgggggc cgtcagtgga gcaggcgcgt gaaagagcac atgaaatagg    128280
     tgtatcgcca atattttcgt attgctctaa tcgattatag ttgtgaagcg caatttcagc    128340
     ccgtttactt gccgctcaag tcacgcataa aagaaggtag caccgattcg gtagcttatc    128400
     ccctgtcttt tgcgtactcg cggcccgtgg cgccgagtgg acgattgaag atcgccggtc    128460
     tcactagcgg gtgggcacaa gcgcctgggg ccggttggca agccacagga gtaggacaaa    128520
     tgtcgaagga ttcgggtaag ggcgatcacg gcggcgggcc aggcaagatc gagatcacgg    128580
     tggtggtgaa cggccagccc acgcaggtcg aagccaatcc caaccagccg cttcacgtcg    128640
     ttcgtgccaa agcccttgag aacacgcaga acgtcgccca gccggccgag aattgggaat    128700
     tcaaggatga ggccggcaac ctgctcgacg tggacaaaaa agttggcgat ttcggtttcg    128760
     cgaacattgt gaccctgttc ctcagcctga aggcgggtgt agcaggtgcc tgaaatccag    128820
     actgtggacc ctgcggtctc gcgagcgaaa ttcgatcggc agatcggctg gttccaaacg    128880
     caagcgggcg cttaccgggc tcagggttgt ttcctgatcg aggcgagatt ccctactgcc    128940
     ttcttcatct tcgcaccgcc caagataagg ccacagataa tcggtgcagc tgtcgagatc    129000
     gacttctcca attacgacct ccgacctccg tcggtagtct tcgtcgaccc ctttacccgc    129060
     cggccggttg cccgcaagga tttactgcta agtatgctca gacgaccgca tctacccgga    129120
     accccaccgg gtatgatttc ggtcctcatg cagcagaaag ctctgtcgct atcggacttc    129180
     ctccaggcca acagtgcgga acatacgcca ttcctgtgca tggcaggcgt ccgggaatac    129240
     cacgacaatc cagcccattc aggtgactca tggcttctcc accggggttc tggcgaaggc    129300
     tgtttggcct ttatcctgga caagatcatc aagtacggga ccggccccgt ggagcagata    129360
     cagtatcagt tccaaatctc agtgggagcg atggtagtac ccccatccgc catcccggaa    129420
     tgagcgtttt gatggatgta acgaccgtga cgctcccgcg ccactgcatc tcgactgtgc    129480
     atgcgcatct gcgctcggtt ggtcgcgaag gcaatgaggg gatggcgctc tgggtcggcg    129540
     ttcagcaaga ccagcatttt gccgtaacag agaccgttat cccggcgcag cgtcacattc    129600
     ggacgggcga tggtgtttgc gtgatggttc cggccgagga actgcaccgg cttaatgtct    129660
     ggctctacaa tagcggcctg aaactcttgg cccagatcca tagccatccg ggccgagcct    129720
     accattcgac gaccgacgat gcttatgcgg ttgctaccac ggttgggtgt ctgtcgctgg    129780
     tagtgccgaa tttcgcccgc gagcctttcg attttgctcg agtcgccgcc tatcggctcg    129840
     acggaaaagc caactggaat gcgctccctt ccgcggcact gtcgcgaatg atcacaataa    129900
     cgagttgaac aatggcactc gctaacttta tcggccgcgc cgccacggcg gcatctaggt    129960
     cctagccgat tttcatctgg aggactttaa agcagctctt gaaaagcagg tcgtggccgt    130020
     cgcctttgac gatcaagccg cttcctgcgc cgaaggccag gcgacactag atcttgcggt    130080
     gaggttgctc gccaggctct atccagttct ggcgatactc ccgctgggca gcgcggcaag    130140
     ctctcaagcc caagcgctgg agcgcttggc aaagtcgata aatccaaaag ttggcatccg    130200
     gcgttccggc aagtctgcca ccatctgcgt agttgcaggg gtgacgcgcc caccactccg    130260
     gtgcccgacc tttttcatgg gatcggacgg ttgggcggca aagctgtcgc gtacggaccc    130320
     ggtgggctcc ggctcgagtt tgctgcccta tggagctggc gccgccagtt gcttcggcgc    130380
     cgccaacgtc tttcgaacca tcttcgccgc ccagctgacc ggcgccgagt tagacgaaac    130440
     catcgacctc tcgttataca gctacgacaa gaccagagcc ggcgaggcag gcccgatcga    130500
     catacctgtc gaccttggcg aaacgcacct cgttgggctc ggtgcgatag gccatggctc    130560
     gctttgggcg ctagcgagac aacccggtct cactggtcgt ctgcatgtaa tcgatcacga    130620
     agcaatcgaa ctctcaaacc tgcagcgcta cgccttggcc ggccaggcgg agattggcat    130680
     gtccaaggcg gttcttgcag ccaccgccct tagatcgacg gcccttgggg tcgaggcgca    130740
     cccgctgacg tgggcagaat atgttgcgcg ccacggcgac tgggtcttcg accgagtggg    130800
     tgtggcgctt gacaccgccg ccgaccgtct ggcggtccaa ggtgctctgc cccgatggat    130860
     cgcgaatgcc tggacgcagg agcacgacct cggcatctcg cggcacgggt tcgatgacgg    130920
     ccaagcttgc ctttgttgca tgtacctgcc gtccgggaaa tccaaggacg agcaccagct    130980
     gattgccgag gaactcggaa taccggaagc acacgagcag gtgaaaacgc tcctgcagac    131040
     caatgccgga gttcccaacg actttgtagt tcgggtggct acagcgatgg ctgtgccgtt    131100
     tgaaccgcta gccccgtttg ttggccagcc cctgcgttcc ttttatcagc aggctatctg    131160
     cggcggtctg gtgttccagc tcagtgatgg aagtcgccgc gttcgaaccg tggttccgat    131220
     ggccttccag tcagcgcttg ccgggattat gcttgccgcc gagctcgtca aacatagcgc    131280
     gggttttccc gtgggcccaa cgacgagcac tcgggtgaat cttctgcgcc cacttggctc    131340
     ccacttgcac gatccgaagg ccaaggattc cagcggccgc tgcatctgta gcgatgacga    131400
     tttcattgcc gcttacaggc gcaaatacgg caagagcgtc gtacagctaa gcgatgtctc    131460
     cgccgcctaa gcagacgcgc gaatgtctcc gttgccgccg agcggcgatg tgcgcgccac    131520
     tacgaaacgc tatgtccgct cctctgccgt ccgagggtcc atgagatagc ctccccacgc    131580
     gccacaccgg aaacctcctt tccgatgtac cgatcaagca ccggcctcca tggcacgagc    131640
     gtgaactcgc gcgacttctc gatcacggca tatttgccgc tggcaagctc gaccgatcgg    131700
     cgcagcgtgc cttctattcg ttctccaggc tgcgcttcgg catacgagag accgagctga    131760
     tccgacagct ggccggcgac acggttcagc tcgcgctggc gcaggatcga aatcatgttg    131820
     gcacgataga cgacccggtc ctgttcttcg tgcgcgaggc cttgcgcgat cagccactgc    131880
     cgccgacggg catgcgcctc ccgcacctca tgcccgaagc ctgagttgcg caacggctcc    131940
     ggtctctcgg caaccaggtt ccggtcgagc caggtggcgc cttcgaagct gacttggcgt    132000
     tccagcggca ttgatgagag cttctcgact atcacaggct cgaccctggc ccgcaggcgc    132060
     tcgtattccg cgacacgatc gagatgatcc ggcgcgatga tccaagtgcc attcggctcg    132120
     cgctccacgc cgccggtgga gcgccggatc gcctccagcc ggcggatatg cgtctcggca    132180
     aagctttcgg tggcgaacgc atcatgcttg aggtgcatat cgacgctgta acggccgccg    132240
     tgtgcggtag cgatgtcggc gattgtacgg tcgacttgcc tgggcttggt atccctcgac    132300
     gtgacacgca cgatgcagcc gtcgggcgtc ggttctgtca actcgccttt gccgatgtct    132360
     atccaatggc ttttgccgtc aacgccgtcg acgatgaggt aatgccgatc gttgatttcg    132420
     tcggcgagcc cgcgcgcggc gaggcggccg acgaccggtg gggagggctc ttcacgtcga    132480
     tcgtggacaa ggtaatcggc ggcactgcga gcgagcccct tgccagtcag ctcgcggtgc    132540
     atggtcttga tgatgtcgcc gcgttcgccg gtgcggcgca gcgtggcttc cagctcatca    132600
     tccaggcgcc agcggaccgg gtcgacctcc tcggctaagc ccatccgctc gagcttgcgc    132660
     agacggcctt gatgcagcgt ctggcgaaag gcgtcgcggc cgtccgtaga aacaagtcgg    132720
     tcctcatcgc gcatgcgcag cagctgccgg tcgatgctgg tgaagcgttc ctgctccatt    132780
     tcctggcgca agcgctgttc aatctcgcgg tcggtgcggg gaccgaggtc gaggctcacc    132840
     agttcggccg cccgctcgcg aatgccgctc gaaatatact cccgcgcgat gacgaggttt    132900
     tcgccgcgat catccttgcc gcggacaatg atatgggtgt gcggatggcc ggtgttgaaa    132960
     tggtcgacgg caacccagtc gagcttcgta ccgaggtcct cttgcatctg cgccatgaga    133020
     cggcgggcga gcggcttgag gtcgtcatag tcgataccat cctcgggagc gacgatgaag    133080
     cggaattgat gccggtcgct atccgcgcga tcgacgaagg ccttactgtc gatgcgatca    133140
     ctgccggggc catagagttt gccgggttcg ccttccctgg tgacgccatc gcgctggatg    133200
     tagcgcagat gcgcacgcgc tcggtccgaa cccttgccgg ccagcttcac aatccgcgcc    133260
     ttgaccatca cccgccgctg ccggaaggcg gcataccggt cgcgtgactt gagcagcgcg    133320
     gccgccgccc cgccccggcc tgtccggctc cccgtgaagc gaccgccgcg ctggaggcgg    133380
     ccgccggctc ggttgatcgc tgccttgacc tggccggcat agcgcttgcc tgctttcgag    133440
     ccgcgcgagc cgatcttgcc gagcttcggc ctgaactcat cgtcctgcat accagcctcc    133500
     gggcaaattc aagcgaaacc tgagtctcgc tggcccaccc tcctggcgcc gccggcagcc    133560
     tccggcaaaa acgatgtgca gacaaaggct tcgccgcctc atggaggcgg tgcctttatc    133620
     ttgccttacg cgcccctcgc cttaagcgtc cctggcccct cccggatgcc ctcaacatcg    133680
     ctagccattg tgcttctttg gccgcgcgag atccctgccg agcggcacga aaaggccgcc    133740
     attcgtttca ccggcgcgaa caccgtcgcg aaggaagaac aaagagcgtc cggagggagc    133800
     gttccgcccc tttgaagttg tggattggcc tttgaattcg ttcatgtcgg ccgccgaaat    133860
     ccccgtcgcc tcaagctgtt tcagataggc aacggtctct ttcggcagcg gccttcgaag    133920
     cttcaaatgg ccttcatagc gctcgggtcc agcgttgtag gcggcaaaca ggccggggaa    133980
     tccgaaacgc ttatacatgg cgctgagata ggcggttccg gccaagatgt tgtcgcgcgg    134040
     atcgtgcggg tcggctccca gaccgtgctc gacgcgcatc tcctgatagg tgccgggcat    134100
     cacctgcata agacccatgg cgccggcgcg ggaggtgatg ggacggccat cgaggacggt    134160
     cttgccgcgg ctttcggcat cgatgacggc gcaaatccag gcctggggaa tgtggaagcg    134220
     tgcgcttgct tccgatacga agtgctgcca tcgttgcagc tgcggacttt gggagatgac    134280
     ggctggctca gcgccggtcg aggcggaaca ggcgcatggc gcgacggcga tcatgccgag    134340
     catcaggagg gtcactcggt ccatagcggc accagcctcc cgatgatgtt ttcggccggc    134400
     accggcccga aatagcgact gtcgaaggag tgattttttt cgttgccgag caggaaaacc    134460
     tcgtcatggg cgagcgctcg gcagccgttc caccagggca gcggacggcc ttgcgtgtcg    134520
     attttgagcc gacgggcgac gatctcgccg cctatgatga tggcattact aaaggcgcag    134580
     acatgctcgt ccggcagcgc ggcgagacgc ttcaccagcg gtgtattgcg aggcagataa    134640
     ccgcgttggt cggcgagata ggcaacgaag ccaggcgggc gggcgagcac aagatcgccg    134700
     cgcgcaggcg tgccagaccc aacgcgatag agaccgaccg gcgcgctagc cgaggcgttc    134760
     cagaccagca agggagacgg ctttgggagc gccgtgaagc ctgtcaggct caggccaatc    134820
     gcggcgatgg cgattgcctt gcgcgcccga acgcgccgca aacggctgcc gatcagatgg    134880
     atggaaggcc gctggctcat gagcgggctc cctcgtcggc tgagccggac ccgcccttgt    134940
     catcgtcgga gccgggttct ggcgggcggc ctttcgacca gtcgtcgagt tcgtcgatgt    135000
     ggtagcggac atagcggcca tgcttgcggt atttcgggcc gccgccggtc agccgcatct    135060
     tttccagggt gcgctgggac aggccgatat agaaggcagc ctgcgcggtg ttcagaaacg    135120
     gactgccctt cttggcgcgg gccgcgcggt cgttttcgtc gtccatgatg gtcctcgttt    135180
     cgcttcggac aagcaaccgc gaggatcggc gaacgaggtc gtcgtgggga cgggcgaaga    135240
     gtcgggtggg agttttcgcc gccccttcgg gcgagcgtcg gcgggaaccc ccgcgccgag    135300
     ttgcggcgcg agggcttgag ccggccggtc agtcggccgg gttccagatg acggcgtagg    135360
     tgtcttgatc gtcttggccg gcggcgcggc cgagattggc gtagagcttg cgcggaccga    135420
     actccggtgc ggcgatggac aagctcacat agtcgttgcc ggaagtctcc ccggttcgga    135480
     cccagccggc gccgacctcc acgccctgcg tcagcacccg gaagtcggga tggttgtcgg    135540
     cggacttgct ccgattgggc acgatgtcga tgtcggcgcg gacgctgagt gtcctgagct    135600
     ggcctttgta gctgccgttt tcctgcttgt tgacgtaacc gatcgcggtc attttcctgt    135660
     ctccttttgc tgtcgccggg gaccattccc ctgcgatggc ggaccgtgat gggcgcgtcc    135720
     ggaccacccg aacccggcag ggccgcagcg gcagcgaagg acccgagcgg gcagcttttt    135780
     tgaagcgaag cgggcgcgag gaagccgcgt catgcggcgg ggaaaaaagc tggtggcgag    135840
     ggtttcgggc gggctggaac cgcccatagg tcaatgagcc agccgcaggg gaatagtcct    135900
     caagacgtgt ggggacaggt cgcgtgatcg ggtgagcaca acaagcgatc ggaacgcgtg    135960
     cggcgggttc cgcgcgctca acaccgtgcc ggatcgataa atgtgcccgt gcaccggagc    136020
     cccagcaggc atctcggcgt ggtaatcgag cactgacaaa ggcgagcttt ggcggccgga    136080
     tgttgttgcc ggaagcgggg tccaaggggc ggaacgtgca gccaacgcgc cccggagagg    136140
     cgccaacccg cggctatcga cgagccgcct cggcatggcg gactcattcg agggtaacag    136200
     cgaccgggcc ttggcccatt gatcggcggt cggaagccgc cgcgtttcgt gtgttttcgg    136260
     ttgggaactt ggtcgaatcc gcgccagcag gttccattgg agcgaaaccg atcgtctcgg    136320
     cgtgatcgag gaattcgacc acattgatac cgatggcctt cgcgaggtcc gcctggctga    136380
     gaccagacgc ttttctttta tcgacgcgga catacccggg tgatcggcca gccgccatcc    136440
     gccaaggtta ggtcgttcct agcggcgcgg cgggcacggc tgagcccgcg tccgaagtcg    136500
     acgaggaaag ggtattgctc ccccgatttc cgaagaaggc cactggtcgc aattgcccct    136560
     gtgggccgtg gcgatctttt ggtcgcgctt gcgacattct tgtcagcctt cgcgacacaa    136620
     caatgttttc ggataggcgc gcacgaggga gcaaatcaag gaatctcaat catgcaaacg    136680
     ccgtgacgcc cagccggact cgatcctcac ggcgtggaga ccggcgcgcc gtgctgaaga    136740
     gctcgaaggt gtcaaaggcc ttcctcgaca gggggagcag caacagcgcg atcgtaggcg    136800
     cgacggccgc gtcttcgcag atcgcagccc gcgcacgcaa ttacacgcaa gagacaaagc    136860
     cttacgcggt cgatgccggc gtgcggcaat gcatcggctc ggcccgtccg gaacggtttt    136920
     cgccttccct tgccggtgcg gaagttctga ctactccgac agtacagcac ctttgctcgg    136980
     tccgggtgac cacgcgattg tgcggcgcgc tcggtctcgg tcaaggcacg gcgcccctgc    137040
     tcaagccgac agggcttcgg caaaagatag tccgattcgg tgcccccaag tgaaatggca    137100
     tagcgcttgc tgttatccgt tagagcccac caaagcacgt agaaagctat gaacagaacc    137160
     atggcaaaaa cgcgaagttc catacaagcg cccaaggaga ccgtgcacgt ttgcgccgaa    137220
     cgtcccctcc agacgtccct cctccggtat ctgatttgct atggctggtt cgagactgac    137280
     ggagccgtgg cgctcgccca attgtcgctt acccgcctcc gccaggagga tgcctttttt    137340
     ggaacacggc atcgaccaag tgcggcctcc cgggcccagg actgtcgtcg acgcgatcaa    137400
     agtgcatcag gcgacggtaa gccgggtgac gtcgaacaca tacatgcaga ccccgcgcga    137460
     agtgttcgaa ctgaagtatt ttttcaccgt cgcgagcgcg tcctcccaag gtggcgacgc    137520
     gcggtccccc ccgaagctgt ccgccatcgg atcaaggcga caatcgccga cgaatcgcaa    137580
     gatgacgtgc tttccgacga cgacatcgtc gtccggccca aggaaagggc catcgatttg    137640
     cgcgccgcac cgtcacaaaa tatcgcgaag cgatgaacat cccctcgtcc gtgcaatgcc    137700
     gcagggaatg gcgcttctgg cgttaatccg ggtcaacgca gcaacccgag tttgcagcac    137760
     atccaaactg gagaccctgt tgatgaccga atccgctacg ggcttcatgg acggagttct    137820
     gcatgaccca aaacagccag atcaacggtc tggtcccgca tggggtgcag tcatttcgct    137880
     tgccttaggc acctttgggc ttgtgacggc agagtttctg cctgccagcg tgctgacgcc    137940
     gctcgcgcat gatctctcta tcaccgaggg tgcagttgga caggcgctga caacgaccgc    138000
     catcgtgggg gcgatctcgg cgcccacgat ggccgtcatc acaaggcccc tggaccgcag    138060
     gatcgtcata tgggcgatga cgctgctgct gatcctgtcg aacgttctat cggccgtcgc    138120
     ggggtcgctg ccggttctcc tggccgcccg cgtcgtgctc ggcatagcac tcggagggtt    138180
     ctggtcgatt tcggcagcgc tggcgatgcg gctcgttcca agtcacctcc tgcggcgcgc    138240
     catgtcgatc atcctcaccg gcgttacctg cgctaccgtt tgcgcggctc caatcggcgc    138300
     ctatgtcggc gatatctggg gatggcgaac cgccttcatg atcgctgcgg tcgtcggcgc    138360
     cgttacgctg gtagcgcaac tcataaccat tccgaggctg cctccgattg gagtggccag    138420
     cttccgcagt ctgctggatg tggccaagaa tccgatgatc aaagtcgcga tgttggtcgt    138480
     cctgctggtc gcttccgggc acttcgccgg cttcacctat atccgcgcct tccttgagaa    138540
     gtttcccgcg cttgatatcg agacgatctc gctggtgttg ctcgtctttg gcatcggcgg    138600
     cttcttcggc aatttggccg gcggattcct ggccgagcac agcctcaagg cagccgcggc    138660
     cctgccgccc ctgctcatag cgatggccac tgtctcgctg ctgacgctgg gagcatcggc    138720
     ttgggccacg gcgattgcgg ttacagtatg gggctttgcc ttcggcgcgg tgccggtggg    138780
     actgcagaca tggatggtgc tgcacgccgc tcccgagcag gccgaaagcg ccggtgggct    138840
     gatggccgca acgttccagg tagccatcgc agcgggcgcg attttcggcg gactactgat    138900
     ggacaatgcc ggcgtcgcca gttcccttgc ctacagcgcc gttgcctcgt tcctcggcgc    138960
     cctgacagtg ttcttgctcg gcccgaagcg cgaacctcag accacctgac agagaggcca    139020
     tcagtgcagc gcgggaaaga tgcaatcatc agccgcgcgg tgcgatccta cgcacgattt    139080
     ttggcggttg caggcctcgt ctccgggtga tcggacgctg ttgtccggtc gatttcgacc    139140
     ggcgggggcg tttcgaatga tggtgccgac gagagaacct aagagtgcgg gaccgaaccg    139200
     gaccgcctcg tccgtcgacc gctctggcat ggcgacgcgg tctatgcggc tctgtcttgc    139260
     ggcgagcatc gggcggatcg cgcgcctgat ctcttacatg aagctcgggg ccgaacatgc    139320
     cccgcggctt ctgattcggc ccgaaataga ggatcgttcg gcgatatcgt agttgtattc    139380
     accaactgtg atccagccgc gattgaacgt cgacagcccc gcgcggcgga tttccagcgg    139440
     cggaacctca tgcgccgcct gcccttggta aggcggctta ccggaattcg gcaggacgac    139500
     gagacgagtt atctcacgct cagtatcccc gcaattcggt gcggcgcatg gcgaaaacct    139560
     tcagcctcgc atagcttgcg gtaaaagtac ttcttccact tcatgttttt ggtgttgccg    139620
     gctgccagca tggggaaaca cgtggcacgc cgtcatgcaa aatcatcgaa tgtgcgtcag    139680
     acccaatttt gcacgccggt tcgcacccgt atgaggcgct gagtaaatcg agactgagac    139740
     caggagtgcc cgcgacttca catgcgggat gcctcctgca acattatctg ccgcatccag    139800
     atgcttgccg gatcactgtt gtggagggtg ggccattgga cggcctcggt gaacgtggga    139860
     agtggccgcg gaagttcgat gatccgcaag gggaaggttt ttttgaaatg ctgaaccagc    139920
     cggaagggca tggtcgctat ccgagctgtg cctgagacca tcggcgggat catgctaaag    139980
     gcctgtacga cgatctcaac acgtctcttg agaccatgct caagcaaaaa ctgttcctcg    140040
     atggatggca tctgggcacc gccgaccctg aacgcaatgt gtttcatcga cacgtatctc    140100
     tcgaatgtaa gctgacgtgg caactgcttg ttcgtggggc agcccacgca cacgaatgtc    140160
     tcgtcgaaca gcgccgctct tggatgggcg ctcgacatga aaaattccgg aagaatcaca    140220
     aaatcgacgt caccgcgccg gagaagctca tcggggtcgt tgtcgagcgg ccgcaattcg    140280
     aagctgacgg cgggtgcttc gcgtgcaacc cgctccacga ccttttcaaa aaacacgagt    140340
     gtggcgaaat cggaaagaat gatcctgaag cggcgattgg attgagccgg attaaacgga    140400
     tcccaagaaa taatcgagca ttggatgtgc aagagtgcgc cacgaactgc gggggcgagt    140460
     gtttccgcac gcggggttag aacacgttcg cggccgctca tcgtaaacag ttcatcgttg    140520
     aaatagttgc gcagccgggc gacggccgcg ctcatggccg gctgactaag gttgatgctg    140580
     cttgccgcgg ccgtgaggtt gcgcgcggtt agcagtgcgt cgagcacgac gagaaggttc    140640
     agatcaaggc ctttgaaacg catgcctcat ctgtccgtaa cgtggttgtt tgtcatcgtg    140700
     accattatgg gcgctcgttt acggtcccac tcagaggtgt tgtgtcccga cctgccgccc    140760
     gcgcgcgtgg aggcgcggcc gatgagcgaa tggccgaccg gtacaacagt cgatcggata    140820
     ggtccggagc tatgaaacat gtcgattaca gatgcgaatt tttcacgtgg ctaattgatt    140880
     acagattgag atttgagcag acttgggcgt ggcggcgctc cgacaacgat ccgcgacaca    140940
     tatccgaggt tgcgcgcaat actgcgaatt gccatcgcta tgacgacaat cgccactcca    141000
     agcacagttg cgaaggcgat tctggtcgcg agattccaga cttctccaaa ctgtatcaaa    141060
     tccatgagac gaaacacggc accctggacc aggtaaagca gcagcgtgct ctgaccaagc    141120
     tgcaccgcga caaagcgagc tactctagtc gaatagacaa gtctccagca ttggaacata    141180
     gactgcattg ctaccgcaga agccgccaaa gatccagaga acatcagaaa aacttgttta    141240
     gctgactgtt catcatgaat taaaacgaga ttgttgtagg cataagtctc cttgccccac    141300
     ccgaggaagc atatgaaagc cgctatcgaa aataagacaa caaaaatcga tttgtaacgc    141360
     cagatgacgc cattctgcca tccgatcggc tgggcaaaca ggaaccctaa acaataaaat    141420
     gggtaagtgt attttaacaa cggggttatt gataacgtga tgggtgcgaa tgcgaccgca    141480
     attgcagatg cgcttatgat ccacatcgat agacggttga acgttgtaag aactctaatc    141540
     agaacgaacg aaataaatgc ggcccatatg aaccagtaag ttccaataac ttccgtcgac    141600
     aaatctaaca gagtatcagt caaactcttc gttggaaaaa taacggcgga ctttaacgtc    141660
     caaatcaacg tacaccaaaa tagcattggc agtagtagct gcattgcccg ctcaccgaca    141720
     ccctgggtga acgattttcg caaaattgcc ccagaagaaa ggtatccgct tatcgccata    141780
     aatagaggca tatgaaacat gtagatcgac ttgaaatacg gcgacagcca gaaagcgtcg    141840
     gtgccctggt agattaaata ctgtaacaag tgcccaatta tcaccaaagt aatgagtatg    141900
     cctttggcga aatcaaagct taggtctcgg ttgtttgtcc ctgctgggca cgagccgtgt    141960
     cccttcgctc cggctcttat gtgatcaagc atcagactcc agcctatctg ttgcagttgc    142020
     tacttgccgt ttctgggcac ggcgagcgcg gtgcaaagga tcgaaaatca cgcggatcgc    142080
     ggcgtggtat ggagggccga ttggctgcaa ccgagcggac aaaatcccag tgcctgatcg    142140
     caaacctcga gcgcattggc ggtcgcgatc atgtgtggcg atgcgaacgc ccggcactat    142200
     ggtcgtctgg ccgtctctgc agaacctctc aagatggttt cgcagcgggt gccgaaccat    142260
     gccaaaagcg aatggaatgc cacgctgctg cagcaccgga cgcatgacgc ggatagaatg    142320
     gctcattccg agtctctcaa gatcggggtg catcctgtac gatccgagtt tgcctaccaa    142380
     gaaatcaacc tcgccaaccg tgaagaaatg gcgcagcagg tcctagtgag ctgctacgcc    142440
     gtgcacatca gagccgattg cgcgaacctt cggccctgca ccggcccagc tactaccgcc    142500
     tgaaagcccc tgtcgcccat gggccttttg gaagaaggcg gagagttcga catgaccggc    142560
     tacttgcaag tcatttccca gcacacgctg cagaagcagt ggcgtggtcg ggcgcatgcc    142620
     aagtgcggtc atctatgcag cgccctggaa gtttggtaaa atcgattgtt tagatcgcga    142680
     gcatccacgc tatggataag tgaaagccat gcgcttcaaa ggccttgatc tgaatcttct    142740
     cgtcgtgctc gacgcactgc tgaccgagcg gaccctcacg gcggcggcaa gcagcatcaa    142800
     ccttagtcag ccggccatga gcgcggccgt cgcccggctg cgcgactatt tcaacgatga    142860
     actgtttacg acgagcggcc gcgaacgtgt tctaaccccg cgtgcggaaa cactcgcccc    142920
     cgcagttcgc agcgcactct tgcaaatcca gtgctcgatt atctcttggg atccgtttaa    142980
     tccggctcaa tccgatcgcc gtttcaggat cattctttcc gatttcgcca cactcgtgtt    143040
     ttttgaaaag gtcgtggagc gggttgcaag cgaagcaccc gccgtcagct tcgaattgtt    143100
     gcctatcgac gacgaccccg atgagcttct ccggcgcggt gacgtcgatt ttctgatttt    143160
     tccagaattg ttcatgtcaa gtgcccatcc aagagcggcg ctgttcgacg acacgctcgt    143220
     gtgcgtgggc tgctccacga acaagcagct accacggcag cttacattcg agagatacat    143280
     gtcgatgagg cacgttgcgg tcaagttcgg gcggacgctg aagccctcca tcgaggaaca    143340
     gttttttctt gagcatggtc tcaagagacg tgtcgagatc gttgtgcagg cctttagcat    143400
     gatcccgccg atggtctcag gcacagctcg tatagcgacc atgcccttcc ggctggttca    143460
     gcatttcaaa aaaaccttcc ccctgcggat catccacctt ccgctgccgc ttcccgcatt    143520
     caccgaggcc gttcaatggc ccgcccttca caacagtgat ccggcaagca tctggctgcg    143580
     agagatattg ctacaggagg cgtctcgaat gacttctccg ggggacgcca aaaggcgccc    143640
     taagcagccc taatttactc ccgcgtctca cgccggcact cgcgtcaata gcccgtgtcg    143700
     gaagagagcg atgctcgcgg caattgcgcc tgcgaggtcg tccagcgggt gggctgcgtc    143760
     gacaaacggt gcgaatgaga agggcccccc atagccgcca tcaagcagcg cccggatctg    143820
     gctgccattg tcggaaccga ctaggacgcg atccgggtaa atccagtgga tcggatcgtt    143880
     cacgcttgaa atgtggacga gaccggtcag ctcggaggag aagaacgcct ccccggcaag    143940
     cgtgtggtgg aacgtgtcgt gcacgaggcg gaagacggat tggccatcaa tggcggcaat    144000
     ggccttagcc gcttcgttct tcgatcgaag cgagcaggtc cggaagccca gcggctcgat    144060
     gagaccgatc agaccgcgcg actggaggat cggcttgagc gccttcaagg cgacgcggag    144120
     atcgccccgg cgctcgacat tggcgggcca ggagccgccg ttgaccggca ccagcatgag    144180
     cgccgtggct ccgcaggccg ctgcataatc ggcgagcttg ctcgcctcgg ccctgcgggc    144240
     gggcgtccac tcattgaagc gctggagggc attgacggaa ataatcccaa cgcctgtgtc    144300
     ggcggccgca gaccggacgt ccgccgccgg ctcgccgcgt gccatagcat tgctgcccgg    144360
     ttggccgcgg atctggacat cggttaggcc ctggtcgcgg gcaaaagcga aaagtgccct    144420
     gacgtcaagt ccgggcgtcg ccatataatc gagtgcaaag cggggcgatg cttggcgcat    144480
     ggcttggctt tccttccatg aaacgggcgt cattctcggc tgactggctt ctaccgtgcg    144540
     ttgattagcg agggccgata tgatgggcat gagcgaggcg aggcagtcgt actcacgttt    144600
     ctctcacgct atgtttttct ctcatttatg agccgacgtt cacccaaacg gcggtgccgc    144660
     gcctcctgag acatggcttg aataggtgca atgaccgaac tggctcgcag ccatccaact    144720
     gctttcgcaa ggtacccgcc aaccctgaaa gatgcccaat cgatcagatt caaagtcagg    144780
     cagcagggtg tttcgccaga gcgaggccga cgcccagcgc gatcatcgcg ccgcctgacg    144840
     cctccctcag gcggcggatc aacccgggac gcgctgccgc gccgtcttga atgccgctgg    144900
     ccacgacggc aaccacgatg tcggcgagcg tgttgagcgc aatggacacg gagccaagca    144960
     ccgcgaattg cagagctacg agccctgcgc tcggattcac gaactgcgga atgaaggcga    145020
     ggaagaagac tgccgtcttc gggttgagcg cctcgaccag taccccttca cgaaacgccc    145080
     gccggggtcc gactggaccc actgcggcgc cgtcatcgcc gccagtcgct cccttgaggc    145140
     gggcggcttg aaaggtgcga aagccgagcc agacgaggta gaccgcgccg aacagcttta    145200
     atgcggagaa cagttccgag ctctcgagca cgatcgcgga aacacctaag cttgcggcga    145260
     ggacgtggat catgcccccc aaccccgtgc cgaagctgga agcgatacct tcccgacgac    145320
     caccggcgag cgtgcgcgcg gcaacgtaga agatgcccgg accgggggtg atggcgagca    145380
     cggaggccgc ggcgaggtac agggcgagtg gggtcagttc tggcatgatg gtcgattccg    145440
     acgaagttca tgattatttt gggatgagag cggcgacgtc gcggtcagat gcccgctcgc    145500
     tcgccgcaag gcccgccgcc acgccagcgc ggtcggccgc gttccggttc tggctcattt    145560
     tgcgcttgcc ctccaacctc gtgattggca tgcgcaggcc gacgattccg cggagttgcg    145620
     cctgtacaaa atccggcggc gcgtccgaca cggcccaagg cgaggcgcgc tcgccctcgt    145680
     ggtggtcggt cagccgattc acgacgtcca gcagtcttcc cgcatcctcg aagaactcga    145740
     ccgggccata ggcgtggacg gcgacgtaat tccaggtcgg gacgaccttc ccggtttccc    145800
     gcttggtcgc ataccatgcc ggcgtcacgt aagcgtccgg ccccatgaag atggccaagc    145860
     cgtcgcccag cggcggaaca cggcactggg gattggcctt cgccaggtgc ccgtagatca    145920
     cgccgtgctc gccctcgttc tcgttaagga agaggggcag tggcgttgcg agcggccctt    145980
     ccgccgtgac ggtaacgaag ttcgccagca gcgccgcgcg aatggtcgcg cgcaggcatt    146040
     ccttgtcgtc gtcgcggaaa gcgggaggga tgtacatcgc gaaactcctt gcgttaccaa    146100
     gtcaggtatc ggcaagctgg cctgctggaa acagccagtc agaagctatt gaggtagtcc    146160
     agttgatgaa agatggcatc gcgcgccgga tcagagcacc ggaatccccg gtgccggtcc    146220
     acggtatgcg aattgcttgc caaacctttt cgacgcagcc agcgatcccg cagggtcgcg    146280
     ctatgtgagc ctgcggcaag cccaatgaaa tcgatccaac gcgaagtgaa ccatacattc    146340
     aaacaatcgt cgaagagtga acctaccggc ggtgctgggc catgccgagg gcgtgcgcgg    146400
     gtcctcatcg tagcagctga caacagacgt ctacgcttag ccaactgtcg gagccgacca    146460
     gttcgtccga tgtcaacgaa gtgcttgttc gcagggcgta aacggcctgt aagccttcat    146520
     aagcgagacc acacaggtac tggctgggaa agcaggtcca tgcgatctcg catttcagtg    146580
     atgttctgga agcgagcgaa tttcatatcc gcaggcatct aatgcaggaa tcagattgga    146640
     cagcgccata acggtctggt tgcgcagact ggcttgagtg ctccgtgtcg actcgtcggg    146700
     agggcatccg tcgtgcaaga gcacgattgc gccggggcgt accgaggcga gcactgcatc    146760
     gacgatcgcg tcggtgccgg ggcgcgacca gtctcttggg tcgatcgacc aatgaagggc    146820
     cgccagccct gcgatctctg aggcagtgag cacttcttcg ctccaggcgc cgtatggcgc    146880
     gcgaatgtag cggatcgagg cctgcgggca tgctagcatg atggcctggt tcgcctcaaa    146940
     tacctcacgt tgcacttcgc ccaagccgca cttggacagg tccggatgag acatcgtgtg    147000
     gttgcctacc tcatgccctt ctgcgatcat tcgctggatg agatccggat gctctgcggc    147060
     gtaagcacca atgacgaaga atgtcgctgg cacccgattt tgcgccagca catcgagtat    147120
     ctgtggtgtg aaacatggat ttggaccgtc gtcaaacgtc agatagacgc ttcgacgccc    147180
     ggtgccgtca gcgcattcac tctgcacctc ccatctgtca tcgagacgtc tcatagctgc    147240
     gaacccttgc ggtcaattgt tgtaccggtc ggccattcgc aatcggcata accccgatcc    147300
     ttgaggtagg ggcctacgct atcggaggga gcttgtcgcg aagagccgac gcgatgcagc    147360
     ttgccccgat caccgatgta cctggtcgaa aaggggatcg gctcgcttga tgttcggcgc    147420
     agaccacacc agaaaatgct cctcggagcc aacgcatgca tcgacaatct ccttagggct    147480
     gcatccttga attcttccta tgggacgttc tgtcgaatcg gcaaaatcga ttgtttcgat    147540
     gacaagcatc cacgttgcgg atagatgaga caaaggcttg gatcgcgcgc aacctcacgg    147600
     cggcagcagc atcaacctta gtcagccggc catgagcgcg gccgtcgccc ggtcgcgcga    147660
     ctatttcaac gatgaactgt ttatgatgag cggccgcgaa tgcgttctaa cccgcgtgcg    147720
     gaaccgtcag cgtctcagag tcgagcgacg acgtcgcgca gcatctcgac gcctttttcg    147780
     atctgccgga tgctcagggc ggaatagccc atgacaagcc cgacgcggtc ggcttcgcct    147840
     gctcccgact gccgatgata aagcggcgaa atcgggtgca gacccagacc cgcgtattgg    147900
     gcagcttcga ccaacgccgt ttcacgcgat cgcggcaggt cgttgaacca tatgacgacg    147960
     tgcagtccag cctctgcccc ctggacggcg atccgacctt gaaaactccg cttcagggcg    148020
     gtcagcaatg cctcccggcg ctcgccgttg atgcggcgca cgcggcgcac atggctttca    148080
     tagccaccgc tctcgatcag agaggccaat gactcctgcc ccgccatcgg agaatgccgg    148140
     tcggcaagct gcttggcggt ttcgaaaacc tgcaggaatt ccgccgggac gacgagataa    148200
     ccgatccgca gcatcggcga gagcgtcttt gagatggtgc cgaggtagat gacggcccca    148260
     tgatcctcga ggctatgcag cgggggaacg gggctgatat cgtagcgata ttcgctgtcg    148320
     tagtcgtcct cgatgacata ggcgccctgc tcccgcgccc attccagaag ctgatgccgc    148380
     cgcgggatcg gcatgacgcc gccgagcgga aactgatgcg agggcgtcac ataggccagc    148440
     cgggccgcga cccccgccag ttgctccgtt tgcatgccgt gatcgtcaac ctcgacggga    148500
     acgggcgtgg cacctgtact ggcaaagacc tggcgcgcca tcctgtagca ggggtcctcg    148560
     atgacgaagc tgtccccggg gtcgagcagc aggcgcgcgc agagatcgag gccctgctgc    148620
     gaaccattga cgatgacgat ctgctcgggg tcgcagcgca cagtacgggc gcgccagaga    148680
     tagccctgaa gcgcttggcg gagccggctc gaaccgcacg gatcgtcata ggcgagccgt    148740
     gccggccgct gcgccatcgc cgcgttcatc gcgcgcttcc aaaccgatgc ggggaaatct    148800
     gagggcgcca ggacgccata tcggaaatca accttcagcg tgttcggcag gtaatccggc    148860
     cagcgcggag taccacgcag ccgttcgcca tagcttgaca agtgaaccgg gccgaaccgt    148920
     tttgggggat tggcggtcag ctcatgtccc aggagtgagg atgcgacacg agggcgcgcg    148980
     ccttgacgga tgtcgatgaa accttccgcg gccagctgct cgtaggcgac ggtgacggtc    149040
     gttcgcgaga ctccaagttc ctcggcgaga ccacgggagg acggcagctg gctgccggtg    149100
     ccgtaaacgc ctctgaggat ctgctcgcga agcgcttcgt agatctggcg cgcccccatg    149160
     ccatgcgagc gggttgaagc accgggacct ggagactgga ccatttcttt tcctgccaac    149220
     tggacattcc atatcaacca gtttgcagcc actccttccg aaagccaaga gcacgtctga    149280
     agccgatgcc cgagaccgca atccaagacc ggaaagtggc acatctgcga acgatgccaa    149340
     attcggcttc gctacccgcg cgatccatca ccggctacga tccggctggt tttcccaatg    149400
     ccgttcaacc acgcgccttc ctgaactcga cccacgattg aaagtgtcgc ggcgaatgag    149460
     gtcgcagcct tggcggcgca atcctcggcg acgcggaacc cctccacacg ctgtacgaaa    149520
     ccgccgtgcg ctacatcacc ggcgcggcgc tcccgactat gtcggccttc ctggttctgc    149580
     gcgggctgaa aaggactctc acgcttcgca tggaatggca cagcaccacg gcgcttgcaa    149640
     tcgcgcaggc gcgcgacggg cattcggccg tgggttgggt gagctcccct tcctcgactc    149700
     gcatcccgat caggcgattg cccgaaagca gatgtcgggc atcgccaacg ctaaccgcgc    149760
     gggtggcctt gaccaacaga tctcgagtcc tgaagaaagc gccggcgaaa tccgcaatgg    149820
     cgtcataatt ggaaggcgaa gggtcaagcc gcgctaagac atgatcgtcg ccccaccaac    149880
     gcatttggcc aaaaagcatc tcaacgacga atatgccggc ttggcgcgcc gtagggccgc    149940
     cgccttatcc cgcgagcggc gcagcccgct cgcacgtccc gtccgctatg cgtaacacca    150000
     ggctgatgcc ggacacatag gcagtcaccg aaccgggtcc gccgtcgaga aacgacaagg    150060
     accggtgttt cggcaactgc tatctgtcgt ccagcgattg gcatcagttt tgatcgacgc    150120
     gagcagcttg cgagggacgc atgcgaacgc ggcgctgctc ccacaaccgt cgcagttctc    150180
     ctgtgagagc ctcgcgctgg gcctgatcca gcgtaattgt atcgaggaga tccgcgagca    150240
     cggcttcgcc ttcgatccgc gtcagcagat cgaacaagtc atgtgaaata cgcacaccgt    150300
     cacggctgga gtgatccgtt cggatttcgc agacggtctc ctggcgatcc agcgccgtgt    150360
     gagcgcggac cttatacagg gatacataag gcggcaatga aaccgcgagc gcagtccaat    150420
     cctccagcgt tgtggcccgt tttttgacga ggaacggccc gaccacaagt ccatccaacc    150480
     ctgtcgtcag gaacgtggca atcgagtctg caactgaatc cacgatcggc tcggcattgt    150540
     tgttaaagga cgtattgagc agaattggga tgccagtgcg ctgcttgaag gcattgatga    150600
     cgtcccagta ggccggactg gccttgcgcg atactgtttg cagccgagcc gtaccgtcga    150660
     cgtgcgtgat ggcgccgagc aaaccacgct tggagtcgcg cacacggacc acgaaattca    150720
     tgaagggaaa ttcgcacgca ctgcctggga ggtcgaaaaa ttcgcgcgca tcctcctcca    150780
     gcactgatgg ggcgaacggg cgataccctt cccgcttctt gaccatggcg ttgatccggt    150840
     ccttgtttgt ggcgggcctg gggtcggcaa gaatgctgcg atttccgagc gcgcgcggcc    150900
     cgaactccga acgaccttgc acccagccga tcacggcgcc accggccatc cactcggctg    150960
     ccctatccgc caccgcctca gtgcgttcaa actccaggtg ccccgcccat gcttttagtt    151020
     cctcttcgac agcgtgatcg ctcgcgagat ccggccccca ataaacctcc tgcagtcgcg    151080
     cacgcggcgc ggggcggccc agctcaccag acacgattaa tgcagcgccc aatgcgcagc    151140
     cagcgtcatg cgacgcgggc tgcacgaaga tgtcttcgaa aaggcctgaa tagagcagct    151200
     tgccgttcat ggagcaattg tgcgcaacgc cgccggccag gcacagccgc gtcatcccgg    151260
     tggcctcacg atgatgccga agaatgtgaa acacgatgcg ttcgagcgct tcctgtaacg    151320
     acgcactcac atctttgtgc tgctgggtga atggcattcc cttttgccgg acctgaatgg    151380
     tgcgaagcaa agtcggaccg atgcggtcca ggtggacgcg atactcgccg tttgcagaca    151440
     gttcatagaa ctgctcgaaa agctcgcgat agggaacggg atcgccgtag ggggcaagcc    151500
     ccattacctt atattcatcg aacaagccgt agccgagata ccggatcacc tcgagataaa    151560
     atagcccaag ggaattgttc tctgggaaag tcgcgagttg cgaaatttca gcaccagatc    151620
     ctaccgccac aagacccgac tggaaatcac cagagccatc aatcgcgaaa atcagacttt    151680
     gctcgaagcc cgacattgca aaagcactca cggcgtgcgc ctgatgatga cttacgaatg    151740
     agatacgcga agggtcgagc tcgctaccga actcctgcgc caacagctgc tgcaccaaaa    151800
     atttggcatc caacggaatg gaggcgttcg gctcggaagc aagcatgttt tcgagcatgg    151860
     cgttgcaata ggtttcggta gcgtagtacg ccacatgatc gatttcgctg agctgaaccc    151920
     cagcggctga aagacagtat tgaaccgaac tgattgggag cttgttggag tgtttgatcc    151980
     gattgaggcg ctcctcttct acggccgcga tgacctgtcc gtctcggacg agcaccgcag    152040
     cgccatcgtg catgaatgta ttcgcaatct ggaatcggtt ttcatagact ttgtctaatc    152100
     cgccgctcaa tcctagacac agcatctcgc tctccgttta tcgtacagga agactgaatt    152160
     ggcctgtctc aaggccgttt gatcaaaaac acaggctgcg ttgtcgttcg ccgccgcgaa    152220
     cgccagtcag acatcaccaa cctcaaagaa attctcttac gcctggatca acatgagatc    152280
     ctgtgatcga ggtcccgggg cgttccataa cgttgagaga ttgagtggat gccacgaaga    152340
     ccctgggttg gatgccgatt tgcgttggcg atgtcgtttt tatttgcagc acgaagtccg    152400
     tagcgcattg tttatctcac tctctttcgt cagcgcatta gtcggcggcg caacagcgcc    152460
     atcgagagga agaatggcaa cagcgcgtac aggccgagca caccgacgtg cagggcgatg    152520
     ccgctgatcg ggtgatcaag cataaccgga cgaatgaggt cgatcgcatg tgacagcggc    152580
     atgcatcgcg ctatctgctg aaaggcgcca ggcagctggt tcaatgggaa aacggcgccc    152640
     gacaggaaca gcataggtgt gaggacaagc gtctggtaaa acacgaagta atcgtagctg    152700
     ggcgaaagtg cggtgacgat catcgcgagg ctcgcaaata cgcaccctgt cagagcaatg    152760
     attggcagcg catagaggac ggacggccag gcggcatagc ccaaggttgc ggtgacgatg    152820
     gtaatagccg taccggccat gaaggccttg gtggctgccc acgccagttc acccagaacg    152880
     atgtcgccga gggtaatgtg cgtatacagc atggcttccc atgtgcgttg agaatgcatg    152940
     cgagcgaaag ccgcgtacaa tgtttccagg gtagaggcgg tcatcgcact taccgcgacc    153000
     atgccggccg ccaaaaaggc gatatacgac gcaccgtcga cgcggccgac cattatgccg    153060
     aggccggtgc ctaggccgaa aaggtagatc ataggatcgg cgaggttacc gagaagcgac    153120
     acgagtgcga ctttcttcca tgccagatag ttgcgtcgcc ataccgcaac ccagttccac    153180
     gcattggccg gcagcgccgc cgcaaaacct tcaatcatcg ttcactcctc catctcgcgc    153240
     ccggtcagcc gcaagaaaac atcctcgaga ttggctggac gcagaagaag acgcagacct    153300
     gctcgcccct gcagttgcgt gcgcacctgg tcagggtctg gcgcatagca ataaagggtt    153360
     tcgccgctga cctcgatgcg ctgggaatgt ggcttgacca gcgaaagcaa ctcgtgcgga    153420
     tcgccaccat aaatctccat gacctggcat ccgatatgct cgtcgatcag cgcctgcggg    153480
     ccgccttcgg cgatgttgcg gcccttttcg agcacgcaca gccgatcgca taatcgctca    153540
     gcctcttcca tgaaatgcgt cgttaggata atcgtcttgc cacgtgccaa cagggcgcgc    153600
     agccgctccc agatcaggtg gcgcgcatgc ggatcgaggc cggtggtcgg ctcgtccatc    153660
     acaatgagct gggggtcgtt gatcaacgcc cgcgccattg tcaggcatcg cttcatgccg    153720
     ccggacagtt ccgagacgcg cgcatccgcc ttgcgctcga ggcgagcgaa ctcgagaagc    153780
     gacgggatga ccgcttcgct ctgacgtgtg ctcatgccga agtagcgtcc gaacaccagc    153840
     aggttctcgc gtacggtgaa ttcctggtca agattgtcga attgcgggac cacgccaatg    153900
     cccctgcgtg ccagccgagc gcgcgccggc accgggacgc cgagcaccgt gatcgtgccc    153960
     gcgtcagggc atgtcatgcc gaggagcata cgcgcaatcg tgcttttgcc cgccccgttt    154020
     ggtccgagga ggccgaaaca ctctcccgac gcaacggaga acgacagttc gtcgacaacg    154080
     atcttgttcc catacgactt ggttacgccg gcaaaatcga ctgccacggt cgacagagag    154140
     tcaggcacgg agcttttcgc gcttgtctgc ccgtgaaact cccgttcgat cgcaggagtc    154200
     tcgaatcgcc gcaaatcctc tgggcccaac ttacgcttca acacttgatg tttctggtcc    154260
     tggctcaaaa ctcttccacc tgagatcacg tgactattgc tgttcgctgt aagctgcgtc    154320
     agatcccacc aagttcggct ttgaactggt gccgccagtg tctgtcacat tggccgcaga    154380
     gctgcgcgac aaccaatcgc tgttgctcaa tgtgcacagc gcgtatgctt tcaacgggag    154440
     caagagaaag atgttgatga gtgtgtggag cgagaatccg agaaatcgaa gttggcgcgc    154500
     acgaaacgct gccacgctgc agcgaactat agtcatggct gcaatcatca ggcatgccgt    154560
     ccaaggcgca gtacctgtcg ttaccaattg cgcgagcccc gccagaatcg acaaagagag    154620
     caataatggg ccaatattct ggccaatcac gtccaatgtg agataaatgt taaggccgcg    154680
     cagcagttgg aacgccagca acgtgtcacg gaaagtgctc cgggcccagc gaagctgttg    154740
     gcgcagatag ggacccatgc tgttgggaac gactgttgcc gcgacggcct ccgggacata    154800
     ctctgttcga aagcctgctt tcagcatcag gatcgtaagg tggcggtcct cgccgaagtc    154860
     gctcggcttc cctcgaaagc gctgcgtctc gtactgatcc agcaacgaaa caagcgcgga    154920
     tcgccggtac atggcacacg gaccgcagca acacatgacg gcaccgaacc gagcctgcgc    154980
     tgcccgctct tcgttgcagg cgagccagta ttccatgtcg atcaaccgcg tcagccaagt    155040
     ttcactgcga ttgctagccg ccaactggcc catggcggcg ccgaccgctt gatcttgcat    155100
     ctttagcgca agcctggtga tgacgtccgg ggcgagtatc gtgtccgaat ctacattcag    155160
     caccaaatct ccgcacgagc ggcgaatggc ggcaatctgc gccttgcgct ttccgacatt    155220
     ctttgggagc gcaatgaagt tgaacctcgg gtcgcccgcg tattcctcgt gtacacctac    155280
     gagggcatcg cggtttgcag aaccgtcatc aacaacatag acctgcagtt taccggcgta    155340
     ttcctgactt gcaatggaag ccaggcagtc cgagagggtg cgaggcgcct cgttgtagca    155400
     cgggataatg acatcgacgc tcggccaagg ctcaccgccg ggcgggtcgc ccgaggtcgg    155460
     cggtacgttt gtaggcaggg tataaaacac ctgcgcggtt ttgtagacgg tcgacagtag    155520
     cgcataagag cagatggcaa cagtactggc tgtggcaaac agggtcatga gatgtcagat    155580
     ttttctgtga atttgaggaa gcgagcggat accagatccg cggtcatagc tctggaccgt    155640
     tccgatcgat caaagtgccg gccggccact cgctcatcga gcgtccaatt gggagcacca    155700
     tgaggagtac gtcgtcgtcg actcgcgtcg tggaaggcag atcggagtac acgtccggga    155760
     gggttgaacg cacgcgaacg cccgtcagaa tgttcgccaa gcctttgcgg cagaacctcg    155820
     aaacatggtt ccggagcgcc tgccgaaccg tgccgaaagc gaatggaacg ccaagctgct    155880
     gcagcactgg atacatgacg ctaatcgaat gggcgattcc cagcccctca agatccggac    155940
     gcaccccgta tagaccgagt tcagcgacca gcagatcaac gtcgccaact ttgatgtatc    156000
     ggcgcagcac gcccatgtga gccgctaccc cgtgcacatc atagccgatt gcgcggagtt    156060
     ccggccttgc accggcccaa cttcgaccgc cttcgaattg ctttccattg aaggctccgg    156120
     tcggctcata ggtcttccgg aagaactcag agagttcgag gtgatcggga agctgcaact    156180
     cattttccca gcataacctc cactgcacgt cagggcgcat gcgaagactt cctctttttc    156240
     gggttctttt gtgcacctca cgcggtagag caatggcggt gcatgtcatg ggtctatgaa    156300
     cgaccctccc ggattggtaa aattgattgt ttagatcgcg agcatccacg ctatggatat    156360
     taaaaccatg cctttcaaag gccctgatct gaaccttctg gtcgtgctcg attggcccga    156420
     taagcggcgg caccgatggc agctgtcggt gacacaacct gattcaagag cggccgccag    156480
     cgcgtggctg cgcccgtgcc gaagcagcga tcaagtggag gacggcccga ctgttaggcg    156540
     tcagcaaacg cggcgaccgt tggcgcacgc gatgatgcat ggcgatcgcg cagctctgga    156600
     tcgccggcgg caaacaggtt ccgcgaagct ctatcgcgct cgccaacagg aatcgtctgg    156660
     tcaatgcttt cgagtgttgc cggtcaaccg gactgtcggt gaaagcacct ggagagcggg    156720
     aaggagcgcg cccggatggc gctacttcga acgaattgtt tgaggttttg gccgactgga    156780
     acacacagct tgagcacctg aggcctgaag tgcgcaaagg agctggcccc taagtcttca    156840
     ttccgtgcga gggatcaaag atcgccgcac acagaaaggc agcctaagga gcgtcagcac    156900
     ttgcgccggc cgaagggccg ggacgcggga ctgactgcaa cgacgagatc ggttaaaagg    156960
     gcagccgtag gagtgtcagc atagcgccgc ataaggcggg acacgggacc gacggccccc    157020
     gacgaggagt gccgctttcc cggctaggga tcacctttga ggttcggtgg cggcagccgt    157080
     agagcccgtc ccgcataggg agccatgcaa aataaggact tcgcttcatc tgggtatcta    157140
     tgggtcattt attgggtaaa gccgttacgc aaaatggcag aggtggggga acggtcaccc    157200
     cgccgcttcc gaacctgatg tctggaccgg aaaggcttcg gccgacgtct ggggccgttg    157260
     aggtggaagc gggcgaaaac ccctcgaggc tcgcggcgca gaacatcgag ccgcatgaag    157320
     aagccggatg tagtcagcag ttgttaccat caactggatc cagctacttg ttgcaattgg    157380
     gcgctctata cgtccgcata ttgggtcagc ttgacaccac agaagcccac acagtttcca    157440
     agtgttttat caggaagcgg aaatcggctt tcggaagaga gccagcaggc agtcttcatt    157500
     gatcgacgcg ccccggcact cgatgcactc gatctcggtc aacgattcgt tcagcatggc    157560
     gatggtggtc tctgcaccag cagcgtgccc ccagcgttgg caattggcgt cacgtgccga    157620
     tccgaaaacc agctgcccgc ctggcgcaag cagacttacc aggttgcgga ctgccgcgcg    157680
     gatctgatcg aggtctccga cgtagtaaag aacctccgca acgacgatca ggtcgaacag    157740
     ctcatcactc gaaaactgtt gaacatcgga aattatccag ctgatgtgcg gcgtctcctt    157800
     catgcgtaaa cgtgctcgcg taatcgctgg ctcgacgaca tcgatcacag tgagccgctg    157860
     gcaaatgggg gctagccgct ccgtaaaagc gccggcagcg cagccgactt cgagcgcatt    157920
     tgcgactcga ccttgcgcaa gtgacaaccg gagaatttgg gtgtggcgct cccgctcgaa    157980
     cgggttgcca tcaagccgcc atgggtcgtc tgcggccatt tctcgattca gcagttcatg    158040
     atcgatttta tgggtcaaat tcgcacctag ctaaggcagc aatcaccggc gctgcaaatg    158100
     ccgtctgacg tcggtagggt cggggcacgc tcattccgag aagcggggtc cttcgtgaga    158160
     cccgatgtca aaacacgagt ccgcttgacg cgcgacatag accccgatga ggaagaacgt    158220
     cccggcagca atttccactg ccttcgggtc gttgcattct gttgctcctt aaggcccagg    158280
     tggttggtgc tcaggctttt tcgtcgggcg tactgcgggc cgaggcactt gatttcggtc    158340
     acgctcctaa tagggtccgc aggattggca aaattgattg tttggatgac aaccatccac    158400
     gcgctgaaca catcgaaggc gggattggac gtggctgggt ccacttctgt gtggcgccgg    158460
     ccgacaaacg ctttgcggcg gtcgggaatt ctgcacacac acggcgattg acacgctgac    158520
     gatctgcgat ggaagaggct cgcggcattc agcggccgcg tcttcatcaa gcatgatccc    158580
     gcgcagccgc gaccgctcac atcgaaccaa actcgccaga cgccagcacg ctgacgatga    158640
     tcctatgacg actgcggttc accgcctcag catggccgca atgccatgac ggacaaaggg    158700
     aagatgttgg ccgaggcgca gtcctacatg ccttgcaagc cgtgccgccg gatgctcgct    158760
     taagtagagt ccgacgagga tattcgtagc atggtagagc ggcgccgccg acaggcgcag    158820
     tcggctttca tatctgtgga gcatgtcggg gtcggcaatg tcgcgacggt cgcgccatgc    158880
     ggtctctata ccgcgggcga gctgcttctg gccgccgagg ccgatgttga agccatgcgc    158940
     ggtcaccggg tgcatgccaa tggccgcgtc gccgatcaat gcggcgctcg gcgcccggaa    159000
     cctgtgcgcc caggtcgtga ccagcggata gatgtagcgt tggcttgcca ggctcatgtt    159060
     gccgaggcgc cctcgacagc gctttgtcaa ctccctcagg aacaactcgt cgtcgagggc    159120
     aagcagtccg tcggcctcgt ttgagggcaa agttagaagc agcgacgaca cgcctggcgc    159180
     gagaggcaac atcgccaccg tctgatggtg atcgaaccat tcgatcgcga tctggtggtg    159240
     ggggcgctcg tgcctcaccc ggcaaatcag catcgagttg ccaagccgat tgatatcggc    159300
     gccgatgccg agcagattgc gggtggcgga aaaacgcgaa tcggctgcaa cgagaagccg    159360
     agcgctcagc tgcctgccag tggagagcgt tatcattgct ccttgacggc tgtttgttgc    159420
     acgcacgacc gagtggccgc acagcagccg ggcatggccc tgcaagcgga tgatcttgaa    159480
     cagggcatcg cggatctggc aattcgggac cagaacgccc agcggttccg cggatccgcc    159540
     gggggaatcg aaacacaacg caaacgggct cgatccgttg aggacgcgtg cgccttgaag    159600
     cggtgacttg tccgaagcgg agataacatc ccaggcgccg agctcgcgaa ggattccaat    159660
     cgaggcgtgg gtgagcgcga tctcgcggcc gtcgaaagcc ggacttgcca gtctttccag    159720
     ggattgccct tcgacaaccg ccagtttgag ctggctatga gcaagcgatg cggcgaagga    159780
     aagtccgacc ggcccggcgc ccacgacaat gatgtcgaag ctgtcgtcac ggccggccat    159840
     cagcgtgccg ccagcgcgtc ggttctcttg gtgatatgtt gggggagtcg agccgcatgt    159900
     cgtgcattga ttgcgctgtg atctattgcc cgcatcgcct caagcgcgtt tctcacgtcg    159960
     gttcctggct ggtgaagcgt catttgcctg ccgtatgatc tggattgtca agatgatgga    160020
     gggacgacca ggctgtcggt cagcccatgt gtttttccct tgtaggactg atcgatcaaa    160080
     ccacgccgac aagggcgtgg ccttgatctg ggtcagtcga ggcccaaccg gcgtcggatg    160140
     acatagcggg cgaaggcggc gatctcctca tggatgaaag tcggcaggac gagcccgcaa    160200
     aacagcccgt ccgaccgcag cgcctcgaca atttcctggc gatcgacgcc ggcaaacatc    160260
     gtgtcgtggg ctttttgcga cacgcgaacc ggctttgccc cacgccagtg catccggcgg    160320
     gccggcatgg tgcgggcgag cacgaacatc ggcagccagg cggggttctc gcgaatgtcc    160380
     gacagatagg tcggaatgcg cacggcgatg cggcgcagca cgccgccgtt tcgcgcgatg    160440
     gcctcgagac tggcggcgcc agatttgtca gggctcggcc aacagacaaa ccgcgccggc    160500
     cgacagggcg gcgaccgtca gcagccgaca ggctgcccgc gccagggggc gaagccggat    160560
     ggccgagacc gcctgagcct ggcgaagaaa aagcgggctc ggttcacgag cacccggcac    160620
     gcgccgtcag gcgcgcgggc gccgtcaaag cttaggccaa attgccgctt tccgcggatg    160680
     cgtggatgcc atgcctgcgc tgcggttatc aggtcgcagg gctcaacgct cggtgccccc    160740
     gccaggcgtg cgggcgagaa aggcgctgaa caggaattct cgttccagga acggtcgttc    160800
     ctattccata acgcggtcgg caggtcgcca gggccccgtc gctcgaggtc cgatgcgaag    160860
     tgcggttaca catcctgacg cagccaatag aaaacatccg ccggtttgaa gagaaagccg    160920
     ggatgcctcg gtgccagccg ctgatgcgaa tctgaaactc cccgacctgt tcggcgctat    160980
     cgaccgcatg ccgacgcctg gcacgttgtt gggttagcga aagttcgagg gtttttatcc    161040
     atccactagc gaagtgttgg cagagctacc cgacatgggc gctgaggaga cgcgctcggc    161100
     gatcgacgag gccttatacc gcgcaggctg atgggcggcg tttaccgccc gggatcgcag    161160
     ggacatgctc tggcgctggc atcagctgat caagaccata ccgacgacct tgctgccatt    161220
     cttacggcag agattggcaa gccgcttggc gaagccaagt cggaggtctc gcatgcggcg    161280
     gcatatctgc aatggtaagc caaagaggcc aaccgcatct ttggcgagac gatctccccg    161340
     ccctcgactg accggggcat gctgggtgat caagcagcca atcggcgttg ttggcacgat    161400
     cacgctatgg aatttcccgg cttcaatggt ggcgcgcaag atctcaccgg ctctggcggc    161460
     gggctgcacc gtgatcttga aacctgccga acagacgccg ctcgttgcag gcgcaatgtg    161520
     cgcggccggc cttcccgacg gcgtcgtcaa cctgatccat gcttgcaaag gcgatgccgt    161580
     cggccgcaca ctgattaacc gatgaacttg atccacaggc gcttgaacca tgcgacgatg    161640
     gccttgagcg ccttcggccg ggtgccgcgc ttgagaaggc ggtcataggc gcggccggct    161700
     tcgatctgct tttgatgagg tgtaacggaa atgactggaa tgggtctatc atcggtcttg    161760
     gagcaagggc gtctcgcaca atttggctga cctgggtcag cttgttcggc gtttggtgtt    161820
     tcgcggacgc tctgctgacg tcggctggtt ttcgcgatcc ttggtggtca attgctgcgg    161880
     accgacaacg gacttgcggc cacctgcaat gggcaacttc atctgcgggg cacgtcgaac    161940
     ctcttccggc gtcggacgac gacgtggctt tcttgtcttc agaccggatt tggcgtgctc    162000
     gttgaatgcc tcacgcgcca gattgagttc taggagattt gccagggctt catcttcaga    162060
     gatatccgca ggccaaccgt aggctccggc aacggcggca tccaggtccg agtgggcgtc    162120
     gaccagccac tgcggacgcc ggttgtagag gttggtcagg gtacggtcac gcaggattgc    162180
     gtccgacgcg atgtccttcg gaaggattcg atccggatag ccgggcacga cctcgggctt    162240
     gatctggaca aggtcgctcg gattgagcca cgcgtttcgt atgtcatcaa gtctcttggc    162300
     cgcctttgat atggcgatgg ctcgtgaatc cttttcatat cggacagctg ggatatccgg    162360
     cgtgaggccc tcggggaacg ggaaggtctc gaataccccc gcactattgt aggttggatc    162420
     attgccgacg ccgtgccacg agcaagttcc gaagctccaa gcctcatgaa atcgggagtg    162480
     aagaatcccg aaaaagacat cgtctgagcg agaaaacgcg aagatgcggg agtcgggcac    162540
     tatcgcttga tcaagccaca cgaatgtccg atgctttgcg acgcgaggtg ttgccatgta    162600
     acgcgagtgg ccctgcaagg aagcgtgaaa agccggtctc ggctccacgt gtcgccacca    162660
     acgctcgcgg taggcatcac gcctgttctt tgagcgctcc ggaaacacat gctctctaat    162720
     gtgctggaac ggcgcctcgt agagggcagc ctcctgctcg gacatctccc agccgaaatc    162780
     cacaatccac atgtcgcggc cgcggcgagc gacgtccatt ccattgcgcc atggacggag    162840
     cacatctgag tttggcctac cgttgggatt catcggcatc gagagccagg cccgcgccaa    162900
     gctacccggg acgtcgaagg caccgccctt cgtgtcgccc atgaacgcta cgttctggtt    162960
     ttcagacagc ctgcgcgcct tggtcaagtc ggttacgccg gcggtaagat ctgcgtttat    163020
     ctgtgcaacc gtcctcccat cgaggcacaa cgggtcctcg ccgtggccga agcagattag    163080
     ggatactcgt acggctgcgc catcgacgac ccacggctcg tcactccagg cttcgaatag    163140
     ccggctttcg gcgatgatcc gatccaacac ccttctgttc gctccaccgc gtatggaatt    163200
     cgtcgtgacc agacccactc gacgcgttcg atctgctgcg acagcggcgc gggatttctc    163260
     cacccaatag cagacgagat cagcctcgcg agagacgcgc ccatcgtaca catcgaaaag    163320
     gcgatcaacc gttggatcgc ccaaggcttg ccgcatcaaa cgcacgccga caaacggcgg    163380
     atttcctacg atgaattctg cttctggcca ttctgcttca gcatcttccg agactggttg    163440
     cagtgcagca agaaggtctc cttgtgcgtc acgagctgta tcaacgtctt gggcctgcct    163500
     gaccaaggcg tctcgccttt cgattgcatc tagcttgcgt aggattggta tcgatttcga    163560
     gcgtatccca ttcttgatct gccactgaat gtctccgatc caaatggtcg tgcgtgcaag    163620
     ctcggccgcc atcatgttga tttcgatgcc gcgcaggatt tcaggcccta cgagcggaag    163680
     ctgagcgggc atgccgagca tctcgcagtc gaggttggcg cggtgttcga tatccttcac    163740
     accctggaga gcgaggtata ggaagtttcc agacccgcat gccggatcca ggatgcggag    163800
     ctttcgcagc cgttccgtga accgggaccg tacttcggcg gccgcttcct cccgcttcat    163860
     ccggcgggat tgctgcctgc gcattggcgg cttgcgattg ccattcagga gttcgacaat    163920
     ctcccgcctt gcttgttccc attcctgtct cagaggcctc aggatgaccg gatcgacaag    163980
     acgcataatt ttttctggat cggtgtagtg cgcgccgatc tgggcgcgtt tttccgggtc    164040
     cagaaaccgc tcgaacagag ttccgaaaat cgtcggatcg atgaggcccc aatcgaggct    164100
     gtctgcggcg acaagcaaac caatgtcacc gtcatcgagc cgtagcgctc ggcgaccatc    164160
     aaacaggccg ccgttgaacc atgtgatgtc ggtcaggtcg aactcgccgc cgcgctccat    164220
     tgcttcaaac agcttgtcga ggtagctcat ggctcgttca ggagcacggg ccgatcgctt    164280
     caggagcttc gtgaacaggc catcaggcag caggctgaca ctctgggcga aaaagcaaaa    164340
     gaccagctga tttacgaaat gagcaatctc atctggtgtg cctcgcccct gaacgcggag    164400
     tgcgatcgcg gaaaacttgt ctgctgcctc cttggtgacc gccgcgcgtg ttcgggtcgg    164460
     cctcagcttt tccgggctga agaagacgtt gtgcaacatc tcacgcgctg aaggttccgc    164520
     gaggtcatct agggtgatca cgtatgtgga cggaacggtg ttcgtccaag cggtatggat    164580
     gcgaaggcgt tcgatgtcgc aaacgatgtg tagcggcggg ctcaaaagcg ccggcgcgta    164640
     tcgcatcaac tggaggaggg cctcgtcgag gtttcccttc ttacgcttgt actcccatgc    164700
     gaagtgaccc ttcttccaga cgtcagcaaa acctttaccc cctccgagct tgttcgcacc    164760
     tttctcgaac gcgaagaacg cgccggtcgg gtcctcatcg ctcggagacg gatggccgac    164820
     cagcgagcag atatcgagga agtgttcttg agctgcctgc cgctcgccaa gttccgactt    164880
     cctccacttc ttgatgaaag cagcaggcgt tatgggcgtg agccctgcgg cacccagact    164940
     cattacacat cccctccgac acagtcatcg gacccagcag aagaggttgc caataaaact    165000
     ctgattattg gttaatatta gtcaccgatg catcaataat ttcctcgccc tgacctatta    165060
     ttgtgtagca tcagaaatag gggacaccat gcattgtggc agcggtgatc acacgactgg    165120
     agtgcatttc ctggtttcct gaagcgcttt ccattcgact tccggcgcgg aaaaaacgcg    165180
     tcagcgagcg cccgactaat taaagcgcgg cgcgctggca ctggaccgcg gcagtttgcg    165240
     ggcttctact cgtgttccgg tggatggcaa cccacgcttt ggctcaacat ggtttgccta    165300
     ttaattgcct tcgtgatgcc cctcggcggc cagcttctgc ttgctcttgc gtactcggat    165360
     ctcgatacga cgcctttctg gagcgtcgcc tgactgagct ccatccgtga ggcgatcatc    165420
     cggcaggatc agttggccgc ctgacatggg taggatgttc aaatgatcaa acgccggtat    165480
     ctttttcaga acggacgcga cggatatcgc tcgcgcgagg cctagcccgg cattatcacc    165540
     cggctccatt tcgctgacgc tctcatcccc agagagtacg cgccccagaa cgaagtccat    165600
     gttcgactgc ctcgacaatc gctgctcgtc agtgtggcca atgacctcga cgacatcgac    165660
     atcgtatttt gcgacgatat cggcaatctg ctcggcaata gcgccctcaa gcttggcctt    165720
     aaaggccggt ttgagttcgg cactgctgac ttcgaaggaa tagcccttgg cttcgctcag    165780
     attgatgatc ggtggcagat ccttaggctg ccgtgtcgtt tcagcgagtt ccttttcggc    165840
     ttcagccagc ttccgttcgg cttcggtcgc acgctgatct gctgagacta gcttgcgtac    165900
     gtcgtcggct gagagattgt tgtctcggac cgcgactgtg gcttccgcca gctgaactgc    165960
     ttcgtcggcc gacagtccct tttgctcgat ctgctcgatc gcttttttgg cgaggacgag    166020
     ctttcgccat tcctcatcag gcactttgtg cccagtgaac cgctccatga gctcggcaac    166080
     ctgggccagc aggttcttgt tctcctgctt gagttgctga accactgctt cgctgcggga    166140
     taccctttca agggcagttt ccaattcggc cttcttcttt gcgacaatgg cgcctgcaac    166200
     caacagcagg cagaagacga gcaggagcat cgtttcggcc atggtgagcc cgaggatcaa    166260
     gccgcgggca tagcctttct tttcgtagcc gaccgaagct ccgccgggtt cgttcagcgc    166320
     caccatctcg gcctcggctg gactttctcc acgatcggct gggaggcctg ctgcccggca    166380
     tcagcgccgt tggctgttgc cgttgcgcct ggcttctcac cctgcgcagt tgccgccgaa    166440
     atggggatga agatgggagg ttcaacagac ggttcattgg cgtgcaaagg tgcaaccgga    166500
     ggaatttcgt gcgggacgga cacacgatcg cgatcgagga tgcgggatag caggttcgtc    166560
     gtactggcgt tttgctcagc ctgcttctca agcctctcca ggaggagctt ctgatgcgcc    166620
     gccatcctca agacggtatc cgaaagcttg tcggtccttt ccccctgctc tttggaaagc    166680
     gcctcagccc gctcggtgaa ccttccgaca gacgctgcaa gcaccttgag aactgtgacg    166740
     acatccgtct tgaggacctc gtccggaata accacgttgg cgagcttccc ggcaactatg    166800
     tcggcctgcg cctcgaactt cgagatcgtg ccagccatgg aggcattcgc cgtgtcgagc    166860
     gacgctgcga ctgtgtcgac cttttcagcg acacctgaaa acctgctttc gatacggccg    166920
     aacgtgtcat cgaggctttt ggctatcttc tccgaagtct cctggacggg ctttatcgct    166980
     ttggcggcca taccctcgaa ggcctgtcgg acctgatcgc cgttcttctc cgcctgtcgg    167040
     gctatttcgt cgaagccttc ttccaacatc tgattgcaaa cccggcggaa gtcggcgaac    167100
     tcacgcgcta cgctttccat ctcggtgcgc acgcgacgtg tcatgtccgc gagctcgtga    167160
     cgggcagccc gttccacgtc ggcggggtcg cgtcggacct gattgtggaa gatgcgcagc    167220
     gcgatgcctg tgatggtcga cgtcacggca atgccgaaat tcctgacgat ttcgtcggtc    167280
     gatgcgtctg tgccgaactg gtaaagcgag gtgcccaggc tggagagcgt gaacaggaag    167340
     cccatgtaat agaggttgtc acctgtctgc tcgtcgtgaa cgcgcaactt cccgacgtac    167400
     caggaaaacg cgaagtagcc gatcatgatg ccgatcggca ccgttgacga gataacgggg    167460
     cttatgccgg cggtctttgt gacggcgatg aaaacgcacc cgcctaccgt cagcgcgata    167520
     tagaaagcct gcgggaagat ccacgtatcg aggaaggatt gtctacgcgc ggccatgggt    167580
     tacatccctt ccagctttgt aaagtcgctg agattgcccc cgttctccga aaaccactgc    167640
     gtccaaaaat tggcgtggtc gacggacggg aacttccttt ccggcctgtt gaaatagaga    167700
     atggttacgt cggcgccgag aagatcggtc ctaaagcgcg aattcgctgg gcttttcttg    167760
     aaggcgttgt agtcggcgcc cgctttgtat tgggaatagg cgggcgtgtt ctccatcatg    167820
     tccgacacga ggaccaaccg ttttggaaca ttgtcgaaca tgccgttgtc gaacaggctg    167880
     agcttcagtt tctggatgcc agccatgatc ggcgactgat cagcctggct atccgccggc    167940
     aagtgctccg gcagttcctt gaggggcttg tcgaaggcct cttcccagat tctctgatgc    168000
     tttccgggat tgctggtcca gacgtcaacc gttgagccgt ctcccggatt gcatcgcgcg    168060
     tacagctctt tcaggtcgcc aggcaccgct gtcaaggtgc caacccagag gtagccgcct    168120
     tgcttgattg agccggcaat ctgcctgaat ttgttggcaa gatcctccat ggtcgcctgc    168180
     gggacgggat cagaggtgtc aaaaagaaca gcggtgacgc tgttcggtcc cgcctttgtc    168240
     gggcagcccg tctttgcgtc tgtttccagc acgtcccggg cctttacgtt gagccagacg    168300
     tagccggaaa acattgcgag cgaggcaagt ccaagcagga ttgctccgac aatcgctcca    168360
     acgcctttcc cgcgcgagct ccctgccctg cgacggcttc taggcctggc catcgagcgt    168420
     ctccggatac agcttgtcga ggtcgcgata cttttcgatc ccggactcgc attccttgcc    168480
     cacctgcagc atctgctcgt tcagcgcctg ctgggccgcg gcaattgatg aagcaagatc    168540
     gctatccttg atctcaccat cgttttggac aatgggcttg gtcttttgga gtttaaaggg    168600
     ctgggagaag tgttttggag cgggagtttt gcgcgcccga atgtttgctt cgcggtattt    168660
     tgaaagcagc tggttgcaac tcctctcgag ctgctcttga tgttcattga acagagccaa    168720
     aagccgcgca cggctggata ggattgcagc gtgttctctc ctacggctgc ttagcccctt    168780
     caagatgtct tcgaccttgg tattgtggtc gtcgcgcaat tcgatgaggc ggtctatgag    168840
     gtcggctttg gtatcggtgt aatcctgccg tctctcccgg cgcctttttt ccacgccggc    168900
     ataacctgga tatggatcga gaacgaacca gccgtcgatg aaggcgatga tagaaaagag    168960
     cagaccgacc aggaagagca tccacgatct cacctcctca agcccgagcg ggttatggag    169020
     cattctctgg accgcaatgt tgccagctcc gtcggcgagc gttccgctga cctcacgata    169080
     gtgcgcaagc agcaagttga tcccgagtgc aatagcggca tagagcagga tgaaaacggt    169140
     tccgacaagc ttccctcccc aagaccgatg ggtcacccag cgcacgcaga agatggcgaa    169200
     aatcaacgcg gacacgatat tcacgaagga aaaggcgaat gcttccgtgg caccaccgag    169260
     gaagccttgg tcgttgccct tggccagaaa ggatccgttg agatacgtct cgaccagcag    169320
     gaggaaaata aggagtgcca ccctgaaaag atgggctgtt ccttgctgca gcctggcaac    169380
     gcgttccaag cggtggttct tgcggaagct ggaaagctcc gtggttgcct cgtgaaggtc    169440
     ggttcgcttg gcgtgaaggg tatccaaacc gaccgctatt tctcccttga agtcggacag    169500
     gcttgaagta ttggcttgct gaaggaggcc gaactgctcc tcaaggccca ggttcgcaac    169560
     gcggccggag aagaggtgaa gctgatcctc aaggatctgg tgggccgcct ttttctcgtc    169620
     ctgcaccctt tcgacgatgg aatgttcgac ctcgtcgagg gccttggacg aggacgatgg    169680
     ctggtctttt tcgccatgcg ccgttccctg atcgtcgagg tccatatccc gggcaatctt    169740
     gtcgacgttg agactcggga aaatgtctgc ccccacccta tagtcgtggt tcgcttccat    169800
     tatccgattg cgcagcttct cgagcgcttc aaacctcgca accaacgtct ttacccctac    169860
     gatccaaccc tggaaaacac atgcttgcgg cacgccgcgc gcttcagcgc gcagcaatcc    169920
     cgcaatcggc gtctgtcata tccggcttgc cccacccagc agaatgcaaa aaacccattc    169980
     tgaatgtgct cgatagtaca tcgacgcgct gcgtgcaaac taaagtagtg gttcggtccc    170040
     cggagcgatt ccttgcaacc agcgcgggcc ggccatggtc tttcgcatcc gcgtactttg    170100
     aggccgctac cgtttgctcc agagagttat tgacacactg tgttaacgcg atcgatcagc    170160
     gcccggccat acagaaagat tctcaaccct tgtcacccgc caaacctaga ccagcgccaa    170220
     atttgatagc attctagtga tggggagaat agcttggaca aatctcgcta caaaaatcgc    170280
     tcgggtcagg ggcgcaaggg caatggcgtg ggtcgatcac gcgcctggcg tcgcgcaagc    170340
     gtgccgttga aactggtctt tctgacagtg gctgccgcta ccgccttagc cacgcaatca    170400
     gccatgcagc acaccgaccg aataccagac attggcgttt cgaactggtt cgggtcgaag    170460
     ccggagccga tcgctggcgt cgcgtccgtt atcgatgggg acacgatcga agtccatggc    170520
     cagcggatcc gctttaacgg catcgacgcg ccggagagca agcagtactg cagcgacgcc    170580
     aagggattcg actattcctg cgggcgccgc tcagccgacg cactggacgc atttctagcg    170640
     gcctccaggc cggtgcactg caccttcgta acttgggacc gatatcaccg gtttgtcggt    170700
     gattgccagc gcgcggatgg cgtcagcgtc gcctcctgga tggtcgagca cggccaggct    170760
     ctggattggc cccgctacag ccacggggcc tattcagcgc agcaggcgaa ggcggaggcc    170820
     gcgaagctcg gtctttggct cggaacgttt caggcgccct gggaatggcg ggctgtgcac    170880
     gccggtgatg cgaggccgtc gagccagcca ctcggcatca gcagccgccc acaggtagcg    170940
     caaagctttt catgccaacc gcggcggaca tgctcgcaaa tcagctcttg cgacgaagcc    171000
     caatggtatc tcaacaactg tccatggggc ggcaagctgg atcgcgatgg cgacggaatt    171060
     gcttgcgaga cactctgttg atggcgctgg gcaagatgcg gctacagtgc aaacgccgta    171120
     gaggcggcgg ggatgagaga gatggtgttc tttgcaacaa tcggacttct tgtcatcgcc    171180
     gtgagcatcc ccattgccgc catgtacgcc tgcggacagt ttgtcggaca gaaaccggcg    171240
     gcatgtccgt ttccgagtgg gtgatgctgg cgtgggttgc cggatctgcc gttaccggcc    171300
     aggtcgcctt gctggaattg ctgagccgca agcctctttc gtcgcccgca actgactgac    171360
     agtttcaatc cgctgactct tgcttgcctt gggtcgtgat cggtgaggcc tcatgccgtt    171420
     gacccatcgc cacagcacgc cagtgcatcg cgagcgcaat aatgcccgcg agggttagcg    171480
     cgccaaagat tgttggctca aggcccggca gcaccgtcgc gctgccgata cacggcttgt    171540
     cgagcccctt gtcaaattca gtgcagatac gagcgggatc gttcagcgtc cggagctccg    171600
     accaatccca aaggctggcg cctgggtcct tcttgccgtc gttcagcatt accgtcgcgg    171660
     agagaaacgt acaccagaaa tagaccagcg cgatcgcggg cagcacggag aaaaccacaa    171720
     tcatcgcgcc ttgatagacg cggccttctc gcgagcccgt ctcgatcgcg tcgaagccga    171780
     caaccggtat ccgcgcatgc cagtgcgagc cgccgcgtgg ggcatagacg cgtccaacaa    171840
     gtgaggttag tgcgagcaaa atcgaacata tcgggattgc gatcattact gcaggcaccc    171900
     tcgccttcat gaccagcttt gcaccgaaaa tctcttcccc gccttgcgct accacccaag    171960
     aattcagggt gtagtagaga agcagcgcac tgaacacaaa ccaaaccttg ctaagttgcg    172020
     attgcgtcat ttgcacccct ttttcgtttg gtgggccgtc cctggccttg gtcagcgaca    172080
     gcctatttgc acccatgcat cgtcaactcg tgagattgca actcattcgg catacgggct    172140
     attgacctac taaatcagct gatagcgcca tatcgaaatt cattttgagg cgcgcactgg    172200
     caatcagatt ttttggcccg acagtgatat cgagtagttc gatcgacggc gtgtcagcgg    172260
     aaatcttcaa tcccggaacg ttggtattgt gaacggcctt caaaatctca tcggacgcgt    172320
     cgttgaactg cttgttgaga tcgactctcg aatgagcctc taaatctgcc aggatctggg    172380
     tttcgaacag ggattgtgca gccttccaga aagcgttgtc caggacggtc gcgaaatgca    172440
     attcgttgat ggagatcgct gttccagttt tctcgacgcg gggtaggcct gagaggtaaa    172500
     cccagccggt cgtattcagg aactcgcccg gcagctttgc ctgtaccttc aagcccacca    172560
     cgacagagct ggcgctagga tagaggtcaa catcctcgac cttcacatcg acggcgccgg    172620
     ccggtgtctg ctgctgaaaa tcgcgaccct taaggttctt tgacagctcg tccaatagca    172680
     atccgtaggg agcagctgct tgcacggtga tatcggcttg acttcgatcg gctgatgttt    172740
     tgcccaatgg cggcagagac agggactgtg tggcaactgg ctctgcggca agactggtct    172800
     ttgctgcgac acgcacggtc atcttcatgc cttgcgcttc accgaccagg cccgaaaagc    172860
     tcgccgctgt ggggacgatg ttgagataga cgggcgtgct atccgggcgg tcgatcttga    172920
     tcgcaatggc gtgccattgg gcctcaacct ttgaccgaag cgcaccacaa ggcagagctt    172980
     tggtgatggc atcctgtatc ttggcgcggt ggtcattgat ctggccgttc aacacgtcag    173040
     ccagtccaag attgattggc cctgcgcaga cctctgggtg gcctaggctc ccaaaatcaa    173100
     agccgagaca gtttttgccc acgacttcca ccgaagcact gctcacccat ctgccggtcg    173160
     gggttcccgt gagcacgggg caccacttat cgttcatgtc gagctgcaga tcgacgccgg    173220
     ggaccagccg agcctcgaag ttctttccgg aaagcgaaag cagtttggca aggtcgccgc    173280
     ctacgccggc ctgaccgctg acaaacagcg gctgttcgac gtgaacgcca ttgcccgcct    173340
     gggccacgac aagagggcca tccgttttga tgtcagcgtg ccaatgatat tcggcgcatt    173400
     ggttcgtagt gccaaggctc ggagcggtaa tatctggtac ttcagcgcaa atacggacac    173460
     cgatccaacg gcactcagta tgatgtccca cgtgtccggg attaatatga ggaataccga    173520
     cacatccgat ttgaccatct ccttgcactg gaacggattg cggtatcttc gattgggctg    173580
     cttgcactag cgtctcgtac gggatttgcg ccaacagcgt gagaacgctg tccgacacgg    173640
     gtgccggtgg cacatcggca gtgccaccat ggggtggcgc ctggaagaga tttttttcgc    173700
     agcccgaaac gccaaccaaa atgagaaggc ccggagcgaa ccgacgagcg gcggcggcaa    173760
     agtgagcgac acgcaacttc gtgtccggtc tggtacgcgc tgtcatggac atctccccca    173820
     agaatgctct gcacccgttg aagcggcggc actgaaagtc accgctttgt gatctctacg    173880
     tgatcgaatg accttcaggt ccccctatgc gcaggcaggc accgaagctc ctgccgccaa    173940
     agacagccga acaagcgatc ccgccataga actctattct tcacattgac cgcacattac    174000
     tctttgttgc atagtgacgt aagaggaggt ttggattttt ttagaaattt atagaggaag    174060
     agcgagttca taatgaccat cgtttgcaaa tctgttagcc gcttaaatat taaatcgttt    174120
     gaactattca tccgttgaag tttaatcgtt taacgtagaa tctcttaatc actatcatca    174180
     aatagagtcc gctagacttt ccctatttcc ttggaggaag gaatctccca tggttacgac    174240
     taatttgttc gacgagcgcc gccgcgcggt aatgattgcg gctgcaaaac gatggaaagc    174300
     gcaaccccca acgcccgcga cgacgcaagt gacgccttcg gaacaggcgc gctacgacgc    174360
     tcgccgttcg agctttgatc aggcgagtga actgaaggca caaggccgtc ttccggtgtt    174420
     cgtcgagcgg aagatggggc ctacccttga ctggtacacc ttgccgccag acgatgctgc    174480
     ccgagccgct ggccggccgg tcgcccgcat cgtggccaac gtcgatccga aggtcgaccc    174540
     ggtcgggttt gcgaccgggt tcatggtttc acctaacgtt cttctgacaa actggcatgt    174600
     gtttccggat cccggctcgg tacgaggaac cggcgcaaat tttcttcatg atgagacggc    174660
     atcaggtgtc gcccgcggca tcattttcga gtttgatccg gacgcccttt tcttctcggc    174720
     ggaggatctc gatttcgcgc tcgtcgcggt gaagccgaag gcaatcaccg gcgagcttct    174780
     ctcctctgtc aacttcctgg cgatcaacgg atcgcggtca aagatcctgc ccggaatgcc    174840
     tatccggatg atcgaatatc ctgatggcgg gccaaaacgc tatgcgatgg agaattgccg    174900
     gctgctcgag ctgcgggagg acggtttcct ccggtacgag accgacaccg aggaaggatc    174960
     gtcgggctcg gcctgctatt cggaaatgtg ggaggtcgtc ggtttgcacc acgcctccat    175020
     tccaaaaatg cgtggcaata ctattctcaa taaggacggt tcggcatggt cacctggcca    175080
     gccggatgac gggatagact ggatcgcgaa tgagggtgtg cgcataagtg cgttggtaaa    175140
     ggccttcggc gggcttgtac cgaccacgcc cgcctccaag catcttttgg acgaattgct    175200
     ggccaacacg accgatccta ccgatgaggt cgcgaagcta gcgacgcctc gcgcgccaga    175260
     agcccttagt cctgtgttac ctgatccctc caaaattttc gcaaacacga aaggaaacgt    175320
     gatgggcggc gttaccatga atttttccgg accagtgacg attttcgttg gtagcggtgt    175380
     gccggcatca cagcttccac aggcgacggc cgcagtcgcg acagacgagg cgctcgagaa    175440
     agcactgcgc ttcgacccca attacgacga tcgagaaggc tacaaccctg actttctcga    175500
     aaacgatatc accgtgccgc tgcctcgcat ttcgcaggag cgggaccagg agatgtataa    175560
     ggagaatggc cagatcgtcg tgctcaagta ccatcacttc agcctggcga tgaacgcttc    175620
     ccggcgcatg cagatgtggt cggcggtgaa tgtcgattac gatgcatcga aaaggacctc    175680
     cagcggccgc gccttcttcg gtcaagatcg ttgggtgttt gacccgcgaa ttccccagaa    175740
     ataccagttg ggcgatcccg acatctacgc gcccgccaaa cagatcgacc ggggtcatat    175800
     cgtgcgtagg gaagacaatg cctggggtga tgcgccgacg gaaatcgagt ttgccaattc    175860
     cgacacgttt cacttctcaa attgcacgcc gcagcacgcg gccttcaatc gctcccaacc    175920
     gggaaagcaa tggccgggag ttcaaggctt gtggggcggt ttcgaaaacc acattcaacg    175980
     cgacttgcaa tcaggtgaca cgcgcgcctg catcatagcg ggtccgatct tgcacccgaa    176040
     cgatccatcc gaagatttcg ggaccggccc ggtgcagtat cctcttgtct tttggaaagt    176100
     ggttgcggtc tcgacgcgcg ataccaatgg gcgccggtcg ctacgcacct acggcttcag    176160
     gctttcccaa aaggatgtcg tcgaccggtt cggagtggaa ttcgcgcccg gcgagtatgc    176220
     acgctatcaa gtcgccctgt cagccataag cgatgaggcc ggcgttattt ttgacgatgt    176280
     tctcttgcgc gccgataccc acgccgacgc gtaacgtgac actcggcgtg gcaacgatgg    176340
     ccagccgtcg catgctgtag acgcttcggt ccagaaggcc gccgctcacg cggcggctgc    176400
     ttcggaggcg ctgaagcgca acagatagtc tacggcgcgt tgcgcgtgcg cggcggcggc    176460
     ggcgaagatc gctcgtttat cgtccttcag cgcggccgac ttcgacgccc tcgccttcga    176520
     gctcgacatc ggcaaatggg agatgaatcg cacgcactgg gcgatcaagg acgtcaacct    176580
     gccgaaagaa ctgcacgctg cgcggggcat tgccttgccc tcgtggacgc ggcaggccag    176640
     ccgcgccgtc gacatcaccc agcaccattt cgatgttggt ctctcgtttc ccggcgaagc    176700
     ccgcgggctg gtcgagcagg tggcccgcga gctcgaggcg agtctcggcc ccaacgccta    176760
     tttctacgac aacaactacg tctcccagct tgcccggcca tcgctcgaca ccctgctgca    176820
     ggacatctat cgcaaccgct ccaagctcat cgtagtcttc atcggcgccg actatcagcg    176880
     caaggactgg tgcggcgtcg agttccgcgc gatccgcgaa atcatcatgg ctcgggacga    176940
     gcagcgcgtc atgtacgtgc gcgtcgacga cggcgccgtc gatggcgtgt tccgcaccga    177000
     cggctacgtc gacgcgcgac gcttcaatcc cgctgagatc gcccagttca tcaccgagcg    177060
     cctcgccctc atcgcctaat cgtcggtgag ccagcccggc gtcacggcga ccgtccggcg    177120
     gtcgaccagg acgcgacgac gcctcggcgc gccgggatcg gtgaggcgcg gcgtcaccga    177180
     gacaatggcg accttccagt caggcatgcc cggctggggc gcggccatga caccggacag    177240
     gaccgtcagc ccgcggcgct ccagctcgga caccgcggca agaatgtcat tgtagagctg    177300
     gcgccgccct cgccccgacg acaatggctc ctcgacgatg tcggagagga tgaacgaggc    177360
     gagatcgagc cattcgccga gattagcgat gtggtcgtca tgggtgtcgg gcacgccggg    177420
     acggtggatg agataggcgt cgcacttcgc ggcatcgcgg atggccttgt gcgtcttcat    177480
     cggcgacacc gccaccggtt cgagatggcc aaacgcctcg acgaggtgtt gttcggccgc    177540
     cttgtccgga ccgatcggca ggcgcggcgt ggtgaacgcg cccggcgcgt ggccgagcgc    177600
     ttgggcgatg cggtcgagcg cctcgtcgct taccttcttc gcgcgttcga cgcgctcgac    177660
     cgtcgacagc gagacacgcg cgaagtcggc gagcgtggtg gctttccact gcttgagatg    177720
     gcgaccccag cgcaccacca tggcgacgag ctcgatcgcc ggcggcgtgg gcacatcgac    177780
     cggcttgttg ggcagttcct taatcttgtc gagaagttcc tgggcattca tggacgaggt    177840
     ctcctttcgt gcccgcgaac atgcctcaac tccgccgagc aaaagaggtc gaaacgccct    177900
     tcagcacgca tcagctcccg acgcatcccc gccgcccgcg cacctgtcgg ttgaatcccg    177960
     ccggtctgtg ccacgcttgt cagcgcgttg ccccaatccg gccgagcccg cgcgctccgt    178020
     cagcgagacg atgattctgt cgaggcggcg gagcagatcg tcgtagggga cgatgtccat    178080
     catattcaca tatttccgct tgatcacctc caggtcgaac gattggttct cggtgagccc    178140
     gcccgtgccg tccgttcggc gatcgcggcc gagcagaagc agcgccttgg gattggtcac    178200
     ccggatctgg aggccggcgg gaagtgctga cccgtatcgc ttcgacagtt cgcgctcccc    178260
     ctcaacgccc catttggaga ggtggaacag gtatttctcg gcctgcatga tggtgcctga    178320
     cagctccttg gtcggaacgc tgttgccacg atacaggcgt atctcgagca gctcgccgaa    178380
     ggcctcgacg gcgatgctgt cgacccggtc gccgccaacg acgatttcgc tgccgggctt    178440
     cagctttgca atgcgccgaa agatgctgat attgcgctcg gcgacaaaga ccttccggtc    178500
     cggcgcgatc ccctccgcga cgatcagcac atcgttgtcg atccccagga tccgcccggg    178560
     aatgcggtga tatccgtctt ttgtggtcgc gaaccgaaac cgatagagcg gtcgatcgtc    178620
     ctcgtccgcc tcgtcgtcgt gagcggcacc gtgcgccgtc tccgccacga ggtcggaact    178680
     gcggaagaag aagacccggc tcagcgtcac cttgcccgcc gccttgagct cccgcgtcac    178740
     ccaggcattg ccaccgaagt gcggttcgta ttcgagcgtc acgcccttgc tgccgacctc    178800
     aacgaaatca tcacacgtgc tcctgcactg gctgccacca tcctcttcaa ccggcgccac    178860
     gactaatggc gacaaaccgg tctcgcacta tatcggtccg ccctgccggg ccgcggacat    178920
     ttccctcaag gaaatattcg aagtcgccgt tctgaagcag gactgtgaac tgttcggcga    178980
     tgaaccggtg gacttcggcc tctgcagcaa gaatctcgtc cacgatctcc ggccgcccgt    179040
     cgacaatgag gaggatatct tccatgtcac ggctcatgaa cagatcacct gcgccgcgcc    179100
     cgagataagc ttccagcttt gtcgcgacaa atagttccgg ggaaagcttt ttgatcctga    179160
     gcgtatcggt caattcatgg gttactgccg tttcgatccc agctgcgtac cagtggctag    179220
     tgaagccgag tatgccggca tcgtccggca taaagtcgac cttgaggtcc cgcagccgca    179280
     tccggcagat gacgttgtcc tcgggggact cagcgaaacc tcgctgcctc aattcttccc    179340
     gcaactgcgc ccactctcca taaccggcaa gatcgacgat gaggtcgaca tcgtcagtcg    179400
     ccctcacatc ctcaagggtc acttcgtctg ttataaaaag agcggttgtg cacccgccga    179460
     caaagaccag ccgttcccgg aagtcttccc ccaaagcttc cgccaccgtc tgcagcatca    179520
     ggagcaattg gcctcggacc gtcatttttt caggaacctc tccgaaagcc gctgtccagc    179580
     caggcccgct tggcgctgat tgccgagccg gatggcatca acgagagcaa gatattcgta    179640
     gagccgttca tctttctgga ctgcttcagg cacactcttg aacaaaggtg caaccgactg    179700
     ccccatgtcc cgcccttggg catagggcca tatgtgtatg tactcgcctc cgctgaccaa    179760
     tagccccttc agcatcggcg cggcgaacgc cgtcggaata ccgcgcgtca tcgcgcctgc    179820
     cttcgcggga aacacgaact tcaggccgtg gacgataaat tcatagagat tgcggcggtg    179880
     aggattggcc cgtcccgtat cccggtcttt aatggccaac cccgatgaga gactgcgctt    179940
     taaggaggcg ttgatctccg tcttgctgat acctgttagg gattccagcc cgcgaacaga    180000
     gaaggggtcc tcgcccgcaa agcccctacg ctgttcccca tggcccgcga actctccttg    180060
     ctcctgcaag ctcacgagct tcagaagcac cacgatatcc tgacttttca ttccaatcat    180120
     tgcagcttgt cctctgtcct aggaccaagg acattccatc attcgatgtc tctcctgtca    180180
     atgagaacgc taggagggcg ccgcggaaag cccaaaatac gtcgttttga gccgccggta    180240
     cgtggttcgc cggcagcatg atgattggct cagggcgctc accctagcga aagagcattc    180300
     aaacgtcgtc gtccgactgg cgagcgccgc cggcagcatt gaagcggtca atatcgtcgg    180360
     cagaagagcg tccgaaaagg gctgtcggtt gcttcatcgt gggaacgaaa aagcgagaga    180420
     agcagaactt tcgtgtgcga tttttgcacc aggcccgtaa ctggctgatt ttccttaagt    180480
     atctgtccag tcccgtcatg cgccagctga tcccatgacg acgccatggc accagccagc    180540
     ccaaggaaga accaggcgtc tgatctgggg aaggctgttt caggactttt gcgagatcag    180600
     cgaataaccg gctcgccatg gaagcgccgg cgcgagggcg gcgagacgcc gaagccgact    180660
     tccatcatca gccgtggcgt gcgcgacggt acggtgccca tatgaaagcc gaacgggtct    180720
     tcgacgaagc cgaggccggc ttcgccggtc agcgtgacgg ggctgtcatc gccatagacc    180780
     ttgagaactt cctgcgccgg atggccgaca agcagcgtca gctgatgctt gatggcgcgg    180840
     cggttatgac tgccccgcac atagacatgc gggccggtgc cttcgtcgac cggcgtcagg    180900
     tagaagaaga atttcagcat cctccagtca tcgagatcga aatgatactt gccgagcgag    180960
     gcacggttct tgtcggcgtc ggaggcctgg ccggtcggga agctccacca cacccgtgtg    181020
     gtgatcagtt tcgcctgagc gcccagataa tgcgcggcga tgtcgagcag cagcgggtcg    181080
     ttctggatgg cgaccgctgc cttgcagccg aggatgtgtt cgaaaaagtg gccgctgagc    181140
     agcgagcggc cgaaacgctt ctcggcctcg gcatggtcct cagccatgaa ttcgagacgg    181200
     cgatcgaaat tgccgaaaca aggcgtgtag cgggcgaagg cggcgatctc ctcatggatg    181260
     gaagtcggca ggacgagccc gcaaaacaac ccgtccgacc gcagcgcctc gacaatttcc    181320
     tggcgatcga cgccggcaaa catggtgtcg tgggcatttt gcgacacgcg aaccggcttt    181380
     gccccacgcc agtgcatccg gcgcgccggc atggtgcggg cgagcacgaa catcggcagc    181440
     catgccgggt tctcgcgaat gtccgacaga taggtcggaa tgcgcacggc gatgcggcgc    181500
     agcacgccgc cgtttcgcgc gatggcctcg agactggcgg cgccggattt gtcagggctc    181560
     gaaagggtca tgaaggtcct cagctatgaa tgcaatatga tatcgacgaa gcatcggttc    181620
     tcactgcctc gccgctggtc caagcccgat tcccgcaacg gaaggacgtt taggcgcgcg    181680
     tcggattttg tgcaacgcac aatagccttg tgcgtggcaa aagctgttcg gatcgccgtg    181740
     cgcatcagcc aatattccag cggcaggcaa acggggcggc ggcacttaga aagagccgcc    181800
     gcccggcttg gcagctattg gcggacgaac agcggctgga cgctcgccca ttgatcggcg    181860
     gtgcggaagc cgccgcgttt cgtgtagctt tcgaccggga atttcatcca gttgggcagc    181920
     cagttgtcga tcttctcgcg gccgttctcg cccgacaggc aatcgcggat gatcttcttt    181980
     tgcgtcttga ccttctcggc gacattgccg tcggcgacag gcttgccggc gaggtcggcc    182040
     agcattgcat tggcgatctc cctgtcgcgc agcaggtcga agaaggcgtc gtccgcttgc    182100
     caccacgcgc ccatgtcgat gcccagatgg ttgccgaggg cctcgacgat ggcgctgccg    182160
     gcttcgagcg tctcggccat ggcaaggctg agaacgcgca tgacgtcatc gtcgcaaagt    182220
     gccagcaaac gggcgaagac ggcggcaagc gcaaaggcgt cgccattgcc gccggctatc    182280
     gcaccctcct cgtcgggctg cccaagcagc gcaagcaccg cgcgccgttt ttcggcgaat    182340
     acagcttcgg ccctggacgc ggcaatgctt gccgccaccg cttcattggc ggtgcgctgc    182400
     ggctcgcggc gaacctgcca caggcccgag cctgcgatgg catgcgccac catcaggcgc    182460
     agcgcgacat ccggatggtc gagcatggcg gtacgcacgg ctccgtggcg gtgcagatcg    182520
     acatagttct gcatcggccc ggtgagttcc ggccgcgacg gcctggctgg cgtttcgtcg    182580
     ggctcgccgc cctcgccttg cgcgcgggcg cggcgggcct ccttgcgcga cagccagccc    182640
     tcatggcact cgaccgcgcc gcgatgcgag actgatatga agaccttgcc gcccttcttc    182700
     ctcggcgtct tttcgtggtc ccaagactgg aaatgctggc ccggttcgag cacggccacc    182760
     tcgggccagc cggcttccag ataggcatcg cgtttggcgg cgatggcctc gttctgcttt    182820
     tgccagaaca ggtcggcatc ggcgaaatag ctgtcctcgc cgaacaggtc gcagacgatc    182880
     aggcccggat agtcctcgat ggcaaacagc gccatcttgg tggaaatcga ctggccgccg    182940
     aacagccatt gcttcaactg gtggccttgc ggcgcgtatt gctcggggtc ggcataaagc    183000
     gccagccaat ccttctgctg ccccttggag gccatggtca gatggcgcgc cgtctcggcg    183060
     tcgatgtcct cgcgccgata ggcctcgcgg attttgggca gaagatcgcc gagcgccaga    183120
     atgcgtttga ccagaagctc ggtgacgccg aaggttgcgg cgatatctgg aatggtgcgg    183180
     ccttccctga tcagccgcga aaacgtctcc cactgcgaca cctcgtcggg atcgagccgg    183240
     gcgaagtttt cgatcagcga ggcctcgagc gcgtcggcgt cgtcgccgtc ctccatgatg    183300
     gcgcagggca aggcattgcg ctggccgcgc tcgtcggcga gcgacttcgc ggcgaaatag    183360
     cggcgccggc cggcgacgat ctcgaagctt tccggcgtgc cgttgggccg caccagaagc    183420
     ggcaccagga cgccgcgcgc gcgaaccgat ggcaagatat ccgacacgtc gggcgcgcgt    183480
     ttggaatggc gcatgttgag cgcggaaatg ttgagcttat caagcggaat gtgggcaagt    183540
     tgcatggttt gtctccttgg ttgaggggtg ggatttcccg ccgcagaggc tgcaagccgg    183600
     cgcggcggga cggttttcgc gcctagcggc gcgtctgttc cgccgtgtcg ggcggaagct    183660
     tggaatgggc gttgccaagg gcctctgccg cctgtcgcag caaccgctcg gcttcggtga    183720
     tgtggccggc gctgcacgct gcctgggcgt agacggagag cggaaactcg gccttgaagc    183780
     cgaggtcgcg ctcgatgccg aggccaagcc gccccttgac gcttgcaagc tcggcaaggc    183840
     tgacgctgcc gagttcgggg aagccgaagc cgaggtcgca aaggccgaaa agggtgtcgc    183900
     cgtcggcgtc gagttcagtg agaagccagg ttgctggccc ggtcggatcg aacagtttga    183960
     ccaccgggac atggtcggtt tcggtgtcgg ttgcgccatt ggcgagcagc cgggcgcaaa    184020
     gctcgtcggt gatcaggatc atgggaaact cctctcaaaa cggttcgagt tgatttctgg    184080
     cgtcatcgaa cagcccgata tcgagcggct tttgcgccgc gcgcgggcgc atcggcgcgt    184140
     ccgccaaagg gcaaggcggt cgcgcgtggt gagcggccgg acaccgggaa tgagcgtctg    184200
     ctcgcggttt cggttcggtc tgcagggtgt cgggatcgcg cgcgctcatg ccgcgatctc    184260
     gtcttgttgc gcgccttggg cctcggcgtt gaagcccaga agaaaatcgg cggccttgga    184320
     ggcaaggctg gcggcgcgga agatggcgcg attgtcctcg cgcagcatcg tcagccatgc    184380
     gccgatatag tcggcatggc gcacgctcgg ctcgatgccg agggtcgaac agacaaaggc    184440
     tgcggtgatt tcggcaacca gttcctcgcg cgcataggcc ttggaaccga aggcgctgga    184500
     gaggtcgcgc gccagccgcg ccgggtggcc cgtccagtgg ccaagctcgt ggaagcaggt    184560
     gcggtaatag tcgatctgct gaaagaatgc gggctgcggc ggcacctgaa tggtgtcact    184620
     gcccggcatg tagaaagcgc gatcgccgcc gatgcggaaa tccgcgccgc ttgctcgaat    184680
     aagcgcctcg gcttggggga tgatctcgcg ttcgggcagc ggctcgacgt tgcggtaaag    184740
     gtgcgcgggc aggccgtcgc actgcgcgac gttgaagacg gtgaagcgct tcaagaaagg    184800
     caccgcctgc ggctcgtcgc cgtctgtcct ggcgcgctcc tgctcgccct ttgggacaaa    184860
     gcggtcggca tgcacgattg ttgtgccgcg ctcgcccttc ctgacattgc cgccaagggc    184920
     aagcgcctgc cggaaggtca gccagttctg gccgggatag ctgcgctcga tgacggcgcc    184980
     ccacaggatg aggatgttga tgccggaata gcggcgcccg gtggccgcgt tgctgggcag    185040
     gccgaggtcg gcctttgcgc tgccccatgg cttgacccat ggcacggtgc cgcgctccag    185100
     ttcggcaatg atgcggtccg tgatttcctg ataaaggctg gcgcccgggc gcccgcccct    185160
     gcccgcgcca gcctctcggc tgccggaacg ctggtgtttt gcacgcatcg tctggtcctc    185220
     cgctcttcaa tcccgcgcct ttccccggaa gcggggtggg cggcgagacg cgaccggaaa    185280
     ggcccgccgt cggaggcgga ccgcatccga aggaccggaa cgaagaggag gacccgaagc    185340
     gaagcgaagg gttgcgggat gccgcggcgg gcctagaagg gagtgccgcc caccccgcgc    185400
     cgccgggaac ggccaacgaa caaaccgcgc cggccgacag ggcggcgacc gtcagcagcc    185460
     gacaggctgc ccgcgccagg gggcgaagcc ggatggccga gaccgccgga gcctggcgaa    185520
     gaaaaagcgg gctcggttca cgagcacccg gcacgcgccg tcaggcgcgc gggcgcatca    185580
     gatttctgcg ccgtgcggac atcggtttgg cgttccggtc gcactcgttc aatcagaacg    185640
     aggtcttgat gccgaccatc accgtcgccg cggcaaaatc gccgccgatc cagtcgtctt    185700
     cgccgccagt ctctgcgccg gtcgcaatgt cataggtgtt gtagtcgccg cgagcggtga    185760
     acaccttttc gtaggaaccg gagacgaaga agctggtccg ctcgttgtac tggtagccga    185820
     cgctgccgcc gaccatcaga accggcgccg cttcgaaatc atcctcgaag cgcaggtcac    185880
     gcatccagtg atgatcggta gcgccggcgg agaaggtcgt gccgcccttc agcgcaaagc    185940
     cgaagttcca gcgatcctgg acataggtcg catcgatgcc ggcgaaggcg accggcaatt    186000
     tctgctggta gctgatggcc tttgcgtctc ctgggaagtc gccaaccgaa tcccggaagc    186060
     cggcaacgct gtagacatag gagccgccat aggcagtcca cttgaccgag gtgtacttga    186120
     aaccaccgtt gacgttgatc agcagctggt cgctgacctg gaaatcgtgg ccgagcgcga    186180
     cggttgccga atagaagtaa tcaagatcgg tgtcggaatg gcgcgaacgg tcgctccagt    186240
     cgttccagcc atcattggtc gagaatggcg ggatccagtc atagtcttcc atgtagctgt    186300
     tgccgctgaa ggcgatctgg ccggaaagct tggcggtcca gccggcctcg ctgcgcgccg    186360
     tcatctcggc tgaaatgacc gcagaggtgc tttcccagat aaggtggctc agcttcgagc    186420
     cgctgccggg agcctgatag actagctcgt tggcctcgat gtcgatgacg ccgacgccgc    186480
     caacgaaaga gaaattggga ttgtagggcg ccggttcgct cgccaccgcg tcgctggcca    186540
     tcgccggcca ggcagcgagc aacgctgccg ctccaccaaa gactttcgcg tacaatttca    186600
     tgggactacc ctcataggaa tcatcgtcgg ctatacgcag cgtaaccggg tgcacgtcag    186660
     gtgcggtcgt ctatgcagcg cccctgtagg tggcgaaatt gccgccctcg gctctgttcc    186720
     tcaacactca aggaaacgcc gttgacgtga cccgattgac ggcggttttt gccgatgcgt    186780
     tccgggcggc cggcgtgacg ggaaccctgc attatccgag gcacacattt gcgatgacga    186840
     tgctggtacg attgcagcgt caggcagcga ccacgccgga cctcaatccg ctgagatcgt    186900
     gcaggttgct ttgagcagcc catagcaaac tctctagtct agataatccg atagagccga    186960
     gggccgagtt cctcgaaccc gttgcgcaga tagaaatcga gcgtgcgctt ccattttggt    187020
     tgcctgggcg ctgcaagctc aagtcgcttc caaccacgcg cacggccttc ccgcgaggcg    187080
     acctcaagca gatgaggggc aatccctttg gagcgctttt cgggtcgaac atacagctcc    187140
     gaaatatagc cgaacttacc tcctgcatag atcgccgtgc attcattcag caccatgatg    187200
     ccgaccggct cgtcatctgc acttgcgatc acggcgacca cgccagcgtc ggcaagcatt    187260
     atctgcgcgc tttgtctcac gtcgtcgggc gcgggcgctt tcccgccagt gagttcatcg    187320
     agtagcgcgt gaataaaacg gacgaccgtc cctgcgtccg ttgcgttggc gcggcgcgta    187380
     gatatggaag gcatattttc tcctgctagt ggtcaaaatc ccgagtcacg ctgctatccg    187440
     cgcagatccg actcactctt ttaagtaact ctgacgagtg aacagcattt ttcatcgaaa    187500
     atatgataaa agaatgcaaa atatatatta caagcatgca ggattacgga tgacttgagg    187560
     tcaattgcgc agatagggga ccttcttaca aaaaatcaac ccggtcacat cgcaactgca    187620
     cggtgaagcc ccttgccgag gtaagatgaa gctgcaagtc gaaaagggcc tgagacaaaa    187680
     gatgcagcct gagatgctcg tgcggccaga acgctcggac aatgcagtcg agcaaagagg    187740
     acatccgtaa cgggcggcga gagcgctcga cggtcgccac aactcattcg gcgccagccg    187800
     gaacacgagc cgagccgacc ggtgcgcaga ggctggtcgc cgcgccgatc aagtcggaca    187860
     cgtcggcctc ggtcgtcgcg aaagaggtga cgaacctcac gatcccgggc tcccagcgat    187920
     catggtagaa gcggaatccc atgtcgagca gcccccggat cagggacgtg ggaagtcggc    187980
     agaacagtat attggcctcg ggccgctgct ggattttcac gcctggcacc agggccaacc    188040
     cccgcgcgag cgccgatgcc atcgcattgg catggaccgc gttgcgaagc cagacaccgt    188100
     ccctcagata accgtccatt tgcgccgcca tgaagcgcat cttggaactc aactggccgg    188160
     cccgcttgcg gcgaaaggcg atcgtgctcg cgagatctct gcgaaacgag acgaccgcat    188220
     cgaccccaaa cgttccgttc ttggtggcgc caaacgacac taggtcgacg ccggccttcc    188280
     acgtcatctc ggccggcgag cagcgcagag tgacgagggc gttggcgaag cgagcaccgt    188340
     ccatgtggag cggcaggttc gctgaccggc agatatgtcc gatcgccctg atttcgtcga    188400
     gcgcgtagac cgatcccatc tcggtcgcct gcgtgatgct gacgctggag ggctggaccg    188460
     agtggatatc gcccaccatg cgcgttgcat tggccgccaa ggcgtcgatg gcgattttgc    188520
     cagcctcgcc tggaagctgc accaacttcg caccggcggt gtagaactcc ggcgcgccgc    188580
     actcgtcgcg gttgatgtgt gcgtcggcgt gcgagaggat gctgccccat ggcggcgtaa    188640
     tcgccgcgag cgccagcgcg ttcgccgccg accccgtcga aacgaggaac acgtcgaccg    188700
     catgctcgaa cacctcggcg agctggcgct cgacggtatg cgtcagctca tcgttgccgt    188760
     agggaagcgc ctgacccgac gcgcacgcgg tgatggctgc gatcacctcg ggggagacgc    188820
     cggcgatgtt gtcgctggtg aagccgcggg ggcgggtctg cttgctgtcg ctcatggtct    188880
     tgacgctcgt ttcatccatt gagcgtccaa gctagacggt tcgccgcgcg ctttattgaa    188940
     cgatattcaa acggagaggt aacgcgccgg cgtcaccccc aacaccgctt tgaagtgccg    189000
     ggtcaggtgg ctctggtccg cgaaccctac cgcgacggcg acctcggcga cctgctgacg    189060
     tcgcctcagc agccgtcgcg cctcgtcgat gcggacctgg atcaggtagc gggtgggggg    189120
     caacccgaaa tgcgccttga agccatcgat caacgtcgcc ttggagcatc cggcgagggc    189180
     ggccagggcg gcgagctgca ggacttcgtc aaagtgggca tggatgaagt cacgcacgtc    189240
     gcggaacctc ggcggcacga attttggccc agcaacgcgc gacccgccga cttgtgcgaa    189300
     aacgcggcgc aggaagcgga tcagatgctc ctcgatctcc agtgccgagc tatgctcatg    189360
     ttcaaggagg cgccaaaacg cgctgaggcc gtgtgcaact ggggcattct cctggaacgg    189420
     gcttttgaag tcgatcgttc cgggttcggt ttggctgctg tcctcaagga cttgccggac    189480
     aaggccttcg ggcatgtaga agatcttctg gctccagcca agatcgtcac cagcgccccc    189540
     gaaatgcggt tcgccgggcg cgaaggtcgc gacggtgccg ctaccggcgt gccaaacctc    189600
     acctcggcac cagacatcat ggacgcctcg ctcgatcagc ccgatcagat actcgttgtg    189660
     gatatgcttg gagaaatcct gccggtgata gtccgccgcc aggtaatcga gcccaccaag    189720
     gacatcggag tgcttcatca ccgcacgatt gcgcggcggc cggcccggag gttcagaacg    189780
     gccacgcgcc ttttcgtcgc attctacggc ggtatcggcc acttgatgga tcaatccagg    189840
     tcggtcgtca caacgatatc gtgctctcgt cgcgaatttc aaaccgaagc aggattaatt    189900
     gccgcccgaa gaggggcctg ctgcagggcg ggcagcggat tggcgggatt aatcgtgttt    189960
     caagcttggg aagtggaccc gagcgacgcg tggccggatg gccgatatcg agaagaagac    190020
     caagcgctat cctctccgat ctgacggatg aggaatggtc gcggatacaa ccgttcctgc    190080
     cgggcgcggc caagaccggg cggcgcgtgg tattgaacgc gttccgctac atggcccgat    190140
     cggatggcgg ctggcgcatg ctgccaaagg atttcccgcc catatcggcc gcggtcgaga    190200
     cgccttacgg atacgcccac ggactgcgcg aactggctgg aacgttcccc ggcctgacga    190260
     ccgagcagca ggcgccgatc aaggcgctga acgcagaata cgccaaaact cgaagccgag    190320
     gacgagcgtg ccaacgaact gccggccgat gttgacgaac ggctcccagg ggcggctacg    190380
     gctgcactca ttgtcggatc ttcgacgaag tcggacatcc gacacagcgc tatcggagtg    190440
     accgcattgt tctgcaacga ttttctcatt tggcacgaca catgcggggg ctatcccgca    190500
     tgagcgctcc gtcaatctcg attgatgcga gcaggattca atcaaggcgc agtgcgtcgc    190560
     ttctgaagat caaggagaga aaagtatggc gagagcgcga attggcgtgg cgcgggcaat    190620
     gacagcggct gtcgtcctca tcgttgcggg acaggccggc gcggcagatg ttgggcaagc    190680
     cgcgagcgtc ccgcaggcag aagcctgcgt cgcggaagcg ccaagcccct ggcagatccg    190740
     cctgcgtgcg ttgggggtga tcaccgagga ttcgggctat gtcaatgcgg tgcccggctc    190800
     cggtctttcg tattcgaaca ccgtgacgcc ggaactcgat atctcatatt tcttcacgga    190860
     caacatcgcc gccgaactca tactcggcac cacctatgcc aacatcgatg gccagggtgc    190920
     gatcggcggg ctgggcaagg taggcaaggt ttggctgctg ccgcccacgc tcacattgca    190980
     gtatcatttt accgatttcg gcgccttcga gccctatatc ggcgccggcg tgaactatac    191040
     gatcttctat catcagcaag ccggcagcgc cgatgatctc aaggtcaaga acacattcgg    191100
     cgccgcgctg caggtcggat tcgactacat ggtggacgag cactggggcg tcaacttcga    191160
     cgtgaagaag cttttcctca agcccgactt cgacgtcact gtcgccggcg ccaagctcac    191220
     gggcaaggcc aagctcgatc cctggttgat aggcgcaggt ctcacctacc gcttctgagg    191280
     acgaagcaca ctgggggggg cacttttcga agtccgcgcg cggatcttcc gtgccgagaa    191340
     gtggacccgc gatggtcttg aaggagttgt tggcatgcgt gtagaaaacg atcattgcga    191400
     cgtgatcggt gtgccggccg ctcccacgca acttgatcgt ctttcttctg cgattctgcg    191460
     gcaggggggg atggcgcgag tgtcgctgcc aggcgatgtg gtgacctggg cggcagcccg    191520
     tcaccagacg ctcaggcaga tgctttccga ccagcgtttc aataaggact ggcgacagtg    191580
     gcgggcgctg caggacggcg agattcccga ggatcatccg ctgatcggga tatgcaaagt    191640
     ggacaacatg accacggcgc acggcgccga tcaccggcgc ttgcgcggcc tgctgtccag    191700
     cagcttcgcg cccagtcgta tcgccttgct ggcgccacgg atcgaacaat gcgtcgatcg    191760
     actcctggcc gagatggcgc agcgcggcgg cagtgccgat ctgatgtgcg agttcgccgc    191820
     tccgctgccc accaacgtga tcgccgaact gttcggtttg ccggacgaac agcgcgaaga    191880
     gatcgtcgcg ctcacctaca gcctggccaa cacctccgcc acagccgaag aggtgcgaca    191940
     gacgcggcag cgcatcccgg agttcttccg tcgcctgatc gcgctcaagc ggggccagct    192000
     cggcgatgat ctggcttcgg ccctgatcgt cgcgcgtgac aaaggcgagc tcgtttccga    192060
     caccgagctc atcgacatgc tgttcatggt gctctctgcg ggcttcgtga ccaccgccgg    192120
     cgtcatcggc aatggcgtgc tggcattgct gacgcatccg cagcaactgc acctggtgcg    192180
     cagcggccaa gttccgtggt cacaggcgat cgaggagatc ctgcgctggg gcagctcagc    192240
     ggccaatctg ccgttccgct atgccaccca ggacgtggag atcgacggat gcatggtccg    192300
     ccgcggcgat gccgtcctga tggcgttcga tgcggcgaac ggggacgaaa aggccttcgg    192360
     tcctggcgcc gacagattcg atgtcacccg gcggcacaac ccgcatttgt cgttcggcga    192420
     ggggccgcat tcctgcctgg gcgctgcgct ggcgcgcctg gaattgcgct gcgccttccc    192480
     cgcgctgttc gggcggctgg aggatctggc gctgaccatc gctgcggagg acgtcgtcta    192540
     catgccgtct tacgtcattc gctgcccgca gcgcctgccg gtcagcttcc gcccttccgt    192600
     cgcttagaga gtgccgcatt caccccggat tcggtgattc tcggttcgcc ggggtggctg    192660
     gtctcgcacg aggggggcga gcatgcccgg ttacgcacga tcgtggcgcc ggccttcagc    192720
     aatcgcaggg tgaagctgct cgcgcagcag gtcgaggcga tccccgcgca gttgttcgag    192780
     acgctggcgg cccagcccca gtccgccgac ctgaggcgcc acctctcctt tccgcttccg    192840
     gacatgttat cagcgtgctg atgggcgagt gcgcaagcac gctgagcaaa gccgagcggg    192900
     gaacaaatac cgggattccc ggcggaccgt gacggcctcg ccccacttta cgctcttgag    192960
     cccggcgacc tcgatctgat ccggcgtcgc cgatggggac aaggatctct ccgagcctgc    193020
     actgataaga ggcggcatcg taagcggctt tgggcgaaag agaccgatca gcgcaagggc    193080
     actattcgca tcatcacata aacatctcgt tatatgtatt gacaaggagc gaagctgctg    193140
     tgattgtgcg catgtcgtgg ttctccgcgc ggcactgccg tagcggagct aagagggaag    193200
     ccggtgcgat gccggcgctg cccccgcaac tgttagcggc gagccaagcc cattggtgtc    193260
     actgaggcga acggcctcgg gaagacgggc agaggctttg acccgcgagc caggagacct    193320
     gccacgacga acaacgtcca cgggcggggt gtctcggtgg ccgcagtagc ccggcttcgt    193380
     gccgcctgct cgcgcgttcc ttgtccccac gccccaacca tcggggtatg gcatgactgt    193440
     ctctcaacaa attcctgtgg caacgctcgg cgtgccgcgt atcggtcgac ggcgggaact    193500
     gaaattcgcg cttgaaagct actggtccgg aaaatctccc gctgccgacc tgctcgcgac    193560
     ggcgaaggcg ctacgcgccg ccagctggag ggagcagcac gatcgcggcg tgtcgaaaat    193620
     cccgtccaac gatttctcgc tttatgacca tgtgctcgac accgtcgcca tggtcggcgc    193680
     cgtgccggca cgatacgtct ggactgacgg cgaggtccca ctcgatacct atttcgccat    193740
     ggcgcgcggc aaccaagatc aggccgctga ttgcggacat gccggtgacg agcatgcggc    193800
     caacgggcat ggccttgccg cgatggaaat gaccaaatgg ttcgacacca actatcacta    193860
     cattgtgccg gaacttaccg acgatcagag ctttgccctc tcgtcggcga aaccggtcga    193920
     tcatttcctc gaggccaagg cgctcggcat ccacacgcgc ccggtcctgc ttggaccggt    193980
     tacctttctc aagttggcga agtcacctga ggaaggtttc aaccctatcg cgctcctgcc    194040
     acggctgctg cccgtctacg aggagctcct gcggaggctg aagctcgcgg gagccgattg    194100
     ggtgcagatc gatgagccgg cgctcgtggt cgatctggtt cccaacgaac gggatgcgct    194160
     ccaattcgcc tactgccggc tgtcaaaagc agcaccggag ttgaagatca tggtcgctac    194220
     ctatttcgga tcgctgggag acaatctcga gaccgcgatt tctctgcccg tggcgggact    194280
     gcacgtcgat ctcgtgcgcg ctccagagca gttggagacc gtcggccggc tcgcgcagaa    194340
     ggaccttgtg ctctcgctcg ggctgatcga cggccgcaac gtctggcgcg cgaacctgcc    194400
     tgccatgctt gaccgcatca agccgatcgt cgccggttgg ccgcgggacc gcgtggagat    194460
     cgccccgtcc tgctcgatgc tgcatgtgcc gatcgacctg gacatggaga cggcactcga    194520
     tgcggatgtg aaatcgtggc tcgccttcgc ggcgcaaaag accgacgagc tggtcgtgct    194580
     cgcccgtgcg ctggccgaag gccgggacgc ggtcgccgcc gaactagagg cgtcggctga    194640
     ggctgccgcc gctcgcgcga catccgctaa ggtgcatgat ccgctcgtcg aaggtcgggt    194700
     cgccagcatc aaggtcgcca tgacgcgccg gaagagcgca ttcgacgtgc gctccaagct    194760
     tcagggcgac acgtttggct tgccatcctt ccccaccacg acgatcggct ccttcccgca    194820
     aacagccgag gttcgcaagg cgcgggcagc ccatgccaag ggcgagctga gttacgtcga    194880
     ctatgaggcc ttcctgaaaa aagagataga agccgccgtt cgctggcaag aagagatcgg    194940
     actcgacgtg ctggtccacg gcgaattcga gcgcaacgat atggtgcaat atttcgctga    195000
     gcagctccgc ggcttcgcct tcacgcaaca cggctgggtg cagagctatg gctcgcgctt    195060
     tgtgcgcccc ccgatcatca ttggcgatgt gtcgcgacaa cagccgatga cggtacactg    195120
     gtggcgatat gcccagtcgc tgacgccgaa gccggtgaag ggcatgctta ccggcccggt    195180
     gacgatcctc aactggtcct tcgtccgaga cgaccttgcc cgctcagccg tctgccgcca    195240
     ggtcgcgctc gccattcgcg atgaagtgag cgacctcgaa aaggccggcg ccgggatgat    195300
     ccagatcgac gaagccgcac tgcgcgaggg cttgccgctg cgcgaggccg agtggcaggc    195360
     ctatctcgac tgggccgtcg aatgcttccg gctggcttca acggcggtcg gcgatgcgac    195420
     ccagatccac acccatatgt gctactccga gttcggcgat atcgtggacg cgattgccgc    195480
     aatggatgcc gatgtgatct ccattgaaac ctcgcgctcg cagatggaac tgctcgatac    195540
     gcttcgaacc ttcaagtatc cgaacgagat cggtcctggt gtctatgaca ttcactcgcc    195600
     gcgagtcccg gaagtgggcg agatttccaa ccttatcatg cttgcgcgcg atcgattgtt    195660
     ggatggccaa ctgtgggtga atcccgactg cggtctcaaa acgcgcagat gggaggaggt    195720
     ccgccctgcc ttggtgaaca tggtggctgc agcacgcgca attcgggaaa aagcgcggac    195780
     ggcgtagggc tcggtgccac tcgccggcgg tgagcggcaa cgccacacac cgggcaatct    195840
     tggggtgagt ccatccggcg cacccaaggc aatcgagctg cccgtgacga agcgcctcgg    195900
     caagcttggc ctggccgcgg cccttgttac ggcgcgtcga agtcagcttt ccagacgccg    195960
     gcgttggctg gcgatcgaag caggcttcgg tctcaaatga gccggccaga aacgaggcgg    196020
     ctcaccgcca gccagtttcg gattattccg tattgggata atccagtgtc actatcatct    196080
     ccccgacctt ggtcgccgaa ccccggtccc gaccatcggg agaggcattg gcgatcacgc    196140
     gccgccggtc cgcggagcgt gttccgggaa atcggatgca gggccaagct gggggaaggt    196200
     tcaaacggca cttccggaga ctgttgaagc ggcatcgacg ctccgccatc tgcagcgggc    196260
     caattcccgc tcgatggctc cgtctcctct ggctgcaatc acgatcaccg cgacggcgaa    196320
     gccgagcggc cgcagctggc tggcggaccc ttgtgttttg atggtggaag atcaggcgcc    196380
     ggaccaggaa agccgtcgcg gaaagagcgg ggttggcttg ctcctggcgg atgccggcag    196440
     aggtattcgg accgcgctca atcgcgatgc gcagatggcc gaaattcacg agcggcgtcc    196500
     caaatctcaa tcgctgcgca gaatgcgtgc ttcaagtgcg gctgcgacga aagctcgtcg    196560
     agcggctggt ggatgggtct taccgcgtaa cacctgcaga caggtgtcca tcgctatcct    196620
     gcgtttatcg gtcgcatgat gcagatcccg gagcaagata gcggccgcgt cgttgacgtc    196680
     gaacacgaca cgctccgagc tgcggcggct aagctgaact acgactggcc tctcaaatct    196740
     gatcaacccg gtcatcccct cctccacagc cactactcgg caaaaagccc gggccgcctt    196800
     tctttactca gccgaacgcg accgctgcac ctgcgccatt gagcctggcc attggcgggc    196860
     aagcgatcgc catgaggcgc gtccggccat ggtcagcttg cgtgcgatct gcggttgtgc    196920
     agtcgatggt gaggaactgc ttctcattcg cgtggtctag ctgtgaaacc tggacatagt    196980
     gcactgtttg acgcgcctcg ccagtctcaa acatgtcgtc gatgtctaca cctgcacttt    197040
     tccactgccc gatctgcagg cggcgatcca ctgcatcgcg gaggttgcat cttccaatat    197100
     ggcgacccgc ttcgcaaagc cgaaaaaggc attgcgcgcc gtgcttaccg gcttgcgccc    197160
     atcgtatgca tcgtagcatg ccctcagggc ggcttcgtgg atcaggtctc tgcggtcttc    197220
     cggccattcg ttgagaaaat cgattgcatc cgcaaggccg gcaatctctt ggatgatgtg    197280
     ggttgcgcgt ttcacaaaaa gggggctgct gaaagcctca gcgttcattg gtttctccca    197340
     actttctaaa tagccaattt gcggtgaaga ggcgccgcat cgacacggcg accatggcac    197400
     aatgtgttgt cagggcgatg acggttcaag aggagatccg cgaccgcggc cgggcgtgca    197460
     gcgatccgcc aacacatcat gcaatggctt ggttgctatc aaacgccgtc gtcactatta    197520
     agctacgaag tgattctcac cgcctagtct aagcccgcag gagcgttttt atgaccgaag    197580
     aaaccgagag caaagctgac agcctcatcg aactcaccgc ccatgtcgtc tcagcctatg    197640
     tttcgaacaa tccggttccc gtcggtgaac tgcctgggct tatcggccag atccacatcg    197700
     cattgaaagg cactgctggt ggggccgcac cagaaaagcc ggaagctctc aagcctgccg    197760
     taccgatcag aaaatcggtt acacccgact acattatcag ccttgaggac ggtaagaagt    197820
     tcaagtcgct caagcgtcac ctggctaccc actatggcct tacacccgac gaatatcgcg    197880
     cgaaatggga gctgccggca gactatccca tggtggcgcc gaactacgct gcggcgcgct    197940
     cggcattggc caagaccatg ggtctgggcc gcaagccgaa ggaaccggaa acgccggcac    198000
     cggccaagcg tgccggcaag aaagccgcag cctgaccgca gtttttcagg atcggctaag    198060
     cggatccggc atcatttcgc actcgcgaga taaaatttgt gcgttgcaat atccgcggcg    198120
     atcggtatga taatgttgtc ggccatctac tcctcccaga tgtggtgccg acgctgaatg    198180
     gggcgcacct cctcccgcgt ctcattcgaa atcgagcccg ctgccacctc ctcccggcag    198240
     cgggcttttt tatttgttga gccgcgattt cggtagagcc aacgcatttg gctaagcgag    198300
     gcgaatgctc cgaacttcca ggcccttctt gccctgaccg cattggacaa acaccttctg    198360
     gccctccatc agcatgctca gtcccgagcg ggtcagcgcg gtggcatgaa cgaagatgtc    198420
     cttctcaccg ttttcaggag caatgaagcc gaagcctttt tcaggattgt accacttgac    198480
     cgtggcctcg ctctccaact gggcactcgt cccggcggtg gactctccag cgcaacgcgt    198540
     atgtagctga gttctcgcgg tctgatcgcc gacctccagc acttgcgcga cctgatgacc    198600
     acctcttgga ctttcttccg ttgtgacctt gagacgcgtt ccctcggaaa caccgcggct    198660
     cccggccgcc tccagcaccc ggatgtgcag ataggcctgg atgccctgcg gcagtttgac    198720
     aaagccaaaa cccttgctgg tgttgaacca caccacttcg gcgtcgacag ggtccgcggt    198780
     tacgatcgac ggacgctgaa agtagcttgg ctcggaaggc cgttccgtaa aagaagccgc    198840
     gtcatcgtca tgacgatgcc ggcgtggctc acgatggtcc ttatatttgc ccatgatcgt    198900
     ccgactggct tgaacaacgc actgcgctcc cggcgggata atctcaatcg ggcgatgcgt    198960
     tcatgtcaat tcaccagttg gccgcttacc cgctcgatcg catcacgatc ccgacctgtt    199020
     gccacacgcg gtcgatgatg gcgggtgagc aatatatgcg acaggtcgag ctgccgatcg    199080
     aaacgcttcc ctatatcgca cggcagaagg ttcgcactgg agggcgacaa cgccatcaac    199140
     gtttcgatca tgatatgccg cgggctgccg tctcacgcgg atgcgcatcc gacatttcga    199200
     tttacgcgca cttttccgca cagcccccag gagggcagac gggcagctcg tcattaacgc    199260
     cccctacaac aacccagcct gctcggcctc gcggcgcaaa ttctgccgtg gccttgggcc    199320
     gatctgctgg atcaccaatc cggccgccag cgagccaagg tcgccgcagg tcttcaggtc    199380
     gcggccttgc gtgtagccat gcaggaaacc ggcggcatag aggtcgccgg cacccgtggt    199440
     gtcgaccagt tccttgatcg cggtcgcctg gatgaccacg gtctcgtcgc cgcgcacgat    199500
     gaccgagccc ttttccgagc gggtcacggc ggcgatcttg cagtccttgc ggatctgcgc    199560
     cagcgcctcg tcgaaggagg cggtctggta gagcgatttg atctcgtggc tgttggcaaa    199620
     gacgatatcg accgtgcccg agcgcatcag cttgaggaac tcgtcgcggt agcggtcgac    199680
     gcagaacgaa tccgacagtg tcatcgacac ctcgcggccg gcggcatgcg cgagcttcgc    199740
     cgtctgccgg atcgcctcct tggcgcgcgg cgggtcccac agatagccct cgaaataggt    199800
     gaccgccgca cccgaagcct tgtcggcctc gacatcctcc ggcccgagct cggtggcggc    199860
     gccgagatag gtgttcatcg agcgctcgcc gtcgggggtg acgaagatca tcgagcgcgc    199920
     cgtcgggggt agacccgcca gcggcctggt gtcgaaggcg acaccctgcg catggatgtc    199980
     gtgcgcgtaa atctcgccca gcgcatcgtt cgaaaccttg ccgaagaagg cggcacgtcc    200040
     accgaagctg gcaacgccgg ccgccgtgtt gccggcgctg ccgccggagg cctcgatcgc    200100
     cgggcccatg cggctgtaga gtagttcggc gcgatgggtg tcgatgaggt tcatcgcgcc    200160
     cttgatgatg ccgttggtct cgaggaattc ctcgtcgcac tgggcgatga tgtcgacaat    200220
     ggcattgccg atgcaaagca cgtcataatc cggcatcaat gtctccgcca actacccacc    200280
     ggctttctgc tatgccggcc aggcgcgggt ctagcgagtt gaaatgggtt gccgcatgcg    200340
     cttgatccag cggccctcac gcagctgccg gtcctgcttc acgcagcaag tcgtcggctc    200400
     tgtccgtctt ctcccaggtg aactcaggct cttcacggcc gaagtgtccg tatgtcgcgg    200460
     tcttgcggta tatcgggcgc aagagatcaa gcatcttgat gatgcctttc ggtcggagat    200520
     cgaaaagctc aagaacaagg cactcaatcc ttttttcgtc aatccttgcg gttccgaagg    200580
     tattgaccat gacagaaacc ggactggcca cgccgatcgc gtaagcaagc tgaacctcgc    200640
     agacctccgc aagtccgctg gcaacgatat tcttcgcgac ataccgggcg gcgtaggctg    200700
     ccgagcggtc aaccttggat gggtccttgc ccgaaaaggc gccgccgccg tgacgccccg    200760
     ttccaccgta ggaatcgacg atgatcttgc gtccagtgag gccgcagtcg ccggccggcc    200820
     caccgaccac gaaccgccct gttgggttga ccaggaatct gatctccgaa gtatccagat    200880
     gggtcggcag gaccggtttt atgatctcct caatgacgcc ttcgcggact gtatcttggg    200940
     agaccgcccc gtcatgctgc gttgacagga ctatggtgtc cagtgccacc gggcggagac    201000
     cctcgtagcg tacggacacc tgagatttca cgtccggacg cagccagcca agctgtcctg    201060
     ttttccggac ctccgcctgt cttttcgtca aatggtgagc gagttggatc ggcaagggca    201120
     tcaatgtatc cgtctcgttg catgcgaatc caaacatgag gccctgatcc cccgccccct    201180
     gctcgagatc ctgccctcgt ccttcatcaa cgccctggct tatgtcgggc gactgctcgg    201240
     tgagagccag aatgacggcg caacgtcgac catcaaagcc gatggcatcg tcgtcgtagc    201300
     caatatcgag gatcgtatcg cgggcaactt gagtgtaatc gatctccgcg tggctggtga    201360
     tctctccagc cagaacgacc atccctgtct tcaccaacgt ttcacaggcg acgcgcgcct    201420
     tcgggtcggt gcggaggatg gcatcgagga tggcatccga gatgttatct gccatcttat    201480
     cggggtgtcc cgcgccgacg gattcggaag agaacacgaa ctgcctggtc atggaatgtc    201540
     ctcgcttcaa gtgttggagt tgggtgggag tttctggact ggggcggtct taccggtcgc    201600
     tgatgccggg gacgtcgaac gcagcgcaga agtcggcaac gtcccttcgc acgttcgcat    201660
     gaacttcctc gtcgtcgggc tggcggcaga ccagatcaat aaaagcggcg atctgcacca    201720
     tttccccttc acgcatgccc atggacgtca ctgccggcga ccccaagcgg atcccgcttg    201780
     tgaccgccgg gtcgcgcggg tcgcccggca ccatattaaa gttcgtaata atgcctgccc    201840
     ttgccaggcg ctcggcatag gctttccctg acagcggccg gccccgcaga tcaaggatca    201900
     gcatgtgatt gtcagtgccg ccggtgacca ggtcataacc acggtccaga agcgcctcgg    201960
     ccagagcctt ggcgttgttg acgatctgct gaccgtagac acgaaaggac gggtttgctg    202020
     cttcctgcaa agcgacggca agcgcggcga cagtattcat atgcggtccg ccttgcagga    202080
     gagggaacac ggcgcggtct atacgtttgg ccagattgtg tttggtcttc ggatgataga    202140
     ggggctgata acggtcttca tcccttgaca aaatgaaccc accacggggg ccgcggatcg    202200
     acttatgaga agtgctggtg actacatcgc aatggcgcac gggggtcgga tgcactcctg    202260
     cgacaactag gccgctgatg tgcgcaatgt cggccacgag ataggagttc gcctccgcag    202320
     cgatttctgc cattgccgcg tagtcaaaga cgcgcgggta ggcagttccg ccgacccaaa    202380
     tgagtttcgg ccgttcccgc ctggcggtct cgcgcaagcg gtcatagtca atttgctgcg    202440
     tcttttcgtg cagcccatag gggacgcgtt gataatcagt gccggaaaag ttgacggacc    202500
     acccatgagt cagatggccg ccttcgggca aaggcagccc catgactttg tcacgggggc    202560
     tcaaaagcgc gcgatagacc gcctggttgg ctggtgagcc cgaataaggc tggacgttgg    202620
     cgtgctcact gccaaatagc gctttcaggc gctcgatcgc gagggtctca agctcatcga    202680
     cgatctcgtt tcccgcgtag tagcgcgcac ccgggtagcc ctcggcgtat ttgttcgcga    202740
     agatagagcc ggtcgcttcc agtacggctg aggaggcaaa gttctcagat gcgatgagtt    202800
     tgagcatcgt ccgctcttgc cgcctctgtc gtagaagcag ttcgtgaacg cggcaatcga    202860
     catggaccaa ggaagaccgt ccgaatgtgc cgggctctgc gatggctacg tcagcggagt    202920
     tattcatggt agtttctcac tcccacctag gcggatcttt tcacgattaa gcagcagtcc    202980
     ccttcgacca cgcgtctgta ccgcctcgag ccgctccagg tcccgcttat gatacccatc    203040
     gtcgtggggc aggagatcga ccaggaattg aaccaaccct ccgtccttgc cccctgcatt    203100
     gagatgatat gaggaccaag gacgttgtcc gttgccgcaa agaaagtcgg ctctggccag    203160
     catccggacg tgtcgcgcga cgcgctcccg acgaagatcg agaatctccg ccagttcgcg    203220
     gacagtcagg tcggcatgcg cgcaaaggcc caggatccgt aggcgatcaa gatgtgctgc    203280
     tgtcatcagg cgatcgacaa gtatcatcat tggtcagcac ggcgccaaat agaagaaccg    203340
     aacccctcgt cctgctcgct ttttcatgtc gggctcttcg caaatgctgt tcggcagcgg    203400
     aacataacca catcagattt ctgccaccac tgaacttgaa agttgtggtg agcgtaccat    203460
     tgacagcgat ttgtggtcgc aaagattcca taaatttcct tgaaggatct gttgcaaggc    203520
     ctaaacaaga acgcaacgag actggcgagg tggctggtaa gacggcaagc tggcaaactg    203580
     cttggccaac agggaggcga gcggcgccac ctctacctag gcgacagtgc taacctgtat    203640
     cgtgcacctg atccgtcatc tgttcgtgtc gcggaaggtc gcgaagccgt tgtgccgacg    203700
     ctcagcgccc tctgccgggg gcggacgcta agccggcatg aaggctctgc aggacttcga    203760
     ggccggcgac acccggcgat cactcagagc tggcggcgcg actggcagca cgtcgtgccg    203820
     ttcttcgcct atccgagtgt gcgcagcatc atctacatgg tggatgcggt cgaaatgtcc    203880
     gcggcgcgtt ggcgccattt ccaaatagcg cttatcctgg tcagttaggt cgcacccctt    203940
     cgatgtggct gacacggagg gcttgtgcca gttcataaag cctgacgatg gtggttcctt    204000
     ttgcccttct ccagcccgct gatgtactgc tggctgaagc cggagatctg ggcaagctgc    204060
     tcctgcgtca agccggcctt ctccctgatc ctgcgtgcat ttcgtcagac cagcttgcgc    204120
     tctccatgcg aaggtcagca agtcaaagcc attgagttta tgccatcgat gtgcccgaac    204180
     catctgccgc cggggcagca aatccagggc tacgattttg gtgacttgtc gcttgccaag    204240
     cagcacaagc tatcggtcac gcaagcgacg cacacgtgcg agaacctcgc aagggtcgat    204300
     ttcgagcgct tccgctacat cgaggaactc aatgacgtcc atgcgacgtt caccgccctc    204360
     atacttggcc acgaaagact gcgggcggcg aagcgcttcg gcaaccttgg cctgggttaa    204420
     gcccttgttc ttgcgcgccg ctatcagctg ttccagcagc cggcgttggc ggggcgatcg    204480
     aagggatttc ggcatcagat gaaccggcca gaagggaacc ggctcatcaa ctaatcccag    204540
     tttcggatta tcccatttta ggatatattt gcaatccaca aggcaaaccg cgccatggag    204600
     caaactgtat ggtcgagacc atgtcgaaga aaagcgggct cagttcatgg gcggcggttg    204660
     cgcgtcatcc agatggattt cggcaatccg ggatggactg atcgcctttg ttactgcggc    204720
     ggcctaatca actcacaagg atcaacgtca aacgcttttg cgagccggcc aagcacactg    204780
     acacttgcgg aaacccgagc acgctcgatc gagcccacat agcgcatgct cagttctgcg    204840
     cgggcagcca attcttcctg cgtcaggtcc tgatcatggc gcaaacgacg catgttgatc    204900
     gccatgactt ccgtgaggtc catggcgaga tagggaccag aaccggaact atcgttctag    204960
     gaacgatcgt tcctattcgc tatggtgagc caaccgagga gaagccgtgc ccgatcacaa    205020
     caaaccccaa accggcaaga gggtcgcgat gaaacgcaaa gtccaagacg aagtcccatg    205080
     gtcggacagc ctgaccgctt acgacaatga gcacttcacc atctatatga ggctcctgga    205140
     cgcgtccgcc gacgacgcca gcgaagacga gatggcgcag ctcgtccttg gcatcgatcc    205200
     gatgcgagaa cctgagcgcg cccgaatggc ggttcgcagc catctcgatc gggcaaactg    205260
     gatggttacg actggataca aagaactgtt cgcgcgctga ccggctccag gtgagctatt    205320
     ccaatcatct tagacgagga aatcccgata gccacgatcc atgagcatgt gaccgcgccg    205380
     gacggcacgg cggattcgat cgcgaaggtg gttgcgcgga tccgtccagt cggcctggac    205440
     gcgttgtcga gccaacaggg ccattgcgat ttggcgatgc gatgccccgc ctagcgagcc    205500
     gtcgagcgcc tgaagaacaa agcgcagacg gctagcgcgc gcttcggggg gaaacagcct    205560
     gtcgggaaat tgtccagtcg cgtgaaaagc attgaggcat tcgagcgcat tcaggtgctg    205620
     cctcattcga tcggcgggcc agatcgcgtc gacggaaagc cgaacggggc gcaaaacctc    205680
     cgcgccctcc acgacaagtt ggaggtcccg gtgagcattt cgcagcatga cgtgctgtcg    205740
     accgtccgcc gtgatcatga gtgccgcccg acatggcaat ctagcgagat caaacgaaag    205800
     cgtttcgggc gacagtgcct ttttcgcaat gaccggcagg acatgcgggc attggcggga    205860
     gcaccagaac acagccgcat caggcctcaa cgagcttgcg aaacaggagc ccccactgcg    205920
     tgagatcgag cgacgatctc accagttcta cctcgaacca cctttctgca aattctgcgt    205980
     gctcaagcgc gtgcctgcag tcacgctgga aggccggatt gcgccgcagg aattcccagg    206040
     cccagccgcg tcgcgtcagg tgccgcgtat agcgataaga tttctcatcc tgccagtccg    206100
     gccagtcggc gtcattacct atcatagcca tgtcaggcgc ccgtgcagag cactggcgcc    206160
     cacaggacgg gaccgccaag actgccactg tggcggaccg cagcaaggct cgcctctgag    206220
     acatccaaac agccggcaac tgcgcacgtg gtgccgattg tctggggcgg accgatccgg    206280
     gccagcggcc atccggcgcg acgcaggatt cgctccatgc gcaaatccgt aaccgtgacg    206340
     atatgggtaa gctgccgcga caaaccgaac tcgatcatgc cagcgaggag ttgataggtc    206400
     gcaacagcaa tactcccact gcccttcggt gaagacggtg gaagatcaag ggcgaaacgg    206460
     ctgctttccc agacgctcgg ttcctcgggt gccgttctct cctccaacag cctcgaaaag    206520
     acatctcgca acatcgtcgg ccccgtcgag ggcagaaggc gtacgccgct cccgacgcga    206580
     ccggcggaat cgcacaacac aagatagtgc ggtttcaggg aatcgaatga atcgatctcg    206640
     aagccgccgg tcgtgctcac gttccaatcg aggcgctcct taaagacgcg gtagcgcagg    206700
     cggtgcattt cgtgaagttc gtaggcaaag gcgccgtgcc agccgggcgc aataagctca    206760
     atcatgatgg tctcctcgca ggtatgaccc tgccattgga ggcgaacctt catgccgcga    206820
     ctgcctgtgc atttgcacag gtcgatcaaa gagggattct gtccctcaga gaattgatga    206880
     tcgtgaggag gccagcagtg tcactgcctg atttttggtg cgcacgccga gcttcttctt    206940
     ggcattgtcc aaatggaaag cggccgtgcg ctccttgatt cccaagatac agccgatctc    207000
     ccaggcggac ttgcccttcg ccgtccactc caggcattcg tactcacggg gcgtcaacga    207060
     aacaccatcc accgccagac cacacgaaag cttgcggcga acgccaatgt gaaagcacat    207120
     cgccataatc tcgagcgcct gctcatactt ctcggcgacg cgcaggaagg tcggatcgag    207180
     cctgtctgcc gcgaaggtca tcgcagcgac accgccgcgg cgatcaacaa gtggtatcgt    207240
     cagtccgcag cagatgccga attcggcagc ctcatcgaaa agctgttgct gtcgcgttga    207300
     aatgccagca tggccgaaat caggtcccca ctgaaaggga tattcgctgc accttgccca    207360
     ttctatgact gggtcgatcc tttcatattg gtggcgcaag tagtgcgacg tccagccaga    207420
     atgatagttc gatatcagcc tgggttttgt gacgcgatca gacaccagag acagataggc    207480
     aaatgcggga atgtcgaagg cgccggcggc gctggccagt gcgttatgga agtcgacttc    207540
     atcaacactc aaagacaact gttccagcaa agtttcgaag acgagctgca ttttctcctg    207600
     cggctgtttt caattaaacc tgggactttc cggcttcttg gcagctacgg cgagaggact    207660
     cgccccccga gatgttcgac gctggagaaa attcaccgcg gtgactactc cccggacctt    207720
     cgatcatatg aaaggaggtg catgcgacct cgacgccggc tgccgtaagc cgcgggtccg    207780
     aagctgcgat tgtgggcggt cgccatggtg tataagaatt atcgaagctc gatgtgccat    207840
     ccggatatgc agatgacctc cttctcgaac tgtcgattgc ggaggcgcta caatcacgca    207900
     gatccagcgg gccacccaga tccagcgggt caaaaaaggc gccctgccgg cggggaggta    207960
     catcggcagg gcgcgccgca caaacaccct ggtcgttggg caacaggaca gcggcggcag    208020
     aactgatttg gttatcgctt gcgatcaaag gtatccgaag catgcttaga atccgacggc    208080
     ttcaagttca gcagtttcgg tcggctcggc gcgaaatgcg ctgtcaaccc gccttcacca    208140
     atgggacacc gtgggcgaca ggctgacgtc aaagcgtttg gtccgtggga aagttcctcc    208200
     cagggaccac tttacccggg acggcgtcga acccggggct cgcttccgtc ggcactcgca    208260
     tgttcatatc gcaccctcgg ccttcagcgc gcgataggtc gtctcgactg atttcgcggt    208320
     tgcgttgacg attatgtcga tctccttccg ggtgatgatc aaaggcgggg caaagccgag    208380
     gatatcgccg tgtggcatgg cacggccgat gacaccattc tcgaacagag cagcggcggc    208440
     tcgaaccccg acctgaagat cggattcaaa cggtattctc tgctttggat ctcgcatcag    208500
     ctctacggcg gagaggattc cgacaccacg aacctcgcca acaatggggt gtcccgccag    208560
     ttcggcattc atgcgggcat gccaatacgg gccgacatcg cggacatgct ccaggatatt    208620
     tctttccttt aggagtcgaa tattggcgag cgcggccgca gcgcaaagcg tgtgacccga    208680
     atatgtccag ccatggccga gggcgccgtg cttctctgtt ccttgttcca agatcgacca    208740
     gacgcggtcg ccaatgattg acccggagat gggcaggtag gcggaactca aacccttggc    208800
     gatggtcacg aagtccggcc gcatgccata gaggtgggaa ccgaatttct caccggttcg    208860
     tccaaacccg caaaccacct cgtcggcgat cagcaggata tcgtacttgt cgagcacgct    208920
     ttgaatagcg gtccagtatc cttttggggg tggaacgata ccgcctgtcc caagcaccgg    208980
     ctctccaata aaagctgcaa cggtctccgg gccttcagcc acgataaggg cttcaagttc    209040
     atccgcgcag cgtttcgaga atgcttgctc actttcgccg tcatgcgcct ggcgatagtg    209100
     gtgcggcgtc gtggtatggc gcaccaagtc cagcggcagg tcgaagaaat tatggaagaa    209160
     ggcaaggcct gtcaggctcc cggtgaccag cccggacccg tgatagccgc gatgacgcga    209220
     gatgatcttc ttcttttcag ggcggcccag aatgttgttg tagtaccaga ccagcttgat    209280
     gttggtttcg ttggcgtcgg agccggaaag gccgaaaaag acccttcgca tgttctgacc    209340
     aaaatactcg accacggcct ctgccaagag ggcgactggc tctgttcctt gacttgcata    209400
     gatatgggcg aacggcattt cgtgtgcttg cctggcaatg gcctcggcaa tttccgtgca    209460
     gccatatccc atgttgacgc agtagagccc accgaaaccg tcgaggctct ttcggccttc    209520
     ggtatcccaa atgtacacgc cttccgcacc ggccatgatc cgatttgggg tctcgcctcg    209580
     gctgtgcttg gccagatgcg tggacggatg aaagacgaag cttcgatcct tctctctgag    209640
     ttgctcggtt cccagattac tcaaccgcat agtcctctcc tcgcgatgga ttggcggagg    209700
     gcactcggcc ggccgcgtta gcaattacca taccgcaaac gcctctccag tttcgcggga    209760
     atgcacgtcc ttcgccgacg aattcgcgga atggggatca aaagccgtgg aaacgaaggc    209820
     gtcggcgttt accgtcgcct tagtgcggac aaggggattg gtgaattgga cttgattggt    209880
     ttggtcacga caagactgta atattgatcg atccccaagc ctgcctgcag cagtctctcc    209940
     atgaaatcct gatacgcagc catagaagga gatgcgacgc gcatcagata atcgatccgc    210000
     ccgccgatag cccagcaatc caagatttcc ggaaattctc cgatcgcagt ctcaaagtgt    210060
     ctttggtcct cgaggcgatg acgttccaga acgacctcca ccatcacaaa caccatgccg    210120
     ccgatgaggg ccggactcag ccgcgcgtag aacccctcga caatccctgc tgtctcgagt    210180
     gcacggagcc gctccgagca ggccgacgcc gaaagatgaa cgcgttttgc aagctcgctt    210240
     tttgagatcc ggccgtctga ctgaatctct gagagaatcc ggaagtccca agcgtccagg    210300
     cgcgcaggat tgggcttcga cttcatgacc ttgtgctctt aagccgtgtt gacaatggaa    210360
     ttgacgccga tcaaccgagc ttggtcggaa ggctcaaacg ccgatgttgc gtgcgatgct    210420
     gtccgccgcc atgcgcttgc gccactcaag aggcccagaa ttgtgaattg agtttccctc    210480
     aacatcgaca gccatgatga caggcatatc ctgcacctcg aattcataga ctgcttccat    210540
     gcccaggtct tcgaaggcaa tgagccgcgc tgacttgatt gattttgata tcaggtaggc    210600
     agccccaccc actgcgatga gatacggcgt tttgtgcctt acaatcgact cgatggccgc    210660
     ccgtcctctc tccgctttgc ctaccatcgc gaaaagcccg gtttcggcga gcaccttgtc    210720
     cgtaaaatcg tccaagcggc tggacgttgt tgggccggcc ggtccgacga cctcatctct    210780
     cacggcgcgg acgggtccaa cgtagtagat tacgcgcccc tgcagatcga acggaagcgg    210840
     cttgccggcg tcgatcaact cgaccattcg cttgtgggcg gcgtcacggc ccgtcagcat    210900
     ttttccggac aaaaggagcg tttccccgca acgccacgac gccgtctgtt ccttggtcag    210960
     cgcatcgagg ttcactcttc gtacgccggc tggactcaat tcgtccgttc caatgtcggg    211020
     ccattcgcgc aaatcgggcg gctccagcat gattggtcca gagccatcca aggtaaactt    211080
     caggtgccgg ttggcggcgc attgcggaat gagcgccacg ggcttggacg cggcatgagt    211140
     aggataggtc gcaaccttga cgtcgacgac tgtcgtcagg ccaccaaggc cttgggcgcc    211200
     gatgcccagt gcgttaatcc ggtcataaag ttcaatccgc agtgcctctt ccgcgcttga    211260
     aggccgcctg gcaatcaatt ccgccatatc gatgggctgg ttcatggcct ccttggccag    211320
     cagcatcgcc ttttcagcgc tgccaccgat gccaatcgag atcaggccgg gtggacacca    211380
     cccactgcca agcgtcgcga ctgtgtcaac cacccagtcg gaaacggagg cgctggggtt    211440
     caaggtggta aaacgtgcct tgttctctga cccgccgcct tttgcggcaa tggtgatgtc    211500
     aatctggtta cctagtacaa ggtcgacgtg gacgaccgcc ggcgtgttgt cacgagtatt    211560
     gactcgtccg gcgagcggat cggcaacgat cgatgcccga agggggttgt ccgggtcgag    211620
     ataggcctga cggacgcctt cattcacgag ctctgcgaaa ctggccgttg atttgatccg    211680
     ggcgtccatg ccgacttttg cgaagaccac cacaaggccg gtgtcctggc agatcggccg    211740
     ccgcccgaag gccgccatgc gggagttcag cagaatctgc cctattgcgt tttttgccgc    211800
     tgggctctgt tcgcgcgcgt acgcttgcga aagagagcgg atgtaatctg gaggatggta    211860
     gtacgagatg tactgaaggg cgtcggccac gctccttatg atgtccttgc cggcgatggt    211920
     ccgtgttcta ctgcccaccg gatctcatcc aaatgaaccg aggccgttca ccattttcag    211980
     gatctggaag ctccgtaccc cctgctcgcc tccttcatat ccatagccgc tctgtttgac    212040
     gcctccataa ggtgcatcag ctgaaacccc tttcaggtaa ttcacactga cagcgcccgc    212100
     cgaaagacta ttggtcagct ttcgttgcgt atcggcagcg tccgtgaaga agtaagcggc    212160
     caagccatac tcagtgtcgt tggcttcccc gatggcctcg tcgagcgtat cgaacggagc    212220
     cacggtgagg atcggtccga acggctcttc atgaagcact ctggcatcct tcggcacgcc    212280
     cgtcaggatg gttggcggcc agtaaaagcc cgctccgtcg aggcgggttc cacctgtctc    212340
     gatgtgggcg ccgcgatcga ccgcatcctt ggtcagacgc tgcatggcct cgattcgccg    212400
     cgcgtttgcc atcggtccca tctccgtcgc agggtcgtcc ggtaggccta tcctgatctt    212460
     gcgggcggct tccgtcatcc gggataggaa ttcctcgtag agtgtccgag cgacaagaat    212520
     cctgctgggc gcattgcagc tctggcccgc gcactcgaac ttgtattccg aaatagccgg    212580
     tatcgccttt gccaggtcgg catcctcgca cactataacc ggagagtgcc caccgagttc    212640
     aagaatgcag cgctgcaaat tattcgccgc gagcatggcc agctgttttc caacagcggt    212700
     tgaaccggtg aaagtcaaga ccttcacgat tggtgaactg agcaaatgcc gcgatatatg    212760
     caccggcaca ccgaaaacca gattgaccac gccgtccgga acacctgctt ggcgcaatga    212820
     ttcaacgata tggacagcta cgctcggtgt ctcttcagcc cctttgagga tcactgggca    212880
     gcctgccgcc aacgccgggg cgagcttgcg ggtgatgagc acggccggat aattccatgg    212940
     cgtgaacgca gcaacgacac cgagcggctc cggaacgatc atccggttcg gacccaacgg    213000
     aatagtcgcg gacagctctt ccgcgtgcgt accgttccac tccagcgttt cgaccgcgcg    213060
     cgcgtactcg cctgttgctt cggcaatcgt ctttccctgt tcggccgaca ggtccctagc    213120
     tgctggttca atctgcgttg ccaagactct tgcggctgct accaggatct cgccacgttc    213180
     ttttgcaggc cgtgaacacc aagccttgcg gctgcgttct gccgaagcga gggcctcgtc    213240
     cagatccgac accgtcgccg aggctaccga ggcaactacc ttctccgttg ccggattaat    213300
     caccggcaat gtgactctgc taccacccgc ccgccatttg ccgttgatga agagctcgta    213360
     gctcctggcc tcggacatcg cgtgctccac ttgtgtgaat tttttgccgt acgatcgccg    213420
     ttcgatagcg aaccgctaaa ctcgcctgag ccagtttcat cgcgagtgtc gcggcaggtc    213480
     aaatatcgaa tattgccgaa atccatctgg aatccagatc gatctgatcc tgatggccgc    213540
     aagaagacat agcgtttcca aataggtcga agagttcagg tggcgtcagg agccgcggct    213600
     gcccaggcct cactctcaat taattctctg gcgaccttgg ggatgagctt gcggaccgcg    213660
     gagacggccg cagaacgctc atctttcgga tttacggcaa gtacgacgga acgggtaatc    213720
     accggatcga cgattttgac cgtccgaact agcccttgag tggcttcttt ttgaacggct    213780
     gagggggcga gaatagaatg ggcttttcct tctataacca tgttgatgat cgttgagagc    213840
     gagtccactt caaacttgac gtccagcgcg caaccgtgtt gtgcgacgac gtcagccacc    213900
     gaacgtctga cattgttatt gcgcatggga accgccagcg ggaacgcgtg tagatccgcc    213960
     agagatatcg aagcttcgaa aggcggttca cctgatggca ccacgagaca gagctcttcg    214020
     cgcgccagga ccgtcattcg tgccacacta tccgctgtgc ggtagagaac tgccagattg    214080
     aagcggccag cagccatcca ctcctccagc ggtcccgtca taccctcgat catctttagt    214140
     gagaccctcg gcagttcggc tctcactgat tcaagcaagg ggccgctcag cacgcgagcg    214200
     gctcccgacg gaatgccaat ggtcacctcc ccggcagggg aagcggctgt attggtcaat    214260
     tccgcctcgg tgagtcgaat ttccctgaga atcgcccgcg ctcgctcgag cagtttggct    214320
     cctgacgccg tcacgcttac gccggacctg tcgcgtatca gcagctgagt gccgaagcct    214380
     tcctccaact gacgcacatg caagctcaga gcgctctgag caatattgag gaacgcagca    214440
     gccttcgtga agctgcccgc ttcgactacg ccgacgaagt attttaactg cctaatttcc    214500
     atcatttgaa gtgcccaact gaggcacttc cccagcttcc tcgtatctat ctcgaaaagt    214560
     gatggcgaga aagcaataat tgtgccgcac tgcagcaatc gcccaggcaa tccacggccg    214620
     aggcaagtgg agcaccttcg tgtcgtgtcg tccgagtctg ggctaatcag ccgttcaaac    214680
     gcccaactcg gcctttggac ccatggcgat gatttcacgg gccctcctga caaccggggc    214740
     atcgaccatc ttgccgtcca aggcgaaagc acccctaccc tctgccgcgg catccctttc    214800
     ggtcgcgagc acgcgccggg cccactcgaa ctcctctgcg cttggcgaga aggcttcatt    214860
     caggatggca acttgtgtcg gatgaatcgc caacgctccg acgaaaccga gccgccttgc    214920
     ctgtatgacg acatcgcgga acttctgcgt gtccgaaaac tgcccgatac ttccaacgaa    214980
     tccaagaggc agcagacctc tcgcacgggc ggcgaacaag accgaaaggt tcggtcctag    215040
     aaggagctct ggacttggtg tcccgccagc ggccgcgctg aaatcttccg gaccaagcgc    215100
     catcgcggcc atccgtggat gggccgaagc tattgccgcg agtctcgtca atgcccccgg    215160
     agtctcgatc tgggcaacga accgaatgct tcccgcgtca agattccttt cgtgctcaag    215220
     ttccgtcacg gcatcagcga cttccatcac ccactcggcc gattccacct tgggaaggac    215280
     aagcgcattg acgcctgcga cgaccgctgc ttcaaggtcg gcagccagcg cgcgcaggcc    215340
     acggttcacg cggaccaaaa ccgacgcacc gttgcgaccc acttttgcca ccgatccacg    215400
     aagttgacgc cttgcctggt ccttccggtc ttgcgggacc gagtcctcga ggtcgagtat    215460
     gacgccatct gcaccccgct catgggccgt cttaacgaag cgcggaacgt gagcgggaac    215520
     gaagagcagg gatctccagc ggggtacaga catagggctt tcaatggccg gaaaggtgtc    215580
     cttgatcatg gagtcgcctc tgcggtcgat tttagcgagc tcgcagggcc gccgattcgc    215640
     tggatgatcc gtggtacaca cgctctccta tagatcgcga gcgcaccggc cttaccgaca    215700
     agacgcacgc tcacgccgat gtggctcttt cgcgcaaacg tcccagaacc tcctcgcgga    215760
     cagcctcggt atgagcgcca agagccggga cagggcgcag caaagggtgc tcagcgttga    215820
     agatcgctgc gggggcgatc gtctcgatgg tcccttcggg tgttccgacc tgcaccttgc    215880
     gaatgtgtgg gtgctttgaa acatccgcga cttcgttcag tcggccatat gccaacccgg    215940
     ctgcctcaag ctcctgcatt gcttcgtggc atagcagttt ggaaaagcgc cgttcgatga    216000
     tctcatcaag ttgcgcacgg tgaccgaggc gctccatatt atcggcgaaa ccaggtgcgc    216060
     gtataagctt cggcagcttc aggaactttt cgcaaaaatt cacccattca cggtcattct    216120
     gaaccgaaaa gatgacctct ttgccgtcgg cacaccgata ggcaccatat ggcgcgagcg    216180
     acgggtgttt cacgcccgcg cgcaccgtgt gatagccgct gtagtcgttt tgaagaaccg    216240
     gcacgttcat ccagtcggcg acggcatcga acagtgacac ctggatgctt gtcccttcgc    216300
     cagtgacctc gcggtgatat agcgcctgaa gaatggcgct atgcgcgttc atgcctgccg    216360
     agatgtcgca aaccgacaca cccacacggg cgggcccctg ttgcgtcccg gtgatcgcac    216420
     acagaccagt ttcggcctgg acgatgagat cataggcctt caaatgggag tacggccctg    216480
     tgtcgccgaa accggagata tcgcaggtga tcagacgcgg aaatcgccga cggagatccc    216540
     tagaccggaa ccccagtttt tcgatactgc ccggcttcag gttttggatt aagacgtcgg    216600
     caccggcaat gagcgtgtcc aggacggcgc ggtccccctc agttctcaag tccagacaga    216660
     ccgactcctt accccggttg agccagacga agtaagcgct ttgtccccgc accaacttgt    216720
     cgtagttgcg ggcaaagtcc ccttcgggcc tttcgacctt gatgacacgt gcgccggcgt    216780
     cagcaagacg agacgatgca taaggcgcgg ccacggcctg ctccacggcg acgacagtga    216840
     tcccctcaag agagttctgc atgctacacc gtgctttcat ccaacgtttt cgttttgagc    216900
     ccgacgacgg ttcagcatcg caagcagccg attttgttca ttcccaacga ttgaaaatgc    216960
     ttcgtcgaca cccataccgg gctttgcgag catcatgtcg gcctgggtcg cgaccgatac    217020
     gtggacagaa gcttgggcgg agagatccgt ctcggtacag ctccccccga catacgctcc    217080
     aacttggttc tccttacaaa taagaacggc acgtgccgtg tcggcaattg agccaacatc    217140
     gggggtcttg atttggacga gatgggcggc ctttgcttcg gcaaagagcc ggatatcctc    217200
     gagcatgttg catcgctcgt ccacaacaat acgggcattg gaaccccggt tgtccaatat    217260
     cgatacgatc ttggcatagt tctcaatttg tgcctgcgtc gaaccgaaat ccgctgggga    217320
     ctcgatgttt agcgtgaaat ccgggacggt atttgcaacc tggcagataa agtccgcgat    217380
     gttttgcggc tcaaggccga tttcctggcc gatccagcca tacacatcga aatgcagcac    217440
     cggatgatac cccgggcagc cgatttcgcg cgtacgcctt gcaacccact tcacgaactc    217500
     catgaaggtc tggccgttga ttccgaattt ctgccgtgag ttgatcaggc cgtggggaag    217560
     cacatccacg gccttcagaa tcatcttgtc gacattgatt tcgcgagcat cgccgctctg    217620
     gcagtagatc gggaccctgc gcgtcggcag cggcaagtca aattcagcgc atacaacctc    217680
     tgccatggtg gcgcgctgga ggtaggccgc ggctcgaagc agggcctggc tgacgccata    217740
     ctcaatcgcg agaggtagcc gcttatgttc gtgaggctcg agaaccttcg cgcaggccac    217800
     aaggtaacga gatacatcaa catccagaag ccgaggcgcc acgacccggg aggtcaaatc    217860
     cgagatttga gaagtttcaa acaatggatc gcgtccgcca gcaccagagt actgaacgcc    217920
     catcatgtcg ccccaaacaa cggtgtcgtc ggagaggaca agcccgacgc tgagcgacga    217980
     tgctggaacg cgaatggatg taaacccggg cgttaccggt tcgccaacat agatgaaagc    218040
     atcctgcgag gccccggccc tgatagcagc ctggtcgtca tagaaaaatg cgccattgcc    218100
     aagcgtgagg aggacgtctt tgatttgcaa ttcagtcact cgattcattc tgaggggatt    218160
     aaatttcgtt ctgctagtgg cactcgaggc gcagggggcg cgcaacggcc gctacccatt    218220
     cgttgacgcc gacatgcccc cccgatcgta tggcgaagac gatggctgtt ccaggcgcgc    218280
     ggatgtcaat ggattcaacg gacagagaat ccatcggatg caggatgcct atgagatctc    218340
     cctgcttcac ttcatccaac accgacgcgc gaggttcgaa gatgcccggt gcgggcgatt    218400
     tcaactcgtc ggacggatgc gtttcgagtg tttggccgga cttctgttga cggaacgttg    218460
     gatactcggc cttaccctcg accagcccga gcgcgatgag cgcgttgcgc actccagcct    218520
     cgtaaatcgc gagattgtcc gcgccgaccg tgccgccgcc aaattcagcg caaacaaata    218580
     ccttcccttg gttttgggcc acgatatcga acattccaac cgtgtcgttg tattcccaga    218640
     ccaatgtcaa gggcaatttg aacgcttccg ccattctcac cgtcctggcc atgagatcga    218700
     gatcggcaat cgggtgcgtc gtggcggccg gtggaaaatc ccacgttggt ccgaagctgt    218760
     gcagatcaaa taccgtgtcg gccattggca acaaaatgcg cgaaaccgca tccgcgattc    218820
     gttcggtcac tgacccgccg gcgcggcccg gaaacacgcg attgagattc aacccgtcga    218880
     gcggagtatt gcggctccat gcctgcacgg ctaatggatt gagcatcggt aggacgatga    218940
     cccttccaca ggtttgcgct tctggcagcc actcgataag ccgtcgcgcg acaagcggcc    219000
     cctccagttc attgccatga tttccgccgg tgacaagaag gcgcggcccc tctcctctat    219060
     tgagactgaa gacagggagc gaaagctccc cgcggtcggc acctcccggg acaacaagat    219120
     gccccctgct cacgccgggc atatcgctat caaaggtaag atgcggtgct tcgctcattg    219180
     ttcaacctat tgctagtatt caggcgacct ggcgccgggt ttacgatcgc tgatgcgcgt    219240
     tttgctgctc tggaagtatg cgccacgcgg tgttcaatta gccaatataa tgtcccagat    219300
     ggtgccatcg cgtttttaga tggccgccgc ctggcttggt ggctgcacga tgttcagacg    219360
     ggaaccgtga tgaatagctg gctcccccgc ctacacccaa tggccgccag cctgcttgcc    219420
     cgccacacgg gccagcccct cagggatctt gtcaagcttg ggcagatact ggagcgtttc    219480
     atcaccgatc gagggctaag aagcatatcg cctgctaccg cggtttatcc tggcggacat    219540
     tatgagcggt gcccgttgct ccaagacgcc gagcttgtgc gagatgaaga tgaaggcgat    219600
     gccgatcccc tcttgcagat tgataggcag gttcagggtc tgggcctata cgaagacgtc    219660
     cagggccggg cgatgagctg cgaggcttga ggggccgctt cggcgcaatg tgccgagccg    219720
     ctggcgcggg tcaaccgaca gtgcggacgg actttgcggg cgacgagggc gctgatcatg    219780
     ccgcccagta gggccggcaa gcggagctta gggccatctc gccgctagat gacccagcta    219840
     tggatactgc atttgacgca agccagcagt tgatcaatct tggactggaa tgaaattgca    219900
     aaatggcggc agtttgcgcc tgcacatctt ccgcgcaggc gagtctatac gtaagacgag    219960
     aggcggcgct ccgaaatatg cgcaggatgg cgggagcaga cgagggcgca ggttcgccgg    220020
     cgacatttgc gccgcttaga aacccgacct ttcgttcgat ctggctcgcc acccaggtgt    220080
     cttctctcgg ctggttgatg cagactgtcg ccatcagctg gttgatggcg acgatctcga    220140
     cttccgatct gatggtggcg ctggtgcagg cttcatcgaa cttgcccgct ttcatcttgt    220200
     ccgtgttcgc tggcgctctc gccgacaatt acagccgtcg cggggtcatg ttcgccggcc    220260
     gctgccttat ggtgatagcc tctgtggcgc tggccgcttt tgtggcgctg ggctttgtca    220320
     gtccgtggat gatcctcggc ttcagctttt tgatcgcatg cggcggcgct ctccacgatc    220380
     ccgcctggca agcttcggtt ggcgatatcg tagaccgccg cgatgttccg gctgccgtga    220440
     ccctgctctc cgtcggcttc aacactgtgc ggaccgtggg cccggcgctc ggcggcatcg    220500
     tggttgcctc cttcgggctt ctggcggcct tcacagtgac caccctcacc tatttagtcc    220560
     cgctaggcac cgtatggcgc tgcaagtgga aggttcgctc ttcacctctc ccgcgtgagt    220620
     cgatgaaaac ggcgatttat gacgggctgc gcttcacggc gatgtcatct gagatcaagg    220680
     cggcgatcgc gcgcggaacc atctttggcc tggcgagcat cgccatactc gcactgctgc    220740
     cgctggctgt ccgcgatcat ttggggggag gaccgctcgc ctatggcacg ctgatggccg    220800
     gtttcgggac aggcgccgtc ttcgccggcc tcgccaacgg cacattcaga cggagcttat    220860
     cgcaggaacg gttgatgagg ctcgcgtgcg tcgcctgcgc ggcatgctcc ctttccctgg    220920
     cactgacctc ttccattgcg gtggcggcac ttgcactcgc cttgggcggc gcgggctggg    220980
     tcaccgcctg gtccggcgtt ggcgtgagcg tgcagctggc gagcccgcgc tgggtcgtgg    221040
     gacgcaccat ctcgatctac tatgcattga tagatggcgg catcgctgcc ggaagctggg    221100
     tatggggcac ggtttcccag aaccattccc tgacctgggc gctggagggc tccgctggtg    221160
     ctttgttgct cgtcgccgca gccggcgtgc tgtttcctct tcgcgagcgc cgggagtccg    221220
     agcccgatcc tttggaggaa ttcgacgccc cagctgtcgc tctcaatttg aagccgagaa    221280
     gcggcccgat cgtggtcaag gtcgaatatc tgatccatga agagaacgtc gaggctttcc    221340
     tggacctcat gcgcgagcgc cggcatgtgc agacccgcgt cggtgctcgg caatggaccc    221400
     tgcagcgcaa tcttcagaag cctgtgcagt ggatagaaac attccgcacg ccgacctgga    221460
     cagactatct tcgcctgaac catcgcctca cggaagcaga caaggaactg gacgaacggg    221520
     tcctccaaat acacaaagga gagcttccac ctcaaatgac ccttttgatc gagcggccaa    221580
     caagccttgc tcggaaaccc gagcagtcgg ccccttattt tccccaccgt tgactttacg    221640
     ggtgtactcc ccgtactagc gcttgcacca gatggcgacc gatcgcgcta tgctttgcag    221700
     aaagtggtga tggcgcgccc aaagagccga gcaaggcaac agcttccccg gacgctgcag    221760
     gattcgggcg tcttgagatc agcgacggcg acgaggattg ccgctcaggg ttccgatctg    221820
     cgagagcgtg ttcgatgtta tgggctgacg ggatggagag gagcgagtct tgtcagtctt    221880
     gttaccagaa cgagctggcc gcttcatgag ctttttgcaa gcagcgtgag aattctgagc    221940
     ggctgtcatg gccgttgcgg catctaatcc atctcgcttc tagatgatag cgaagaccga    222000
     ctgaatttga ctttgagccg cccgtggcct cggaggaggt gcggcgtctt ttaatttctc    222060
     gccgctgcac aatcgattgg ctgactcaat ggcaaggcgc ccccgatcct cagcgtttga    222120
     gcggtctcgc aaggagcgcc accccctcgt cggcgtcgac atatgctccg gatcttatac    222180
     cgcaaccgat agcgtggcgc gcgcgcgaat atcaatggaa ccagccgaca gcgtatccat    222240
     cggatgaagg atgcctatgg gatctccctg cttcatttta tccagcaccg agcagcgagg    222300
     ttcgaagatt ccatccgcgg gcggtttcag ctcgtcagac gagaagcgcc tcaagtgtct    222360
     ggctagactt ctattcattg ccatgacatc cgcctgtgat aggaaggcgc gggtccctcc    222420
     cctttattgc gactgaagac cggaagcgaa gcttccgcaa tccgcgcctt tggggacaac    222480
     aaggtgcccg tgctcagcct gcagcgtcga gatcgaaggt aaagtgtgga gtgtcgctcc    222540
     ccgccccccg aaggacgacg acagtgggca agttacatat ttttggttga gagccgcgga    222600
     cgcttgtcct tccaaggctg cagctgttcg aacgccgccg aggcctgcaa cacgcccaga    222660
     tcgtcgaaac gtttgccgac gatctgcagt cccaccggta ggcctgccgg agtaaagccg    222720
     cacgggacgc ttgcagccgg gttccatgac atgttgaacg ggtaggagaa ctccgcccac    222780
     atgatccagt cccaagcatg cgtcggccaa tgatcgggca tcagcttgtc ggcttggaaa    222840
     gcggcgactg aagcggacgg tgtcaatagc aagtcccaat cttggaacca gcgatggatg    222900
     ttcgcgacgt aggtcatctt ccgatagcgc atctcctggt agcgcgcgac ggagacgttc    222960
     tcagagtgct taatgcaagc gacgagccca ggatccatct ccgcttccca tttcgggagg    223020
     tattgtgcta ggccggtcag gtgcgcagac cagaagaacc ggatcagttc cggtccgtcc    223080
     ttcgcccacg gggtgggtac ttcctcgaca actgcaccaa gttcggtaaa gcgtgccgcg    223140
     gcggccttca ccagttccgc gacttccgga tcgacacggg caaaacccag atcggggctg    223200
     taggcgatcc gcctgccctt tatgccttcg tgcatgcggc ccagatagct ggcaggcccc    223260
     gcctccagcg tcgtatgatc gagagaatgc ggaccggcca tgacttcagt catcagcgcg    223320
     gcgtcggcca cagttcgtgt cataggcccg ttgtgggtcg tcatgtcact gccggggacc    223380
     ggatagttcg gaatacgccc gaaacttggt ttcaatccgt agatgccgca gaaatgcgcg    223440
     ggcatgcgga tcgatcctgc gccgtcgctg ccttggtgca gcggaccgta gcctgccgca    223500
     gccgcagcgc ctgcgccagc cgatgaagcg ccggcgttgt agccgagctt ccacggattg    223560
     ctcgtaatgc cggtgagtgg gctgcgcgag acgccggtcc agcccatctc aggcacggtg    223620
     gtcttgccga tgatgatcgc gccctctgcg cgcaggcgct ggacgagcgg cgcatcctcg    223680
     gtcggctgat gcccggcgta gatcttgctg ccgtgctgtg tcggcatgtc cttggtgatc    223740
     gagtgatctt tgatcgtgac aggcacgccg tgcaaccgtc cgatccgccc accgctcatc    223800
     agcgcgcctt ccgccttttt cgcctcatcc atagcgtgat ctgccgctaa gtaagcgaag    223860
     gcgtttatct tgggctccag ctcagtaatg cgagccagta gcgtgcgcat atactccaca    223920
     ggcgaaatct ttttgcttct gacaagttca gccagctcta cggctggtgt aaagcccatt    223980
     gtctcagagt tcattaatct catctctctg aatatttatt gttgaatcgg taccttcaac    224040
     aaacctcaaa tatatcgtgg tgaaggttgc tcggctttgc ttccttctta cagttcgaag    224100
     aaaatctcga tacccggcat ctgctatttc aaaactatgg accttatggg cattcgacat    224160
     ggccatttag gtgtgttcat taatcaagct taatcgccac gcggcttgcg tcaaacgcaa    224220
     tttgtatatt gttgtcatct agaagccaga tggggcgctg tcgacattgc gactgtcgaa    224280
     gccacataag cgagagcccg ccacacggac gaggttgaac agaacccgcc cgacatcgtc    224340
     aagcaggtgc ttcaggtgtg cgcccggtta acgcgagccg cgaggttgtc atccatcgaa    224400
     cgcgacggcg ggaccaccgc cgccgcctca taggcgacgg cgatccgctt gaccgtgtgc    224460
     ccggcccggc cggcttcgtc gcgccagcgc tgcagcagct tcaacagtgc tggcgcgtcg    224520
     gcatcgagct tcttgagcgg ctggcgcttg agaccccgaa caagcgcggc gacccgccac    224580
     ttcgccttgc tcatttcgat gacggcgatg atcgtgttat cctgtttgag agcggcaagg    224640
     gaccggctcg cgtcaaaaga ttgcgacatg gagacgctcc ttctgctgga tgttcttgga    224700
     gcgccgaagg atgccacacc ctcgccgctc gccccatatc gtcttcagcc tcttgctcaa    224760
     ctggctgagg cttttgtttg ccttcttcct ggcgttgctt gcaaccgctc cggcgtcacc    224820
     ggtccagcca cgatcaacct gaccctccgc aactcaaccg caatagcctc tgaaacgggg    224880
     ctcgcctcat gctcgacgct ctaaagcgcg tctcgtcgaa acgcactcat gcgacgcgct    224940
     tcaagccttt gtttccatgc atgtcgtttt ctcaaaaccg aagccacttt tgagcgacgt    225000
     gcattagatt gaagggcgcc ttggtcaagg gcgcccttcg catcggcggc aggcttcgat    225060
     cccggaggtg cggacctaag cactttggaa ggagccgccg aaagcctttt tgggtatccc    225120
     gctaagccaa ccccggctgg acgagcgagt ctagcgctcg caatcttatg cgacgagcgc    225180
     tatgatccaa tccttcgatc cgtcagaacg accgttggaa gcggaggatg ccgccgacgg    225240
     cgttgctctt gccggcgggg atgccggtcc agttgtaacc attgctgtcg tggtcgttat    225300
     gagcccagtc aacttcggcc gtgatcgtga gacccgggac gatcttgtag gcgacgttcg    225360
     ccgcaaggcc aaattctttg gcctcatcat atgacacctg gaggttgaac gcagtcttct    225420
     cgttgacggt gtaggtgccg ccgccccaga ttgcccagtt gccgccccac tgcttgtaga    225480
     agccgcggtc gccggcaggg atcgcatagg tagggtcgtt gagattgtcg tccgtaccgt    225540
     agcccgccat aatgaatagc gatagcgcct cggtcgctgt cacgtccaag cgaaccttgc    225600
     cggccacctc ttcgtagttg ctgtcataag caacgacgcc agtgatggcg ccccagccct    225660
     gcgtatactt cacgccgcca acgacatgcg gaacgtagct gtcgatcgta ccgaccacgc    225720
     cagagccttc ttcgagggag accacggccg agaagccgtt gccggcgtcg aaatagtact    225780
     ggacgacgtt ggtgtcgaaa tccccataag gaaccagcga atcgttgatg acgtctccgg    225840
     cgtagccgat gaacgtatcg aaggccgatt cgtctttacc gacacgcagc ccgccgagtt    225900
     gaatccaggc aaagttcagg gaactgctgt tactgccgtc agagtagttg aatttggttt    225960
     cagtgtaggt cttcaaggtc ccgagctctg tttcctgacc agtccaggtc ctcagcgaga    226020
     ggcgggcctt cttgtgccag gtatcgttga tgctgccgtc ctcatggtcg acagcacgac    226080
     gttcgttgaa cgaaccttcc tggccagctg acgcgtccca gcggacatag ccaccgatgc    226140
     gcaggcaggt ttcggtgccg gggatgtaga agtagccagc gccgtagacg tcgcagatct    226200
     tgacgtattc agcgggttcc ggctcggcga cggtgatggc atcggccgcg cgtgcgccgg    226260
     tgactgcggc caagccggca gcggagccga gaagaaggct cttgatattc attttgatct    226320
     ccactcaaaa gattaaaaaa agggccaggg catcttcatt gccgaaagac agcatccctc    226380
     cccatcccca cgatcgaaaa agtgcgcatc gcgctgcttc ctcggagttt gacgctattc    226440
     gtgattgtga ataatgcaag gtatatgctg agcagcgcag atctatgtat aacaaccgtt    226500
     gcgattatgt cacgtacaat cagatatata ctgtacaatt cgtgcaaact atacaaacaa    226560
     cacaggctgt acaggttgca cgagattgca aaatagattg ctcaggtgcg tagtggcgtg    226620
     cgcgacccgc aattgggctt tcacaggctc gcaacgcggt gcactgattt gcagctggtt    226680
     tcgtcagctg gacttcatgt tgaggaaaag tctcgtgcag cacagatgac ttctgcagcc    226740
     agatcttgcc ggagcatctc tatgggaatt cggccatcaa gccgaggtga aggggaggtc    226800
     agccaaagcc acgccggtct gggattggcg atcaaggaga gcacttgtcg tatccctggc    226860
     gctggcctgc catcgatgaa ctgagctaag ggaaacacat gcttgcgcgc gcccttccgc    226920
     aatgcgacca cgtcgttgtg ccgttgccac caatgcaatg tcgaccgcgg tatgccgaag    226980
     tgttcttcca gaaaggtggg ccctgcaacc gcgcctgccc agtcttcaat gcgcaagcta    227040
     ttgctttgct gatcaggccc ttttaaaact gcggacccat gcgcgccttt ggtttgcgct    227100
     gtgagcggtg gcgtctcgcg agcgctggca tcgaaacgtc gcgctgcttc ggctgcgagc    227160
     ccgtgaacaa acttggaggc caaggctgtc aaatcgtcat gaatcgcttg ttcgcaatcc    227220
     gaaagcaaat cgggagcagc gatattgcca ttccccacgt gcgatgagat tgaactcctt    227280
     cccttcataa cctcttggtg ctgagccaga acgcgctgga cctcttttgc aaccaagctt    227340
     gaaagctcgt cctggcgagg ttcattttgc aaaatcagat gattttatca tgtgtggctc    227400
     cccctgccgc gtaagagtcc ggttgattgc ctgcgcgatc gaattgcgat tttgggctta    227460
     tggacaagag acgcgaggcc gagccttcgg ctggctcaca cacaggcgcc gcctcgtgcg    227520
     cgaccacgaa cgacgcatcg acgtctccga agccatgatc cacgcagccg tgggcagtct    227580
     tttgatgcgc agaatcagcc attgaccgac tctgagcgtt cggaatagag gacagaacta    227640
     gatgccgcag cccagccgag taatcacggc gaagtcggac tcaatctgat cactccaacg    227700
     ttgttctcga tgacgatctc ggtcccaaat ggcttcgaga ggttctttag gcgctccaga    227760
     atagcttttg cttgggttgt gggggcgagc tgggggacgc cccggttggc aaacctattc    227820
     gaaaaaccga gctcgatggg ataaagacgt aattcagcaa ggtggttctg ttcgaagcgg    227880
     ctgacggtga caacactctc ataatacact ggggccgaga gcgccgcata gaacagccct    227940
     tccccaatcg ggtacccttt cgcctcctcg tcaactgtca cctcggcatc tgtatcgact    228000
     cgtgggtctt ttccgtaagc ttcgaacatg tccgccccgg cgggcgtccg gaggtcgtcg    228060
     taaaagaaat tccccaagct ataaaatatc gggcggccct tgtagatctc gatgcctcgc    228120
     aacagatgcg gcccgtgtcc gacgtatgcg tccgctccgg catcaattat ttggtgcgca    228180
     aacgattgtt cgtaatcagc cggttcctgg ctccaccccc caggctcgtg agcgtggttc    228240
     gtgacaatgc agaagtcgga aaactgcttg ccccggcgaa cgtttcgtag aatgtcggcg    228300
     acatcgcgct ggtctgcttc gtagctgtag ccggccttgt tgcctgtctt atatgttgcc    228360
     ccaccgacca tgacccggct tggatccgtt tcgcccgcct tgtagcctgg caacgcatca    228420
     cgtacccgcc tcaaactctc aagcatctcc ggcggcacga cgatgctttg ggccaaacga    228480
     agggcattaa gccctggtct gccgggagcc tcgccagcgg gatcgcacgc tcgagccata    228540
     ggcgcgaacg ttgtagccaa tgacaccaat gccgcgcgac cgcgtgcggt ttccaaaaag    228600
     cgagcggcgc cagcttgtgc gagattctcg cccgcacctg catggacgat accgctctca    228660
     tccagcaccc ggctcgtctc gcgcatgcct tcaagacccc agtcaagtgt gtggttgttc    228720
     gcgcgaccga cgatgttgaa ccccatcgcc ttcaaatcag gtcccagttc cggtacgctg    228780
     atgtgatacg caccgccgtg ctcagcctcc ggacttccct tgaacgatcg gatatcgaag    228840
     atcagggttt ccatgttgcc gaatgtaaca tcggcattac aaagaatctt gacaatgtcg    228900
     ccaaagccgg gatggtggcc attagtcagc gctcgcgaga cgatgaggtc tccaactgcc    228960
     accatcgtga agccgtccgc aacgtttgtt tcggttgagc cgatcgcatc atagccgtca    229020
     gcccgtcgca ccggataacg accattctcg tgtaaatgtt tctccataaa tttatcctct    229080
     atctctctac tttcacttgg cacgacctcg gcttcgtgtc gcgtgcgctc ggtatgtttg    229140
     ctggggtgaa tacgtatgcg ctatgccata ggggtgaacg acgaattggt cgaggcacgc    229200
     gctaggtgcg gcatgcctgt agccggagcg cgcacatgac aggccacgat gcgcccgtct    229260
     gccatcggta ctaagggcgg cacttcgatg cggcaccgct cgaccgcaag cgggcagcgc    229320
     ggatggaacg cgcatccgct cggagggttg atcggacttg gcacctcgcc ctcgacgggc    229380
     gcctccagcc gaacccgcgt cggatccggc accggcgctg ccgcgatcag cgcctcggtg    229440
     tagggatgga ccggtttcgc gaagagcgcc tcgctcgggg cgagttccac gatccggccc    229500
     aggtacatga cggcaacgcg atgcgcgata tgctccacga cgccgaggtc atgcgagatg    229560
     aagacgaagg caatgcccat cttctgctgg agatccagaa gaaggttcaa gatctgtgcc    229620
     tgcacggaga cgtccagagc cgagaccgcc tcgtcggcga tgatcagcga gggctcaaga    229680
     gccagcgctc gtgcaatgcc gagccgctgg cgctgaccgc ccgacaattc ggatggcagc    229740
     ctgtgcatca tctcaggcga cattccgact tttcgcagaa ggtccgcggc aagcgcctga    229800
     cgctgcttcc ggctgaggcg ctcaaaattc tcgaccggtt cggtgatgat ttgcccggcc    229860
     gtgaggcgcg gattcagcga cgagtaagga tcctgaaaga ccatctgcat acgacgccgc    229920
     caagcgcgaa gcgcgtcctt cttgaggcca gcaatgtcgg ttccttcaat cagcacgcgc    229980
     ccgccggtag gctccacaag tcgcatcaag agccgcgcca cggtcgactt gccgcagccg    230040
     gattccccga cgatgcaaag cgtctcgccc gcatcaacgg tgaaggatac atcctccacc    230100
     gcccggatca ctgggatggt cttcttcagg tatcccgccc caagcggata atgcttggtc    230160
     agattctcga ctttcagcaa aggatcgctc atgcgcccat cacctcttcg gcgcgccagc    230220
     aagccgcggc gtggcccggc ctgacatcat caagaacggg tgtcctctcg cgacaaatat    230280
     cgatcgcgaa cgggcagcga ggcgcaaaac tgcacccgac aatgggctcg cgaagacttg    230340
     ggacaatgcc gggaatttcc ggaaggcggc gctgtcggcc gcgccgcgga tcaggtaccg    230400
     agcgcatgag gccctgggtg tagggatgcg cgggacgcgc aaacaaatcg atgacgttgg    230460
     cctgctctac gattcggcca gcatacataa caatcacgcg ttggcatgtc tcggccacaa    230520
     cgcccagatc atgtgtgatg aacatcactg ccgttcccat gcgctctttc agatcgagga    230580
     tgagccgcaa aatctgcgcc tgaatagtga cgtcaagcgc cgtggtcggc tcgtcggcga    230640
     tcaacagttc cggcgagcag gcaagggcca ttgcgatcat ggcgcgctga cgcatgccgc    230700
     ccgacatttc atgcggatag ttgttgacgc gacgctcggg gtccgcgatg cgaaccagac    230760
     gaagcatctc ttcggccttt gccatcgcca ccgagcgggg gcctttcgtg tggatctgga    230820
     ccacctcggc gatctggtgg ccgaccgtat agaccgggtt caggctcgtc atcggctcct    230880
     ggaagatcat ggcgatctgg tcgccgcgga tctttcgcat ctcccgatgg gacaactcga    230940
     gaagatcgcg tccgtgaaag cggatctcgc cggcgacagt cctggctgtc agcttcggca    231000
     gcaggcgaag gatggagaga gcggtgacgc tcttcccgca tccggattcg ccgacgacgc    231060
     cgagcgtttc gccttttttc acctggaagc tgatgccgcc cagggcacgt gtgacgctct    231120
     cttcgccgta aaagtgcgtt tccagatttc ggacatcgag aagcacatcg ttccctgcgg    231180
     tttgatgtat ccgcatgtta gcgcctccgt ttggcgcggg ggtcgaacag gtcgcgcagg    231240
     ccgtcgccga gcaggttgac ggcaaggacc gtgacggcaa ggcagatacc gggggcgaag    231300
     attgtcaatg gcgcgatggc gaggtacaag cgcgaattgg cgatcatgtt gccccaactt    231360
     ggaatctcgg gcggcacgcc cgcgccgagg aagctcagtg ccgcctccgt cataatcgca    231420
     ctggcgcaga cagtggcacc ctggaccatt agcgccggaa tggtgctcgg gaggatatgt    231480
     cgccacagca ccctcggcag gcgcgcgccg ccgcagagcg cggcctccac atagggacgc    231540
     tcgcgaacac ccagaaccac cgaacgaacc agccgcgcga cggttggcgt ctcggggatc    231600
     gcgatggcga tgatgaggat gccgatcccg gggcctgtca gagaaatgag cgcaatcgct    231660
     agcagaatcg tcgggatcga catcaggccg tccatgaccc tcatgacgac gttgtcgaag    231720
     ctacggctgt agccggcgat gattccgatc aggagcccgg tcatggccgc gcacgccgcc    231780
     gacatcaatc cgaccatgag tgagattcgg gcgccgaaca ccgtccgcgc aaacacatcc    231840
     cggcccagat tgtcgctccc aagccacatt tcggcggaag gcggctggag gcgcttgaac    231900
     ggatccatgt tcaccggatt cccggcgtaa agtggggcag cgagcgccag gatgatcaga    231960
     agcgccaaca gaccgccgcc tgcaatgacc agcggatgac gctttgccaa acggggaagg    232020
     tcagatattc gcaggcggcc cgtagggacg tattcaactg ataaaatcgt catatcagta    232080
     ccggatacgg ggatcgatta aggtgtaagc cagatcgact gtgaggttga ttaggacata    232140
     cagacccgaa gtcaggatga gcacactctg aatgatgggg tagtctcggt tgttgatcgc    232200
     atcgacgacc agacgaccga taccgggtat gttgaacacc gtttccgtga ggacgactcc    232260
     gccgatcaga taggcgaagc ttatgccgat gacggtcagg atcgggacgc cggcattcct    232320
     caaggcatgg tggaagagga tggcatagga cgaagcgccc ttggcggcgg ccgttcgcat    232380
     atagtcttcc gacagaacct caagcatgct ggcccgcgta acccgggcga tgaatgcaat    232440
     gtagccaatg cctaatgcca cggtgggcag gatcaggtgt acaaaccaag gcccgaggcc    232500
     accatcgatc ggcgcatatc cctggaccgg tagccagtgt gtcctgatcg cgaagaagta    232560
     tatgagaaaa tagccgatga caaagaccgg gacggaataa ccaagtgccg aaaaggccgc    232620
     gaggaagcgg tcgacgagcc cgcccgttcg ccacgaggca aggatgccga aagagactcc    232680
     gaccatgacc gaaaggatca tcgtcaggat tgacagcgaa agggtcggtt caagccgctg    232740
     cgagatcagc tcgagaaccg gtcgcccggc aaagatcgag gtcccgaaat ctccaccgag    232800
     catgtcgcgc acccaacgta tgaactgaac cggcatagga tcattcaggc ccattttttc    232860
     gcggatgccg gcgatcatct ccgccgtggc caacctaccg gcgatcatgg ccgccgggtc    232920
     gcccggcgcc agcctgagaa gcaggaaaac gaataccccg accatcgcca taacggcgat    232980
     ggtcgacacc attctgcgaa ggatataggc ggccatcgtg tctcaggcct tctgcatatt    233040
     ccatatcggg atgagctccg gcatgctgat gaggtccgtg agggtctggc ggcgcgcgat    233100
     tggggtgaca tattgaccca acagaacctc ggggacatag tcccaccata tccgctgcat    233160
     cttgcgggcc agggccttgc gctcttcaag cgtttcgaca tctgcccatt tgacccggag    233220
     agtttcatat tcgtcgttct gcggccagcc gaaccaacct ttttcgccat tcatggatag    233280
     ggtgactgcg gtaacgacat tgccgcggat ccattcagct tcggacgaca tgaagaggct    233340
     ccagccgccg tcctcaacgg ggcccttgtt cgcgcggcgc gcgacaagcc cgccccagtc    233400
     gctcggcgca agttcggcat tgatcccaat cttctgcagc gccgccacca gtatctgcga    233460
     ggcattgtcg gcttcgcgcc agtcagtcgg atcgagaatg acgaccttct cgccggcata    233520
     tccggcctcc ttgaacagtt gcctggcctt ttccgggtcg ccgcctgtct tgtgccatcc    233580
     tgtattttcg tcgttggacg ctggcgtttc gtttccaaac atcgaagtga cggatcggaa    233640
     gtattttggg tcaccgaaag cggcgcgcat aattgcctcc tgatcgacca ggtgcagcag    233700
     cgcttggcgc gccttgacgt tgtcgaacgg cttttgcaga cagtttatac gcaggaacat    233760
     atcttggccc gtcttgtcca gaacctgcag ttcaaggttg ggatcgctct caatcaccgg    233820
     gaaaagatcg actggcggcg tcccaacgaa atcaatctca cctgcttgca aggccgccaa    233880
     cgcagtctgc tgattgccaa tattctccca gatgacgcga tcgaccttcg cgaccttccc    233940
     gccggccaat ccgtcggcag gttcgttacg tggcacgtat ttgtcactgc gatcgtaggt    234000
     aaagctggcg cccggcttcg caagagcctg attgaactta aagggccccg atccgatgtt    234060
     cgcagtcacc tgctccgtgg gggaaaggtt cgcgtctttc tcgcgcatga tgaatgggcc    234120
     ttggaaaccc aggaggtcga gtagaatccc cagcggttcc tgaagcgcga tcgtgaaggt    234180
     cttgtcgtcc tttttcgaga tatccctggc ccgcgccatg agcaattgcc cgccgggagc    234240
     cacctggccc caccgacgga ttgaggccac acagtccgcc gcggtgacgg gggagccgtc    234300
     gtgccagccc aagccatctc tgagctcgaa cgtgtaggtc ttcttgtcgt cggaaacgtt    234360
     ccacttgctc accatctgcg gctgcggcat aaacttggaa tcagcgccga acaacgtgtc    234420
     gtaaatcgct aagcaatggt tgaaggtgac gctagccgtc gtaacgaccg gatcgaacac    234480
     actgaggtca cccatgacca tccggaccgt ccgcgctgcg gttggcgcgg tctgcgcccg    234540
     caggaccgat gggatcgaca tagccgtacc ggcggccaaa cccgccttta tgatttcgcg    234600
     tcgagtgatt atcatgtttc attcccctct taagttattg gcgcaacgat ccgcgcctat    234660
     ctgctggatg gagcggtttt ccgcagttcg acgttgtcga tcggatcctc gtcgggcgcc    234720
     tgccgtaact ttgatcccgg cctcggcgca gaacgacgtc acattaggtt caatggtcac    234780
     ctttcagccg tcaccacagt cgatcaacgt tcgcatcttg tccgaggatc acgccgaagc    234840
     ccgtcgggct acggatgacc gcacgccgac ggcaactagc caacattgat gcgcctgttc    234900
     accaaataag ctcatcgtct cctccgattt gcggttgttt tctatttggt ttgtcggtgg    234960
     attttcagtt gccgataggc ttgggtcaaa ttcagtgtgt gtatcgaggt catctggttt    235020
     ttagatagcc gcaggcccgc catgaggccg gaatttcgct cggggtatcg cccggtctgt    235080
     attacatccg ttcgcgcggc cacagccgct ttacggagag gatgcgggcg cccggcctgc    235140
     gcgctgcgat gcggaaacgc tccagcttgg cgtcgcccaa ttcgacacgc tgcgtttgcg    235200
     catcatcaag atccgctgcg cgggtgatcg agatgaagac gcaaatccgc ctgcacctgc    235260
     cgacatcctg ccccgaccaa cgcatcctgc gcatcgtcct cgatcgcatt ccgcggctcg    235320
     cgacataacg atggggcgca gacgcccgaa acgaatccgc cgaccgcaac ctgcaaacca    235380
     cttgccatca cgacggatca tcgccggcgc ctgacgagga tcgcggaaaa gcgcccaaca    235440
     gcgaccacat cgccgcttca ggccgccaaa acctcatcgc cgtgcatcaa ggcggctagc    235500
     ttaacgaagg gttttaagtt tgacatgacc gagcttgccg atctcacgtc cccaatgtga    235560
     gtcccgggca ggctccattg ccaaagggat ggcggctgcg cgccggagca ggccaggcct    235620
     tgctccctcc gaaattcatc aagacgcttc gtaccacatc cccaaactac atgtggcaaa    235680
     aggtccttta aactatttta cagaatcttc acgaccgcag atcgctgaca atggtacctt    235740
     caccgcaacg tctgaagtca cgcacagcta acaaaagctg atgccaattt atgcacggac    235800
     tgccgcacag aacccaaggt cggagtcaac agccaatggc aagaagcgcg ctcatcttgg    235860
     ttgaaggcca caggagtatc agtctgctat acgtgaaagc ggctcagtgt cttggccttc    235920
     atccaattac cctgtcggct gatccagctc agtacgacta tcttgcggcg gaaggaattg    235980
     aggcgatccg tgtcgataca gacaatctcg atgcgctgat ccacgaatgt tctcggctgc    236040
     gtgcgacgta tgagattgct ggcattactg gctttgccgg cgacgacgag tcggtctctg    236100
     cgacagtcgg caagctctgc cggcatttcg atctaccggg accgaacccc gcatcgattg    236160
     aacgatgctg cgacaaattc actcaacgtc agctcctttc ggaggccggc gttccgatac    236220
     ctgcttatcg cctggcagcg aatgcgacgg aggtggaaag ctgtgccgcc gagatcggcc    236280
     tgccggtagt tcttaagcca gccgtaggta gcggcagcat cggtgtccga ttgtgccgca    236340
     gcgtcgaaga ggtagccgaa catacgacct atctgttgga cgggaagcac acatggcagt    236400
     cttcgccgaa gatactggtc gaagagttcg cacaaggtcc ttattattgc actcttgtaa    236460
     tgggaaatga ggtccttggg attggcgccg ctgatttcgg ccccctgccg catttcgtct    236520
     tcctgcggag catcttcccg gcccctgtga ctgatgacga gcataggcgt atcgccgatg    236580
     tttcgctgag ctgtttgcga gctctcggcc ttggctgggg gccaacgaac attgaactcc    236640
     gttggacgag gcgtggccca gtcgtcattg aagtcaaccc gcgtcttgtg ggtgggaccg    236700
     gacctcggct ggctcaagcg gctcacggta tcgatctcgt caccgagcac atcaagcttg    236760
     tgatcggcga cgaatgggat ttgcgcagaa ggcattcgca cattgcggcc gcgcggttcc    236820
     tacttgttga tcgcgatggg atcctcgact ggatcgatgg cgacagtcgg gcggctgctt    236880
     taccaggtgt cgccgaggtc aaattctatg ttgaacccaa gacgccgatc atcaggaaag    236940
     gcgactaccg agactgtatc ggacatgtcg tcgccgtttc acccagtctt gctcagaccg    237000
     agatcgcact tcagcgtgcc gtcgactcga tcagttggtc gatcacacca tttccgaccc    237060
     ttggcgaata ggaacaatat gtggccctta cctctgcgca gcggcgctag gtaagaggtt    237120
     atagtcgtcg cggtacgacc gactggtgga gcttcgatca gttcgcagcc aaaccccgtt    237180
     cggggcacct tcccgacgag caaaagtgat gaaccaccaa agcaactgct gatgttacta    237240
     tgattgcaca gaataggatg caattcaatt tatacttgag acgtttctga aaggagatgg    237300
     tgtgcccgag ccccctaaaa tcctttacgc tagcgagccg gacctcgatg ccgctgagtt    237360
     ctgccgagtg ttggtggaat ccggcttcgg gggaggccat ggagagctgc ggctgaaggc    237420
     gatgcttagc catgccgatc tagtgctgac ggcgcggctc gaccggcgcg accggaaact    237480
     ggtcggagtt ctccgcggcg tcaccgactt cttttgggtc tgctatatct ccgagctcgc    237540
     cgtctcgaaa tcggcgcaag ggcttggcat cggcaagggc ctggttggcg acgcgcgccg    237600
     gcagctcgga cctgtcgtcg caatggcgtt gatttccgag cccgacgctg taggcttcta    237660
     tgaaaggatc ggcatgacgc gcataccagc cgcgttctgg ttttcgcgtg agtgttagcc    237720
     tgaaaaattc acggcgggtt ggcggatgtg gttcaagcca ttgaaatgac ctagggtttg    237780
     gttggtaagg ccgatccgaa tcatttccgg agaccacacc cgccatgaat ggtcttacgc    237840
     tgccactgag cggcttgtca tctgtcggcg gcaattccgt cgtagcccgt ttcgacggcg    237900
     gcatgctgtg gtcagacagt ggcgttctgt ctcctagcga ggctcgcgga aaagcaccca    237960
     acagctgcca catcgccgtt tcaggccgcc aaaacctcat cgccgtcgat cttgagcctt    238020
     cgggcgacgt catagcccga aaccaagcct gcaaggcgcc acggagttcc ggctgtgcgt    238080
     ccgatcggta atgtttaccc aggtggtgcg gatgacgctc gcttcaatcg gccagaaccg    238140
     tctcgatcag gttcacccaa tacccgatgc cgtagggaag gcttcgtcgt tgaaatcata    238200
     tgccgggtgg tgcactgaag ccgtcggtcc attcccaagg aaaacgagag cgcacggccg    238260
     cgcctcaagc atgtagggga gttccttccc tcccatgctt ggtctcaact tatcgttcac    238320
     ggcttcagac ccgacgatgc tgcatgccgc cttgaccgcc aattttgtcg tgtcgacgac    238380
     cacggcacag gccggcccag tttaccgaca catggagttc gcgcggcaat gcctttggcc    238440
     tggacgtcca gttgatttcg accaccgacg cttgggccag ttctccgtgg tagggccgaa    238500
     tgcgcgcaag ctgatcgaac gcgttgtcga ccgcttcgat cacttcaaag cttagatctg    238560
     gtcctcggtg gtcgcgtaca atctcgcctt caccccgtct cagaccgggc tgacgccact    238620
     gatcgggccg tgctcagggt acgccggcga gtgccgggcg ataacctatg ctcgcgtcac    238680
     cgcggcaagt actcgggcgc gccacctgac gaagacgaag aacgccctga ccgccctgcc    238740
     aaaggccgac ggcgtccacc gacacggacg gtgcgcatgg tgatggatga tctccgcatc    238800
     ttcgatccga tcttctgcgg ataacatcac ctccatcata gcctggcgat ctacgacacg    238860
     ctgttcgcaa gcgaagctta tgacccagcc gcaaatggtg gggaagtagc tgcggcaacc    238920
     ccatagccta cccagcgccc agtggcatat gtatcgattg tttccgcagg ccgagagctt    238980
     gccacacgca gggcgatttg tatccgagcg cgattgcagc cattgtctca gaggtcgacg    239040
     cccactccca ggcggcggga ataacgcctg cgccggcgtg gccctccgcg ccgcggtgac    239100
     cttcgtcgat atccagcgct ctcgctgcag cgctatttgc catcgcggcg ccgacgacac    239160
     tagagtgttc gtctatcaac cacatggtta cggaaccttc gccgtaagca tccagtgctg    239220
     gaccttatgg ctgcattggc caacggtgat cgcaggctcg cagcggcagc gcacaatgag    239280
     cgcggcaatt ccacaagttg caagacaacc gttaagccgg ctcacagcgt aggcgccgcc    239340
     aaatgatgtg atcacaaatt ggtcatgccc caaattgggt cagcaaacga atgccagacc    239400
     ggcgagcgca tcgcccgaaa ggaattggtg acgtgaattg tcttcagtct tgtctggata    239460
     ctccgctcat ttgccaaagt gcttgaacga actgcctcgc agcggtcagg atctacacgc    239520
     cctgcataca ttctcgagaa tgagggcgat cccgaagagc tgggaatcgg agccgggcga    239580
     tccaacaatc tgcacagcga cgggtaggcc gccgctcggc gaggcgaccg gcaacactag    239640
     tgccggcgca cctaccagat tgaagaaaga agtgaacagc gtcagcgcgt tgccaagcgg    239700
     aatagtctgc cccgcaatgt ctacgtcgac ggtcccgacc tgcggcgcca tgatcggaca    239760
     cgccggcgtc agcaggacat caaacatctg catggcctgc gcaaacgctc gcctgtaagt    239820
     tcccagcatg cgcttacact ggatgtagct ttctgcagat aggaactgcc ccaacaccat    239880
     gccgccgcgc atgtcagcac cgaatcgatc gcgggcgcgg gcgcgattgg ggccgtgata    239940
     ggtaagtgtc tcggcgagct gaattgtcag cgagaccgtg cgggctacgg actggtctgg    240000
     gagttcgatc gcgccaaaca ttgcccccaa acgtcgcatg tgccccttcg tcgcgaggaa    240060
     cgcgtcttgc accggctcct cgcatttttc ctcgaagccc tcgaccagcg caaccctcag    240120
     cgccgcactg ggttgcgtcg ccggcgggag cttcgcgatg tgcctgacga caagctccag    240180
     gtcctcaact gatgtcgcga gtacgcccgc atggtccaac gaccagcaat aggggatgac    240240
     gccatcgaga ctgatcaggc catagctcgg tttgtacccg gcgatgccgc agagcgcggc    240300
     cggaacgcga accgagccgc cggtatccgt gccgagcgcg aacggcacga tgccggccgc    240360
     cacggccgct gcggagccgc tgctcgagcc gccagcgagc cttgtctcgt catgggggtt    240420
     gacgaccgtt ccggcccagc ggttctcgcc ggtcgcgcca taggcgaatt cgtggaggtt    240480
     cgttttcccg atcagggccg cccccgccgc gtcgagcatg caaatggctg ccgccgacgt    240540
     gtccggcaca ttgttctcta gcaccctgct gccaccggtg gttcggatgc cgcgcgtttc    240600
     gaacatgtcc ttcgcggcgt aaggaattcc gtcaagcggg cctaggacgc ggcccgccct    240660
     tcggcgtgca tcggacttcc ctgcttgttt tagcgcgtgg tcagcggcca ccgtaatgaa    240720
     gctgcgcaac gaggaattgg tccgttcggc cgcagcgatg cattctctga caatctccac    240780
     cgcggaccgg ttgccgccct cgagtgcggc gacgatcgtc ttgattgacc ttgaatcagt    240840
     catgaccaga gtgtgatgct tgcgctacgc cgtccggcgc gatatgaccc aggtccctgg    240900
     cgacgatact gcgcaaatcc gagagcaagc tctcgaagct ggagacgatc ccgaaaggag    240960
     acgtcgccaa ctgctcaaga tcgccgtcaa cccattggtt gccaagaaac tcggcgttga    241020
     tggacttcaa ggtctccaga cgcggttttg ccatcgttcc tctctcacac cacggcaagg    241080
     tcgtgaccca catcataccg acatcgatcg cccgcttgag ttgcggcgcc tctgggaagg    241140
     gctgaccaac cggctgcccg gtgtggtagc cgacggagaa tgacctcctc ggctgccgtg    241200
     gactgcctcg cacgtgaggc cggccctgat cgccgccagc gccggccggc ggcgccgcca    241260
     cggcggtcta atagccccac acttgccggt cacgtcgccg atgatttgca gattgtagct    241320
     catcggcgac gcgaaccagc gggcgttgtc gtccggaagc gacgcggctt tgcgcgtgtc    241380
     ggccgccata gccgcaagcg cgaccttggg gccttttcat ttcggtccta cttctggtaa    241440
     tgaaacgcta cggtgtttcg ctcagttgct cgaactaagg tgcggagcat catggggcat    241500
     ttcctctgtg ctttctccac ggtcgatgtg atgccgatgg gcatttagta cctaaatcac    241560
     cttgccgcct tttgatctga accagagcaa caccccacct tgggcaatct gggcagggat    241620
     tgcgttgcgc tggcaacaca cgaccgcatc gaagcccgat gagcttaaac ctagtggccg    241680
     gaagcgccaa cgcgagcgat cagtcggacg tcacgaccgc cgtatattcg ccgacgctcg    241740
     ccgcataagc gccgcctcat tccgcggatc aagcgccacc tccgggattc tgcacgggca    241800
     gctgaggtat caccatcgac ctgtgtctct ctcctgctct caattgaacc aagttcggcg    241860
     aacatcattc cctaatcagg ccttacgtgc gccggtgcag cggaggaagg gacgcagtta    241920
     cctgaggccg gaaaaggtgc gatcgaccaa cttattaagt cgacggcatg ctgaagtata    241980
     gccgcagtct gagcacggcc gggtgaagtg gcaatgacat gtccgatgcg gtctcggaag    242040
     tcgcccttcc tgacgatcgg cgtcttgggt ttaatgtaca atttcacctc ggcgacacct    242100
     ggtacagcag cggcccgacc gtcgccatgg atccaatcga gtacgccatc gcgatctgca    242160
     tccaggcact gcgaggccgc aatgtgcgaa tgccttctgc gcaaatccca tgcgtcgccg    242220
     atgacaagtt tgatgtgctc cgtgatgaga tcgattccgt aagccgcttg aaccagccga    242280
     ggactggttc cacccgcaag gcgcggattg acttcaatga cgactgggcc ccgcttcgtc    242340
     caccggagtt caactgtggt tggcccccag ccaagaccga gagctcgcaa acagctcagc    242400
     gaaacatctg cgatacgcct atgctcgtca ccagtcagcg gggccgggca ggtcaaatga    242460
     cggaagacaa aatacggtgg agggccgaag tcgccggcct caattccaat gacctcattt    242520
     cccattatgt caacgccata gaatggccct cgtgcgaatt cttcgatgag tatcctcggc    242580
     gaagaccgcc atatgtgttt cccgttcaac agataggccg tatgttcggc cagctcatcg    242640
     atgttgcggc acaatcggac tccgctgctg ccgctaccta cggctggctt aagaaccacc    242700
     ggcaggccga tctctgcggc agcgcattct acgtctatcg cattcgccgc caaccgataa    242760
     gcaggtattg gaacgccggc cttctcgagg agctgacgtt gcgtgaattt gtcgcagcat    242820
     cgttcaatcg atgcggggtt cggtcccggt agatcgaaat gccggcagag cttgccgatt    242880
     gtcgcagaga ccgactcgtc ggagcccgta aagccagtaa tgccagcaat gtcatacgtc    242940
     gcacccagcc gagaacattc gtggatcagc gcagagagat tgtctgtatc gacatgaatt    243000
     gcctcaatgc cttccgccgc aagatagtcg tactgagttg gatcagccga cagggtaatt    243060
     ggatgaacac caagacactg agccgctttc acgtatagga gaccaatact cctatgacct    243120
     tcaactagga tgagcgctct tcttgccatt ggctgttgtc tccgaccttg ggtgctgtgc    243180
     ggcagtccga gctagatcgg catcagcttt agcagtgcct gatctcagac gttgtggtga    243240
     acgtaccatc gtcagcgatt tccggtcgca aagatttcgt aaacttattt taaggctctg    243300
     ttgcaacgtt ctgatttgcc ggcgtgtggc acggaccgtc ggccaatttc cggggggtgt    243360
     gatgttcaag gaatgccact ttaatcagtc agtcatccta ctttgcgtaa gccggtgcct    243420
     gaccgtatct agtgcgactg gtctagcctc tcatgttccc tgtccaggtt gaaatcgccg    243480
     catggaacac cggcgaaacg atagtggccg cccgcatcaa ccggatgttc tcaaccgaaa    243540
     ggcgcgcctc aaaatggccc gggcctatcc agagccggtg cgctttgcta ccatccattt    243600
     tttccactgt gtcaggggga tagacggccg tcgatcagtt ctttcaccct ccgtttgcgg    243660
     tacatctcgg cgctcgccca gcgttcacgt atctctgcgc atttaagctg agtttcccga    243720
     aagagtgacc ttgctacaga aagctgggcg tccgttgatg ctttggcggg tcctccgccg    243780
     aattccagag cctccctgca ttcctctggg ctcgccggca acacaccgcc cagatggcag    243840
     gccagctcgc ctcggcgatt ggcaaggcaa ctatcctgcg acaggcgtgc cgcgatctcg    243900
     ccaatttgtg tatgggcact cctgaaggga actccccgca ccgccattcg ttcggcggca    243960
     acagttgtca tcgccaaacc gtcttccaga ttctcgagca tggcactaac gttgaaagac    244020
     atgaacttca cgatgagcga tgtcaggatg atggcccgct tcagagcacc ttcagcaagg    244080
     ctgattggag agcaaccgta gttacttgat tcgatcgagt tgctgaaagg cgctttgcag    244140
     gttgcagatg ccgcagaaac gtatgcgccc atcacggtgc ttgcagaccc tttgatatgc    244200
     tcaagaagat atgggttctt cttttgaggc aacatggaag agcccccggc aagattgcgt    244260
     ggaacatcga tgagggcgaa ctcgcgagtc gtccaaacct gcagatcctg ggctacgcga    244320
     ctaagcaaaa ttgagacact cgtgaagagc gaaaggccat ttagatggag atctcggctt    244380
     gcgaccgcat caagagagtt gaacgaaggc agttcgaagc ccagcaggct cgcggtttct    244440
     aaaggatcta ttggcatgct ggttccccca ccggcacccg cgcccatagg gcaactcctg    244500
     atctcctcca gcaggcaatg aagtcgctgg cgctcgcgcg cgagagcaaa gaagactcct    244560
     agcaggtagt gtcccgggga gcctgggagt gcgatttggt actgactata gagcggggcc    244620
     acaaggttcg atgcctcttc ggctcgctga agaagggcat cctgcgcaat tcctatctcc    244680
     cgcgagacgg agcacacggc ttcccgaaga accagcagag aaattgtcgc gttcaagtcg    244740
     ttacgagacc tcgctagatg tagccatcct gccctgtctt cgcctgctct ggccgcaagt    244800
     tcggcctcat aggcaagata aaggccacgc ggagcatcac ggccatccaa ggatttgaag    244860
     ccttcgcctt ggagatccaa aatagacgta agcaagtctg cggctacagc ttggccgacc    244920
     aagccgtgat cagcgagcat cacaagatgc gcttcgtcga tggcagcctg gaattgcagg    244980
     acccgaccat cccgcgaaat ttcgatgggc ggggcgagca gcttcattgc ttcaggatgc    245040
     aaggtccatg ttggctcact tgacccggcg tctcgactgt tgtccggttt gcgagcaagt    245100
     gtttctatgt caagcataat ggaatcaatc atgcgttcag ctgctgaggc agccatattt    245160
     acttcatcgg cgacgcccac tgcataggcc actcggtctc tgaaatcgcc attgatttgt    245220
     atatcctctc cctcagattt cagaaggccc gcctcgggcg tgtttggccc tagagtttta    245280
     aagaaaacca agcgtttgat cttgccagac cggtgagcaa gcttgaaacg aattgctgcg    245340
     gatttcttgc tcgctcgaag cggtacgaac gcttcaccgg agtaaagctt gatcatcatg    245400
     tccgggatgg acgtgcccaa ggcgtgcgag agcataaccg gaatcatccc tccagccagc    245460
     ctgggattga cctcaatgat gaccgggccg gactccgtta tgacgaattc cacatgagcc    245520
     ggtccgaagt ccagacccaa tgccgaaact gcgcctgcag caaaagaggc cagttcgtgt    245580
     cgcgacggct ccggaagcgg ggccggaaag tcgtgcccaa tctcaacgaa gcagggcgcc    245640
     gcccccttgt gcttggcaat aatgccaagg cagtgcagcg atccgttgta tgcgatgatt    245700
     tctgcagagt attcctgacc ttcaacgtat tgctggatga ggatttccgg gctgcgcaaa    245760
     tctacttggt caagcaacac tctctttgct ccctcgaacg cctctacgac ttctgaggtg    245820
     ttttcgcaaa ggcgtacacc gctgctgccg cttccggaga ccggcttcac aacgacggga    245880
     aaaatagttt gaacaagagc cttctctacg tctctgatgg agctgaccag ccgagtttca    245940
     ggcactgaaa tgcattgtcg ttgcaactcg gtcacttgtt tccatttgtt ccggcaatta    246000
     gctatcgcct ccggacgtgc cgctggcagc ccgatcgcct tcgcgactct ggatgctgat    246060
     tctacaaaat agtcggacga tgaaaatatt cctgccagcc ctgtcagttt ggcggcgaac    246120
     cggatgattt catctggatt acgcgtttca gcttcaatta ctcgcgcacc gcacaccttt    246180
     aggaaggggt agcggctggg atttcgcgta acgagataag gttcaaaacc caaaacccta    246240
     gctcgcttca tcaatagctc accagtacca gtcgtgttgc tttccacgaa aagaaaacta    246300
     ttctggtcca ttacagcctt ccaacgcgct caagacagcc tcccgggttt tgcgcttcca    246360
     acgatatcgg ttccatggcg ggagagcagt cgagggatgc tcctcgctag ctggagcgtc    246420
     cagaagaaca ccttcaagca cacattcgtt ttgcctgagc cactcctggt cgtacacagc    246480
     ttcagcgtag cggtggcctt catcagggca tatgaccaca acggtttcct ctgggtgctg    246540
     tcgggcgcgc cagcgcccta cgatatagct cgcgcctgag gtaggaccgg caaaaatggc    246600
     gtgccgctcg tggagggcct gcgttgcagc aaacgcaagc gaagccgacg tgaaatgtac    246660
     ctcatcgtac agttcatgct tcacgttctt tgggacgagg ctgttcccca gtcctcgcaa    246720
     cttccgttcg ccgtccaact ggccaaaaat gacactgttg aatgtatcca ccccaatcag    246780
     gcgggcccca agggccttct ggcgcaaacg ctctattgtt ccgcaagtag agccgcctga    246840
     accaacagag ccaaccaatg tcacatcggc gccaagcaat tccgagatct ggtcagcgaa    246900
     acaccggtag gctgccgggt tgtctggtgt ttcgtactgc cggggccaga aatgggactc    246960
     acccaattgc ctcatcctgg catgcatggc gtcgaggcgg cttctctgat acccgccctc    247020
     ctttgccttt tcagttataa tgaaaacctc cgcacctaag gatcttagcc tattttccag    247080
     tcccttatcc atcactgggt cggtgaatat ctcgagtgaa aatccatatt ccctgcacac    247140
     tacagccaat cccagcgcaa aggttccgct agatgtctcc aacactatcg tgtcatgcgt    247200
     cagagtccct cgagccactg cttgtccgat aatatacttg gccgggagaa gcttcatgaa    247260
     agcaaactgc gcgagatata ggttcgagcc acaccgaata atgcggggga gcgcataggc    247320
     cgcagaatac tgagaaaatg gcaggggcgt gcgatcaagg ttcatgtggt caacgccgct    247380
     agttcatcgt tagatatatc tttggcgatt tgccgaacag cgacacatgg tggaccacgg    247440
     accggagttt ctgcgagaat tcaggcgccc ttcgatcaag cattatccca gtcatggtac    247500
     cgctgtgcgc gactatgacc ccgagggcac ctgtgccctc cgatgctttc agcatcgagt    247560
     tcagatactt tttcggagcc cgctgctgat gtaggagcgc gctggctgtg gctattctgc    247620
     ccatagtgac cgtgtcacct tgcggaatgg ctatgcgcgc gcgatcgagc aattcacaat    247680
     actgcgctct ctgactagcg ttgatttcac ctcgacgttg atcatagtgc atggtttcga    247740
     ccgtacctcc ttcatcgatc ccaaccacgg cgagcggtgg catttgtccg aggaaagata    247800
     aaaggctaca tgatcgctgg tgatatgcga ccactccggg atacatcacc ccgtcagagg    247860
     gctcgatctc cgccattagt ttctccatca atgatgtccg cactctgagt ttgaagctgg    247920
     aggcgatcga ccgtgcggtc gccacaagat ccgcagacga acttgcaagt cccttgcctt    247980
     ccggtagctc agattgcaga atgaggtctc ctcccgagac gccgagcgca atcacgagat    248040
     tctcggccag tcgttgagct ttgattttgt gtggcgggta gacggttaca gatcgggtgc    248100
     ctgtgatggg cataaatttg gcccgtgcaa agagcgcgat gggcatcgtg accaagaaat    248160
     gggaatcatg agaatgggga ctaaccggca actggccttg aagtaactcg ccaaatgtgc    248220
     cgcagcaaag tgcaacaccg tcaccggaat ggaccctggg ctgcccgttc tgcagggcaa    248280
     cctcagccgc cgcttcggca tcgaacctct ggtgaagcat gtatggcctc caaagctcat    248340
     cggccgccgc ttcattaatt tttgtcatat cgagactcgc cgagcatccc gaaggagcga    248400
     cgcgataggt ggaatcctgg ttcaccatgg cactccgctc aaatcgagga gtgtgagact    248460
     tgagccatct gggcaagaac gtgcttcagt tggatctgac actagcttgt tgcctgtata    248520
     aaacgacttc agggttactt tgacattgta tggcgttaaa gggtgcaaac ttctgttaag    248580
     tttcttgaag gatctgttgc aacctttgaa agcgaagcac cttgcgggtt gggcccgccg    248640
     agatttgtcg cctgatttgc gaggagcaca ggcctatgaa gtgggacaac agcgatgccg    248700
     gtcatcaaga cggttacgaa ggtgaccatt attgcgtgtt gatgtgatta ctggtgtggc    248760
     aggcgcgcaa ccctcgttag actgttgtcg acgatcaaag cgcggatcgg tccctacgct    248820
     caacggccgg cagaacctgc gcccgcacga tgccaagcac ggcattgtcc gaccagtcgc    248880
     tcttcgccac gacgtgatgc ggagactggg gcgtagcctg gacacgacca agctccaccg    248940
     cgccgccatc ggctcaacgc tcctccgctc gcccagcaaa aagcagcagc cccgtgctgg    249000
     cgccacccgg tcagtttgac ccagtgccga gacgagcgtc tcgacattag cagcaaaacg    249060
     cgactctctc gtttcgttct tcgtttccgt cctggaggcc attgctccgt cctcctcgct    249120
     gcccttgtgt tggcatcggc gtcactcggg cagatcggca ggtcatcgtc gctgctttgt    249180
     tgacttctcg agcactcgca aagcccagta atgcgcatcc tcgccatcga ggaatctgcc    249240
     gtcgttcaaa cactgtgccg gcgcaaggac gctcgcctcc tgcagacgca gcacctcgtc    249300
     ttcaaacgac attgcctgcg tatagctctt gcaggtgcta gcaattacga atccgttcgg    249360
     tcgcgtgagg cgcgaaagct cgcgcagccc atccgggtgg acatgtccaa gtgtgaagac    249420
     gccgcagcag acaatcatat catagctcgc gctcgcgtat tctgagaggg acctgtttag    249480
     gtcaatctcg ccttcaacgt ggcgataaac cccggtttgg cgcgccattt cggccattgt    249540
     ttccgagaga tcgaagccga cgatgaagcg gaagccgata tggtccagtt gcacgccaac    249600
     caagcctgta ccgcaccccg cgtctagaac tgcggtggct gctctatcac cgccaatata    249660
     cgcagcctgt aaggcgcccg ccatttctgc cacgatcgag gggccgctgt agcgttcgcg    249720
     gtccatatcc aactcgtagg agtctgccca ttcaaaatag tgctgcgcca atagattggc    249780
     gtcacccttg agcgcatgtg acgccttaat ccgcatttgc gcagcttgtc ggagtgcgtt    249840
     ctgtttatca acggcgctca tgtattctcc gctaatgtgt gagctggcca gtttccgcta    249900
     cgacttgtct gccgagaatt tcgcccggac cgccgcagat caggcaggat ccgccactaa    249960
     ttccagcatc tctcaagaaa ggcaacctcc tttgatcaat atatatttct atctttcgat    250020
     tttcacctga tttcttgtta aacttttgct attatttttc attgttgttg tcacattaaa    250080
     tgatcgggcc cgtccaggcc ttgaggtgaa tttagctaat tccgatgccc gaacgctttg    250140
     ggatacagtt caagtttttc tcccgtgacc tcaacggaaa ccagaagaaa aatcgcgtag    250200
     tgaccatccc gctggctcga agagcgtggc caattgattc tgcgactcaa tcgcgcgggg    250260
     ggagcggccg caaagcagct tcgttcggtg ccgaacctgt tcaatcgctt tggtgaaatt    250320
     ccttgcagtc cgactagaaa ctcaaactgg gacgcgtgcg tagtatgact gatgcggcgt    250380
     agaggaaggt cccggcgagg cgatggtggc ctcgaagttc ttggcaaggt agcggatccg    250440
     gttgatcgaa tcgaagaaac gctcgagcgc tgtcgatcac cgccgccgaa gggctggcct    250500
     cggccgacct actcgcggtc tttcatgacc agatgatggt tgagcgtctc gacaagctct    250560
     cgcggcgaaa gcggtggaac cggccgcaaa ctatgcttct tggcggaatc attgggcagc    250620
     agaagctggg tggagcttgc ctgcggattt cgcaaaagcg ggacaagggt ttcgctaact    250680
     ggccctcaat gcccgaccga gaaagacgct ggtttggaaa acgccagaga ggcccttgac    250740
     gtgctgctgc catgagtgaa cacaatcggt gttgcaatga ccatttgaat ccgccttaca    250800
     cgccgcggtc agaatggtgg attatcggcg gtaatggaag acttgaaacc gattgacttc    250860
     aacacgccga atagagaagt cccggtattt tctggagcgg attgagtttg aagcgtttgg    250920
     gctgagaggc acatgccttg cagataaact ccctacggcg tgagggtctt gagcctacgc    250980
     ccgtagctgt aggcggcgac tgtcgcgttg cctcaaggaa aatgttactg cgctgcttgg    251040
     ttgcctcacc taaaatgtta cccgtgaaga ggaataccgc catgaggctc tcaccacgat    251100
     ggaggcatca tgacggcgaa gatgacgcat gctattcgca tggtgtcttc aatggggtca    251160
     gggttcgcta tgcggccgca gcgaacaagg gcaagggcag ggtcttggag tgtgaatcgg    251220
     cctttaattg cgggtggttg tcaatccgag tttcgctctc atcgccgggg tcatggtcct    251280
     ttccgaggtc gaatgcctca tgatcatgtt cgggttgggc gcctcaacgt gtgcaacgag    251340
     gttcgaagtc gacgtcagcc gattcaacga ggtcaccaca agcaccgtcc cggcgggaca    251400
     tcacgggttc cggaaacagg cccgcgattg ggatcgagtg cagatctgtc agttcgccgc    251460
     cccactcaaa gctggtgccg tcaacccaga ggcagtggag cagaaccgcg atcttgcgag    251520
     ctaccgccac ttttgtcttt ttcataccta tccgctttga cagacgaagg cccccacgcc    251580
     ttcaaagaag accatttctt cgttgcatgc atgagtaggc gtcaggcgtc aggtcacccg    251640
     aatctcggag ccacgttgtc gttaaaactt cgttgttttg cctacttaac gaacagctgg    251700
     cgcggtattt tggtcagggg ttcgtgcccg gtctcggtaa cgacaaacgg ttgagtaatg    251760
     gtgataccgt cgttctcgag ccaaagcccc gacatcatat ggaagcacat acccggtcga    251820
     agcactgtct tgtccccctt gcgaagactg acggtttttt cgcccaccgc tggcggatac    251880
     ccaagaccga gcgaatagcc gagacgtgaa tccttctcgt gcccgtgctt agcaagcgtc    251940
     ttggcaaacg cggcgtggac ttcctcggcg ctcttgccgg gagctacggc gtccagccct    252000
     gcattcagag attccacgac gacgtccgcc agcttttgat agttcgggct cggtttgccg    252060
     acgcaaatcg tgcgagccag attgacctgg tagcgatggc gatttccgaa gagctcgaga    252120
     ttgacgatgg tggacggtag caacggcttg tcggtccacg cggcatgcgg agccagagcc    252180
     ttctcgccga cgcaaagata gggcggcgaa cacgtatagg ttccgccgaa ctcgggcgta    252240
     cccgccatca tctgatgata aatgacagca gcaatgtcgc actcccgggc acccggttcg    252300
     atcgtatcga cggcacggta catcatcgct tcagcgatac ggccggcctg tcgcatgagt    252360
     gccacctcgg ccgggctctt caccagacgt atccagttca ccagcaagtc cgcatcgatg    252420
     aaggtggcct caggcaatgc cttcatcagg tcggaatgtg cacgcgcgga gtagtagtaa    252480
     ccgcccattt cgacgccgac cctcgttttc cggccagcga tttccttcac aatctccgcg    252540
     acgaagtcat acggactgag agccgactgc acatatgcat cagcgtaagt acggatgctg    252600
     tcgtcggaca gataagtggt catgaaggcg gaaatgccat ccataccccg tccgacccaa    252660
     atcggctctt cgcggtcgag agccaccacc accatctgcg gaacgtaaaa tgaataggcg    252720
     tcgtagccgg tcaagtaatt ggcgttggcc ggctcggaaa gcagaagggt gtctatgtcc    252780
     cgcttttcca tctccttctt cacgctcgtc acgcgtgtcg caaactcgga ccgctcaaaa    252840
     tgtagttcct tctccatttc gatccctttt tgatacgcct ttagaagact attcaggacg    252900
     tccggattca gaatccgtcc gggtcgattg ccactttgat ggctcgcatt atggtgcgtt    252960
     cgctagcgcg ccgaagcgcg gcggccagcg cgatcttgga cgggatcggg ccacgtttcg    253020
     gccgcgaagc ttccatccct gtcggatgcg agtttcgcca atgcgagacc tatcgccttg    253080
     cccggtcctg cagaatcggc agtagcgagg gaggcgtgtg gtggacgttg ctgtcggcca    253140
     gattgccaaa cggattgatt cgtgccccgg caagattctc ttcgcaccgg gcagccccat    253200
     gtcgccatag tcgtagcgcc gacgtcgaga tggtgcgcca tcacccgcga agtccactaa    253260
     atcattgtcg atgatgacac ggccatacat aaccaaatca ttggtatggg cactgccgag    253320
     tgaccctccg gccaggtgcg aatcgttttc agcaccatgt cgtcgattcg ccattcctcg    253380
     ctcgcaaggt gatgatcgaa aatggaatgc aggcagatgc cagcacaatt gaggtggatc    253440
     gggatcttgg ccggttccgc cagcagtcga catttggtat cgaacggcgg ggaggagcag    253500
     ccctccattt ccttgatcat gaagcagcgt ccagtatgta ccaggcgatg tgtgatctgg    253560
     ctcacgtggt tgctcaggct ccgataaaac aacccgttcg atcgcgcctc gatggcgtat    253620
     tatgtgggcg tgagtcaacg tcatcttaat catctttttg ctaagcaata caatcggttg    253680
     cttggaagca aaccggaaga ttaggctagc tcctgcgccg tgtctccgtc ggcgcgttgt    253740
     tattctaagt ttcgggcgtc tggtggcaac agggcggtca gaaggcgcgg aatgcctgca    253800
     gtttcaaggc tagctgtcgc cgcgaggatc tcgtcctgcc accgcgggtg aacgttcttt    253860
     cgggcgatgt tcttgaactt ctccgcgacc tggtcgctgg ataacgagtt ggcgacatcc    253920
     cccaagggat gcagcacgat catctcttcc gggccgttcc cctgatcgat gacgacgcgg    253980
     gcaggcgttc ctactggaaa cgcggaagca aaatcgggcg acggctcaag ctcaatacgc    254040
     gcggccaagt cgagaacacg tgcgtcagca agacgctcca tttgaaaagg ctgtagagct    254100
     tcgcggccgt ataaagccgc caccgcgcag ctaaaataga agctgtactg ccccccctcc    254160
     aacgtgctgg gcgcgcgctc gtttgcaagg cgcattgctt gggggaacgt ttcgatgcgc    254220
     agcttgcgga tctcttgccc gtcccgacgc atggcaagga ttgcatcgat agccgcgtgg    254280
     atatagcggc agcatgaata tggcttaaga tagcattttt gtacttccca cgacgaccca    254340
     agattgtttg tcaggacatg gcgagtgaaa cgatcattgt catcaagaag atcaagaggt    254400
     ccagttgcgg ctgcccacgc gcggtaggcc gcggtaatac ctgcaaccac ggcagggggg    254460
     atcccttcct tgatcgtggt accctcgaac ttggagcttg cggttaagaa gacaattggt    254520
     ccttcggatc cggcaatcgc caatgcatga gcggtttctg ctgcacctaa gcccaggaga    254580
     cggcaagctg cagctgcagc gccgtaggcg acccagcgtc cggtcgcata cgtatcgatt    254640
     gtcgtaaccg gacgagagct cgcaattcgg agaccaattt cgtatccgag cccgattgca    254700
     accatcgttt cggggaccga cgcgtcaaca gcttgagcca ctgccaaggc cgcgggaatg    254760
     acgccggcac cagcgtgacc tcctgcgccg cggtgaccat catcgatatc cagtgagctc    254820
     gcggcagcgc tattcgccat cgcggcgccg accacgctag agtgatcgtc agtcaaccaa    254880
     atactgatcg ggccttcgcc atacgcttcc aacgccgtct gtcgggcggc atgagctaac    254940
     agcgatcgca ggcccgcagc tgtggcaccg ataagatcta gcattagcga cgagattgta    255000
     cgccgtgtgg ccgtcggcag cgcagaggcc gggtagctgc taacgaagtt cgcgagttca    255060
     gttatcgctc tcacttgagc actcctcgtt ctctggtgaa tgaaatgacc acaaaaaatc    255120
     tgcataacta gtaagcaata cggttcagtg ccgcgctcgc tttgtctgcc ttgaacttag    255180
     ggcaagatga tcggaagtgc gtcagctttt tcgattggcg cagatagggg agccggacaa    255240
     aagtaacctc ctgccctccc ttgttcttgt ttacattgct aacgatacct atgaccggtc    255300
     gcatgagttt agccatcttc tgggatttca ggtgcacgag aagagcttgc gctccatgca    255360
     ggttaggcgt tccgggcctt gttccgtcac cagcaccatg tcgctgaagc ccatcccgcc    255420
     tgccatcatc agcatatcaa acaccattcc cggctccagg acccattcca cgcccggcac    255480
     gaactcgcgg ataaattcgc cggcggaggg gcggtagttg agaccaagcg aatagccgga    255540
     acggttggta tatgtcttgc gcagccccgt tgccagcagc ggctcgcggc aagctcggtc    255600
     aatcacactg gctggtgtgc ccggccgcat caacgcgatg gcatcgtctt gcacgcggat    255660
     gattgtctca gcgatgtgct gctgctcagc gctgggcagc ccaacaatgg cggtacgcat    255720
     caaacgtgcc cagtaatgtc gatgaatccc gctgagctca agatagaccg tatcgccacg    255780
     ctccaattgc cggtcggtat aggatccgtg taaaagattt gtccgattgc cggaagtgat    255840
     gacaccgcta agcggcattt ccgccccggc gttcaccaat gcgccgaaca cggtgccggc    255900
     gagctgtcgc tccgtgatgc ccggcgtgac agcctcgata ccagcgtaaa tgcccgcttc    255960
     aacgcaacgg gcagcgccgc gcagataatc tatttcccgc ggcgatttga tcagtcgcag    256020
     atggtcgacg atgcgcggct ctctgacaaa agtcgcattt ggcagcagcg cctgcagcat    256080
     cttccaccgt tctagtgtca agaaccatga gtgctcatcc acgccgacac gcccggccgc    256140
     caagcccaag ccctcgaggg ctctccgcgc cgcgtcgagt gaaacgcgga tcggatcgga    256200
     tgaatctgcg tagctcgtgt ggctcgtgac ccaagacgtg aggtgcgctg ctgggatttc    256260
     tacatcgcgc aagatcagca ctggatcgcg atggctcgga accgctacgg cgtgatatga    256320
     gaaaaagccc gccccagcgt cgagacctgt cagatattga atgttctcgg gctgatgcag    256380
     gagtaacacg tccagatcat gctttgccat ttcctcctgc gtgcgttgaa ggcgtgtctt    256440
     atattcttca acagggaaat ccatcccgct attcgtatgc tcggtcaccg tcgtggctcc    256500
     ttcattgcca aactacatca cctttattcg gtcagccgct cctccctctg gcggattgct    256560
     tcaaatctga cgtagaaaca gattgcaaat gcgatcagta tacttgatac ctcagtaatc    256620
     gtgggtgtga tctcttcccg aattcccgac cacaccttcc tggcagggcc atcgtgtctg    256680
     gcccgctcac gcaccaccgg aaggcaaaga acccagcgat gattaacgcc ggacagatga    256740
     acaggagtac gattggcgaa atcgtaacaa gtcgcggggc gctcaaactc aaggcaacgt    256800
     gctcgagtct tatgttctgg gcctgcatgg cgagttgcag tggctcaaag aggaagtaga    256860
     tcgctaccgc actaatgatt accagcgcga tcagcggtgc gagcaatagc tggtacccga    256920
     cgcggcgcat tcgccgactg ccgcgaacga atcctatcgc agccgctgaa ccgggggaca    256980
     ggcgcgcaaa cacgatagag atcgcaactg ccaaactctc aaacgtagcg gagacccagg    257040
     cctcgcttgt gacataggca tcgtaccatt gcactgacag gcccggaggg gggaaatcga    257100
     ggaagcgtga agagctggat gagatctgga cgatgatcag gatgggacta accaagagga    257160
     acacagcaac gatcacgcta aagtcccata atagcttacc accaagcgca gcccgctcac    257220
     aacgcctggg gaggccggcc ggaaagcaga cactacctcc gacggcgcgc accaagaccg    257280
     gggcgaggtc aacgagttgc aagtaagcgc tggttgaatg gcgaagggta gagcctgctg    257340
     attggccaac gcctcgctga gagccgagca gcggttcgat tcccacgaaa tagttggata    257400
     ttgcgtagtg cacgagcgtg atcgcgagca acacggtggc aacggtggcc gcaagcggcc    257460
     agttaggcgt cgcgttcatc agcttccgtg gtacgattgt gttccgatcg cctagcagtg    257520
     agggtgtgat gtagaactca agtgcgaaca cgaagaggag cagcccggtc gctcttacgc    257580
     ctggcgcgct tatgagaaag aacatgcgcc aaaaattctg ggccggggag gctcccagag    257640
     aggcagcagc gcacgtcaga ctgtccatga caggctcaga gcacttcgcg tgacggtgcg    257700
     gagatgtagc aggacgcgta gatatagccg gtcgtgcgct ctaggcgatc ctccatgccg    257760
     agtttggcca tagccttcag gattgcttgc cgttccgttg gtgtggagaa gcggcgctgg    257820
     cgttgtctta accgatctac aaccttggtt tccaaagcga aaccccgaag tgtccgcgcg    257880
     atgtcgtcat aactgaaggg gtgcattgca aaggcgacga cccatgggtg tgacgtcgcg    257940
     gaggccttat acacgcgtgc aaaggttcgc gccgtggcgt agcccacaca gcctgtgctg    258000
     atgataatat ccgcacccgc aagggcgcaa cgttcattgg gggtcaagtc acgggtttcc    258060
     aaatcccccg tgatgccagc cttcagcagc cccagattcc gtgcatatct aacagcccgg    258120
     aacgatggat ccacgccgac gaactgaatg tcgtcacgga ggccgcgatc gcgaaagaaa    258180
     gcgcgatgct cagtctcctg tcggcgcgag agagatccgc tgggttccag ataggcagca    258240
     tacagatcgt cgagatcgag atcggtgcgc agcaaggcgg cgttgacgcc ataggagcaa    258300
     ccgacatcga taattttcaa ccaagtcttg tttcgaacgc gtcgataatc ggcgaagatc    258360
     ctttcgaaga ccggcttggc ccgatctggg atcatatagt ccaaggccaa atgcgcgcga    258420
     aaataggcgt gcggccactt gcgattatag gctgccgtga agtcttgctt cgccccctga    258480
     atgctgctgt gcagtccact tgctggcgcc attgtccacc tcattgcccc gtggccttgg    258540
     gtcacagccg accgtcaaga gcgctcagtc tgaagctgag accggcgaca tggacctgac    258600
     atgctgcttt ccttcattcc atcgatcgcg atctgatcca agacatgaac atccgttggc    258660
     gccctgccgc cttatgttga aggagtttca aaagtcgtac caactgctca gaaaagccca    258720
     gaaaactttt ctcttaggga tcatgggtta catgagagtg cggccggtat ccgagccgaa    258780
     cactaccgtg tctgatactt gacaacctac agcaggtgtc gaaagcccag cgccgtccca    258840
     ggatcgcacg ttcagaccgt tcgacggaag ccttgcgcta aagggagcat ttatatgcat    258900
     agatcgctga tcggcgtcct ctgacgcaat ttccatgatc gtgctgcacc gatcggcctt    258960
     gtctaaagga gatcgatttt gccgcagcgg tacatctttt gaggctcgcg atctgtcgtt    259020
     ccgtctagcc gttgggccat gttcagctga ttgcggctcg aacgaaaggt ttgtcgcgcg    259080
     caatcgggtt ggacaagtgg cagtcaaagg gcaatgcaac agttctgaag tcatacgctt    259140
     aggccccttt tgcgaaggga aaacatcctg ttgatctggc tcacacgagg atggttgccg    259200
     gccccgagaa attcggcggt gagatcgttt gcgccgataa tttccgagag gagatcgtcc    259260
     cgcgcaccac cggggaagcc taagaggatg ctgcccgcct ctgtgaggaa ttttgggcct    259320
     tccgatagat agcggcagag caatccataa cccgggtcga tggctcctcg ctcgatgttg    259380
     tcctcatact ggtagtcatc cggcgcaaag accgacggat agttccaaaa tatgaaatcg    259440
     aattttcggt gcggtggaac atttgtaaag atgtcgcttt cgattacctc aacgttcttg    259500
     atgccgtttc ttgcagcatt ttctaacgcg ttcgcgaccg ccttaggatc gatatcacag    259560
     gcaaccaacg acgcagcgcc gagttttgcg aggtatagtc ccggaaggcc gaagccgcag    259620
     ccgatctcca aaatgctttt tccttcaacg ggaggaaaat tgtcagtata ccaacgccaa    259680
     ctgtggaaat cttgtggggg atagacacct tcgtgaacgg ccaagtccag tccaaattcc    259740
     tgcatccgca gcgggaaagt gcgctgttgg ctaagtttga gtctcgtctt tatccggtca    259800
     atttccgtca tattcctgct ctcctcgagc tagacacgat agacactgcg atcggctcag    259860
     gaccgtctgg gagacttcag agtcgtaaaa aaaccgcctc attcagtttc gagtcctcag    259920
     agcccgagga tggatagaat aaattatgat gtcaatcatc aaaatgagta tattttgtag    259980
     tacaaattct acaaagagcg acagtacggt aatatttata gcctgcttgt gaaatattcg    260040
     taaaatatat taacaaatat gtcatatctg taaggcaacg ggttgagccg ttggagtcaa    260100
     aaaacagtgc gccttcccgt gctcgccatg gatcgtgccg gttggccaca ctaccaccaa    260160
     cctcgtggta ggcggcattg accaagtccg tcattgaggg actgcgaaat cacctgatcg    260220
     agacggcggc gacgcgcccc aagccgcgat cgacctcggc aacgaggtga tcgtcggcgt    260280
     caataagtac cggttggaga ctgagtccga caatgcggcg gtgcgagacg cgcagatccg    260340
     tcgtctagaa caaacaaaac gcgtcagcgc gatcccaagc gcgttgacgc agcccttgcc    260400
     gcgcttggtg agactgcggc caatggcaag ggcaatacgc tcaaagcggc gatcgaagcg    260460
     gtgcgcactc gcacggcggt tggggagatt ttccaacact ttgcgccgcg ccttcggcga    260520
     ttacgcggct gtacgccgaa gtgatctcga aggcgccgcc tttccgtccg ctcggccgtc    260580
     aaccgaagct gatggtggcc aagctcggcc aggatggcct gtgactgggg cgccaaagta    260640
     atcgcatctg cgtttggcga tctcggcttc gacctggtcg cggggccgct cttccaaccc    260700
     cgcaagaagc agcaagcatg gccgtggccg ccgatcgcga cctcggaccg atcaccacgc    260760
     tcgccatcac aggcatctcg gtcgtggtct tcatcatctc gatgtatgtg ccgtcgatcg    260820
     cccaaggggg tcgtgcaggg cgcgtcggtc gccggcggca tggagcgatc cggcagggcg    260880
     ggcggacccc aaccttcgcc gaagacggcg cattcttgga gcgagggccg tgtccagggc    260940
     gcgcagacgg cgagcgacgc aagagctggc gggtctcgtc catgcgggtg ctgcacttcg    261000
     agatatggct tcatcggcag cgccggatgg gcggccggct cggcggcaaa ggaaagagca    261060
     atcgcgtcgc ccggcacctt tgcgggctct ctcctggggc ttgccgatgc caagctagat    261120
     cagagccggc atcgggcggg cgtacagcct tccggccggg tccgccgatc gacgacacta    261180
     agtgaggaaa ctactcggca tggcctcagg caacccgccc gacaacccct tatcttgccg    261240
     cgcggcagga gcggaacgaa cgctatggct cttatgtgaa ggcggcggcc gcctggcgtc    261300
     ttgtcagcat cgccggcatt gccatggcgg tgatcggatt ttcctatgcg ctcttccaga    261360
     gcacgcaggt caaccatggt gaaccgtaca tcgtcaaggt ctttaagctc ggcacggcct    261420
     cgagcgcggg cttcccgcaa cagatcgagt atgccgatcc ccgcgtcgtc agggcaagac    261480
     gaccctgatc gccgccctat acagctcttt ttgcagaggg ccgttcgcgg gattcgagtt    261540
     tcgctccagt cgaacgctga cagcgttcgc cagggcgtca ccaccgcgcc ctcgaacgat    261600
     ctagggagcc gctccccgtc acggatcgaa ctagccgctg ctaagaaggc gtcaggttcg    261660
     tccacctgaa tgtggtcggc gcggcagagc agcgacatct cctaattgcg gatcgctctg    261720
     gcgaggactt ccgcgacgcg cgccgggaca ccagcctgat cccgaatttg agctcgaaat    261780
     gacggaccga gtttgcttca ccctggcgcg ggcaagctgg cgaggcccga gacacgcaca    261840
     gggtacaagc gaaaattcaa acagctgatt tgggcacttc tgaataacgg cgccattccc    261900
     gacagcgcca tccttgaaat tctatcgacg aaactcgaca agcttgcgcc taagccgggc    261960
     aaggtcccgg ttgtggacga ggttgaggaa ttcgagggtg cgatcgtgca ggaatttgca    262020
     gccgacggac gcgcgattgc ccttcgccac atctgcgctt accgcgatcg aacttcgaag    262080
     tcggtcttat cgggctcgaa gaactattca aagcctggct ggagcctcgg ccagtcaagg    262140
     acgtccggcc cctggccggg gtcgatccgg cgcgttggtc gacagaatgc ttccagctga    262200
     ggaagaggct tggaatggtt gacatcggca tgtcgtgatc gggttccagg gatgagaaaa    262260
     acgaccttgc ggccgcgctc tggtatctcg tcgactctcg ggcgccagag gtcccgaccg    262320
     cgctttccaa gcgacggcgc accggtgatt acaaatatct tgaagcgatc gcggccgcgt    262380
     gggaaagcgg gtggcaggtc aagcgcaccg gcgtcggtac ctggcggtcg gtgagacgtt    262440
     tgaacaggtc ttcacctccc gggagtatga cagcgcgtcg aggacgtgcg tccggatctt    262500
     aattgagacg tttaacgccg agcgtcttga gttagatgat gtcctgaaac tgcttgctgt    262560
     gcccacgagc agaacggccg ttcggcgctt tattagctcg cttatgccgc gcccgccgtc    262620
     agcgacatca cagtaagttg tcaatcgttg gatgggcgca gtgtttgcgg aggcggccaa    262680
     gcattcgaca gaaaaaacgc tgcacgaact ctgggggcgg gtttttccgc ataaaaccaa    262740
     cgaggcgatt tctaaaggtc tcggtgaact gaacggctcg aaggaagtta gccacgccgc    262800
     cagactgatc gatttttcaa aagatcacca agcgacgccg ttcgaattcg tcgaggcgtg    262860
     cagccgcgag agccctaccg caacggcggc ggaacgaacc gaactcaacg cttatctgct    262920
     tataatgtgc agccaatggg atctggcaga tcgataacga tcgtggccga tgtgctcccc    262980
     cgtctacgtc gcgtcgcgct tgctaatggc ttttccgatc gcacccgcgc gttgttggat    263040
     cggcggcttc ctacttgtcg cacacgtggg acctcaacaa acggctattg aagttgctcc    263100
     gcaatgcctg tcgcgacggg gcgaatattg aggggttgat cgagcccctg gcgttttccg    263160
     agatcgagtt gctgtatgtc tttgatgaag acaacaacaa cgatcttaag accctcattt    263220
     caaggttcct ttggccggtc taccgcgcat gagcaattcc aatcagccac gaacgccccg    263280
     gccgatcgca cgcattggat cgatgaatgt cggcgcgatc gagattgact tcgaactcgc    263340
     ccgctcgatc aggccaaagg atcatcggat accatcagag ccagcgagca caagatcaca    263400
     gcaacgggcc ggagacgcga ccgcacccgc accatcccat tgccgtccag acacaactat    263460
     tttgtattgc tcgacggact gcctctgccg tcgtggcgcg gccatgtaga actttcccat    263520
     agtacctcgt tcgactcgga agaaaatgta gaatcaaagc atgggatcaa acatatggcc    263580
     ccagctactc gcggacacct gacctgccac tgaaccttat ccagcggcga ttagagcctg    263640
     gaccgtttct gttacgccgt ggggcgcggg atgagcaacc ggcgaagacg cggagccttc    263700
     gattagcgca gcgtcggagc cggttacggt gatgacctcg gcataggccg ccggggtctg    263760
     gtagccgagc gaggaatgtg gccttgcaga gttgaacaac acgacgagag aacccccacg    263820
     ggaccgagga acgcgagctt ctttatccat ggcatccctg ggccaggcgt cgtgttcacg    263880
     ttcatgaggt gatcgagaag gttgaccggg aggttttccg ctgcagtctc tctggccacg    263940
     cctccgatcg gtggctggag gttccggcct ggatgtttga tcgcgcggtc tgcaccgcgt    264000
     ggcgcattgc cgctgcccca catgtcgatc ccagaacgct tggcgtcttg gtgacactgc    264060
     tgcaggacgc gacggccaat tcccacaccc catcgcaatt ggaggattcg ggcgcagcat    264120
     cgggtcctca cgacgcgaat cggggagagg tccatgccgc gccagcccac gacatatcag    264180
     ttcgatctgt tctccaaccc gcacgatgcg ccgaccgcgc agatgccacc atggcaggcg    264240
     ctgccggaag agacgcgcct gacgcttaga acgctgatgg tgcgcctgat cctcgaccac    264300
     gtcgacggcg agcgcgccgt tccacgggag gaggcgcgcc atggtgcatg agaagatccg    264360
     gccccaccat ctggagcgca aggcgatcct gtatgtgcgg caatcctcgg cccatcaggt    264420
     tctgcacaat cgtgagagcc gcgccctgca gtgtgcgatg cgcgatcgcc tggtggcact    264480
     cggctggtct tgcatcgaga cggtcgatga cgatctcggc cgctctgccg caggcggcgt    264540
     cacacgtgcc ggattcgacc gaatggtagc cgaagtctgc ctcggcaagg tcggtgcggt    264600
     cgcggcgcgg gaagtatcgg gcttcgcccg caacagccgt gactggcagc aactcaaaga    264660
     tgtgccgcgt cgtcgatacc gtgctggtcg atcaggagac ggtctatgcg ccgcgtcagg    264720
     gtaatgaccg gctgctgctg ggactgaagg gcagcctcaa cgaatatgag cttgatcttc    264780
     tgcgtcagcg ttccctgtcg gcacgctacg agaaggcccg gcgcggcgag ctcattgtca    264840
     cggccccggt cggcttcgtg aaggtcggcg acaggcttga gaaggatccc gatcgccgtg    264900
     tccaggacgc catcattctc gtcttcgaca aggtggccga actcggcagc gcccggcagg    264960
     ccctgctctg gttcctcgag catgggctgg atttgccagc caagcgcaac aatggcgatg    265020
     tggtctggcg caggccaagc tatgcgacca tccaccgaat gatcgagaac ccgatctacg    265080
     gcggcgccta cgcctatggt aagactcgtg ctgcgtcggg atatgatgca acagccattc    265140
     gctcgcgcag ccgccgtaag gcgcgtgatg aatggctggc gctgatcccg ggtgcacacg    265200
     aaggctacgt cggctgggaa cgggcggaag cgatccgcaa gatggtgagc gacaacgtac    265260
     ccacgagcgg gcatcacggg gcgcccaagc atggcaacgc tctgctcgcc ggccttgtcc    265320
     gctgccggcg ctgtggacgc aagctgacgg tccggtacac agggaccaaa cataacattc    265380
     cgcgctattc gtgttagcgg ggcttgctcg acaatggcga gccgcgctgc atcgcattcg    265440
     gaggattgcg cgtcgacgac gccatcgagg aagctcttct gcgggttgtc gagccgggag    265500
     cgattaccgc tgccgtcgag gccgaagcac aagcggccag tcgccgcgat caggttcgtg    265560
     atgcgctggt gcgcgatctc gaggcggcac gctacagcgc tgatcgggca ttccggcagt    265620
     acgacgccat cgatccgcag aaccggctgg tcgcggcgga actggagttg cgatggaacc    265680
     gggcgctcac gcgtgtcggc gagatagaga gccggattgc cgcgcatgat ggctcgacat    265740
     tggaaccatc acttctgtcg ccaatacacg tcgccgcgct cgccgccgat ctcaagactg    265800
     tctggtcggc gccgacgacc gacgcgaggc tcaagaagcg catcgtgcgc accgtcatcc    265860
     acgaggtggt cgccgatatc gatgaagaag cgtcagatat cgttctcctg atccattggg    265920
     ttggcggcgt ccatactgaa ctgcgcctgc caaagcggcg ccgtggacag cgcaacagca    265980
     cgtccggcga tatcatctcg gccgtccgcc aactggtgct catcgccaat gatgatctga    266040
     ttgccggcat cctcaaccgc aatggactgg tgaccggcca cggcaatcga tggacacgcg    266100
     aacgggtcac cgcacacagg tcgcatcata agatccctgt cttccggcca gcggcggacg    266160
     gcaaagagcc atggcttaac ctgaacaagg cggcgcgcct tctcggcgta gcaccgaaga    266220
     ccctcaggct cgccgccgag gcgggcgaga tcgaaggcgt tcatcctctg ccggatggcc    266280
     cgtggatctt cagccgatca acgctcggcg aaccggcggc tcagagcatc gttcatcgtg    266340
     cgcggcagaa tccaaaatac cccacaagat cgcatcccga tcaacaaaac ctatttactt    266400
     caacgacata gacagatggg cgttatgaaa caggatttaa gtcccccgtc cattcagcga    266460
     tggcactgcg ggcgtgatcc aggccgaaga acaggctctc gttcaggagc tcatcgcgca    266520
     tccatccatt gaatgactcg acatagccgt tctgcatcga cttgcccggc gcgatgtagt    266580
     gccattccac ccgatgatcc ttcgaccagg cgaggatggc gttcgaggtg aactcggtgc    266640
     cgtggtcgga tacgatcatg cccggcttgc cgcggtgggc gatcagttcc gtcagttcac    266700
     gcgccacccg gcggccggaa tcgccgccag gcattcgagc gtcacgtcgt cgacgatgtt    266760
     gagcacgcgg aacctccggc cgcaggcgaa ctggtcatgc acgaaatcca gcgaccagcg    266820
     tgcattcggc ttcgcctgga ccaggatcgg agcccgcgtc cctaccgctc ggcgcctgga    266880
     gcgtcgcttg cgcacggcca gtccttcttc gcggtacagc cggtagatgc ggttgacccc    266940
     agatgcctcg ccctcgcgcc cgagcaggat gaacagccgc cggtagccga agcgtcggcg    267000
     ctagttggcg aggtcacgca gccgaccacg cagctccgtc tcgggcggac gccgggactg    267060
     gtagcggatc atcttgcgat cagcgcccac aaaggaacag gccggcgctc cgacaggccc    267120
     atgacggcct gcagatgcgc gacgggttcg cgcttggcgg cgggccctac cattaatggg    267180
     atggtccgcc ccgtcctccc gcagcatcat ctgggcagtc acaacaaagg aggttgcaat    267240
     gtccccacgc aatgcgccgc gccctgcggc cgtctctggt ggcgatatcg gcaagaacat    267300
     cttccacgtc gtgggcttgg acagcgacgg cgagccgtcc agcgagttcg cttccgacgc    267360
     gatacgttga tgaagttctt tgagcgggca gcgccggcaa tcgtcgggtt ggaatcgtgc    267420
     gctggatcgc aatggatcgc caggagactt caggcactga ggcacaaggg tcgcctgatc    267480
     ccagcgcagt tcgtgaagcc atacgtcaag tcgaacaaga gcgacatcat cgatgccgct    267540
     gctatcgccg aagcagccac gcgaccgacg atgcgatttg ccgcgatcaa gagcgaggag    267600
     caatccgacc tccaagcttt gcatcgggtg cgcgaccaga tgatcggcac gcgaacccgt    267660
     ctgatcaacc agatgcgagc attttgcctg gaatacggca tcgcattgag acagggcgcc    267720
     ggactgttca agctcgactt gccactggtt ctcgatgacc tttcgaatga cctctcgccg    267780
     gcaatgcgca aactgctcgt ggacctgttc gcaagatctg cgccagttgg agcagcgcat    267840
     caacgacgtg acgagggaga tcgcagcgat cgcagaccga gaagatgtgg cccgccggct    267900
     catgacgatc cccggaatcg gagcattggg agccaccgcg ctactagcgg ccgtcggcac    267960
     cggatgccag ttccagaagg ctcgcgagct ggccgcatgg ctggggctgg tccctcgaga    268020
     atactcgacc ggaggcaagc agaagctact cggtatcagc aacgcgcggg aaccgctacg    268080
     ttcgcaagct gctcgttcat ggcgcgcgat catgcttccg tcacctggat cgaacccagg    268140
     atcgcctggg aagctggctt gacgggttgc agggccgtat gcacccgaac aaagctgttg    268200
     tcgcacttgc cgccaagatg gcgcgcattg tctgggttgt cctgaccaag ccgggagcgc    268260
     tctacgaacg caggggccct gctttcgcct gacgctccgg ctcgattgca aggctcggga    268320
     atagtgatga cgaaacaatg gatcagcatg ccgtaagccc tgtgcaaaaa agtgggcttc    268380
     gtgcccgaac catttattgg gaacggcgtg cgcggatctc atcatggcct ggctgcaaca    268440
     gcagctcact cgcgagaggc cggatacatt tatgcaactg gaatcgtcat cggcgatgtc    268500
     gcgaaccctt gcacggacgg gcggaccgta cattttttga cagaagctca cgcagcgccg    268560
     aggcttcagg catctggtct gcgagcagct tcttcagctt ggcattctcg tcttccaagg    268620
     ccttcaggtg cgcatttcgc aaaagccgga caggggttcc gctaattccc ggacagcgat    268680
     ttcgctaatg tcgggacagt ttggcggcga cggtcctcgg gtgccttgtt gcattcatgg    268740
     atgattgatt tcgccgtttt cgacgccggt caagaggggc gcggcctttt gctttcgcat    268800
     gctatcgccc tggagcacga tgcggtgggc gttgtgcacg atccggtcga gaatggcgtc    268860
     ggcgacggtg ggtctgcgat caggtcatgc catctggcca ccgggacctg ggcggtgatc    268920
     agggtggatt tgcggcgata gcgttcctcg acgatttcga acagatggaa gcgctgttgg    268980
     tcggtgaggg agtgggttcc gaagtcatcg aggatgagca gttgcgcgcg ggtgagcttg    269040
     tcaatgaggc gtgggaagcg gccatcgaga cgagcgagcg ccaaatcctc gaacaggcgc    269100
     ggcacgcgca catagagcac ggaatgatcg agccgtgccg cttgccggcc gaaggcgcag    269160
     gccagccacg acttgccggt tccggtctgg ccggtgacga tcaggttctc atgcgctttc    269220
     agccattcgc cctgggcgag cgccatggtg ccgcgccggt cgagcccgcg cggcgcggca    269280
     aagtcgatgt cctcgatgca ggcttcggga aagcgcagcc tggctgaggc gagccggttc    269340
     cggacgcgct tgtcggcccg tatagcgacc tcgcggtcga gcatcaggcc gagccactcg    269400
     tcacggctga gctcgttggc gttgttctgt tcggccagct cgcgccaggc ggtggccatg    269460
     ccggccagac cgagggcctg catctggtcg agggtggggt tcgtcagcat tctttcttcc    269520
     tttccttcac tggtaatagg tggagccgcg gatgttggcg tgctggggtg tcggctttgc    269580
     cggttctgcg gagctggccc ggtcgaggcc ggctttgagg atggcggtga cggaggtgta    269640
     ggcgatcgcg ttgatcagca gcgcccgctc gcaggcggca tcgagacgct ccggcccata    269700
     gcgcggcgcc agcgacagga tgcccatggc cgagcggtat ccctgttccg gatgcggccg    269760
     gtcgcgcatc atgcgctcga ccagaatggc ggcgttgggg ccgatcccgg ccgcccggct    269820
     gatcaggctg gccggcgtgg tgttggcgta gcgctgatgc gccttgggca tgtgttcatt    269880
     gacggtgacc tggccggaac gctgcgagcg acggacatgg caggcgacac gctggtgatc    269940
     gtggaagatc tcgaccactc gatgagtaag ccgcacctcg acggtgcgcc cgatcagccg    270000
     gtgcggcacc gagtagaagg tcttgtcgac ctcgacatgg tagtcaggat gcaccttcgc    270060
     cgacttccac tcggcgtatt cgaacggtgc tgccggcagc ggtttcaagg cagcccgctc    270120
     gatctcctcg aacagttcgc ggcggctttg gccgacatgg cgcatcggcc ggttgttcaa    270180
     ctcctcgagc agttcggcga tcgccgcgtt gagctcggcg atcgagaaga aggatcgatt    270240
     cctcagccgt gccagaatcc agcgctcgac gatcagcacc gcgccctcga ccttggcctt    270300
     gtcgcgcggc ttgcggctgc gggtcggcag gatggtggta tcgtagtgct cggccatggc    270360
     ggcaaaggtc gcgttcagcg tcggctcgaa ccacagcgcc ttgacgacac cggccttcag    270420
     gttgtcgcac acgatcgctc tggtgacgcc gccgaagaag gcgagcgctc gcacctggcc    270480
     ctcgatccag tccggcagct tttggctaga gctggcaaag gcgaaggtca gattggaggc    270540
     gcccagcacc gcgacaaaaa tctgcgtcgg gtaaatggcg ccggtcgccg gatcgatcac    270600
     cgacaccgtc tgcccggcat agtccgtctg catccgcgcc cgccgcatgc cggttgcgga    270660
     atgtcgcgct cgtccggcgc tcgaaagcgg cgaagtgctc gcagaaccag gtgtagccgt    270720
     aaccgtcggg atgggcggcg cgatactcct gccacaacag cgtcagcgtc acccccttgc    270780
     gcttcaactc cctggcgatc agcgcaaagt ccggttcgct caggtcttgc ggcggacgac    270840
     cggcacggcc aaacagcagc cgctcaagcg tcgcctcgtc gtggccgggc ggcagcggcc    270900
     agcatgccag cccggcctcc cgcgcccgca gcaaataggt cgataccgtc gtcttgctga    270960
     ccttcagccg ttccgacacc tcacgcaccg aaagaccctg ctcatgggtc aggcgcaaga    271020
     tcgcttggat atccctcacg ctcgttcgtc tcgcttgctt ccgtctcggc atggcccctc    271080
     tcaacgtcat cgtgagaggc caaactgcca gaacggcgca gccgagaacc gaccgttaaa    271140
     tccgctcccg aaaactgtcc gggatttagc ggaatcgctg tccgcgaatt actgaaatca    271200
     ctgtccggga tttagcgaaa agggtgtccg ggaattaccg aaacacgcac ttcaggcgct    271260
     tggcgtccga cacgtccatc ccgccatact tcgccttcca gttatacagc gtcgcctcgg    271320
     agaccccgtg cttgcgggcc agatcgcccg ctttgcaccg cctcgtgctc gcgcagagaa    271380
     ccgcgatgat ctgctcttcc gtaaaccgct ttctcttcat cagtccgtcc ttcaatcaag    271440
     gcccggactc taatctcaga tggtggaaat tctcagtggc aggtcacacc gtcgatgaga    271500
     aggtaagatt gcaacttctg ccagcacctc tcgcggcatc ggctcgctgg ccgatctcca    271560
     ctggagagat tgagaaaaaa tcgccaaacg gagaagtcgt tgattgggag tcggctgcac    271620
     caaccgccgg ctatctttgc ggcagcctcc gaggggactg tcgcctgata atgggagagt    271680
     ctctcgccgg cctgcgacgt ttgcaatacc cattccaagc cgtaccagct tttggcgata    271740
     actcgcttgc gatcaggata atattagcct gtcacgtgga gagggctaac agtctcaaag    271800
     cgggggtcga gatccgtagc gaacagagtt gaggagctaa catctcatag ggtcctaggc    271860
     tattcgagct taagactgcc ggcatttgcc tagcggcttc caaaacttcg cgtcggacga    271920
     accctcaggg cctcttgcat cgaagcctcg tatgggacgg cgaccaggct ccctggcgga    271980
     catcgaacaa tcctttgggg gtggcgtctg tccaatccta acgagttacc cgggcacaaa    272040
     gaatgtactc acgatcgtgg ctaaggcatt catttttgca acaactgacc gcacctcaac    272100
     ccgcgcgagg ctcgaagtgt cgataaacga ggccctaatg cgaaacatgc agacggcatc    272160
     ctttagatgc aacttctatc tgcttccggc cttctcactc tatgcttttt cctctgcgat    272220
     cgaagtgctt acgctggcga atgaagcgac cgggcaaaac gcctacagtt gtcaggttgt    272280
     ttcgggtgac ggacaaccgg taacgtcgag ctgcggcatt accataagtc cggcggtggg    272340
     tttgcgctcg gagcgtgacc gcaacctgcg atcaactcca gctcccatcg ccatagtgtg    272400
     cggaggccgt tccctccctc gcaatgacag caagttggag gcttggctca gagagtgccg    272460
     ccaccgtcgc gcacgcctcg tcggcatagg cggcggaacc tttgtccttg ctcgagcggg    272520
     ggttgcggag ggtcgccgct gcgcagtgca ctgggagcaa ttcccgctat ttcaggagca    272580
     atttctaagc gttatagcta cacaagccgc atttgaaaga gacggtgacc tgtatacctg    272640
     ctctggcgga gacgcatcgt ttgacacatt tctagatcta gttggacgcg accatggagt    272700
     tgccgtcgta aatcgcatct gcgagaaggc cgttgcatgt cgtgttcgct cggctggaga    272760
     tcgtcaacgc ctccccccaa attcccgcat acgtttcaat cacaaggcag tcgtccaaat    272820
     catcgatcag atggaggcac atatctgcga ccccaaatca atcaatggat tggtggcagc    272880
     gattggactt acgcgccgcc aagtcgagcg actctttaag cgggaattag gacgtactcc    272940
     gagccgctac tacctagaac ttcgtctgga acgcgctcag ttgctgcttc gcacctcgag    273000
     gctatcagtt atcgagatag cgatagcgtg cggattcgtt tcggcatcac atttcgcgaa    273060
     agtttatcga atcatgcacg gctgcgcccc acatcaaact cggttgtttt tgcgcgaagt    273120
     cggacaagat cacccgtata atccgctcgt cggagggcag ctcggcgaaa aaccggggca    273180
     catccctgct actgctaatc gccgacttgg cgacgatatt gcggaggttg ctgcttgcgc    273240
     ttctagactg agttccaata ctcagcgctc atcctagcga gatctcccca agggctctct    273300
     gcgaagcctc tgagcacgat taactcgaag gagtcgctgt gttgtgagcg gtaacgtgac    273360
     cgatcaggat tgttgcccat cggcagacga gaaacgcggc ggcgaatagg ttgagggcgc    273420
     gttcgcaggc gttgttcgtt gcgtcgacca ttcctggcca ttgggcaaag gtcaaaagtt    273480
     gatcgcgagc tcgcctgaac ttgttttgga tgtcgcgggc cagatcgcac gacgttgtgg    273540
     tggcgaagtt gtcgtccaga cttcgctcca gtgcgcgacg cttgccggcg atggtcgagg    273600
     cggcgaaggt ttcgataccg tcggctaggg cgaaggccct ttgcaggcaa cgcttgagcc    273660
     gtggccgagt acgcgctgac ccgcatcaag cagggcgagc gggtctttgc cgatgagacc    273720
     acgctgccaa cgctggcgcc gggatcgggt aaggccaaga tggcttattc gtgggcctat    273780
     ctgcgcgatt atgcgcaccc gttgattatg cgcagctcac cgggacagga cccgctaacc    273840
     atcggcttcc cagactattt cgaagaggcg aactgcgcat aactcttaaa ggctcaacag    273900
     gaactgcatg agctggtccg gcggccgata tcggccttga ctggccgtca tgggcaacag    273960
     tcggttgagc gtagcgctcc ttcatggcaa gatccgccta aggtacatgt gcgtcgtggc    274020
     gggttggcgg tcgtacgcca gagcggcacg ctgcggtctt tgcgcccctt gccatgcagg    274080
     tgcgcgaccg ccgagccgtc gacgacgacc tcgccgacgc gcagaccgat ggcttcagac    274140
     acgcgggcgc cggtgttgta catcatgctg aacagcgcgc gatcccgctc acccgcccag    274200
     atccgcgcat ccggtgcgtc aaggatcgcc tgcatatcct cgcgtgacaa aaatcccagg    274260
     accggccggt cgaaccgttt catcggaagg gctagcacct gttcgatgac gggcagcgcg    274320
     gttaggtcgt agtgggcggc atacttgagg aaagagcgga gcgccgccag gcgggcgttg    274380
     cgcgtgcggg cgccgttgct ccgctccttc tccaagtggt cgaggaagcc gaggatcaac    274440
     tgcgcatcga ggtcggtcag agtcagccgg gtgggtgccg tcgcctcggc gaagccgagc    274500
     aacaatcgga aggtatcgcg ataggcggcg atggtgcgcg aactgacggc tcgctgattg    274560
     ccgagatgcg cgatgaaaaa gcgttgaagc aggctgggga aggacggtgt cagcttggaa    274620
     tcagacatga cgatccctcc aaccgtagag gcgaagaact cgaaccgttt gcccgcgatc    274680
     gccatgagtt ccgggacgcc ggcaagatac caataggtat cggagatctt ggcgtggccg    274740
     acgtaggtcg agagcgccgc catggcgtta tcgatatcgg cgccatgttc gtgccagagc    274800
     tggatacgac gacaaacgaa agtgtggcgc aggtcgtgaa ggcgcaccgc gccatggccg    274860
     ccccgcgcgg gtccaaccaa ggttggtgcg aagcttctgg aaagccttat tgatgcgccg    274920
     cttggcgata aatccgcccg ccggagacag aaataggggt gagtcctcgg taagcgcacc    274980
     atgacgcgcc cgaaccgcca gatagcgccg tagctcggct acgacggtgg cgtgtatggg    275040
     cacatgcctc gacttgcgga acttggtgtt ccgtatcgtg aggaagactc catcgagatc    275100
     gacatcgctg cagcgcaggt ggagtgcttc tgaccggcgc agacccgtag cggcgatcag    275160
     cccgaagatt gtcgcgtagg ttgccggccg caatccgccc tcggggccca ggcgccaagc    275220
     ggcggccaca aggtcgcaga tctcccgctc tgaatagatg tgcggtgcga ggcggcggtg    275280
     tgaacgacca aaggtcgcgg tctgggggaa ctcggtgtcg ggatcgagcc gggccagata    275340
     cctcgcgaac gggcgaagga cttcgaggcg tcgggcccat gagaagggac tggtccgctt    275400
     ggcctggcct tgcacccagt tcaggacgat atcgttggtg agcgggccac tatggccgcg    275460
     cccgtcggcg aacagggcga aagaggtgat ttgatgaccc tccatcctag ggcgaaacca    275520
     agggcgcggc gttcggacaa atagtccttt gccagtgaga gcagtgcgcg cgccggtcat    275580
     tgcgcgctcc ccggccacgg caaggccacg gctccaaggt tggtcagatc gacttttgcg    275640
     tagatggcgg acgtatcgag gcttcgatgc cgcaggatgt ccgcaatctc cttcatcggc    275700
     gcgccagtgc gcagaagtcg gctggccatg ctgtggcgga gaatgtggac gccggttcgc    275760
     atccatccac atcttcggta gccggccagt accgcgcgtt tgacgctctt ggtcgtaatc    275820
     ggttctggcg aacaaatatg gcccggttcg acgtcgcggg ccgctcctcg tgcagatagg    275880
     ccgcaatcgc cgctcccgta gcggacggca ggggcagagc atcggcgcgt cggctcttgg    275940
     tgccgacaag cttgatcgtg ccaccggccc agttgatgtc gtcgagctgc agcttgacga    276000
     cttcgctgga acgcagaccg agatcgatca gacaccgcac catcgcataa gcccgcaggc    276060
     gcgacgggaa cgtctgatca aaggaactca gcagttcgtc gatctcggcg tcggtcagca    276120
     cctcaggcag tgatgccaac cgccagtgtg cgaccctggg gatcgcggcc ttcagatcgc    276180
     ctacccagtc gccggacatg ctgcggaagc gcagatagca gaccaatgat gacgccgttc    276240
     gcggcgacgg tggcgggtct tcgcccctgt ttgccaagga cgaagcggcg gatggatgtg    276300
     gcgctgacgg tcgccatgga gatcggctgc tcgtcgaaat gctcgacaag aaatccttcg    276360
     accactcggc aacgcttccg acgcgtgttg tccgagacgt agcgcatgtg ggcatcgaag    276420
     cgcgtcagct cctgttcgat ggcggatttg cgggccggat actggagcac cacgccgcca    276480
     gctttgagca cctcgagaag atgacccaga gccgcctgca gctcatgacg caaacgacgg    276540
     accgggtcgg ggcaggcgca cgccggctgg tgttccgaaa gcgcataaca gcgccctggc    276600
     cgatcgcttt taggtcgtac ctttcttgag tcagccaatg ggcgaagtgg gcgacgcagc    276660
     acagataggc gcgctgcgtg ctcggcgcat atcgccttcg ctgcaactgc tcaccgtact    276720
     gcgaaacaaa gggccgaaga atactgtctt ccaaccaagc gcggggctgt ggctgaagga    276780
     tgatcgcttt ttgcatgtag atctcctacc gagttgagtg cgctcggaag gaagcactag    276840
     gattatgcgc atcgcatagc tcgaatgccg gctaccatct tactgatcta ccgaagaaaa    276900
     ctggctagct gtcccggtga gctgcgcata atcaacgggt gcgcataatc gcgcttatgg    276960
     agagatctac ataacaggga tgatcggccc tttggcggca gcggaccgcc catcgttgtc    277020
     tatcgcttca aggacagccg caccggcgaa tgtgttgccc gccatctgga cggctatcgc    277080
     ggcatcctgc aggtcgacgg atacgccgcc tatgaccggc tggccaagcc cgatcgggcc    277140
     aatgacgcgg tgacgatcgc ggcctgttgg tcacacgcgg cgcaagttct acgaactgca    277200
     tgccgcgagc tcgtccacca tcgcctcgca gaccgtggtg catatggccc cgctgtgggc    277260
     catcgaggag gccgtccggc caggacccgg cagcacgaat agcagcgcgt caggagaaat    277320
     ccgccgccat cgtcgccgcg ctcttcaggc cgtgggaaaa cgagctgccg aagctgtcgg    277380
     gtaaatcgaa gcccgccgag gcgatccgct atgcgctcgg tcggcgtgcc gcgctcgagc    277440
     gcttcctcgc cgacggccgt atcgagctcg actccaacgc cgtcgaacgt gcgatcaggc    277500
     cgcagacaat tacacgaaag accagcctct tcgctggcag cgacggcggc gggcggacat    277560
     aggccaccat cgctacgctg ctggccacct gcttatgccg cgcgcggcat aagcagcttt    277620
     ttgccgaccg tcgaactatg ccgagtgagc aagtttttac caacactttc ctcaacgtag    277680
     cggtagctgg atcggcatag cttaggctct ctccgtcgca atagacgcga aggagaggac    277740
     acatgaacgc aagtgactat ctgcaacgca gcacactgta tcggaagctg atccacgggc    277800
     cgtatggcga gtttgcacgc gtttatgcgg gcagattgtc ggacgaaggc ttcggtcggc    277860
     aatgcacctg gcgatcgcta agcctatttc gtgagttgag agactggcat gtcggcaacg    277920
     ggcacgatct ccaggattta agcgaagttc atgttgagcg gtttcttgag caccgttcca    277980
     aacactggag catcgattcg ggcgaccgat cggcgctccg gcgcttgctt gccgcgttac    278040
     ggcaagaagg tttgatacca accgcccttc cgattgagcg cacggagtac gagcagattg    278100
     ttgatgtgtt cgcggcttac ctcacgaatg agagagggct cgccgcctcg acggtggaaa    278160
     gccacaagct gctctcacgc cgatttctgc aggaggtctg tccggctggc gcagatgggt    278220
     ttgcagcgct caccccggag atcgtcatcg gttatgtcga gcgacatgct ctcgatggct    278280
     ccgccgacag cggcaaggcg atgtgcgggg tggtgcgcgc cttcctgcgc tatttgcatc    278340
     tgaagggctt catttcggtg gccttggccg attgtgtgcc gtcgatccgt cgctggcggc    278400
     ttgctggcct accaaccttc ctgccaccac agaaggttca ggtggttctc gatgcctgcg    278460
     atctgaccac ggcaatgggg cttcgcgact atgcggtttt gatggcgctg gccaagctgg    278520
     gcttgcgcgc cggcgaggtt gccgcgctca gtcttgacga tatcgattgg cagttgggca    278580
     gtgtcctcat ccatggcaag ggacggcggc aagcgatgat gccgctacgc cacgacgtcg    278640
     gtgcagctat cgtcgcctac atccggcatg ggcggccggc ttcaccgtgt cgccggttat    278700
     ttctgcgaat gcttgctccg cacgtcggct ttgcctcagg ctgcgccatc acgatgatcg    278760
     cgaaggaggc cctcgagcgg gcgggtattc acggctatgc gcaccacggc gcgcacctct    278820
     tccgccacag ccttgcgacc gacctgctgc ggtcgggggc cagctttgcc gagatcggcc    278880
     agttgcttcg tcaccggagc atcgacagca caaggatcta tgccaagctc gacatcgaga    278940
     agctgcgcga actgagcctg ccctggccgg gaggtgtcca atgagccgtc ttcgaacagc    279000
     gctcgagcgc tatgtgggca tgcgccaggg attgggatac aagtatcatg gccccgctcg    279060
     acggttgtcg gatttcgtca ccttcatgga ggctcgcggc gccgagaccg tcaccacggc    279120
     gctggcaatg aagtgggtga cgttgatcgg ccaacaaccg agttggtcca tccgcctaac    279180
     cgatgtgcgc tgcttcgctc agcacctcgc tcatttcgac cccatgacgg aagtgccacc    279240
     tcaagacgct gtgtcgccgg cgcggcgtgc aaagccctac atctataacg atgctgagat    279300
     cacggcgctt ctggcggcgg cactgtcgct gccgccggcc aacgccctgc gtcgctggac    279360
     atatcattgt ctgttcggat tgatagcggt cgccgggcta cgccattccg aagcgctcga    279420
     cctgcgccga gacgacgtcg atctcgacca aggtatcctc accattcggg agacgaagtt    279480
     cggcaagtcg cggctggtcc cgctccatgc cacgacggtc gccgtgctgt cggactatgc    279540
     cgcgcgacgc gacgtgcatc tcgtcgcacc tcgtagcccc tatttctttg tcgccgagca    279600
     gggcggcaga ttgctgcacc aatacgtgca ccgggtgttc tggcagctgt cgcgacagat    279660
     cggtctgcgg cagcgggggc agcgcaatgg tccgcggatt cacgatcttc gtcaccgttt    279720
     cgctgtccag gccctgacca actggtatcg tgcgggcgaa gatgtcgagc gggaactgcc    279780
     agtcctctcg acctttctcg gccacgccaa tgttcgcgac acctactggt atctatccgc    279840
     cgcgccggag ctaatgaccc atgccgcgcg actgctggat gagcggtggg aggttcgctc    279900
     atgagtgcct cgaacgatct ggccgtgctg atcgagcggt ggttcaccga tcggctcatg    279960
     cgacatcgag gcgtaagctc caacaccatc gcctcctacc gcgacacctt ccggctcctg    280020
     tttgcattcg cgcagacacg ccttggcagg tctccgtcgc agttgacact gcgggatttg    280080
     gacgcgcctt tcatcggcgc attcctggag gacctcgaga cactgcgatc cgcctcagtg    280140
     aggacccgga acctccgcct cacggccatt cggtctttct tcagatatgc gtcgttcgag    280200
     gagccggccc atagcgccca gattcatcgc gtgctcgcga tcccgagcaa gcgatgcgac    280260
     aagcgacagc ttcagtttct caccaggccc gagattgaag cgatcctggc ctgtccggat    280320
     cgcagcacat ggctgggacg gcgtgatcac actctgctgt tgctggccgc gcaaacgggg    280380
     ttgcgggtct cggagatcat cgatctcgac cggcactcgg tgatgctggg gcacggtgcc    280440
     cacgtgcgat gcgttggcaa gggccgcaag gagcgaagta cgccgctcac caaggttgca    280500
     cagcaagccc ttcggggctg gctcaacgag cccaggaagc ggggtgcaac ggctctcttc    280560
     ccgaacatgc acggcagcaa gctgagcgcc gacggcgtgc aggcgctgct gaacaaatat    280620
     gtcgccaagg ctcgcgaaca ctgcgtcacc ctccgctcga agcgggtgtc gccccatgtt    280680
     ttgaggcaca gcgctgccat ggagctgctg caggcgggcg tcgattgttc ggtcatcgcc    280740
     ctatggctgg gccatgaggc gatggaaacg acgctgacct atcttcacgc acatcttgag    280800
     ctgaaggaat ccgcacttgc caagctgaag ccatacgaac gcgcaaaggc cgaacgattt    280860
     cgaccaaacg accggcttct tgagttcctg aacgcccttt gagcatgaga actatgccga    280920
     gtgtcaacga ccggttcttg gtcgaaatgg cgggcaaagc gcttcatacc gccatgatcg    280980
     gaagaggcgc tcggcatagt tcggcagtcg gcataaaccg ccaagatgaa cctggtcgat    281040
     ccgcacgcct ggctccccca gaccctcgat cgcatcgctg atggctggcc aaacagcggt    281100
     atcgacgccc tcatgccctg gaattgccaa agctgaacgg cctcaactgc ccgcttacgg    281160
     ccgatcacgg cgctcgcctt ccgcgccacg atcgaccggc ctgagcggtt cggctcgtcg    281220
     caggcggtgg gggcgcatct gggactgacg ccggcacgct accagtccgg cgaaaccgac    281280
     atccagggaa aggtcagccg atgcggcgac gaacttgcac gcaccgcgct ttatgaggcg    281340
     gcccacacac tgctggtgcg atcgaagaag tggtcgagcc tcagagcatg gggcatgaac    281400
     atcgccaggc ggcgcggcat ggcacgagcc cgagtcgcgg tcgcccgcaa actggccgtc    281460
     attctgcatg gcatgtgggc cgacgcgacc gagcgctttg gaaagggcga cgcccggatc    281520
     gttccctggg ggacgatggg cgaggcgatc tcgttgagag tcccgaacct gccggcccaa    281580
     gcgcggcaag gtcgtgaaac agattgagac gtcggcggcc caagcgctga ccgcgaaaag    281640
     aagcgagtga cccacggaac ggtcaagaaa aaagtgcagg agcatcttga ccaaacgacc    281700
     ccacagagaa ggctctcaga tttaagtgga cgcttggcga atgaagtatc tggctatgga    281760
     gcagccgtcg acggttgatg cgagaaggcc gtcttcagac aaaagaccag gatatcactt    281820
     gagcgatggc tatgtcggtt tgaatttagt catcgttggt gggttctcaa gtgcatgaga    281880
     agagcttgcg ctccatgcag gttaggcgtt ccgggccttg ttccgtcacc agcacggtct    281940
     cgctaaagcc cataccggct gccatcatca gcatatgaaa taccattccc ggctccagga    282000
     cccattccac gcccggcacg aactcgcgga taaattcgcc ggcggagggg cggtagttga    282060
     gaccaagcga ataaccggaa cggttggtat atgtcttgcg aagccccgtt gccagcagcg    282120
     gctcgcggca agctcggtca atcacgctgg ctggtgtgcc cggccgcatc aacgcgatgg    282180
     catcgtcttg cacgcggatg attgtctcag cgatgtgctg ctgctcagcg ctgggctgcc    282240
     caacaatggc ggtacgcatc aaacgtgccc agtaatgttg atgtagcccg ttgagctcaa    282300
     agtagacagt atcacctcgt tccaagcgac ggtccgaata gccgccatgt atgagatttg    282360
     ttcgattgcc ggaagtgatg acaccgccca gccccatcgc cggcgacccg cctttcacca    282420
     atgcgctcca cacctcattg gcaatctgcc gctccgtgac accgagtgcg atagcctcga    282480
     tgccagcatg catgcctgct tcaaccaagc gcgaggcgcc ccgcagataa tctatttctc    282540
     gcggcgattt tatcaggcgg aggtggtcga caatgcgcgg ctctgcgaca acgcttgcat    282600
     cgcacagcac cctctgcagt accgtccgtc gttccggtgt caagaaccat gagtggtcat    282660
     ccacacctac ccgtccttct gccgagccga ggccttccag agctctgcgc gccgtgtcga    282720
     gccaagcggc gagcggatct gcaacatctg aataggtcgc gtggcttttc acccaggacg    282780
     tactttgcgc cgccgggact tccacatcac gcaagatcag caccgggtcg ccgctgccgg    282840
     gaaccgctaa agcatggtag gaaaaataac caacaccatg tagaccactg agatagtaga    282900
     tgttttcagg ctgatgtagg agtagcactg gaagatcgtg ctttaccatc tcttcctgcg    282960
     tgcgctgcac ccgcgcccga tattcctctg cagggaaatt catctcggtg ttaacaggtt    283020
     cattcagcgt cggagatgta ttcattggag actatctcac ttgttgggct tgccgttcac    283080
     ccgcttggcg gaatatggcc acactgacat agataaaaat cgtgaacgcg atcaatagac    283140
     tggacaccgc agcaatcgtt ggcgtgatct cttcccgaat tcccgaccac attttgatcg    283200
     gcagagtagt agtatctggg ccactcaagt aaagtgatag cacgacctca tcgaacgatg    283260
     ataagaatgc aaaaaatccg gagactatca aagctggacg aataagaggg agcacgattc    283320
     gccatatcgt aacgaccctt gacgctccca aactagcagc cgcatattca agtattatat    283380
     tttgtgattg tagacttgcg gcgacgatca acactactag tggaacggcg cctatgctgt    283440
     gcgccgtcac aagcgcgaac gacgtgttga taagatgcag tcgcgcaaag agaaagtaga    283500
     gagccaccgc attaacaatc gacggcacga tcatcggtgc gagcaagagc tggtatccga    283560
     ttcggcgcat tcgcgggctg ccgcgcacga gtgccattgc agccgctgaa ccaatggcaa    283620
     gacttagaca tgccacagct attccaactc ccaaactctc ccaggtcgca gaaacccacg    283680
     cagcgctagt gaaataggcc tggtaccatt gcagcgacag gccggggggc ggaaagtcga    283740
     ggaagcgcga agagctgaat gagatcggga caatgattag gatcgggctg acaaggaagg    283800
     caacaaggag caagcttaat ccgcgcagca gctttctgcc cggcgccaga cgctcccagc    283860
     ctctaccgat accggcggga aagcggattc catgtccgac gccacgcact aaggcggcaa    283920
     cgaaatcaat gagttgaatg tatgcgctag ttgaatgacg cgcggtgtgg cccgcagagt    283980
     gggcagtact ctgattagaa ctgagcaggc gctcgctatc gacgaaacgg ttggaaatcg    284040
     aataaagtac gagcgtgatc gcaagcagca cggtggcagc ggtggccgca agcggccaat    284100
     tgagcgtgcc gtttacataa ctgtcgattt gcattggcag tatcatcgtg ttcggaccgt    284160
     cgagcagtac gggcgtgatg tagaacccaa gtgcgaacac gaagaccagt aggccggctg    284220
     cgataacacc cggagcgctc aacggaaaga acacgcgcca aaaattttgt gccgcggagg    284280
     ctcctagaga ggcagcagca cgcgtcagac tgtatggaat ccctttcatc acgctaatga    284340
     gcaccagcac cgtatagggc atgaggatgt agaccatagc tacgagtacg ctgaactgat    284400
     tgtagataag gtcgacaggg cgctcagtaa ggccagttgc cattagcagc tgattgatta    284460
     caccaaaacg ccccagaagc accatccatg catatgtgcg cacgaggtag ctggtaaaga    284520
     acggcagaac gaccgcaagc agtagcgccg cggcgaccca agtgcgcgcc gagactatcc    284580
     agtaggctag cggatagcct agtagaaggc agatcaatgt aacctttgtt gcgagtgcga    284640
     aggtgcgggc tagaataatc cagttcgttg ggttatccaa aaactcgtgg taatgcgcga    284700
     aggttggccc gggatcgagc aggctgagag agagcagacc ggaaagcggg atgaagaaga    284760
     aaaccccaag cagaagcgct gctggagcaa gtaagagcga ggcttcccgg ttgttgaccg    284820
     gccatgcgat ggccgatctc acaacatggt atggagtagc cattagctag ccgtccattt    284880
     tatccagcgc tcaacgagaa tttctgtatt agatttgcca gataaatctt tagtttccca    284940
     gtatgacagg tcgcggaaga actgtttagc aatgttctca ggagttgtgg gaaggtctgc    285000
     agcaaccttt gggtcgatgt acttgaaagc cgcacggttc attggaccat agaagatgag    285060
     attgtttaga cgcgcttgcg cctgcgcgga ggcttggtag gccacaaacc gcatggccgc    285120
     ggcccgattt tttgctcccc gcggcacgac ccagtagacc gggctaagct ccccctcatt    285180
     ccattggtaa tcaacggcgg caccctgtgt cttcagggct gccattcgac cattatatgc    285240
     cgaggacatc gagacttcac ggttcgacag gagctgaccg ggttcggctc cgacactcca    285300
     gaatttggtt atgtgcgact tgatgcgatc gagggacgcg aatccggagt cgaagtcgat    285360
     tggatacagc ttgtccttcg gcaccccggc cgccagcaat gcaaattcga ttgtcgtgac    285420
     atccgagttc gaacacgttt taagagagcg tggccccgga aacttgtcgg cgtcccaaaa    285480
     ctcagcccat gagcgcgggc gtggcttgtt cgccgggtat tcggtcgtcg agaacgccat    285540
     aacggtgcta tagacgtacg agcctacgcc gtatgttgtc tttgcttccg gcacaaggtt    285600
     gtccagtgtt tccttatcga aaacgccata gtctatttcc tcgaggtact ttgacgcatc    285660
     cggtcgaaaa gcgaaggtgt cgacctccgc tacatcccac tgcacgttgt tgctgtcgac    285720
     ctgcgccttg agtttcgcgt catcttccgg ggacacgtaa gtcaccgtga tccctgtttc    285780
     ttgctggaag ggatcaatta ttgccttgcg gatcgactcc tcataggatc caccgccgga    285840
     gactacgaca agtttcgatt cttgcgcccg taaaatgcct ggagcgccaa tcgcaagcgc    285900
     cgctccgctg gtcgcagtac caattagctt taacgtctga cgccgggtcg gtcggctggg    285960
     gttgatgttg tacgtcatga gatcattccc ttataaagat acgattgcca tacgatctgc    286020
     agttgcagta acgcccgcga aagctgacac cgcgacgcga ttattgggtt tgccggggat    286080
     tgattgttcc ccctcatcag aaagaagtcg tccatcccgc gcgtcccagc caattctaac    286140
     ttgttggtcg acatggaatc gctgagatcg ggcgtggctc ggtgctgcta aagtgagaaa    286200
     cactggaatc tttgcacgta accgaatacg atacttaatg acatttccct ggtagacggc    286260
     ctcttcgacc acaccttcga attcattatc agtgcgaacg ccggggtcga gagggatgat    286320
     cttgtcgggt cggatcatga gggtcacagc cccctgcagg ctatcggatc cctgccacat    286380
     cgctcgaatt tgcaggccgg ccaggtcaag gagagggccg tcttttctac tttcaacaat    286440
     atgagtgcga aggaaattgg actcgccgat gaaacctgca acgaagcgcg tttgcggagt    286500
     ctcatatatt tcttcaggcg tcccgatttg ctcgacgttg cccttattca tcaccacgat    286560
     tcgatcagac atcgtgagcg cttcactttg atcgtgtgtg acgaagacca cagttattcc    286620
     aagggacttc tgaaggcgct tcagctcaag ctgcatatgc tcgcgaagct gtttgtcaag    286680
     cgcaccaagc ggttcgtcca tgaggactac gcctgggcga aacacaagtg cgcgagccaa    286740
     ggcaactcgc tgctgttggc cgccggataa ctcgtgcggc atccgcgctt catagccgct    286800
     cagttgaaca agatcgagcg cttcggcgac accggctcga agttcagagc cggatactct    286860
     gcgcatcttg agcgcaaatg ccacgttctc gaaaacggat agatgtggaa atagcgcata    286920
     attctggaat acaactccga tgttgcgtct aggcacgggt agcccggtta ttggtcgggc    286980
     gccgacaaag atttggccgg aggtgggcgt ttcgaacccc gcgaccatca tcaacgttgt    287040
     cgtcttgccg gaaccacttg gtccgagaaa tgagacaaat tcgccggcct cgatttgaac    287100
     cgacaagtca ttaacccctc gcacgctgcc gtactgttta caaagtcgct ctaaccgcag    287160
     cggttcacct ctgggcatcg acgcctccac gtgaggctaa tggatgtgaa tgagacgtca    287220
     tgtcccagtt ctcctctttt aggctatcgg cgcggttgat ccgcactcct tcggcgatca    287280
     cgagcgaaag tatcggtgat cattttccac aacatcaacc tgcattaagc atcctctccg    287340
     aggcgaaatg gcgtcaatgt gggcggcctg ttgaagaaaa attcgcaaaa gagcgttgtg    287400
     attgaaattt cttagagtcc gtttggaaat tcatggatga gcggttcttc gtagcaggtt    287460
     gccgcccatg gcgacgagga tcatggcgtg agagacatcg atgcgctgct cgtacgaggc    287520
     gtcgccatcg ggtcatccag ccgaaggtgc gctcgacgac ccagcgacgg ggcagagcgt    287580
     ggaagccctt ctggtcgtcg gatcggcgga tgatgtcgat gacgaagtcg agataggcgg    287640
     ccttgtccat gagcttgagc cgatcgtagg cgccgtcggc gaacagatgc ttcacccagg    287700
     gccagcgctt gcggatgccg tcgagaacgg cctgcgcgcc ggcgctgtcg gagatgtcgg    287760
     ctggcgtcag gttgaccatc aagagccgcc cgtcggtatc gactgcaatg tggcgcttgc    287820
     ggccgacgat cttcttgccg gcgtcatagc ctctttgcgc gccaggggcc gaagccttca    287880
     ccgactggct gtcgatcacg cccgccgtgg gactggcctc gcgcccagcc cgttcgcgat    287940
     ccagcatcag cgtcacgtcg tggatggtct ggaacagaaa gcgccgcgcc agttcacgga    288000
     accagccata gaccgtctgc caaggcccga agtggatcgg cagcatccgc cagccgcaac    288060
     cggagcggac caggtagcgc acggcgttga tcacctcccg gaaatcagcc tcgcgcggac    288120
     ggccccgacg ccgcccgggc ttgggcatca gcggggcgat ctggtaccat tcttcgtccg    288180
     tcaaatcaga cgggtaacgc ttggtcttct tggcgatctg ggccatccgc ccacggctct    288240
     gtttggtcca catccacagc ttgaatcaca aatagcctca ccgcaaaacc ccaaccctcg    288300
     attttccaaa cggcctctta gccgtcggag gcctacacgc agcaggtcat actcgatcgt    288360
     atagacacgc ccctagcaat ggaacccagc aagtcggcga accaaggcat tcagaggctc    288420
     ggtgaccgcg ttttggccac cagcgcctcg ttgtacatag gcgtcacccc tttgacccaa    288480
     gacttgtcaa ctctctcacg atggtagatc acatttgcaa gcttatggag agtatgggga    288540
     tagatcgcgc ctcttgctaa aacgcgcaaa gtgtatcccg gcaaattcct gtataatatg    288600
     gaccgactga gcgctgcaat ggcatacgtg aatttgaagt taattcgctc tggtattatt    288660
     cgtggaacag cacggcgcgg agctgagcca aaaactctgt cgaaaacttt ccaccgcctc    288720
     taagcacgac gctaaaaata caatgaagta ccgtcattac ttcctctgcc ttaagtaggg    288780
     aaaatgatcg gaagtgcgtc agctttttcg attggcgcag ataggggagc cggacaaaag    288840
     taacctcctg ccctcccttg ttcttgttta cattgctaac gatacctatg accggtcgca    288900
     tgagtttagc catcttctgg gatttcaggt gcacgagaag agcttgcgct ccatgcaggt    288960
     taggcgttcc gggccttgtt ccgtcaccag caccatgtcg ctgaagccca tcccgcctgc    289020
     catcatcagc atatcaaaca ccattcccgg ctccaggacc cattccacgc ccggcacgaa    289080
     ctcgcggata aattcgccgg cggaggggcg gtagttgaga ccaagcgaat agccggaacg    289140
     gttggtatat gtcttgcgca gccccgttgc cagcagcggc tcgcggcaag ctcggtcaat    289200
     cacactggct ggtgtgcccg gccgcatcaa cgcgatggca tcgtcttgca cgcggatgat    289260
     tgtctcagcg atgtgctgct gctcagcgct gggcagccca acaatggcgg tacgcatcaa    289320
     acgtgcccag taatgtcgat gaatcccgct gagctcaaga tagaccgtat cgccacgctc    289380
     caattgccgg tcggtatagg atccgtgtaa aagatttgtc cgattgccgg aagtgatgac    289440
     accgctaagc ggcatttccg ccccggcgtt caccaatgcg ccgaacacgg tgccggcgag    289500
     ctgtcgctcc gtgatgcccg gcgtgacagc ctcgatacca gcgtaaatgc ccgcttcaac    289560
     gcaacgggca gcgccgcgca gataatctat ttcccgcggc gatttgatca gtcgcagatg    289620
     gtcgacgatg cgcggctctc tgacaaaagt cgcatttggc agcagcgcct gcagcatctt    289680
     ccaccgttct agtgtcaaga accatgagtg ctcatccacg ccgacacgcc cggccgccaa    289740
     gcccaagccc tcgagggctc tccgcgccgc gtcgagtgaa acgcggatcg gatcggatga    289800
     atctgcgtag ctcgtgtggc tcgtgaccca agacgtgagg tacgctgctg ggatttctac    289860
     atcgcgcaag atcagcactg gatcgcgatg gctcggaacc gctacggcgt gatatgagaa    289920
     aaagcccgcc ccagcgtcga gacctgtcag atattgaatg ttctcgggct gatgcaggag    289980
     taacacgtcc agatcatgct ttgccatttc ctcctgcgtg cgttgaaggc gtgtcttata    290040
     ttcttcaaca gggaaatcca tcccgctatt cgtatgctcg gtcaccgtcg tgggctcctt    290100
     cgttgtcgcc ccacctctag atgtgcgtac cttctgcatt cgcctgggtg aaacaaatct    290160
     cttggccaag gatagcaatt gggcaagtgg taccatccgg aggagaggac tttgcgccaa    290220
     aatgagtcag cagctgaaac gtgagccgcg caagggtgct cggtttgaca tgcaatcttc    290280
     cgttggcctc cgttcgacga cccgttaggg attcatccaa atcaacgggc tgtatgtaag    290340
     cgaggatcta ctgctcgtca tcgcgatcgg catgaagggg cggaataaga gcagttcgaa    290400
     atcgtacgag gcctttatca accaaagaca gctacggcgg atttgacgat gatgcagcca    290460
     tactggcttt ggcgcatctg acgacctatg gctgtgcgaa aaacattcgt caagtgcagc    290520
     gcaggcgtca cgcgcggcga cagggtacgc acgctctccc ggccatgcct ggttttgcga    290580
     atgacgtttc ctgtgacgac gcgctgcgac catcggaagt cgatctcgtg gaaatacagg    290640
     tcggcatgct gcgggctgat atgatgaaag acgccggcga tggtacgggg gacgcggagt    290700
     tgaagccctc gaccgagttg acgtggacag cgtcgcgaac agctggtctc atgcttggca    290760
     aagctctcac caatggccat gaatgccttc cactcgtcgc tcatcaagtg agctccgggt    290820
     tcaatctgcg cctcaacgac gcgttcgctt gctcgcgccg aaagaccggt cacaaccgcc    290880
     gcacgcgcat caccggccag cgtgccacgc attacatcag tcggacgccg caccattgcc    290940
     ataactgacg ttttgtgcgt attcgcctgg cctttccagc cgcggcccgg aggtgggtcg    291000
     tcgggattct ttctgggcct ttcaccgaga tggaaatggt cgatctccac cgtgccggcg    291060
     agcacgttct cccgcgccac caataagacg cagtgcatgt ccaattcgcc agatgctggc    291120
     tggctcaccc cgagcgcctc ggctggacgc acccacgaca agcccttgtc ggatggcagt    291180
     aacagccaca tagccttcag gcaaacactc aagggaagct tcgtggagtg cagaggcgta    291240
     tgtgtcgtca ccgtgaactg gaaccggcaa tcgccgctgg aacattgata acgacccggt    291300
     cgggcacgcc gcttgccggt atcgcgaccg gcaagtgcaa tcgagcgttt gtatccgcag    291360
     gcggagcaga tccggccatc cggccgaacc agcaaccgac ggctatgctg ctatccggaa    291420
     ggccgcgatc atttcttcaa cagttcgaat gctggaaagc gtgacaatgt tcttcatcag    291480
     ccatgcagca gccacgcctg aaccagggta ccaaggttcg aaataagtgc agctgaccac    291540
     tagcaacgga acgacttatg taaaacggta acgggtggag atgttctcct cgacattgtc    291600
     agagcttctc gatcgattgc gggctggatt tcacgagtta ttcaaatggc cctcgccatt    291660
     caagccaagc cgccaaactt gcgcacccgc taacaccaga agcgggatcc gtcatggcta    291720
     gggtcaggat ctgtaatttg cagagcttgg cggtgtatcc cttgagggtt tcaaggatct    291780
     gtccgcactg gccgagccgg agctggtcgt gctgtatcgg gtctcacaag gccggacgtt    291840
     gcattgactc gaagcgggct gtcaggccca tctgactacc ttcgcatatc gtccgtccct    291900
     gcgttccctc gcgggacacc gccctcggat cagcgctggc gcttcaccgc tggcaaactg    291960
     tttctacctc atctcaagcc tcgaacaaag tgccgtcgcg cagcatggca tgcatgatga    292020
     cagcgagacg ccgcgcgagt gccactcggg ctttcttcag gccgcggcgc ttcgagattt    292080
     tcagcgccca ggtcttgagc gcgaagctct cccggctccg agtcaggatt gagttggccg    292140
     cttcatagag aagcttgcgg accatgctgt caccttgctt ggtgatccgg ccggtccagt    292200
     cgagttcgcc agattgacga cgcctgggca ccagaccaaa gtaggcgccc gcgtttcgcg    292260
     attgtcggaa ccgaccgcct cgtcgatggc ggcggagaac gcggctgaag tctggatgcc    292320
     aacaccaggt atactcataa ggatttggca ggcctgcgac tgagcggcga gcatacgcag    292380
     cttgagatcc agctccttga tctgctcgac cagttgcacg cgcaccgtca gcaacgaagt    292440
     aatcgcttcg ccaagaccag ggatgtggga tgcttccatg atgcgttcga tgaaggcctt    292500
     tccctgcccg acgcccggcc tatagccgaa ggtagcgcac aaccaacgga tcatgttgtc    292560
     gagccggaca cgggcctcca ccagatgacc gcgagcgatg atcatgctgc gtataccgtg    292620
     tgcgcccggc gatttgacat gaacctcctt gtagaagccc gttcttgcca gttgcgcgag    292680
     ccctgcagca tcatgcggat cggtcttgtt cgccttcatc gcctcgaggc tctggtgcgc    292740
     ctggcgggca tcgatacaca ccacgttgac gcccaactcc cgcaggccaa ggcagatcgc    292800
     gggtgacata cgtccggttt cgatcaccgc ccgctcgatc gggccgtgtc ggcgtaatgc    292860
     gtcggcgatc gcatccggcg tgctctcagc gttctcggaa ctcagcttgc gcccattttc    292920
     atcgataatg cagacctgcg tgctttccat cgacaggtcc agtccggcat aatgcttcat    292980
     ggctgtttcc ttccttcagg attcgacaac cagaagtgtg cgcctcaccc gagtcccgag    293040
     ggaagcaacc acaaattaca cgatgactca taagcgcgca gccacaggcg tattgacgcg    293100
     agctggacca tggggaggaa gttgtcggcg agcttttcat agcgggttga gacgcgacgg    293160
     aagtgcctca acttggagaa gaagcgttcg atcaggttgc gctcgcggta gagccgtttg    293220
     ctgaagcagg gcttccattt ccggttactc ttggccggga tgttgggcgt ggcaccctgc    293280
     ccctggatca gtgcccggat gcggtcggcg tcgtaggctt tgtcggccag cacgatggtg    293340
     cgtgggccaa gatgatcgag aagccgatca gcgatctgac cgtcatgtgc ctgtcctgct    293400
     gtcagaccga gccggattgg gagcccttgc gcgtcgtcga cgacgtggat cttggtcgtg    293460
     agcccactgc gcgattgacc gagacaatga tctggccccc cttttttgcc gtcgcagcct    293520
     gctggtgcgc ccggatggaa gtgctgtcga tcatctgtat ggcgccgtcg tgggcggcgc    293580
     tgatggcgtc catcaggcgg tcccatacgc ctgccttccg ccatcgcgca aaccggttgt    293640
     agcaggtggt ccgcggaccg tagcgttccg gcaggtctcg ccatggggca ccggatcgca    293700
     agacccagaa aatgccgttc agcacgtggc ggtcatcgac gcgcggcatc cctcccggct    293760
     tgttgggcaa gagcggctcg ataacgcgcc actcgaagtc ggtcaaatca tatcggctca    293820
     tagagagtct gaatcagaat tcgcggagat atgaaagtgg accgtcggaa aacggcttaa    293880
     ccgcaaatat tgacggatcg cttggcaacg ctgcatcctt ggcaccatgc taatcgcaga    293940
     cgctgaagcc aggatccgtg agatcataat ttccatctcc gcaggggact gccagagtgc    294000
     agtcaccaaa gcggatgtgt cgcactgttc ggcggccgac gtcgatcgcg ttatatcgga    294060
     ttatggacga acattctctg cgccgccgtt tgccgtttgg atgtaatagc tgtcaacaca    294120
     gcggtcggcg aagaagtggt cagtccgagc gccgctttgg agccaaaacg aaggtggtcg    294180
     atccgatttg gagcttcgtc tcaccgtgac aatgatcaac ggtgtggcga cggttgagct    294240
     aaagcgtgtc gcgattaatt ggcctcatat ccggcagctt tgaagaagtt tctgcattcg    294300
     gctggctgga acagatggca gatatcgccg agagcctcgc agagggcatc gaagcttctg    294360
     gccgccttct ttcgcagcct cgccttgagt tttgaatagg ccatctcgat cgggttgagg    294420
     tctggcgagt atggcggcag gaacaggagc catgcgcccc tttggcgaac cagttgcgcg    294480
     gcgcgctcgt tcttgtggaa gccgacattg tcgagaatga cgacatcgcc gggcgacagt    294540
     tcgggagcga gctgagtttc gacgtagcgt tcgaagatgg cggcattcat cggcgcgttg    294600
     acgatccatg gcgcgacaag accgtggcat cgcagcccgg cgatgaaggt ttgcgtctgc    294660
     catttgccga atggcgcatg cgtcctgaag cgctcgccct tcggcgccca gccggtgcgg    294720
     gcgcaggtta atcagattgt tcacaaagcg aggcgaaacg cggaaatgac gcgcggcctc    294780
     gcggtggcca tgtccctcat cgacatacgc aacaacacgc cgacgcaact caagcggtag    294840
     cggcttgctt tagacgacat acttgtagct tgatcgcagt tcgccaagca tcgcggtcat    294900
     ccccaattta tgagttcacg acctaattga gaactgctga cgaaagctcg ttgcagcttg    294960
     ctggtaattg tatggtgttg agcagaaaac gtgagccgcg gttattcaga aatcggcgtt    295020
     aagatgagct atctcgtccc acagactttg accaaagccg cgaagcacaa tcagctcaaa    295080
     acgattcaaa gcgacgcgcg tgatgtgcac ggaaatgtgt cccatcagcg tcatcgcgga    295140
     ctgtcccacg gccacggcgt taagatcgat agcggtacct tttgccagca gcgattggac    295200
     agcgcggccc gcgacttcaa tcctgatgcg tccatgggtc tggtcgaccg caaatgcccg    295260
     tgtgtcgagt ctttcgaaga gggcctgcat atctgagcgg gatgtcggct catccctgac    295320
     gaccagccat tggccggggc cgaaggtgcg gatcctgttg gcctcgccgc cgaacaggcc    295380
     ttgcagcgtg gccgtaagat tctctgcgcc gggcttgccg agtatgtgga tcagggtgcc    295440
     ctcgggcatc gccttcatag cgaaggcgtc ggagctccct accggtttgg tgctgatcgc    295500
     cggacggtgg atgagttcga aatcagacat ggagcttctc gtttgctgga tcgaagaaga    295560
     ccggattgca aagacgtgcg acggtaaatt ccttgctcag gccgttccac accaccacct    295620
     cttcgccatg cctggcatgg ccactcttca ccagcgccaa cccgatagtc gagccgacgt    295680
     ggggtgaaaa ggcactcgac gagacatagc cctggtcgtt ctcgagcgtc tgcgcggccc    295740
     ccttggcgag aatgtgcgag ccggtgcgga atgtggtcgt tggatcgagc gggacgacgc    295800
     cgacaaggct cgggcgatcc tgggccacca gtccctcgcg gccgagcatc gccttgccga    295860
     tgaaatccgg cttggctgtc gacaccatct ttgcgaaacc gagatccgag gggatcacag    295920
     taccgttgat ctcgttatgc gtcacatggc ccttctcgat gcgcagtacg ctgagcgcct    295980
     ccacgccata aggctggatg ccatgttcct tgcctgcctg gagaacgccg tcggcgacgc    296040
     tctcgcaata gccggccggc acggcaagct cataagccag ttcgcccgag aacgagatac    296100
     gaaacaggcg gccatgcagc cggccgccga agagcgagac ctcctttgcg gcaagaaagg    296160
     ggaaggcagt gtcggaaata tcaccatcga cgatcgcctg cagcgtcgcg cgcgccttgg    296220
     gcccgaccac ggacatctgt ccccattggt ccgtcaccga ggcgagtcgt acgtcgagct    296280
     ccggccacag cccctgggcg cagaattcga gatgcgtcat gacgccggcg gcataggccg    296340
     tggtcgtggt catgaagaag cggtcgtcag ccaggcggct cgtcgtgccg tcatcataga    296400
     tgaagccgtc ctcgcgcagc atcagaccat agcgcgcctt gccgactggc agtttcagga    296460
     aggcgttcga atagacccga ttgaggaact ccgccgcatc cttgccgcag acctcgatct    296520
     tgccgagcat cgacacatca caaatcccga cattcgttcg aacgttcagg acctcgcgat    296580
     cgacgctctg tcgccagctg gtttcacccg cgcgcgggaa ccaggatgag cgataccaga    296640
     gaccggtctc gacgaagacc gcgccgtgct tcttggccca gtcatgcaga ggcgacttgc    296700
     gcaccggctg gaaatgatgg ccgtgatgcg ggccggtcag cgcgccgaag ctgatcggcg    296760
     tatagaaggg ccggaaggtc gtcgtgccga cttcggcggg agagacgcca cgcgcttcgg    296820
     ccagcaggcc aattgcggtg acattggaga gcttgccctg gtcagtggcc atgcccgatg    296880
     tcgtgtagcg cttggcaagt tcgacatcgc catagccttc ctgcacggca aggccgagat    296940
     ccttgcggcc gacatcgttc tggaagtcga cgaaggcctt gcccttcacg ccacggatat    297000
     tccagagcgg gctggccggc gaagcaacga tgtcgccatc gacaggaccg gcgtcgaatg    297060
     gttgggcggc gaacccgaga tcttgggcca tggtagcgcc gcgcgcagcg ccctctgcaa    297120
     agcttgccga caatccggtt gtgcccgtga ctgcgcctgc gagcacgagg cccctggttt    297180
     ccgacggggc catgaaggcg ccatgcacat ccgaccattg cggcttgccg ccgcgatggc    297240
     aggcaaggtg aataatcggg ctgaagccgc cggacatggc gagcgcatcc acagcaatgg    297300
     cttcggtcgc gccgtttgcg gccgtgacgt tgacgctgga gagcgctttg ccgcccttgg    297360
     catcagacac gacggcgccc ttgagaaggc gagccttgcc ggtatacacg aactgggatt    297420
     cggcgcggct gtcgatgatt gcggtaagct ggacacccgc cgcctcgagg tcgcgggcga    297480
     gtgcatatcc gctgtcattg gtggtgaaga tggcggtgcg ctggccgggg gccacggcaa    297540
     agcggttgag atagcagcgc atcgcacccg cgatcatcac accgggaata tcgttgccgc    297600
     cgaacacgag cggccgctcc tcggtaccgg tggcgagaag cgcctttttg gcgacgatgc    297660
     gccacatgcg ctcgaccggc ttgttcggat cggggtggcg cacatgcttc tgggcgcgct    297720
     ccacagcgcc aacgacattg ccgtcatacc agccgaaagc ggttgtgcgg gtcagtacgc    297780
     gtacattcgg cagcgtttcc agctcgtcgg cgagccgctt ggcaaatgcc ggcgcgcttt    297840
     ccccgccgat ggtcgcggcc tccgacagca acgatccgcc cgccaggctg tgttcgtcga    297900
     ggatgatgac acgtgcccct gcacggccgg cggacagcgc ggcggccagc ccggctgggc    297960
     cggcgccgat caccagcagg tcgcaatgcg cccagcgctt ctcgtagcgg tcgggatcgg    298020
     cttcgtaggt cgccttgccg agaccggcgg cgcggcggat aaagggctcg tagagacctt    298080
     cccagagctt cgccggccac atgaaggtct tgtagtagaa gcccgcggcg aggaagggtg    298140
     agagcaggcc gttcagcgaa ccgatatcga aatcgagcga aggccagcgg ttctggctgc    298200
     gggcttcgag accgtcgtaa aggtcctgca tcgtagcccg ggtattggcc tccgtgcgcc    298260
     ctccgctgcc gatggtcatc aatgcattcg gttccgccgc gcccgcggtt aggatgccgc    298320
     gcggccgatg gtatttaaag ctgcggccca ctagctggcg gccattggcg agcaaggcgg    298380
     aggccagcgt atcgccggca tggcccgtga ccgactggcc gtcgaagctg aagccgaggc    298440
     gtgactggcg atcgatcagg ccacccttgg gcagtcgata ggaggtcatc agagcgcctc    298500
     cgccgatagc ttgagtacca cgtcgcggga gcccgagatt tcatgcgttg ccgtattgcg    298560
     gctcaccacc agccagcgcc ggcagccgga cgtatgatgc caatattcct cataggcgcc    298620
     gcgcggattg tcgcgcagat agacatagtc gatccacgcc gccgtgccgg catcaggtgc    298680
     gggtcgggcg agtgccgccc ccttcacagt gaactcttct ttcggtcgag agccgcaatg    298740
     gggacacggg atcaggcttg ccatgttcag gtaccctgca aattagtgga ggttgggctg    298800
     ggcgccctgg cccttttcgt cgaggatatg gccgcgcgcg aaacggtcga gccggaaggc    298860
     gcgagcggtc tcgtgcggcg tgccgcgtgc gatgagatgc gcaaagcaga ggcccgatgc    298920
     gggggttgcc ttaaagccgc cgtagcacca gccggcattg aggtagagat tgttgatgtg    298980
     ggtgcggtcg atgatcggcg agccgtccat cgacatgtcc atgattccgc cccaggaccg    299040
     cagcacgcgg acgcgggaaa tgccggggat catcgcctta cccgcctcgg cgacatgctc    299100
     gacggtggcg agattgccgc gttgggcata ggaattgtag ccatcgatgt ctccgccgaa    299160
     gacgagcccg cccttgtcgg actgcgagac gtagaaatgg cccgcgccga aagtcacgac    299220
     gcaatcgatg aagggcttca ggccctcgga gacgaaggcc tgcagcacat ggctttccag    299280
     cggcagcttg atatcggcca tctcggcaac gcgcgaggaa ttgccggcgg ccgcaagcgc    299340
     cagcttgccg cagccgatga agccgcgcgt ggtctcgacg ccgaggacct tgccgttttc    299400
     gcggcgaatg ccggtcactt cgcaatgctg gatgatgtcg acgccgcgca tgtcggcgcc    299460
     gcgcgcatag ccccaggcca ccgcgtcatg ccgcacagta ccgccgcgcc tctgcagcag    299520
     accgccctgg atcgggaagc gtgcattgtc gaaatcgagg aatggcagct tggcgcgcac    299580
     cgcctcgcgg tcgagcagtt ccgcatcgac gccatgcagc agcatcgcat tgccgcgccg    299640
     cgtataggcg tcgcgttgcg cgtcggaatg atagagattc agtacgccgc gctgagagac    299700
     catcgcgttg aaattgaaat cctgctccag tccttcccag agtttcatcg acaattcgta    299760
     gaaggggttg ttgcccggca gcaggtagtt ggagcggatg atcgtcgtgt tgcggccgac    299820
     gtttccgctg ccgatgtagc ttttttccag cactgcgaca ttggcgacgc caaattcctt    299880
     agcgagataa taggccgtcg ataggccatg cccgccaccg ccaacgataa tcacgtcgta    299940
     gtgggatttg ggctgcggcg cgcgccaggc cggaccccag ccggtattgc cgcgaaggcc    300000
     gttgagaaaa atcgagagag cggagtatcg catcgctggc catgtccaag ctggggagtc    300060
     ggtgcaacct atgcccgtcg acaacaattt agttccaaaa atgggacgat tagttatata    300120
     gatcggacat gacggttgaa ttggatcgac aaactcagcg gtttggtttt ctcctgctac    300180
     cgaatttcgc gctcatgtcc tacgcatcgg cgaccgaacc cttacgcgcc gccaatctgc    300240
     tcgcgggccg cagcctttac actatcaggc agctttcgca gggtggcctg cctgtgcaga    300300
     gctccggcgg catcgacatt gcctgcgatg atctctcgtc cgcgggtgcg gaatttcata    300360
     cagtgttcat ctgtgcgggc ggcgatccaa gcaactgggc ggaagcggac aggctgttca    300420
     gggcgttgcg gcggctgtct cgtctcggcg tccgtctcgg cgcgatctcg agcggcgcgt    300480
     atatcctggc cgccgccggt ctgctcgaca acagggactt caccattcat tgggagcatg    300540
     ccccgatctt gcgcgaggcc tatccggctc tagcgcttag gcaagcccgc tacgtcatcg    300600
     acggcgatcg tataacctgt ggcggcggcg tggctccgct cgacatgatg catgcgctga    300660
     tcgccgaacg catgggcgcg catttcgcga gccgcgtcag cgactggtac cttcacactg    300720
     cgattgccga cccatccgac ccgcaacgcg gttctgcggc tgagcgattt ggcactcaca    300780
     atccgatcct gctggccgcg cttgaaaaga tggaagcgac gatcgaaaat ccgctcgatc    300840
     gcgaagcaat ggcgcatttc ctctcgatca gctcccgcca tctggatcgc ctcttcaccc    300900
     agcatctgag cgccggcttc ttgcaaacct accgccggat ccggctggat cacgcgcggc    300960
     ggctgatcga acagagcccg cttgcgatcg ccgaaattgc ctttgccacc gggttctcca    301020
     gcaccggaca cttttcccag gcattcaagg cccattacgg cagggctcct agctctttgc    301080
     gataaactcc tccgaatgca caggtctcct tcggaataga tgcatcgcct cgccacgaac    301140
     tgtcggcctg cttgcgaacg gggcgcgtgt tgcgggtccc cagggcacgg gtacgcaggc    301200
     gaggcaagag ctttgtctcg ccggagatca tgattagtca acgccccgcc gaagcggccg    301260
     atcgcggagt gccgggccac tgggagcgag acctcatcct tggtcttggc agctcggcga    301320
     tcggcacgct ggttgagcgt acgacacgct tcacgatgtt gccgcatctt ccgcggcttg    301380
     cggggcatgg cgaagctccg cgcatgaaga atggccctgc tctcgcggga cacggggccg    301440
     aagccgtgcg cgacgcgatt acgcgcacca tcatcacctt gcccgaagag atgcgtcgtt    301500
     cgctgacctg gatcagggag ccgaaatggc tcagcacgat cgtctcaaga tcgacgcggg    301560
     tgtccaagtc tatttctgcg atccgcaaag cccctggcag cgtggcacca acgagaacac    301620
     caatgggctg ctgcgtcagt acttcccgaa aggcaccgac ctgagcgtcc acagcgccga    301680
     cgagatcgcc gccgtggccg cggccctcaa tgctcgaccg agaaaaactt tgggttggaa    301740
     aacgccagca gagacgcttg acgagttgct gtcatgagtg aacacaatcg gtgttgcgac    301800
     gatcgcttga atccgcccaa tacgcctgcg gggcctactc cgaacttctg catcgtcacg    301860
     gtatccaggc gagcatgaga cgctcaaacc gaccgaggaa atcgctgtcg ggtgagatac    301920
     tgcgcagatc gcgccttgca aaaggacatc agagcgatgc gccacggcac cttgcaatag    301980
     ctcgatgaac atggagctta cgcgcaatga cattggaaca tgcagacggc gatgtggtcc    302040
     ccgagagcag cggcgctgcg gcgtgcgacg acggtgtaac gatgcccggc cgcgcggcaa    302100
     caaatgcatt agctcgggtg aggtggatta cgaaggccat atctcccgcc gtggaaatac    302160
     acacatgtgc gttcacttct ctatgaaggc tgcagttgtg agcctgactg ggaaaagatc    302220
     ggcttcagag gtaccgccgt cgctgtcgcc ccctaactcg ctgtggcatg cgatgcttcg    302280
     atccgccgaa ttccttgagg cgacagccat cagctatcgt tcgagctctg cagcacccat    302340
     accgtgcgga tacgtccctg ccggggccga agctggttca ttccgttaag acggttgcgc    302400
     cacgaattta cctggaacgt gcgagacata caccggaagg acttccccac gaagtgacct    302460
     gccactgagt ttttcctcca cttggagtta gagtccggcc tcatttgaag gacggacaga    302520
     tgaagcggaa gcggttcacg gaagaacaga tcattgcggt tctgcgcgag cacgaggcgg    302580
     gtgcgaaggc gggcgatctt gcgcgcaagc acgcgatcag cgaggcgacg ctgtataact    302640
     ggaaggcgaa gtatggcggg atggacgtgt ccgacgccaa gcgcctgaag gccctggaag    302700
     acgagaacgc gaagctgaag aagctgctcg ccgaccagat gctggaggcg gcggcgctga    302760
     aggagctcct gtcaaaaaaa tggtagggcc cgccgccagg cgcgaagccg tcgcgcatct    302820
     gcaggccgtc atgggtctgt cggaacgccg ggcctgttcc atcgtcggcg ccgatcggaa    302880
     gatggtgcgc taccggtcct gccggccgcc ggagacagag ctgcgcggca ggcttcgcga    302940
     gctcgccaac gaacgccgcc gcttgggcta tcggcggctg ttcattctgc tccggcggga    303000
     gggcgaggca tcaggggtca accgcatcta ccggctctac cgcgaggagg gactgacggt    303060
     gcgcaagcgc cgggcacggc gacgagcggt cggaacgcgg gcaccgatcc tggtcgaggc    303120
     gaggccgaat gcccgctggt cgctggactt cgtgcatgat cagttcgcct gcggcaggcg    303180
     gttccgggtg atgaacatag ttgatgacgt gacccgggag tgcctggccg cgatccccga    303240
     cacctcgatc tccggtcgcc gagtggcacg cgagctgacc gatctgatca gccttcgcgg    303300
     caagcccgac atgatcgttt ccgaccatgg caccgagttc acctcgaacg ccatcctggc    303360
     ctggtcgaag gatcaccgtg tcgaatggca ttacatcgcg ccgggaaagc cgatgcagaa    303420
     cggctacatc gagagcttca acggccggat gcgcgatgag ctcctgaacg agagcctgtt    303480
     ctttggcctc gatcacgccc gctgcgccat aaccgaatgg gtggaggact acaacaccgc    303540
     gaggcctcac tcctcgctcg gctaccagac cccggcggcg ttcgccgagg tcctcaccgc    303600
     aaccggctcc aacgctgcgc tcgatgtggg cttcgcgtct ccgccggttg ctcaacccgc    303660
     gccctacggc gtaactgaaa cggtcgaggc tctaatcgcc gctggatgac agttcagggg    303720
     caggtcagaa gcagcacgtg gccatgttcg cggcaatcag ccaaccgtag ctaaaaggcg    303780
     cctgctcaat cagctccgat atgtcctacc ttaagaaata ctatctaatg cgacaagatc    303840
     tggctaagga acagcctggt ccgttcatgg tgggggttgg tgaagaagtc gttcggattg    303900
     gcctcctcaa caatccggcc tttatccata aagataatcc tatcggcgac ggcacgtgca    303960
     aagcccatct cgtgggtaac gcagaccatg gtcatgccat cgcgtgccaa gctcgtcatg    304020
     gtttccaaca cttccgacac catctcagga tcaagtgccg atgtaggttc atcgaataac    304080
     atgaccgcgg gctccatgca cagcgagcgg gcaatggcca cgcgctgctg ctgtccgccc    304140
     gagagttgaa ccgggtattt atttgcctgt tctggaattc gcacgcgttc gagatatttt    304200
     agcgcagtct gtttagcttg ggcttcgggt acccccttga tccacattgg gcccgccatg    304260
     cagttcatca gcacagtcat gtgagggaac agattgaaat gctggaatac cattcctacg    304320
     ttcttgcgaa cttcggtcac attccgcatc ttgttgtgca atagcatccc attcaccctg    304380
     atctcgccct cctgattcgc ttcgagccgg ttgaagcagc ggatcaaggt ggacttgccc    304440
     gagccggagg gaccacagat gacgatgcgt tcgcctttgc ggacggtaag gttgacatca    304500
     gttaatgctc tgaagctgcc gtaccattta gagacgtgcg tcgcttcgat aattttgtca    304560
     gcactcattg gcacctgctt ctggccggat aacgcctgcg atgatactgg tatgcgccgc    304620
     acattgcctg tcgccatcga ggaatcgcct ccattgaggc ctatcaaatg atctatgtcg    304680
     gtagcggtca tcgcacttta ctccttgcga agtggtgctc aagccgtgat tggagcacct    304740
     cgaggcaggc ggacaggatc caatagatca tcgccgctgt tatcagcatc tccatatgat    304800
     gaaaggtcgg ctggccgatc gtgcgagcaa ggaatgtcaa ctcccatacg ccgaggaccg    304860
     agacaagcga gctgtctttc agcattgcaa tgaacgtgtt gcccatgggg ggaatgatga    304920
     ctggaagcgc ctgcggcagg attatcttgc gtatggtaag gccgaagcca aagccgatcg    304980
     aacgggatgc ttcccattgg ccgcggtcaa tgctctggat acccgcgcgg aagatttccg    305040
     tcatataagc tcctacgcaa agcgacagtg ccaatatacc cgaaggaact gcattgatca    305100
     cgatacccag ctgcggcagc cccaggtaaa tcaggtaaat ctggataaga agcggcagac    305160
     cgcggaaaaa cgaggtgtaa aagctggcga gggcataggc gaagccattg cttgaaagct    305220
     ttgcaatagc agcgatcatc gcgatgattg atgcgaaaat aagtgaaact gccgaaacat    305280
     aaatcgtggt caccacaccc tgcgtgatca ggtatggcag atgctcccag atgaacggca    305340
     tgttaaggtt aaatgcgttg aagaagccga gaaacagcag cagcagctcg gcccatacaa    305400
     tgccgatctg caccctcaag ggggcaaacc cgatcagcac gatgttgacg cagaacatca    305460
     ccgcaatgac gaaggcgatt gcgacacgcc cataaatgcc gctctgcagc gggtcgccga    305520
     taacaggccg cataaggtcg ccgaacgctg tgcccgaaag gttgaacatc agagaaactg    305580
     cgagcacggc ggcgaagatc gacgcaacaa accaaggtcg atggactagt acctcggaat    305640
     caacagtatc ttggtaaagc aagagagatc ctccaaccag gcggctcggt ttgacccgag    305700
     ccgcacaatg ttcacgaagc tacttacttc gcgacagagt ggtccgatcc ataccacttc    305760
     actgatagct tcgacagtgt cccgtcatcc ctcatgcttt tgatcgcggc agagaccttt    305820
     tctaccagtt ctttatcgcc cttcatcatc gggattgccg caggcaaggc aaagagccta    305880
     tcgataatct tgattggata acctgacttg attgcacctt ccgtgaaggt ttcgtctgta    305940
     atgacagcgt cgagacggac gccatcgccc agtcgaagat catcaaaggc gatagtcgaa    306000
     ttgccatacg ttttgacctc gccagctttg aaatcgtagg gaacgggcgc cgcattgggg    306060
     tcatccggcg tgtaggtttg gtttgcataa gcttctgcaa cagttccacc gtttacgcca    306120
     atcttcttgc cctcaagatc ggaacctttt gttgccttgc tatccttgtg gacgacaatc    306180
     accgtgcggt cgtagaagta tggcacagag aaatcgaact tatccgcgcg agccttggta    306240
     ggtgccattt gtcctgtacc aatgtcccac cgacctgccc agttaccggc cgcaatcaag    306300
     tcccagccgg gcgttacaaa ttcagcgttt acgcccaaat acttcgcaat tcctttggca    306360
     acatcgatat cgtagccgac tagttcgttc ttttcgtcca ggtgagcaat tagcccccaa    306420
     tcggcacccg cagcaaccct gagggtttta gaggtaagga tgcgatccag aacctctccc    306480
     gcgtgagccg aagggccaaa agccactgac gtgagagcga ttaacaccgc tgttacagcc    306540
     atcttaatct ttttcatgct cgttcccctt gttaggttag ttttttcgat ctccggccga    306600
     cattctacta ctcagatttc tgagccggcc tcctcatggt acgaggtctc agaatcgtgt    306660
     gggtaaacac taagccaatg gctacctatg ctgacgaggt cccaggcgag atgtgaacgc    306720
     acggtatcga gccgttcaca catcgccccg gaagtttttg tctccagtcc caacaggctt    306780
     tcgttggccg tcgtcatatg gccatgaata gtacatgatg gcatgggatg tgcgccagaa    306840
     tgtgcccgag gccgaaatgg ccatttcaaa aggcgccttt gtttgaaatc cgttgatgtc    306900
     actgttcaag aacttggata ggcggtcatt ctcccgcttc cacgttgcag gccttagatg    306960
     tccaagtcat tttgcatccc caggaatggc ggaatggcag ccacctagtc tagactaggc    307020
     gcgtccataa acggcaagct gctgatatta ttgaatgaat cctgattttg ggtaggcaag    307080
     gcccggcggg ttcagataca cttcgagatc aagccactga ttccaaagcg tttctgccac    307140
     cgccggagcc gacaatgcgc caagaacgca ccgtccaatc cagtgtattt gatcttttcg    307200
     ccggacacga gatcggctgt gaattgaaag ccatgtcgca atggctggac gggcatcgcg    307260
     agcttttgag cctggtgacg cgggacctgc gccggcacga tctcaaggag accggccgcg    307320
     agggcctgcc ggcggaggct gtgctgcgct gcgcgctgct caagcagcac cgccaactaa    307380
     gctatcagga actggccttt cacttggagg attccgcctc gttccgggct tttgcccggc    307440
     tgccatgggg gtggagccca aagaaatcag tcctgcacaa gacgatcagc gcgatccaag    307500
     cgccgacctg ggaagaaatc aacaaagtac tgctggcaag cgccgggcga gagaagctgg    307560
     aaggcggcaa ggtcgtgcgc gtggacagca ccgtcaccgc cgcactcgtc cacgagccga    307620
     gcgacagcag cctgttatgg gacgctgtgc gggtgatggt gcggctgttg cagcacgcgg    307680
     atgcactggg cagcgccatc ccatggcacg atcactgccg cgcggcgaag aagcggtccc    307740
     ggtcgatcga atatacccgc ggccgcccga aacgggtgaa gcactaccgc gagctgctca    307800
     ggatcacacg caccaccttg ggctatctcc agcaggcggc tgagcagctg accctggcgg    307860
     cgtgcccggc cgttgaactg tggcaggccc aagtccgcca ttaccggccg ctgatcgagc    307920
     ggatcatcgc ccagaccgaa cggcgggtcc tggcaggcga accggtcccg gccggcgaga    307980
     agctggtgag cctgttcgag ccgcatgccg atatcatcgt caagggcagc cgcgacgtcg    308040
     attatggtca caagatcaat ctgacgaccg gtcgcagcgg actgatcctc gatctcgtca    308100
     tcgaagcggg caacccagcc gacagcgagc gtctgctgct aatgctggag cgccacatcg    308160
     cgttttacgg cgagccgccg cgtcaggcgg cggccgacgg cggctatgcc agccgcccca    308220
     atctgcgcca ggccaaggct tggggcgtgc gcgatatggc gttccacaag aagagcgccc    308280
     tcaggatcga agacatggtc agcagccgct gggtctatcg caagctgcgc aacttccgcg    308340
     ctggtatcga ggccagcatc tcctgcctga agcgcgccta tggcttggcc cgctgcacct    308400
     ggcgcgggct caaccacttc aaggcttacg tctggtcctc ggtggtcgct tacaatctcg    308460
     ccctcttcac ccgcctcaga tcgaactgac cccagtcatc gggctgcgtt caggagcacg    308520
     ccggcgagcg ccggccgata cccctatgac cccattgccg ccagatcgac ccccggccgc    308580
     aacctccatg cccttgtacc atcacgcctc cccaaaacat cgcttcagca ggccaaagac    308640
     cactgaaaac tccggaaaaa cagccgttta tggacgcgca ctagactaga ctagaggctg    308700
     gatcgatttt ctcacatggc gcccaacaac ctattgaatt ccgagtctca aaggctcaag    308760
     cacaggctta tgtctttgat gttacccgca agccattaat aagagggagt agcggctgcc    308820
     gtggattcag atgaacgtgt cggcagcaat tctgagctta ggacgcttga ggaccgcctt    308880
     cgcgtgctcc gccgctagac gatggaggtt gaggtgctcc gcggcgccct ttcaactttc    308940
     aaagcaggcc gaaaacagat atcgtggcct gtcttttttg ccgaagggcg gtcgccgatg    309000
     aagaccgcgg ccgacgttct gggagtctct cgttccaaat tcgctgagag cctgaggagc    309060
     gtattaaact cgcgcggtga ttgtcatagg ccgaggatgc tgaattcccg cagctttcgc    309120
     acattgatag aacggtatgt cctccggctc gccctcgagg acggcaacga aatctctccg    309180
     atacctcgct caagatggct cccagggcag ttcctactgg caatatcaac ctggctgact    309240
     ttcccccggt gaaacaagga gcattccagt cagagacgcc acctgccgat ctggatagcg    309300
     gaactatggc tgacaaatct catacagaac atccatctag tcctgccaac tctccttaga    309360
     cagtgccggg attctgatcg aggtgcggca gtcttagtgg gatgactccc agttctttac    309420
     cgacctccac aaagcattcc accgcgaaat cgacatccgc cagagtatgt gctgctgaca    309480
     tctgagtgcg gatgcgcgct tggcctttcg gaacgacagg aaaggagaag cctatcacat    309540
     agatgccccg gaggagcatc atttcggcca tctgctgcgc tacgctcgca tcgcccagca    309600
     tcaccggtat tatgggatgg tccgcgccga ccaacgtaaa gcccgccttg gtcatttcgg    309660
     accgaaaacg acggccatta tcgtaaagct tctggcgcaa aacccccgca cgatcgacaa    309720
     tgtcgaatac cttcagcgag gcagcggcga tcaccggcgc cagcgtgttg gagaagagat    309780
     agggccgaga acgctggcgc agccaatcaa tcacttctga attgccggac gtgtagccgc    309840
     cggaagcacc gccgagcgcc ttgccgagcg tgcccgtgat aatgtccacc cgaccctcca    309900
     cgccgcagta ttcggcagag ccgcgcccat gctccccgac gaggccgacg gcgtggctat    309960
     cgtccaccat gaccatcgca tcgtaccggt ccgcgaggtc gcaaacgccc ctcagatttg    310020
     cgatgatgcc atccatcgag aacacgccat cagtcgcgat caacttgaag cgcgcaccgt    310080
     ccgccttttt cagttcttcc tccagcgcct tcatatcgtt gttggcgtaa cgaaagcgcc    310140
     ttgccttcga aaggcgcgcg ccatcgatga tcgaggcgtg gttcaaggcg tcggaaatga    310200
     tagcgtcctc ctcaccaagc agcgtctcga agaggcctcc gttcgcatcg aagcaggagg    310260
     aataaaggat cgtatcctcc atgccgagaa agccggagat gcgcgcttcc agttgtttgt    310320
     gctcttcctg tgtgccgcag atgaagcgta ccgaggccat gccaaaacca taacggtcaa    310380
     gcgccttttt ggcggcgtca gcaatctctt cgttgtccgc caggcctaga tagttgttcg    310440
     cacaaaaatt cagtacacta ttcccgttgg caaccctgat ctctcgagac tgccgcgagc    310500
     taatcacccg ttcggatttg tagagaccgc cggacttaag atccgccagt tcacgtcgaa    310560
     gatgcgcaag aaaggtttgg gtcatcgatg tatccgacgt tcagccttgc gcaactcccc    310620
     cgagatcgga gccgtctgct taacgctcga ctagttacgc atatttaacg ggggtagacc    310680
     aagcatcatc ggaatgcttt tgccagtaga ggtccatcag ctgccgggtc acgacgccaa    310740
     ctttaccgct gccgatggat gaaccatcaa cgcgcgtcac gggcatgatc ccccctgcgg    310800
     tggaggtgat gaacacctca tcggcttcgc ccagttcaag acgaggtagg tctgcagccg    310860
     tcaccgcaag tcccacttcc ccacacaggt cgaaaacgga ctgccgcgtt attcctggaa    310920
     gcaccccaaa ggctggtgtc ttcagctgac ggttcttaac ggtgaagaca ttaaagccgg    310980
     gaccttccgc aatattgccg ttggtgtcca ttatgagcgc cgtttccgcc cccacatcgt    311040
     aagcatcgta aagacctctg accaagtcaa gccagtggta attcttgatc gtcggatcca    311100
     ctgacttcgg cggaattcgg acagtttcgc ttacgccaac gtggagacca cgctccaact    311160
     gttctttgtt ggcaaccgaa ccaaacggca cagcaaaggc aatgaaccga ttctcggcct    311220
     cgcgcggatc gcggctaaat gtcggcgaac ctccccgcgt gcagatcatc tcaacatagg    311280
     ctgatttatg tccagacaga gcgacgcagt ttgaaagaac ccgttcgacc tctcggcgat    311340
     gatagggcag cttcattcgg agacgatcca tccccctgaa gaagcgatca agatgaaggt    311400
     ccagtctgaa gaatcgccct tcccagacgt gcacggtatc gtaagtagcg tcagagtgca    311460
     ggaaacccca gtcaaggaca gagatcttcg cttcagacat tgggaggtac tgtccgtcca    311520
     tgaaggcgac accgtgagga taacgccggg tatccttatg ggtagtttcg acttccggaa    311580
     ctcccaccgt cgcgtctgtc gtggcaagtg tcatgttttc ttcctctaaa cgtggctacg    311640
     ccaagatctc tgcgcgcgtc tgacctcatg ccgtcccaag ggacctcatg tactttccac    311700
     gcgaaacctt gttgctgcta atgggtcgct ctaagatccc gttaggtctg gaatgtctaa    311760
     cgttcgcgtg acgaacaaga ggaccgaagc cgctagttca tacatgctgg caaaacgcca    311820
     gtgcacctat tcattgcatc aaattatgcg cacgcacgat caaatcggca ccgcaagcgc    311880
     aataggcgct tcaaaaaaca ccgtctgctg gcaaaaaaaa tcagcgtaaa taagccttag    311940
     accaaaatgc gaggttcgaa cttcacacgg tcgagcgtga tcatacttct aaacttgcga    312000
     acgtttggat tagtatagag cttggtcttc acaaacacat cgaacgcttc tacgtcctcc    312060
     actgtgacga tcagaacgaa atctgcctcg cccgttacca tgtaacattg agttacctcc    312120
     tttgcggcgc gcatggcgcg cttgaactcg tcgacaagat ctaagcgttc ccggtctagt    312180
     tccacattta caacaacggt cagggatttc ccaagcgctt tcggatcgac tagcgctata    312240
     tcggctatta tcactccgtc cgctcggagc ttattgacgc gccgcatgca cgaggctgcc    312300
     gaagaaccta cgagctcagc cagttccgca aaggacaatc tattgttctt ctgaagtgcg    312360
     gcgatgaggc gtcgatcgag atcatccaac atgttcgtgc agctccggca ttatactcgg    312420
     caaactatcg acagcgccga ggtaccgcaa actatcttaa cgcatggttt tctacaaagc    312480
     acgcgccacc ttttgccagg cgatgcaatg taggtttcaa gtcgactgga atcatgcaac    312540
     gatgtcagcg agtgctttcg acagggtggt tgaataccag ctgccggttt ggctaccaac    312600
     cttggagttt ggtcagctag gcgtatcggc gaaattctca cctcgcgccg cttccgagtg    312660
     tggctggtcg cctcggagtg aggatattgg ccaagttaag ggcgttgcgg gacacgtcgg    312720
     caataactga cagtcgcatt ttggagtctg ctcctgttta tggagaaggg tagtggtttt    312780
     gaatcggatg ccatgaggtg acgatcatcg gccagcaaaa ggtccggcgc tggaaccctg    312840
     ctttgcccat gccggcgtag tttcgtgcgg ctattgttca ccctaggccg cccctggtac    312900
     tccgcagaaa gccatcaagt ggctattcat ggaacatgca ccgatcatcc agcggcccaa    312960
     gatcgtccac gccatgctct cctggctggt gaagatattg ttcaactgca cgtccggacg    313020
     gtatgccatc aacttgccgc tctccggcaa gcagagcgct caacttagac actctgcctc    313080
     cgtgaagtcg accccggcgc gggtcacaga aggcacgccc gtatcgtcaa ccaatcgagg    313140
     tcagtaattc acgagcagtt tacgcgacat gttgctcagc gacttcgcac cagtctcagt    313200
     gacgcggacg gtctcactga agatgtagcc gtcttctttc tcccaaatgc caataaggac    313260
     atggaaggtc atgttagctt cgatcacggt gtgatcgtcg ggattgaagc tgagatcacc    313320
     actccagtcg atacccgtgg agtaaccgct cctggactct ttacgcacgc catagggttc    313380
     gaatgctcgc ttaaacgcgt gggagacatc ggagcactta acgcccggcc gaattgcgtc    313440
     gaactccgag agaaagccgt ccagcgctgc tcgatgtaga tgttgtgcgc gagcgcttgg    313500
     ctcacccaag aaaatcgtcc tcgacaatgc gcatgcataa cggtgtcgaa aggcgccaat    313560
     ctcaaaattt gtctgacatc ccaacctgta ggtggcatcg gaccacttga gatgaggtgc    313620
     attggccggg gagccaacgg gcatggtgag agcgccatag caaggcccgc cagggaattc    313680
     tggagttcct ctaatgagag cactttgaac tgcggcagcc acgtcacact cgcgcgcgcc    313740
     cacagaaatc tcaagccgac cggcttgcaa ggccctgtcg gcaatcttcc cagcctgttc    313800
     catgtaggcg agttctgccg gcgattttac tcgatgcagc gtggcaacca tgccatccgc    313860
     atcaatcgct ttcgacatgt caagattgtt ggcaagagcg gcataagatt tcatgccaag    313920
     aattttcgcc cccatttcaa cgccgagccg attagatttg gaacgctccc tgataagatc    313980
     ggctatcggt tgccacggcg tgcgctcgct ggaaccaata tattgctcgg gatagcttag    314040
     gacgcgcgac tccggcaggt aggaggtcgg tgtcgcgcaa aatgtatcaa tctcgcgcaa    314100
     gatgagccac ggatcttctt cgtcttgaga caccagagcg agttgcggaa cgtaatctga    314160
     atacccctca tagccagtga gatagttcat atttgactcg ttcaggacga gcagcgtgtc    314220
     aatgccgcgc tcggccatcc gctggcgaag tcgacgtgtg cgttggcgat attcttctcg    314280
     agtgaatgcg gcggacatca atggttctcc tagttgtgtc tgatagcgat tcgccaaact    314340
     gcgccaccct gacatgcgtg gcggcagggt cattgccggg cgccgaccgg atcgaggttg    314400
     tcagcgcgaa taggcgccgc gtggtcgtgg accacgatgt ccagttgaag cgctgcttgg    314460
     gatcatgtgc caattggatg cgctgcggtg aatccgtttt ccgatgggaa caaggcgggc    314520
     gaatcgaggt cgcctcgggc gatagcgcct aacactctta ggctgccgag aacggccagt    314580
     tggccgaacc ggcaaaaggc tctcaaccgt tacagctatg gtatttgcgt cggtccgctt    314640
     cacatgcggc acataggtcg cgcataagca gctcgaggcg cgctcgtcgt tccttcgtgt    314700
     gggagacacg atcctctact cctcttgctt cgacgcgaac ggcagcctat tcgaagcgat    314760
     tttcatctcc gactcgctca actgtgccgc gatcatagac agcgtgcgca tctctaaggc    314820
     caagggcttt cgctatgcca ataacgacat gggccgctgc aagttgaact gcagaaagcc    314880
     aaggagcgga gttgcaggaa gcgaggcgaa gccgtccgac atccccaatc gggaagttcg    314940
     gaatccttca ggcatgtgaa ggcccaagga gcggctggtg gaaatggacc gtcaatccaa    315000
     cacgccaagg ttcggctcgc cgacgacctc tcaagttctg tagccggctg tcctttccag    315060
     catcaatagg tcgctcggat cgccacggct cccccgcgcc gtcggatagg catgttgcct    315120
     gggagcggcc agggatgaaa cgagatatga cagtcccccc tcctcgaaat tcaatgctgc    315180
     ggcaacaagg tcctcctgcc attcgcgccc gagattttcg gtgatgttca tgaacttgtg    315240
     aatgacttgc tctctcgaca tcggatttgc cacatctcca agcggatgca gtacaagcat    315300
     ttcttgaacc ccatcaccct gatcgaggaa gaccctagcc ggtgtaccaa aaggaaatgc    315360
     cgtggcgaat tccggcgacg ggacgagttc gatgaggtta gcaatttcga gaaccctctc    315420
     gtcagtgagt ctctctaagg cgaccggttg aagttcctca gcgccgtaaa gagaagcgag    315480
     cgcgcaattg aaatagaagc tgtactgagc cccctctagg ttggttgggg cgcgctcgtt    315540
     tgccaagcgc attgcttggg gaaacgtgtt gattcgaagc gtcttgatct cagttccacg    315600
     tctacgcatc gagatgatag cgtcaacggc tgcatgcatg tatcggcaac acgcgtaagg    315660
     tttcagatag caattttgcg cctcccaaga cgatcccaga ccgcccaaaa gaacgttgcg    315720
     atcaaaacga acctcgtcgt tgaagaggtc gagcgggccg gtcgctccct ctcgagcccg    315780
     ataagcagca gtaatacctg ccacgacggc aggaggaata ccttctttga tcgtgctgcc    315840
     ttcgaacttt ggagacgggg ccgtgaagac gattgggcct tcgccgcccg cgataccaag    315900
     cgcatgagcg gtctcgttag cggttaactt gagcaggcgg gctgcagcgg ctgcagcgcc    315960
     atagtttacc catcgcccac tagcataggt atccaccgat tccgcggggc gggaacttgc    316020
     gacgcgcaaa gcgatctcgt aaccgagcgc aattgcttcc gatacttccg atgatgatcc    316080
     accaacggct tcggcgactg ccagagcagc aggtataacg ccggcgccag cgtgacccgc    316140
     agcgccgcgg tgaccgtcat cgatatcaag cgcgctggcg gcagcgctgt tggccatggc    316200
     agcgcctaca acacttgatg tccgattagt cagccaaatc ctcacagacc cttcaccata    316260
     tgcattaagg gcggatgctc tggcagccct cgcaagcggc gaatgtaagc ccgctcctgc    316320
     agcaccgatc agatcgagca tcagggtgga gatcgtctgc gtggttggca caggcaaact    316380
     tttcggcgga aaggtagcca cgaagtcggc gagttttaaa aggggctgca cgatgtgctc    316440
     caatattcat gataagccgc cttagcagtc gtaagaaaaa gtatcttgcg ctcaacccat    316500
     agtcattact cgcgcggcta ttgatgtgag tgagcgggtt gccatcctaa aggaagctga    316560
     gcgttttgca acatgcgtct acctgccgct atagtgaaac gacgatactg ctgctctttg    316620
     gccttatgga ttttacttga ccccgcaagc tttggcgaag ttctgaatca gtgaccggca    316680
     cgcaggctcg ctctcgaaca tcgcctcggg atgccactgc acaccgatga caaagggccg    316740
     atccggcgcc tcgattgcct cgacgatacc gtcgtcggct cgtgccgaaa cgacgaaacc    316800
     aggtgccagc ctgtcaatag cctggtgatg cgagctgttg acccggaatg acaaatttgg    316860
     gctttcgaca agtcgcgaga ggtatgtatt tggctcaatg ttaatcccat ggactgtctg    316920
     ttcaagcggg gtcccatcac gatggtcgcc gacttcaggg agagcgtccc gagtatgggg    316980
     atagatagtt cctcccgcga caacattcag tatctgcatg ccacggcaaa taccgagtac    317040
     cggcaccggc cgttcaaacg ctgcccgggc gagagcgaac tcgaatcgat cacgctcggg    317100
     gatcattcgc tgtacagttg ggtgtggatc cgcaccgtag aactcggttg gaaagtcccc    317160
     accgccggtc agaactattc ccgacaatgt gtcgagcaac tgcccaacat cgccttcact    317220
     aacataaggc aggatgattg gaagcgctcc ggattgctcg atcgcacgaa cataattttc    317280
     taaacagaag taacccttct tatcgacttc aaagttgctg acaattccaa caagtggtcg    317340
     cattttgttc cccagggtaa gccgtcaggc actctcaaaa agtctacggt ccaagcccgt    317400
     caggcgttca ggcccatctt ccgttaccag aacagtctcg ctgaatccca tgccgccggc    317460
     gatcgccacc atatggaaca ccattccggg ctgcagcacc catttcacat ccggcaggaa    317520
     ctctcggatc aattcggcgg tggagggccg ttgattgagc cccagcgaat agccagtacg    317580
     gttggtgtag gtctggcgaa gacccgccac taagatcggt tcgcggcaag cttgatcgac    317640
     tacgctggcc ggtatgcccg ggcgcatcag cgcgatagcc tcgtcttgaa tgccgatgat    317700
     tttctccgct acacggcgct gctgcgcagt cgccgggcca acgaccgcgg tacgcatcaa    317760
     gcgcgcccag tatcctttgt gaattccgtt gagctcaaaa taaacaggat cgccgcgttc    317820
     caagcgtcgg tcagtggacc acccgtgtat gagatttgtt cggtcaccag aggtgatttg    317880
     acagccgtct ggcacctgtg tgcaagcgcg tgtcaattcg ctatagactg cgacagccaa    317940
     ctctcgctcc gacacgccgc ccttgatcgc atcaagaccc actcgcatcc ccgcgtcaac    318000
     gctccgagca gcgccacgta gataatctat ttcccgctgt gacttgatca ggcggaggtg    318060
     atcgacaatc agcggttctg cgactaagtt tgcatgaggc agcaccgttt gaagcatttt    318120
     ccaacgttct gcggtcaaga accacgagtg gtcatctaga ccaatccgtc cgcctgccaa    318180
     acctaggcca tgtagggcct tgtgtgctgc atcgagagaa acacggagcg gatcgatagc    318240
     agcatctgga tataccacgt agtcttttac ccacgatgtg ttttgtgctg ccggaacttc    318300
     catgtcgcga atgacaagca ccgggtttcc gcggctggga acaactaagg caagatagga    318360
     gacgtacata acgtcatcca aaccggtaag atagttgatg ttttctggtt ggtgcagcaa    318420
     gaggacagga agatggtatt tcgccatttc ctcctgggta cggtgcaacc gtgcacgata    318480
     ctcctcgagt gggaaatcca tcctgctatt cgccgcctca gtcactgttc tcagctccgt    318540
     tgaaagttag tgccagtttg tggttccggg accgatggtt cagccaaccc tcatatgtta    318600
     atatcgaaac aagacgcgtt tccgtcaaaa cttagtgctt gttgaaattc ggttgcagaa    318660
     gttggcccaa tttgaaatcg gcgctcaacg tacgaggttt cgctggtgaa gatcgctcac    318720
     acgcacatgc ccaagctatg gagttttgac ggcccgacag cgatcttctg tcacgactgc    318780
     agccgagtat cccggcgacc ccgacaaaca gcgctacttt gtcggaagag tttttaagtc    318840
     ctcctagtct aatagccgct tcgtacgccc tcgggtgaag ggcacgcggc gtcagccgta    318900
     taaagtcgag cccagccaga agcgcgcccg ccgtgcattt ctgcaatctc gaacattgcc    318960
     tccgtccgcc gcctaaagcg tgtcgcgatt taagggattc aggattcccc ttgatttgag    319020
     atcgtgattc attgcggttg aaaggagacc gcgatgggca agccgctacc gcttgagttg    319080
     cgtcgtcgtg ttgttgcgta tgtcgatgag ggacatggtc accgtgaggc tgcgcgccat    319140
     ttccgcgttt cgcctcgctt tgtgaacaat ctgatcaacc tgcgcaggca gaccggttcg    319200
     cttgaagcgc gccggcaggg ccatgtgggc ggcgggaagc ttgagccgca tgccgagttt    319260
     gtccgcttgc ggttggccga ggccggcgaa ctgacgctgg atgagctttg cgtcgaactg    319320
     gaagtgcgcg gggtgagcgt gcaccgctcc aatgtcgggc gcctgctcaa tcgcctgggg    319380
     ctcagtcata aaaaaaactc tgcaggccag cgagcagcag cgagccgacg tgcgccaggc    319440
     gcgtgagctg tggatcggac ggcgaaagcg cttcttcaac aaggctttgg cgcggctgat    319500
     cttcattgat gagacgtcga ccacaccaag ctgaccaaac gcaccggctg ggcgccgaag    319560
     ggcgagcgct tcaggacgca tgcgccattc ggcaaatggc agacgcagac cttcatcgcc    319620
     gggctgcgat gccacggtct tgtcgcgcca tggatcgtca acgcgccgat gaatgccgcc    319680
     atcttcgaac gctacgtcga aactcagctc gctcccgaac tgtcgcccgg cgatgtcgtc    319740
     attctcgaca atgtcggctt ccacaagaac gagcgcgccg cgcaactggt tcgccaaagg    319800
     ggcgcatggc tcctgttcct gccgccatac tcgccagacc tcaacccgat cgagatggcc    319860
     tattcaaaac tcaaggcgag gctgcgaaag aaggcggcca gaagcttcga tgccctctgc    319920
     gaggctctcg gcgatatctg ccatctgttc cagccagccg aatgcagaaa cttcttcaaa    319980
     gctgccggat atgaggccaa ttaatcgcga cacgctttaa ggcctaaggt ctttgcgccg    320040
     ccagcgcacc atgccgtttg cgcccaggat cgtggccctg ttccaccaac gcgccaacgc    320100
     gaccttctgc gtcggcgtca ctgcgcctgg agctccagcg atttgcggct gcaaaggccg    320160
     ctcaatccgc ccgcattgta gcgaagcatg cagtggcgcg gcgtctgccg atgcatgccc    320220
     agtgtccgcc gctatcttgc ggtcgcgggc gatcgcccgt gtccggggtg ccgcccgtgc    320280
     atcccgcgtc ttcgccggcg cagcccgaac tcgcgctgcc gtcaggtcca tccgcgtgat    320340
     tgccatctcg ccaagccgcg ttcggctcgc gacagccgtg agtaaggctc gtcgcctttt    320400
     ggcgaccccg tacgagtcat ccgcaaatgc tgttgctata aaagcgcgtg aacgtccgag    320460
     ccttttctgg cttggcaacc attcggcgaa ttggaaagcc tgcactaagc taccttactc    320520
     tatcctcctt gaggcaattt ctagcgcgtg ccagagcgaa gcgccaaacg agcgcgcgcc    320580
     aagcacggcg acatgggttt cgctgcggcg gattacgaaa caggtcatgt gatcaaggac    320640
     tgtacgcgtc gcgcgacccg gaccgaaacc ggcaagatcg atgttgatta gcttcgccag    320700
     caatgcgtcg agggggcctg tgccggcccg agataaaatt tcgacagcca cccacccacc    320760
     agtttgctcg gtcaccgaac aaccgcgggc agcctctttc agatctgcgg caaagtcctc    320820
     ttcggcgcgg ccttcggctt caaccatcca ctgacctggt ccagtccaga aagctgccac    320880
     ttcctgatct gctacccagc gtcccggcct cggcaaattc aaaccgaacg gttggggtgc    320940
     aacggttttc cggcgcagcg ctagagaggc aagcgccaaa tctaggttct cacgaatctc    321000
     cagcgctgca aacgatgcgt aacgaggatt ttcggcgccc agcgccttga gcggtctcag    321060
     gttagccacg cagacgtact ccttcagcat caacgaaatg ggacgaaacg acgcgcaggc    321120
     gtgcgctttc cccttcgacc gggttcgcag ccatgatcac ctcgcccaac cgttcatagc    321180
     cattctcgag gaaagccagc ccgatcattg agccgacatg gggcgaatag caggctgacg    321240
     tgatccagcc ctgatcggta tcgtggttca atgctgctcc ttcggcgaag agatgtgagc    321300
     cgacaacgat cttgctccca ggctcgacgg gctgaagacc catcagtcgg cgcttatttc    321360
     ccgccagccc ctcgcgccga gacatgatcg cgccgattgc gtctttcttc tgcgacacca    321420
     ttttgccgag tccgagcatt tcggcagtgg tttggccgtt aagctgggct ccaccgacgt    321480
     gacccttttc catccctagg acagatagcg cttcgactcc aaaaggtgtc acttccagat    321540
     cttcacccat ctccatcagc cgattcatca gtgcatgccc gtagcgggcg ggaaccgcaa    321600
     gctcgtagcc aagttctccc acgaatgaga cgcggaagag ccgcgcccgc agaccgccgc    321660
     aaaccgttag ttccgcgcaa gccataaaag caaacgcgta gttcgataag tcgaacccgt    321720
     cgacgacccg ctcgagcagc gcacgcgatc tcggacctgc gacagcaatt tgcgcccagg    321780
     cctccgtcgt ggatatgagc tgtacgtcaa gctcgggcca gaggcattgc ctggcgaaat    321840
     ccatatttcg gaaaaccagg cccgcattgc ccgtcgttgt ggtgaccaca tagtggtcat    321900
     cggcgagtcg cgcgcaggta ccatcgtcat agggaaagcc gtcctcgcgc agcatcagcc    321960
     catagcgaac gcggccgacc ttcagcgtcg acatcatgtt gctgtaaaga cgatcgagaa    322020
     actgccccgc atcggtgccc tgcacgtcga tctttccgag cgtggagacg tcacacaagc    322080
     caacggcgct acgcacggcc tgcgcctcgc gatctacact ctggcgccag tgcgtttccc    322140
     ccttacggcg aaaataatcg gctcgccgcc aggggctaga ctcgtcaaat accgcgcctt    322200
     gggcttcggc ccaccgatgg gtcggcgtca agtggggagg gtggaaatgc ggccctatat    322260
     cgccgccccc caggaccgcc agtgccacgg gagtataggg cgggcggaag attgtagttc    322320
     cggtttcccg gattgttttt ccagtgagct ccgccattac ggcgagcccg atcacattgg    322380
     cggtcttgcc ctgatccgtc gccatgccca aagtcgtata gcgtttcaaa tgctctaccg    322440
     accgcatgtt ctcggcatgg gcgagcttga tgtccttcac cgtcacgtcg ttctggaaat    322500
     cgacccaggc gcgtctccta cccggcacgt gaaagacggg tgcgatttta tatgcatcct    322560
     cttccggggt cggaaaatta agagatttcg ccgtgatccc tatgtctgcc aacgcacatc    322620
     tcgccgtttc cgcacccgaa cgcagcgctt ccgcggtcga gaagcggccc gctgcagcgc    322680
     ccgccgcccg caacccagaa ggcccgtact cgccaggcag gaacgccagc agcagctcat    322740
     tccaggtcgg cttaccccga tggtgcgaag ccagatgcac gttcgggttc cagccgcccg    322800
     cgaccccaag ggcgccgcaa tcgatccatt cggacctgcc ctttgtttga aactcaatcg    322860
     aggttaggcc aagacggccg cgcgagccgg tcacaacccc gccggcgatt aaacggtaat    322920
     caccacgagc cttcgcctct gggcgcgcgt cgatgacagc ggcgatctcg acgcccttgg    322980
     cggcgaggtc gcaggcggta cggtgaccgt tctcgttgtt ggtgaagacg gcgacccttt    323040
     cggatgggca cgctgcccag cgattcgcgt aagctcgcat cgcgccggcc agcatgatgc    323100
     cgggacggtc attgtccgca aaagcgacgg gtcgctctat cgcgcctgca gccaagatgg    323160
     cacgtttcgc cgttatgcgc caaagtgtct ggcgtacgcg gcctcttggc tgcgcaagat    323220
     gatccgaaac cctttccacc gcaccataga tgccgtggtc atagacgccg aaaaccgtgg    323280
     ttcggctcat cacccgaaga cgtggcaggc tctcgaattc tgactccagc gctgaaatcc    323340
     aatcgagggg cggggcctcg cccagtgttt ccgtctcgca taacagccgc ccgcccaggc    323400
     ggaaatcctc ctccgccagg atcacacgtg cgcctgagcg agcggccgtc agcgccgcag    323460
     caagtccggc tggccccccg ccgatcacca gcaagtcgca atgcaggaag cccctgtcat    323520
     aggcatcggg atcggcctgc attgagatgc tgccgagtcc tgccgcccta cggatggctg    323580
     gctcgtagac tttttcccag aaacttttcg gccacataaa ggtcttgtag tagaacccgg    323640
     ctgtgaacag cggtgagaac aggtcattga tagccattgc gtcgaaacca agcgagggcc    323700
     agcgattctg gcttcgcgcc tccagtccct cgaacagctc gaccgttgtc gcgcgtgtgt    323760
     taggctcctg tcgcgggccg gtgcgcagct cgaccaaggc atttggctcc tccgaaccgg    323820
     cggacaacac cccgcgggga cgatgatatt tgaagctgcg cccaatcagg cgaacgccgt    323880
     tggctaacag cgccgaggca agcgtgtcgc cgggatgccc ctggtagcgt tttccgtcaa    323940
     acttgaagtt cagtgtttgt gtacggtcga ttaatccgcc tgagagccgc gtcattttac    324000
     gctcctcttg cgcgcaaggg ccacgtcgtg ggccaactcg gcgccgagaa tttcgtgggt    324060
     gatcgtattg cgcgtaacga ccagccagga gtggtcgccg tgctcgtgga accacaattc    324120
     ccggtgcgcg cccgctggat tgtcgcgcaa gtatacatag tcgcaaaagg cggcctcggc    324180
     atcgggtgca gatgggtctg gacggtcgat aagccgggcg tctccgagat aggcaaattc    324240
     tcttgcatcg cgcaaaccca gaactggatg gggaatgagc attttgacct cactgtaggt    324300
     tcggctgcgc accagcgccg ctttcatcga ttaagtatcc tcttgcgaag cgatcgagtc    324360
     ggtaagcgcg cgcagtctca tgaggcgtat cggtcgcaag aagatgggcg aaggcgtggc    324420
     cgctggcggg cgtcgccttg aaacccccaa cgcaccagcc cccgttaaaa taaaggcctt    324480
     cgatgcccgt gcggtcgatg attggcgagc cgtccatcga catgtccata acgccgcccc    324540
     attgccgcag gagccgcacc cgaccgatca tcggcatcac ggccatggcg ccttcgcaga    324600
     catcctccac catcggcaag ttcccacgct gcgcatagga attgtagccg tcgatttcgc    324660
     cacagaagac gaggccgccc ttatcggatt ggcttatata gaagtgcccc gcgccgaaca    324720
     tgataacaca aggaataatg ggcttgagac cttccgtgac gaacgcctgc aggacatggc    324780
     tctcgatcgg aaggcgcatc cccgccatcg ccatgacgcg gctcgaggag cccgccactg    324840
     ccacgccgac cttgttggca ccgatgaagc cacgcgaggt ctccacacca cggatgttgc    324900
     catcaacgat gcgaaaacct gtcacctcgc aattctggat aaggtccaca ccgtacagat    324960
     cggcgccacg agcgtagccc caagcgacag cgtcatgccg tgccgtcccc gcgcgtggct    325020
     gcataaagcc gccatggatc ggaaagcgcg cattgtcgta gttcaagaaa ggaagcatcg    325080
     ccttgagatc ctcgcggctt aacaggcgcg cgtccgcacc ggcgagcgcc atcgaattgg    325140
     cgcggcgtcg atacgcatct cgctgccaat ccgagtgaaa gaggtaaatg acgccgcgct    325200
     gggagaccat cgagttgaag ttcagttcct gctccagccc ctcccagagc ttcagtgaaa    325260
     actcgtagaa cggcccgtta ccgggcagta ggtagttcga acggatgact gtcgtgtttc    325320
     ggccaacatt cccggatccc aaccaaccct tttccaaaac ggcgatacgg gattgccgga    325380
     aggtcttggc caggtaataa gccgtcgcga ggccgtgccc gccgccgcca acgatgacgt    325440
     aatcgtaaaa cggctgcgga tcaggattgc gccataaagg tttccatcca gaatgacctt    325500
     tgagcgcttc agaaagaacg cgaaagcctg aaaatctcac agcgggattc ctcgatagca    325560
     acgtcagaac tacaactccg tcacccaaga cacgcagttt cgagatgtcc gaatgtggca    325620
     gaaaaggtgt accactgcga aaatggcggg ggtatcgcaa aaaatctgag gatctgttcg    325680
     tgacgtgtca aaaaagggcg tcgaatgacg aattgcgcca cgcggaccgc acttggcgca    325740
     ttgaatgttg cgatgggtta ggcgatctct tttgggctac cttgatgagg ataccctaag    325800
     gctttgtcat gacaggcgaa taatgccagt caagcgcggc agtttgccgg cgatcggttc    325860
     gagctatgat gtggctctgg tgaagatgca gcgctgcccc gcagggccac ggtgcggctc    325920
     aagcaggact aggtggtgca ggtcaataag tgcggttcca atgggttaag taacggcaga    325980
     atctccggtt aagccgccgc tgttgaatga caatcaaggc tcggcattgt cgcaagcaat    326040
     cgacctcgac ggggccatgt gctgatggct gtgtgacctg gcctggtggc tttgggggga    326100
     attacgtctc agtaagcgag cagaccttgg ggggcgcgga gtgcgccaga cgggctaccg    326160
     cacccctcgt cccgcccgag gcatcatgcg gaggatgcct cgggcgcttt cgatcgaata    326220
     tagagccacc cagtattggc ggacattgac atctcaccgt cgcgagccgc cgacatgttc    326280
     agcagcctct caggttttgc cgaggcgatg ctccgccttt acagcgcgta caaagaggag    326340
     caattcgctg ctgccgatcc gcggaagtcg cgatggtcgg ttgcgtgggt gcgaaggttc    326400
     cttgccacat gacgcgactg cgttcttggc ttaggaggct gaaaaaagag cggagatacc    326460
     cgttttgaat ttgctttgtg cttgatctga ttccgacacg ttccgtaaac aaaacagttg    326520
     ttcaacagat ggggtgattg gggtctcgcc cgagccaaat tgagggcggc tgctcctatc    326580
     gagatgtgag aacgtggtcg atgtagatcg ccacaaacat caggaggagc agccatgaag    326640
     tattttgccg gacttgacgt gtctttggaa gagaccgcca tctgcgtcgt cgacgagagc    326700
     ggccggattg tgaaggaagg gcgggcggcg agtgagccga gggcgcttta tgaggtcttg    326760
     cggaaaatcg atctgccgct ggaccgcatc gggctcgaag cctgctcgct ggcggcctgg    326820
     ctttatgacg gtattcgcgc cgaaggattg ccggccattt gcatcgagac ccgactggcc    326880
     aatgcggcga tgaagacgat gccgaacaag acggaccgga atgatgcccg cgccttggcg    326940
     cagatcatgc gcaccggctg gtatcgacag gtgcatgtga agagccagca gtgtcggcgc    327000
     tggcggtccc tcctcgtcgc acgacgcacg gtcctcaatg aaatgcgatc catcgagaac    327060
     gtgatcagag cgattctgcg ggaggccggc atcaagctcg gcacgccaag tcgtgcagct    327120
     ttcgccgatc gcgtgcgcga actgattggc gcagatacgg tcgtcatggc gcttgtcgag    327180
     ccgcttctgg cgatcgtggc cacgatgctc cgcgagttcg ggcgactgac aaagcaagtc    327240
     ctcaatatcg cccgcaagga gcaagtctgc cggcgactca tgtccgggcc cggtgtggga    327300
     cccatcaccg cgctcgcctt tcgtgccacg gtcgatcagc cggaccgctt tcgccgatcg    327360
     agcgatgtcg gagcgcatct gggtctgacc ccggcacgct atcaatcagg cgagacggac    327420
     attcagggca aggtaagccg atgcggtgac gagctcgccc gcacggctct ctatgaagcg    327480
     gctcattcgc tgcttgtgct cagcaagaaa tggtcgtgcc tcagagcgtg gggtatgaac    327540
     gtcgccaagc ggcgcggtat ggcccgagcc cgagttgctg ttgcccgcaa gctcgctgtc    327600
     attctgcatc gcatgtggag cgacgggaca gaattccgct tcggcaaggc acccggcccc    327660
     gtatcggcat gaaataggga caacagacca acgaaggagg agttgattcc gcccgaaagg    327720
     gcgtgatccg gatcgttccc gcggggacga tgggcaaggc gatctcgtta gcaggcacga    327780
     tcctgggacg aactctctca aggtcgttca acagattgag acgcctcgcc ctactgaccc    327840
     catcatgcgg cggcctaacg tcgaccgcga agagaagcga gtgacccgcg gggcgacatg    327900
     gtccggaaaa aaatatcagg aggagcttga ccccaaggac cccaatcaga gaagcctgct    327960
     agatcacctc tcgcgttgcg tctgccttgc ttaacatcac ctcgcgatgc ctgttcagct    328020
     tggcaccgcg aacagtggag cgccgggtaa tgcggacagg gcggctgtga ctaaaggctc    328080
     ccctcgggtt gcgaccgatg tgatacctgt cggcggaagc gcagtcagtc gctgcgacat    328140
     ccttaacttc aagtccacca gagaacaaga tctggccggg caaatccgaa aaagctgttt    328200
     agcagcacgc gacgctttcc gttgcctgct tgaccagtga ccccatgaac gaaaccgccg    328260
     tcaagtaagg cgatgtcccc ggccttgagc cggatgtcgc gacaaggcac atcctttaga    328320
     tagactgcag aatagggata gcccgttgtc tccaccccct gcgactttcg gtcgtcaact    328380
     gtcggcttgt ggctccagag ccgcagattg ccgccttcct cggacatgct ggggtagaag    328440
     ttgagcgcgg cgacggtatt gtgcgccacc gcagatagct cgtaatcgtt cccggcacgt    328500
     agcacttgag cgacatcgtc gtgggggtcc aaggaaaacg tgccgctgcc ggtccaactg    328560
     agagcccgac aaacgttagc ctgaccgtgt tctgagcgcg ccagccgcaa ttcaatgcct    328620
     tgtttgtgaa gctcgcgctt caacgcgtcg aagagggctc ggaccggatc aactaaattg    328680
     ccaaaaagag cgtcaacgtg cggccgcgca gtttctgcct ccgcgaaata ggtggctgca    328740
     tccttcctgt agtgggatgc gcccacatat tgtccgggga cgccatcttt gcgctccctg    328800
     agaccgggac tgccaaaaaa cttcgcggtg atctcctcgg ctatttcggt gctgaaagct    328860
     tggctgatat gcagagccgt gatctcacct tttaggaccg agatgatctc cgcagtgctg    328920
     atcgagccgg ttcgttcctc gatcgtaaga ggcgagatgg ccggcgtttg acgtgcttgg    328980
     ttagtcgcca tttgttttct cctgtagtgc ctgatcgagg atggcaattc cgtgatcaag    329040
     ttcgtcatct gagatggtta tcggcggaag gactttaatg acgtcgcgat ttggccccga    329100
     cgattcgatc agcaggccgt tttcgaacgc gacatcgtgc acacggccaa caacggcctg    329160
     tgatcggcac ttgaggccgg ccatcagacc acggccgcgc ttttgttcga tgcacttagg    329220
     gaatttcgca acgaggcgat caaggtgttc ttgcagtttg acggccgtcc cctcaacggc    329280
     tttagtaaac tgcctatcgg accacatttt gcacatggcc gcggaagtca caaaggcgag    329340
     attattgcct ctaaaggtcc cgctatgttc tcccggtttc catatgtcca tctcggggcg    329400
     aatcagaact atggacaacg gattacctga accgcttagg gacttcgaaa gacacacgat    329460
     gtcgggctcg actttcgcga actcgaatga gaagaaatcg cccgttcgtc ccgaacctgc    329520
     ctgaatgtcg tcgacgatga aaacgacgtc gtgcttacgg caaatgcgct gaatttctgc    329580
     aagccatggt gcggatgcgg tgttcatgcc gccttctgcc tggatgggct ccaggatgat    329640
     tgcggccggc ttttctatgc cgctgcccgg gtcgcccaac acgtgatcaa tgtaactcgc    329700
     ggaatcgaaa gtttggttcg gatagttctc gtaagggaca cggatcacgt cgtggcgagc    329760
     aacgccgcca agctgtctgg ttgacgctga acccgataca gccaaggagc cgagtgacat    329820
     gccatggtac gaatttgtga aggccataac actcgagcgg ccggtatatt ttcgcgccag    329880
     cgccaacgcc gcttcgttag cgtttgtccc ggttggccca ggaaactgta tcttgtaaga    329940
     aaggccccgg ggcttcagga tcgaattgac gaacacttcg atgaaatcac gctttgcagt    330000
     tgtgtacata tcaagcgaca agacgatatt ttggttggcg agatattgaa ttgccggcgc    330060
     cataatatct tgattgttat gaccgtaatt gagcgcacct gacccaacaa tgaaatcaat    330120
     ataaggtttt ccggactcgt cccagattgt cgccccaaga gactttgtaa agactgttgg    330180
     gaaggatcgt ccatagcgac gaacgttaga ctcgtaagct tcaaaaatgt cgatatccat    330240
     taaagggcct ctctgtatgc ggcttgcgat tcaacgctgc aggttctatg ttcacgcatt    330300
     ccaaaccaat tatttcgacg atcagctacg gcaaatctct gccttaaagc gaacgtatca    330360
     tggtcagcga cttgagttcg caaagagtct gtaaacttgt ttgacgaatc tgttgcaacg    330420
     cattggatag cgatagcgtg acagtcagta cccgccttgc ggcagcgcta atcggcggcg    330480
     ttgttggcgg gggcactgac caccggtttt tccaagcatg actgcaacca cgatgcttgg    330540
     gtatttccct atgtcggccg tgacgggatc cttgccgacg agtagctgtg acagatagcg    330600
     atttctctcc ttcgatgtga cggcgagacc ggtggccgct cgagtttcgt tttggacgcg    330660
     gacgagccag accgcggttt gcgatagaac tggaactgtc cgcggcctct aatcgcggcc    330720
     gtggccgccg tggcggtgat tgcgctgttg cctgggcggc gtgttggccc acctcctggc    330780
     ttcacggcat attgaacgcc tcagtcggcc ctcgcgagat ggcggccgca ctacagtcca    330840
     tggaccgagc acgcgagtgg tgttcggcac ccacgagccg acgcagaatc gactgcgccc    330900
     tcgaggaagc gcgatcgatg cggctatcga ccacccggtg ttcgccaccg cactgcgtgg    330960
     tcacgatggc gcggcttttg gagcgcagca cgacttaaga gttcccaccc ttacactggt    331020
     caacattcat gtgatcgaaa acgctggctc aggcgacgcc actggcgatg tgtccgatgc    331080
     cgctttttga acgcaaggtt cactctgtcc gacatccgac aattgttaga tgtcagacag    331140
     ggcgcaaaat cagctaaccc gttgtttaat tgaattttcc tctctggcac gttctgtgca    331200
     gcgtagcttg cgaagcatca gcaagaaact tgcgaagcat cagcaagaaa atagtcccat    331260
     gatcacactt actgaaaacg ccgtcgctgc catcaagacc gcgctttccc gcgccgacga    331320
     accggcggaa ggctttcgca tcatggtcga ggcgggcggc tgcgccggcc tcaaatacct    331380
     gttgggtctg gaaagcgtct cgcgcgaggg cgatgccatc atggagacgg acgggttcaa    331440
     ggtgttcgtc gacgcaaact cccagcccca tctcgccggc atgaccgttg acttcgtcac    331500
     ggacctggag tcctcgggct ttgtcttcga caatcccaat gcgcgggaca aatgcgcctg    331560
     cggcaagtcc ttcggctagc cgccatcacg acaaggatcg gcgccgtgcg ggataatacc    331620
     gacaacgtct acctcttcaa cgacaagctc tatctcatca acccgcacaa tgtcggcgct    331680
     ttggacaccc ccaatgcggc cggcgaggtc ggcgccgtcg cctgcggcga cgggcttaaa    331740
     ttgataatgg gtttcgaccc caagaccgag acgattactg ccgcaacgtt ccagaccttc    331800
     ggccgcggct cggccataac cgcttcctcg acatttaccg aattcatcgt cggcaagacc    331860
     atcgatgaag cccttcagat caccgatcag gacatggcgg attttctcgg cgccctgccg    331920
     ccgcacacga cctactcatc gctcgaccgc ctcatcctgg agcgcggctt gcggctgatg    331980
     agcgagttct tccgtgctgt gaggcaggct ttcgaggaga caccaggatt ctcacgcctc    332040
     gtcgtcgtca aggcatcatc gccatgaccg gcgtgatagc ggcgtttttc gaggtgatag    332100
     gtttcaagga gggagaggcc cttccccgca gcctccgccc gctgaaacct aattctgcgt    332160
     ggagttcggg tgagtgggtt ttcggcaatc agcctcgatg gtggaacgaa ctgcaaaacc    332220
     tgcagtggga catttcccac cgattgccgc gtctcctaag ccagcagaga tgctcccttg    332280
     ctcactcgaa ggccgcttaa gccatgccat atgcggtcaa agaaattttc tacacccttc    332340
     aaggtgaagg acgaaatgcc gggcgggctg ccgtattttg tcgtttcgcc ggctgtaacc    332400
     tttggtcggg acgtgaaggc gaccgggcaa gagcattctg cgaattctgc gacacggatt    332460
     tcgttggggt agatggcccc ggtggcggac attttgccac cgcacaagag tttgcgttgg    332520
     cggtcgaaca agcctggcgc gggtcgggaa ctaggcagcg tcttgtcgtg ctcaccggag    332580
     gggaacccct cctccagatc gatgaagaac tcctggaagc tctgcattcc ttggcgtttg    332640
     aaattgccgt ggagaccaac ggtaccattc ccacactcgc cggcatcgac tggctgtgcg    332700
     tcagtccgaa atgcaatgca cgcctcgtgg tcatggcagg ggacgagcta aagcttgtat    332760
     atcctcggat tggcgcggag cccgaacatt tcgaagttct cgcgtttgag caccttctgc    332820
     ttcagccgat ggatgggccc gaacgcgagg cgaatacggc cgccgcagtg gcctattgtc    332880
     ttgccaaccc acgttggcgc ttgagccttc aaacccacaa gtttctcggg atcccatgaa    332940
     aattacgcaa gctttcacct tcgaggcagc gcactgtctt ccgcgcgtgc cagagaccca    333000
     ccgctgtcac cgcatgcatg gccactcata ccgtgtggaa ctgcgtctgg aagggcccgt    333060
     cgatccagac acgggctttg tcatcgactt cttcgatgtc ggggctgtgt tcggaccgct    333120
     tctgcaacgt ctcgaccatc agcatctgaa tgaggttgag ggtctcgaca atccgacagc    333180
     ggaaaacatt gcggtctgga tctggaacca aaccaagccg cttcttggcc aaatgtgctc    333240
     ggtaacggtc tatgagacgc cgctgtgctg ggctgaatac gagggttgac ccgatgcaac    333300
     gagatccggg aaccgcactc gtccttttct ccggcggcca ggattcgaca acctgcctgg    333360
     cttgggcgct cgagaacttc gagcgcgtcg agacaatcgg cttcgactat gggcagcggc    333420
     accggatcga gctcgatgtg cggccctacc tgctcgggcg cattcgaaca gactttccgg    333480
     cctggcgtgg gcgactaggc gaggaccaca tgatcgacat ggccgtgctc ggtcaaatca    333540
     gtgataccgc gctcacgcgc gacgtcgagg tcgcactgaa cgcgaacggt ctaacaaata    333600
     ccttcgtgcc tggccgcaac cttctgttcc tcggctttgc ggccgcgata gcttaccgga    333660
     tgggcgcgaa acacctcgtg atcggcgtgt ccgagacgga tcgtttcagc tacccggatt    333720
     gtcgggatga cgcagtcaaa gcgatgcaac ttgcccttaa ccttggaatg gagacgcatc    333780
     tcgtcattca cacacccctc atgcggcgcg acaaggcgca gacctgggcg ctggcgggtt    333840
     ggctgggcgg cgaggtgctg gtgaagctca tctgcgaggg aagccacacc tgctatagcg    333900
     gagaccgcga acatagacat agctggggtt tcggttgcgg gacctgcatc gagtgtaatc    333960
     ttcgcgcagc gggatgggag caattccggt gctgcaaaga ggcacccgtg gccgcccatg    334020
     aaatgacgtg agcgccccag gtccgggccg acggtggcaa tctgttccat agatcgtttc    334080
     cttctctttg tggtgttcag cacgaccagg gtgggtgcct tcgatgccgt ttcgaagggc    334140
     tgttccatag gattgaaaag gcggctgccg tcacgaacga tacgcgtgac cgcatcaagc    334200
     gccggggcaa agccatccca atgaattaga atggcgaaag tgttgtcgag gtccagaaag    334260
     cactgtccgt tgacgtcagc cagattggcg ccttcgcgtt gcagcgcgcc gcgtggcttc    334320
     ggatcgcaca gccgcagcgc gcgtggtgcc atcgggaaaa atggcggccg cgggcgaaca    334380
     atcgtgccga ttggcgtcag gcggcgcgaa gctttgtgca atatgtcaga cctctccttg    334440
     ggcctactcc gccttcgtcg ctgactagat ggcgtttgca cttggtagac gtcattcacg    334500
     aaatgagagg cggctgatga acaggccaac gatcgccgat ctggcgaaag ccgcgggcgt    334560
     aagtgtttcc acggtcaata ggctcttgca cggaactggc acactgcgac cgcagacggc    334620
     cgacctcatt ttgagcgcag cgcagcagat cggcttccgc agttcggggc cgctgcacga    334680
     acgcaggcgg gacaatctcc cgcatcggca cttgagcttt ctcatgcagc aatcgcaccg    334740
     gccgctctgc cggatctggg ccgaggcgct tctaggtgcc tgcgcgcgac gcacagatgc    334800
     ggttattgag ccagacgtgc tcttcgagga cgacccttcc cccgaagcgg ttgctgccaa    334860
     tctgctgaag ataggcggaa gcgccgacgc aatcgcggta atctcggccg atcacccgct    334920
     cgtcggccag gcgattgatg agttgcgcct caaaggcgtt ccagtgatcg cctacgtcac    334980
     tgacctgtcc gccgccagcc gggccggctt tgtgggaacc gacaactgga aggccggccg    335040
     caccgcagca tggtttatca gccagacgtc cggtcggccc ggcaagatct ttcctctcat    335100
     cggcagcaac cgttatcagt tccaagacat ctcggatgcg agctttcgct cctacatgcg    335160
     cgagcacgcg cccaagttcc acgtcagcga aaccctgctg acccatgagg cgccgaagaa    335220
     cgcctatgca atcgttcgca ggctgatagc ggaggagccg gagctccggg gcatcttcgt    335280
     taatggcggc ggcatttccg gcgttctgcg tgctatgcgc gagctcgctg cggagcagca    335340
     gtgcaaaatc cgggtcgtct gccgcgacat cgggcccgag gcacgcaagg gattgagcga    335400
     aggcctgatt actgcttcct tgtgccatcc cgtcgacagg atgcctgaag aactcatcaa    335460
     tgtgatgctg cgcatgatcg aacgcacgga cacacggtta atcgaacagc ggattgttcc    335520
     gttcgagatc ctcacgccag agagcatttg gacttaagaa tcggaagaac catcgtcgtc    335580
     cggataaggt cgtccgtgcc gctgcgaagc gaaccgcttc gtgggttaaa ctggggcgca    335640
     aagggcagct cggcactcat gatcctcgtt gcaaccgaaa ttggccagga ggacgaggag    335700
     atggaaatct ccgaggaagc cgatcttgtc gagagctgga ccccacgctc gcgccaatga    335760
     ttaggctgct tcggccgtcc gtgccgattt gcgcggcttg tggcgcacca caacgtccac    335820
     cttataagcg cgcgtcgatc gaggcagcgc accgggcgat ctatagagaa cttgcctgtt    335880
     cgcccatgac tacggcggat atgtcgagct gtttcataac aagcaattga gctgatttgg    335940
     cttgagtgag gcgccgacgc ataatgatgg cgcggatctc acgggcgagc ttggctttcc    336000
     gcaattcctc ttcggaatta tcaaagccaa aatccgcaaa cacgttgccg ctggtcattc    336060
     ggccggtgat tcttcgtcat aactttgttc cttcccatag ttttcgcgat cgtgcgtctc    336120
     ggccgccttc aatcgcgcct aacgagatcg atttcgcact tgggcgtgtc cctgcctttc    336180
     ttctggaagc aaggatgtag atcacgccag cgaagcgacg gcatggacgg cgcgataagt    336240
     atccctgtct aagtcgtcga cccccgcaag gatgcggccg ccaaatccct tgagggcttt    336300
     gaccgccaga tgctgttcgc catttgggca tcgttgattg caacacccat cacgctgcag    336360
     atatcgacca atctgactcc gctcagccac tgaaaagaaa gattcgggtc aaacagccgt    336420
     tttcgccaag tgatcatatt tcctatgaac gcattttgga ctgcacggac cgttccagct    336480
     cggcgcaaaa ccctcccaga tattcgtcaa tcgcgctctg caaatgcacc cagtagagca    336540
     ctttggcggt gctacatcga taatgagccc agttttgctt tttttgagaa gatgtccctc    336600
     ttgcttggcc gcagccaata tcccggtaaa aattggcggc agcgcatcgc gtttagcgct    336660
     cgccgggcgg agctggtccg ggttgcgaag cccggcgagc gcggatcgtc ttgggcgatg    336720
     tgttgatcag gcgcggttct tggagcgcca ggattcatgt ccggtttcga tgatctcgca    336780
     atcatgcgtg agaggatcga gcagtgcggt cagttgttcc gtcgaagtag ccgcgcccgc    336840
     tgacgcggat gagcgcccgg gcgatggcaa tggccagatg ccgcttcccg ttccgggcca    336900
     ccaatcaaca cgccattgga caaatgccat caagggcatc tcaccgccgg tcggcggcga    336960
     acaagaagga gaggaagaca tggaacgcag gcttgatgac gtgatcgcag ccctccctga    337020
     gtagcgtcgg gagcgtgtcg atgcacgttt cgaagagcta aggacggagg tcgagtgcct    337080
     cggcggtctg cgccgtgcgg ctgggaaggc ccaggcggag attgccttgc ccctcaagat    337140
     caaccagccc tctgtctcga agatcgagca acaggccaat acgtatctgt cgacacttta    337200
     gagctacgta gaggcgatcg ggggacaact cgacctcatc gtcgcctcgc cgcgcgcgcc    337260
     cctccgtata gagcggctct gcgacgtcgt agcccaaccc cctccgcacg tagtgctgaa    337320
     agagcgccag gtggatgaac ccgcccgaag gcaacgcgcc ggctgaacgc gccgtttcgg    337380
     tcaaaattgc cgaagggacg acagtctcgt cgacgctcgc aataggtatg agcaaggcct    337440
     cgttaaaccg gataccgact gcccgcggtc acgtcgcggg ggacgcctct tcccctcccc    337500
     catgctggcc cagctcaccg ccgcgctggg ggtgtccggc gatgtgctcg ccgacgacga    337560
     ccccgctcga gcacgcttgg tcacagcttc catacctgct caagtagata ccacgcgcct    337620
     gcggatatct tcggtggctt acaatttata aaatttacgg cgattatcgc cgcaccgcaa    337680
     aatgacaaaa aagtcaaacg gacacgtctt ctcccttctt atgcggcttc aggacacatt    337740
     gagcacaggc aaatgctgcc aagcatgcca gcaccacgac cccacgtcgt ggcggcagtt    337800
     aacaactgcc cgctgaagtt tgccaacggg ccttcggtca aacctggcgg agcgctgtta    337860
     cggcaggcac agcacgtgga gagctgtcga gcatcagcca ttgcgaaagg tgtagccata    337920
     accgttgatg gccggcgcgc cgccgagatg cgcgtagagt atcctcgagc cctcaggaaa    337980
     aaagcctttt tgaacgaggt caatcatccc ttgcatcgat ttgccctcat agacgggatc    338040
     ggtaatcata ccctcgagcc gcgcacacag acggatcgcc tccttggttt cctcggatgg    338100
     aatgccgtac cgcgggtgcg cgtagtcctc cagcaacacc acgtcatcct cggcaagttc    338160
     cgatccgagc tcgacgaggg tcgctgtatg tcgggcaatg ctaagcacct gcgccttggt    338220
     cttggccggg gtagcagagg catcgatacc gatcacgttg cgctgccgac cgtccttggc    338280
     aaatccgacg agcatgccgg cgtgcgttga accggtgacc gtgcaaacga ccatgtagtc    338340
     gaaggcaaac ccgagctgtt cctcctgggc gcgcacttcc tccgcgaacc ccacatagcc    338400
     gaggcctcca ttcgggtgaa cagacgcccc ggccggtatc gcatagggcc tgccgcccct    338460
     tgccttgacc tcatagagcg ctttttccca gctgcggcgg ataccgatgt caaagccatc    338520
     gtcgaccaga cgcacctctg cgcccaagat gcggctcaag agaatgttgc cggcccggtc    338580
     gtagacgaca tcctcatgtg gaacccagct ctcctggacc aggagacatt tcatgccgat    338640
     cttggcggca acggcggcga ccatccgcgt gtggttggac tgcacgccgc cgatggtgac    338700
     aagggtatcg gcatctgacg cgatcgcgtc agggatgatg tattcgagct tgcgcagctt    338760
     gttgccgccg aacgccagac cggagttgca gtcctcgcgt ttggcgtaga tctccacgtt    338820
     gccgcccaga tgcttgccga gccggtcgag cttctcgatg ggtgtgggtc caaaggtgag    338880
     cgggtaacgc tcgaattttt ccagcatatt ctctccggcg atgatcattc agctgaaata    338940
     gccacgcaaa actcgttcca taagcgctgc ttggattggt cggccgcgct ctccgaccac    339000
     ccatcagagc tttggggatt tccagcgctc tccttgcgat tgagacgaag cgatccacat    339060
     gtcgccatgc tgcgatgagg cgaccatcgc ctaggaaacc taggacgaca cgcggtcgac    339120
     atctgcgttt ttgccagctt tgcaagtgca gccagactgc caaaccaaca gacttcgata    339180
     aaaacgcagt ggctcttgtt tgcgattgga ccggcaggaa ctgcacggtt gccgagccgg    339240
     attccgcgag gcgatttttg tggcgctcaa cgcgtcacag aggtttcagc tgctcgatcg    339300
     aagtgctcgt ctacctgatc gaaacgggtg ccaatgccct cgaaaggctg ggctcgccgc    339360
     ggccgtaagt cgtcggattg tagttgacga gcgtgtgggt cctagcggta tccagcaact    339420
     gattagtaat ctgtgtcggt gttgctgacg tgaacttgct gctcttctga acgcgagtcg    339480
     tctgaaaggc atgcccggca gagacggagc tccctgccgg gccgggttcg ccttgggagg    339540
     tggcgtaagc tagcgacttt cgtggcggtg gaaccactca atccgtgcgt tttgcgcaat    339600
     aacgagcatg taccgtgcca agccaaaaag catttaaaaa acacccaaga gtcagcttcc    339660
     tctacgttgc atacccgaca ttgtcggtta tcggacaatg ccgaacgtgc ctctcggcat    339720
     cgacctacgc ctgaacccga gcgcccccgc aaggtcgttc gctgccattt cgacctggtg    339780
     gtgaccgggt tttagctccg actgttctcc gctgacggac agggcggatg tcgcttttaa    339840
     aagaggaact gtctgtacct tcaattcaag agggcgcggc cacgagagac ggcgcggcga    339900
     atgcggtcgc gcagatgatc gcgaggatca acacatccgg cagactggca aatcagcagc    339960
     ctgatatctg tccaccctca ggggcgcact ccaaaccggg gtcaaaattg gacgccgatt    340020
     ccccgcctca ggtgtcaaaa tcgcacgccg aaacacagga ccgtcatcgg cgaatccgcc    340080
     cggagaaccg aaactgcatt cccctgggcg gtagaacgat gagaatgccg tcgccttcga    340140
     ccctaccagg gaaccacagc ctgaataatg aatctgcgct ctgatcttgt tacggcgcct    340200
     caagggagga gcagcgatat gccgagcgtt tgattgcgct ggggcacatc ttgagtttca    340260
     ttcctatgct catcgtcgcg cgactggtac cgaacttcct gggacccatc gaaaagctca    340320
     gccccttggc cggctttgcc agcgcagctg gatcgccaaa tcagaaagag cacacttacg    340380
     aaatagccca gctgaagaag tagcgagcag cccagcgtcg tgacgactgc tagacggaaa    340440
     gaatgcgagg cgaagtaaac cgccacagcg ttgccgcaca ggaccagccc gaggagccga    340500
     caaaagatga tgaagcgcat gccgttctcc tgattttgtc tcgtcaaatc atgcagctca    340560
     tgctgcgatc tggtcggccg cgagatgggt ctggcagttc tttgggcaga cgcggccgca    340620
     ggctccgcag ccaatgcagc ggccggcatg gtcgacaacc atgatcatac gattgagctc    340680
     accgtcgaaa tcgtcgtcat cggcgccgca ggcgccgagg atttcacccg cgtcatcgac    340740
     gccgtaaaga tgcatgacct cccgcgagca gactttgaag cagcggccgc agccgataca    340800
     gatcttgcca tcgatagcga tcagatattc cggcacccat attgagccgt cgcggctgat    340860
     gaatttgctc ctcatcgcaa agtcttcatt ttggcaagct ctctcctggc accatccaac    340920
     tcggcataaa cggcatgcgt tttctcggcg acttcctcta tctcaatcca tttgaccggg    340980
     agaccctcgg caaggtcgcg caagttcgtc ttggcaattg ccgcgcgcag ttgaagcttt    341040
     cggactttct tcgccatctc atccaggttt gacatgatcc ttcctcgaaa atgggtttct    341100
     tcacgcccgc gccacttcgg gataggcaat agctgcagtc tcatcgccga ccagtttcgc    341160
     gccggtatcc gcgagtttcc ggagagtctc gaagccgaat cggagacgtc tcgacagccg    341220
     tttgatttct gttgttgaca atgtcatcac gcctgagcgc tcctcgatcg ccagctccga    341280
     catgtcgagc ctccacagca cgtccggatc cggattgcca atgagtggat attccggcgc    341340
     agttcctcgg tgataatgaa atcggccagc agccaagtgt ccgatttccg ttggcatgag    341400
     ccgtggaaat cctgagcacg gatcagccgc aggaggcatt tgacgaacgg gcgggaaagg    341460
     gcctcgccat tcttgttgac ggcagggcca agcgctgcgt gagacatttc gtttcgtttc    341520
     ctcaatttca ggtctcgtcc tcaacggagg atttctgctt tcggttacgc tgacttcggg    341580
     ctcgcttccg cagccgacgt ccggcctcgc caggccgatt ccacgtaaat gctgcccctg    341640
     tggccgacct tgaacaggtc ctggactgtg acgtcttcaa cggcgggcca aattcgcttc    341700
     gaatatcgcc gccgcggcta ttcggttgga agtctaaggt ccgagccctg agctggagca    341760
     aaccgtcgac cctgtgctcc atggacacag ttactgcggg cgcgccgcag aaaatgggcg    341820
     aattgaccag ggttccattc cacttgtcat cccgacacct tgccgggctg aaagttcgtg    341880
     agaggatcgc cacgcagcca gtcgtccact ttgatcagag gagccggtga ctctctacgc    341940
     aacatgttgt tctccattcc cacacctttc ctgacgttta tgcgcgagct ggttctctca    342000
     gaacggaaca ttaggagacc atcaaagtct tgcgtgttct catgcgatca gccctcactc    342060
     agtatttccg atctcaacca gcaaacgtca tgccagcgcg ttgcccgcag taaatgcatg    342120
     attctgcctg gaaaccttac aggcccaaga cggccggttg ttttgaaccc aacatgtttt    342180
     ctgctgctgt cagcttttgg acacgcatca tgcgtcagac gcttgagggc gagaacggct    342240
     tggctgtctg ccctgcggca atgttggcgt cggctcatct agcatcattc gccgctggcg    342300
     atgcgcgggc gcgctaggct gacccagcgc cccgaaccgc atgaccttct tgatcggctg    342360
     gctacaggtc ggaaattccg cgattccgaa aaagttggtc agcgcagtgc agcccgctcg    342420
     gcatttgccg cacgaatggc aagcgcccga aagctgtcaa ccgagggatc ctccaaggcg    342480
     cgggccggca tctcgacgat atgttggtta aggccggcca gtgtttgtgc ctatggtctg    342540
     ggagtggcct tcgggcagcc agtggtagcg agtaaagctt tggcatcctc ggctttgatt    342600
     gccgcccaaa tctggtcgaa atcacgatag gctattatgc ctcctcctca tggagaacag    342660
     gaagctctgc tctggcgtag aagcctagca cgggtccgag atcaaaggtc gttcctggcg    342720
     caaggcgccg gacggacgtg ggccatgttt cggtcgagac gccatcgata gctcgcgcca    342780
     gcgtgctggc gaatcggggc atcagcggtg cgagtgtctg cgccaggatc gcagcggccg    342840
     tcgtctgaag ggcgagcgaa gtgcgggtgc gggcgggata gagacgtcgc gccgcttcat    342900
     agtcttgcgc ctgtcggtag actacacaat cgctcacgaa atcgcaggcc tgcgcggccg    342960
     cgcgccggac cgagaagcca tcgtccgaat aggcgcgttc catcgccgcg cgatggatct    343020
     ctatccgagc aaagaaagcg cgatcggcgg gagcccagtc gcctgcatcg ggcacacagc    343080
     cgccaaagtc ctgcttgatt tcccggtgca gcgcatcaag ccaattcagc cagatccctt    343140
     ggaacacctc gttcttggtg cggcgtagcg cgtccagcgt gaagttcgtt cgctcacctt    343200
     ccgggcgtgt caggcccaaa tgaagacgga cgacatcgac tgtctttggg cccagaacct    343260
     ctttgcccca gaccgcatga ccgcggctgg tcgagaactt ctggccgtcg agcaggtaga    343320
     actcgttcac atgataccgg atgcgcgggg tccagtggga gaagacctca gcataaagcg    343380
     ccggataaag cagggcgtga tagaaggaat tatcgaagcc gaagaaatgg acaatttgcc    343440
     agtccttgct gggcagggcc gcattccagt ctcggccgag cgatgtagct agcgcctgga    343500
     tgttgtaaag aaaaccaaac gccatctctg gccagaccca gatcacctgc cccgggagcc    343560
     cctcggccgg caggccccag tccgaggggt gggtgatggg cacggaaaag tcgccacgtt    343620
     ggcgtagacg cgcgaagagg tccatgatcc gaacgggggc gcccgacgcc cttaaatgcc    343680
     ggtcgatagt gtcgtagcac cgttccagcg caagttcggg acggcgcacg gagccgacca    343740
     ccggcgcctc ggccgagtgc cgcgaccgga ctgcacctag gtcgtggcat aggttcggtg    343800
     cgccgcattc ctcgcagatg ttgccaccag cggagctgcc gcaatagggg cagaggccga    343860
     ttacatccgg ttcgtaaagg tagtcgcctg tcacagcatc gaagagcgca gggctccggc    343920
     gcagatctac cgccgtgctg ctcagaagac tacggaaaca cgcggcttga aactctgcgt    343980
     aagcgctatc gcccaaagtc gggaggaagc tatggacctc acagtcgaga agcgcaagcg    344040
     tggctcgaat ctcgtcggcg tagttgcgcg ccacctttgc gggcgtcgat tgatcggcat    344100
     cggcacgcgt ggcgacgtag ctctggtaat cgtcgcttcc agtcaggtga taggcttcga    344160
     cccctttcat gcgcaggaaa cgcgtgtaga catcggcgcc aaaataaggg ccagaaagat    344220
     gccccagatg cagatcgcca ttaggtgtcg gcggcgtgga gaagacgaag atcggtccgc    344280
     gcggagtcgc gacctgtgca gcagcttcga gggcggcctt gccgtcgcgc cagtagacat    344340
     cgacgaaatt tagctcttcg tccccatcgt tgtgcagcac atgcgcttca aaagggtgga    344400
     acagaacgac gtcgccggct ttgaccgaga tttccccaag gtcggtcctg accttgcccg    344460
     ctcctgacag gaccacgaag gcctcgattt cgtcgtgccg atggggctcg gatgtgacgc    344520
     ctggtgccac cttgccaaat gaaaacccgg tgcccgcgct tcccgtccca agcgcagcca    344580
     tgtcgatacc gaacacccgc gacagctgcg ttcgagaaaa cgtggatttc cgcatgacga    344640
     acctcagctg tcgaaacagt ggtctcttcg gctgccgacg caacagcatc tgctgcaagt    344700
     tgcgaagaga gcggcagccc gacacgttgg ccccccgtca gaatagtccg gctctgggcc    344760
     ccaggcgggc gaaactacgg gcgccaggag ggctttaggc gtcacagaag agcgcccggc    344820
     gacacctctt cacatcgaca taccgaagcg tcgtgacgga ctgcaggcga tgctccagta    344880
     gccggcaatc aaaaccatgc tctccgcgca tttttttggc ggccgatcag tttcgtttgc    344940
     attcccgcct ggttccgtga gctcaatcgc gatagaaaat gccgtttggg agcttgaggt    345000
     tgtcgagatc agccactttg ccctctggcg gattaagggc gcgcttaagc acgttatact    345060
     cagcgcgggt cggtccaccg gttgaagcac gctggaacac caagtagagc gtccgccgcg    345120
     aacgattgct tttattcggc ttcgagtaat gcggtgcata atcgtcgaag atgaagatgt    345180
     cgccagcctt ccatactacg ggttcccagg agaatgtttc ggcgacctca ggatcaatca    345240
     ccccgccggc atccatggga aataccccct tcttgtggtt gccggggctg aagaaaaggc    345300
     caccattgtc cgggtcggaa tcgtcaatgc ctatggcaac gatcgcatgg accatccggt    345360
     cgggcagcct gtgtggaatg tgataaatgt cctgatgcgg gcgataaccg ccgctatcgg    345420
     gatagtggaa gatcagcaac tccttgagtc tgcgcgaatc ttcgccaagc aaatcctcga    345480
     ccgcagagtt tatgcgctga tcttctagga ggagcagacg caatgggtca tggaagtcca    345540
     gaaaattctc ggccttagac gtgatctttc gatcatcagt cgtcttctcg aaccacatga    345600
     gccatttatc atcgctgaca tcccagcgtg atatgtcttc aacaaagcta gacatacctt    345660
     ccacagccgc gggatcgaag aacctttcga gcctgatgta tccgtctttc tgccactttt    345720
     ctctttgtgc atcggtcaac atgcgaaaag cctcctgttg gaaagagtgg ttggtcaaac    345780
     attccggtta gaggcagtcg ggcgccgtca gggtgtgggc cggagacgat actccacggc    345840
     atgcagacgg cgacgctaag tgcgttgcgc tccgggtgga ttgcaaggct ttgttgtccc    345900
     tcctcaatgg agagatcgcc caggcccgta aagatctatc gatccggtac gtctgcatag    345960
     tagtcacggc cgagcatgct gttgatggtg cgactgcccg ataagaggac ctttcgtgca    346020
     gcctgacgca acgcaagtcg tgcgccgcgc aaatctttgc gacaagttcc cgttcgggtc    346080
     gggcgatcag ggaggcacgt cgctggcatc gggtccatcg atgctccaaa aacgagtatt    346140
     gtccgcacaa gttcggcgcc agactgccca tccgaggcca cgcagggtcc agggattccc    346200
     gaagctggtg ccgatcactt acctcacccg gtccagccac cacacgcatc gctacgagcc    346260
     ggaagcctcc gctgacggcc gacgcagcca tggtcgccag ggccactgcg cactttcgag    346320
     tgagcgacct agtacggttt cgacgaccct ggggcaaatg gacgcccgca gaataaagcg    346380
     atgcgcccat agatccaagg gcatgttcag tgacgatgag ttcggagcgg actccggccg    346440
     tcgccgcggc ggaggcggat aaaattcctt ggatgccacc gccgatgatc agtagtcgct    346500
     gagtcatatc ccgctgccca tttcttcggc taccgggtcg ggccagctct cgacggtggt    346560
     acggctgata aagccaggat gctcagggtt cgcgcacggc gcgcgctgta gaaggctgtc    346620
     aagaatgcgg cgagctcgcc acgccagcag gcttaggttc ggatcggcca gcccgcgctg    346680
     gccgggattg gcgttctgta cgaagatgcg tctgtcacgc ggtccgtccc agcacaccga    346740
     aaaatcctcg ttgatgacca actcattgtc ggtctgttgc agctgatccg ccatcggttc    346800
     caaaaagctt ggcacggcgt tctcgtaacc ggtggccagg atgacgatgt cggccgtgac    346860
     ttcttcgacg tcgcccaagc cgcgctgcag cgtcaagttg tgacccgcgc cggcgttgat    346920
     gcagcgcgaa acgttgcaac ccggccgcag tgcgatgtca cataggtctg gctcaagaaa    346980
     ttcgtggcga tacagcgcct ggtagacggc gcgcaaagtg cgatccgaaa tcccatccga    347040
     ggcgagcacg aaacgccgca ggaacagctt gcgctgcggc tcgctcatgg ccgcgaaacg    347100
     atccgaaaaa cagggcatga acaactcgtt tgtgaacggg ctgttgtcga ggggcaggta    347160
     gttttcgcgc tgcgagaccc aggtgatcga ggcaggccgc cgttctcttg gcccaccgac    347220
     caaatgcaac agcacctcgg ctcccgactg gcctccacca acgacacaaa catgtttatg    347280
     tcgcacctca ggatggatgt gcagcaaatc ggatgaatgg aacaggttgc gtccgatcca    347340
     gccctgaaat tgaggtggaa tccgcgcttg cttgccgatg ccgaccacca ggtctcttgc    347400
     accgagaact gcatcgtccg tccgcacccg aaactcgcca tcatagcgta tttcgcggac    347460
     ggtctcgccg ccgcgcacaa gtgggtttct gcggaacgcc cagttcaggt attgttcgaa    347520
     ctcagccctg agcacagcat cgaactgtgc attcagaaag tggtatagac gcccgttctc    347580
     gtgcaggtag tttatgaacg tgtaggcgga tcgcggattc accagcgtga ccagatcctt    347640
     gatgtggctg acctggagtt ctgaggactc gaatgcgctg cctggatgcc agcggaagtc    347700
     gacttgccga tccaagaaca gtgccccgtg cccaacctgc tcatggatct gacacgcgag    347760
     gctcaaattg gacgggccag caccgatccc aatgcaagag agctccaggt gccttgctcc    347820
     tgctgacgcc tcccaatcag gcgctgtacg cggcgaatgt cggccatagc cggtcggctt    347880
     gccctccccg cacgcatcat cgacaccaca ggacttgcaa cagtttgtcc gggcgttcgt    347940
     agtatcgggt gtgacgcccg cagatgccgg ctccgtgatg agatctgaac tcatgccgac    348000
     gacatgttgc gcgtggctgg catcaagact cccgcctcga tgacccggag tggtcagtga    348060
     catgctttcg cagcctatcc ctcattgcaa ttgggctcgg ttgcccgcct cgaccgtgat    348120
     gagccgacct tcggcctgct tggcgaccag cgagggcacg atcatgagtg cggcgacagc    348180
     atttttccgt gggtttgatc atagaagacc tccgctgctg ctttcgggag gtcccctgca    348240
     tcgaacgtgc cagagcaaaa catcagcaaa gggaacggaa ggcaggttcg caatcctgtc    348300
     gagtatccga cattgaggcc gaaaccttgc accggcgccg atttttgcac gcaatcgtac    348360
     tcttcgactt catagcgttg caggctctct tggcactttc cacacggccg tcatcgagga    348420
     ctggcccggc gccgagtgtc gatccctgaa aaggaatttc cgttatcaag gtcctcatga    348480
     ggactatccc gacatggtcc tgcattacgg cgacacgacg gatgcggcta tgcggtggcg    348540
     aagctctacg gctactggag caccatgaac taccgcgagg tatacgggct ctatggcatc    348600
     ctgttcaatc acgaagggcc gacgcgcggc gaaactttca tcacgcgcaa ggtgacgcgt    348660
     gcggtggctc gatcatggcc ggcaaacagg actgtctcta tctcggaaac ctggaagcaa    348720
     agcgcgactg gggctcggcg cgcgcctatg tcgagggcat gtggcgcatc ttgcagcatc    348780
     aacctgacga tttcgtgctg gcaaccggcg agacacacac ggtccgcacc tttgtcgggg    348840
     cttgccttca ggcgagtcga aaaggaaatc gtctgggagg gcgaaggcgt tgacgaggtg    348900
     ggccgtgaac gcatgagtaa tcaagcgctg atccggatcg acaaacgctg tttcgggcca    348960
     atcgaggttg acctgctgat cggcgatggc tccaaggcag ccgacaaaac tcgattggaa    349020
     gccgaagacc actttcgatg agttcgtctc ggaaatggtc gaggctgact gccgcgccta    349080
     cgggatcgtg ttagcgtggc gtgaaaacac gatgacttcg cggcatgtgc atcttgccgt    349140
     ttcagggacg tcggcatttc aggcccgccg cggtcagccg gcgtcagtca gttctatcgt    349200
     ttggatcggc aaattcacac atcctgcaaa gcagaaaacc agccgctcca ttcatgcgat    349260
     cgacgatttc gcaaaaaact tggcttttaa agagatcgcc atattcgtcg catagaaggt    349320
     tgcccaatac gtgacgccgc tcaaaatcca tggagcagag agtgacctcg ccgtttggaa    349380
     gtagtacatt ccgatactgc cgttcgtcca cgcatatcag cgctccgacg actggctgcc    349440
     gtggttctac aatcttaggg tctacgcttc cacccctgct gctcaccggt cgcgcgcgaa    349500
     ctagggcttg ggcagggata atgtcggcga tatcgggatg gggctcaccc aaaaccacga    349560
     atcggatcga agggatgtcg gcgtcgacga gttgaccaac caaatcgcga tacttggctc    349620
     cgacaaggcg gctattcatg tgggcgccat catcaaaaac atgaaccacg aataccccca    349680
     accgcagcgc ctgcaagcgt tgtagatcct gccccttcat tcccacaagc gtcgtgaaaa    349740
     tcctgatgcc gtggcctttg gcggaagcgt gctcgaccat ttcggtgcaa tcgggattga    349800
     gccatggctc agaatacccg gcaaaactaa tgtcgacgga ggctggtacg cgcgccagac    349860
     agcgcttgaa atctccaaga ctaagatgct tcgtatcaga tacttttctt tgccggtcag    349920
     cgaacttgtc ctgcggacaa tatgaacatc ccacgatgca tccggtggtc gtcgttatct    349980
     ccaaaactct gccggctggg atagcagagc gcagttccgg taaaatcatt cgttgtgact    350040
     cccactcgtc ttggtcatgc ataacgtcca gcatggtgtc gttggcttca tgacaccgac    350100
     ggtcaagaca gtccgaatga gcccagccat ctccgcctgg gcagcagtca acagccggtt    350160
     tcctcaatct gccgggcgga ctatcaacga actttgggcg catcggcgcg gcagggcggc    350220
     gcaaccgcaa agtcgcgcgt cagccattgc caaggtgtag ccgtgaccgt tgagcgggcg    350280
     cgccgccgag atggcgcagc agaaaatcaa tcgtctcgcg ttcttatgcg gtcagccccc    350340
     actcaacatt gccgcatctc cagcaaaggc cgtgccagcg cgcttagccg cagcaactgc    350400
     acgagtaggc ttcgagaaac ctcacgccca aggcggccgg tggttttgga ccagacagtt    350460
     ttttgtcgct gtcagctttt ggacatgcat ttcagacgct tgaggacaga cttggctgtc    350520
     tcccctgcgg taatgttggc gtcggctcat catctagcat catttcggca ccggctgtgt    350580
     gcgcggaaga tctacacgac ctgaccgccg cgtgcagcga ctgcctgccg gctcatagct    350640
     gatcttttct cctgaagccg gcgatggggc caggccgtcg agtgcgtgct gccggatgct    350700
     gcgtatgctg tctggctaga cggcggatac cgcgtcacct ccatattttc gcgacagagg    350760
     tttggtggcg tcgcaggcct tcctgctaca tcaccgcagt gctcgggaat tcgtatctga    350820
     tccccgtgag gcgaagacct tctctctcga ctggctcgcc gaggccgtct gtcctgcggg    350880
     caccgaatga tttctcattt ggcatggcgc atgcgcgtcg atccgcaaac cccgtctgga    350940
     caaatcggag ctggccgcca ctccacctcc tcctaccacg agggcagacg ggaagcagcg    351000
     ccttcaaata aggaacaaaa tcactttacc tcgaatcttg cctctcgatc acaaccggag    351060
     ccatggaacc gcgtccgcga ccatcgcctc gcgccccaag gcaattgccc agcgcaaatg    351120
     gctacgcgcg attacgccat gcatccctta cgaggctatg acagcacctc ggagagcctc    351180
     gccgccatca tgcagaccga tctaagccca cctgatccag cacaaaggaa tttcaaacat    351240
     gcaccaagat accgtccgtg ggaaagcttt cgccatgccc ctgaccagcc cggcctaccc    351300
     ggccggccca tatcgcttcc gcaaccggga gtatctgatc atcacatatc gcaccgatcc    351360
     gcagaaactg cgcgaccttg tgccggagcc gcttcaggtg tgcgagccta tggtcaagtt    351420
     cgagttcatt cgcatgccgg actcgacggg cttcggcgac tacacggaag gcggacaggt    351480
     catccctgtc tccttctgtg gccgcagggg gagctatacc cactgcatgt ttctcgacga    351540
     ccatccgccg atagcgggcg gacgcgagtt gtggggcttt cccaagaagc tcgctagccc    351600
     aacgctccga acggagacgg atacccttgt tggcacgctg gactacgggc cggtccgcgt    351660
     cgcgacgggt accatgggct acaagcaccg agccgccgac ctcgcgagcg tgagggcctc    351720
     gctcgctgaa ccgaacttcc tcctcaaaat tatcccgcat gtcgacggca cgccgcgcat    351780
     ctgtgagctc gtggaatatc atctagagga cgcccatttg aggggcgcct ggaccggccc    351840
     ggcagccctg aacctctggt cgcatgcgct tgcccccgtc gccgaactgc cggtgctgga    351900
     agtagtctcg gcagtacacc tcgtcgcaga tctcacgctc gcgctcggga aggtcgtcca    351960
     cgactatctc ccggaagcct agcctcgcca tcggaaagga agaaccatga acttttacag    352020
     tgatatctca ttgaaccaac gcgatgggga gctgctggac ggcttctcga caaggaacgc    352080
     cactgacaat ctcatacaac gtctttccag ctacctagcc ttagaggaca ttccgccgct    352140
     ttgcagcgag tgcaggcgcc tcgcgagtaa gagcgattgc ccttgcccat cctccctgct    352200
     tttggtgcaa catatgctcg ctgccgttta ccagcggctt gacgccattg actgcctctc    352260
     agagcaaggc cccataagac tgaaggcttt taccgattat ctggcggcgg tcgttcgaat    352320
     agcttcagag agcggcgacg cggcaccctg gattgatcta gcaacccggt ttagcgctct    352380
     tttcgatccc gacgaggttg cccattgatc tcgcgcttat cgctttttcg tggaacgagc    352440
     agcctcgtcg gcagatgcgt catcgatcgc cagcggcgtg ccggcgcata tgcgagcgta    352500
     aaagtgccga gcagccggtg atgtatctcg aacgtgacga cgccgattgg cgcgatgcgc    352560
     gttggctcgg ggcctcgtgc ccaagcatgg gtgcgttccc attccgctgc atcgtactcg    352620
     cgatcccgtc tgtgccgtgc tcaagcaaac gagctcgagc gaaccgcccc aggttgcgga    352680
     tttagacagt cgttgatgga gttggctggc gaattggcgc gttcggcctt cggttggaag    352740
     accggcttga ggggggccaa cgagacggaa ttggcgaagc cacgctggag tatgccttca    352800
     ctggggtcgc gtccctgcac gtgctgtagc gcagcgttcg cgaagccgct cgcgagcgcg    352860
     ccctcatagc gctgagcggg cgagcggctt cggggcgggc gcagaggctg ggtagacggg    352920
     ccggactcac ctcacctggt ccagccacga catgcatcgc caaaggcaag gaccccgctg    352980
     accgcgcccg caagggggga gattggccgt catcgctgcc ttcgccaatc tccaaggcta    353040
     gaagtttgga gccgccaggg aagctgccgg tctccccctt gcgggggaga tggccggcag    353100
     gccagagggg ggctgtcccg ccagcgttag atcacattca attccctgaa cgcccgccct    353160
     tcagcgacac ggctgtaccc aaacgccgag cagtccaccg tgcggtagcc gccgtgcacg    353220
     atcagctcgg ccagcgcctt gccgaccgcc ggggcctgct gcaggccgtg accggaaaaa    353280
     ccattggcga agaggaaact cttaacctgc ggatgcgggc cgatcaccgc gttctggtcg    353340
     agcgtgttgt agtcgtaatg gccggcccag gcgcgtgtcg gcttgatcgc ctcgaaggcc    353400
     ggaatgcggg tcgccagcac cggccagatc acctcttcga acagcggcca gtcgacctcg    353460
     aaatcggtgg ggtcggccga gccgtcgcct tcttccggtt cggcgccgcc agtgagatag    353520
     accgagcctt ccggccggac atagatgccg gagggatcga ccagcagcgg catatcagaa    353580
     tatttgtcgc gcgcctcgaa gacgaagacg ttgcgcttgc gcggctcgac cggcaacacc    353640
     agccccgcca tggcagccac cgtgccggca ttcggcccgg ctgagttgac gacgatgccg    353700
     acttccagcc tgtcgccatt gtcgaggctg acactggtca cgctctggcc gttccacctc    353760
     cgccttgcgc atgactggag agatttccgg cgggcgtcgc ctcccgagca atgcttttca    353820
     tgttcgttac tcttcgtaag atcgattatt tcgatggagc ccatctacgt atgaatgcag    353880
     gcgtcacagt agagctttga acagcatcgg tgcgggtccg gaaccgtcat cgagccaaaa    353940
     acagcggcaa tgtcggcttt tcaaagatcc atctggtcac accgccaaag agccgctcac    354000
     gcagccgacg gctgccatag gcgcccatga cgatcatgtc cgcagaaatg tcgattgcgt    354060
     gctgcgcaag caccgtggcc gccgatttgc cggcacttgg caggaggtca accgacaccc    354120
     gagcaccgtg ccgagtgaga taggcagcga tgtcggctcc aggctccgcg ccgttcccgt    354180
     tgtagttggc cttcggatcg accagggcga cacgaacttc ctcagcagcg cataggagac    354240
     ccagcgcttc tcgagccgca cgggacgcct cgactcggga atcccaaccg accaggacgc    354300
     gccgtggcca cagtgtcgcc tcagccccct tcggcacaac gagcaccggc tttcccgtat    354360
     cgaacaagca gccgttgacc acaggaggtc cgagattctc gtcgttgagg agccccggtc    354420
     cgatgatcgt gaggtcggcg cagagcgccc gctgtcgtgc cacttcaccg aggctggccg    354480
     gatcgcaata gtcggtgtca acgtcatagg cgagcgacat agattccagc agtttctgga    354540
     tatctttgga gcgtttttcc agtctgacca cgtcctgtgt aaatcgatcg atttgccgaa    354600
     accgatcgtt caatctggca attgcctgtc cacgccctac cggccactcg gggacaccat    354660
     ctccgatccg ccgatgcgac ataaggagca tcggaggggg tatgatcagt acggaaaggt    354720
     gcgcgccgac ttccgcacac aagccggcag cggttctgac gtcctgatcg gaatggtcag    354780
     cgccggtcaa acagagtacc gttttaaagc ccattttcct gcttcttcct gagtgttcga    354840
     tgagggcgtt tcaggccgcg agaccggctc acagcgcgag gaaagggagt ggaaccacac    354900
     ccggcactcg attcagccgt ccagcttctc gagcgagtag ccggccgacc tgacggtacg    354960
     gatgacaata ccggtcgagg ccgcctccag agcccttctg agccgactga tgtggacgtc    355020
     gactgtgcgt acaccgacat ggatattggc cggccaggcc cccccgatca gctcgtccct    355080
     actgaagacc ttgccgggag cctcaagcaa atgccgaagc acgttgaact cgatcggtcc    355140
     gagatggatg tcatggccat tgccgcaaac ccggtgggca tcgagcttca tctcaaggct    355200
     gccataggaa agccagctgt tgttttcaat cgcgtttgaa cccggcttcg gcagcgccag    355260
     cctcgtccgc agataatcga gcagcttggc cggcgccatt ggccgcacaa agctctcgtc    355320
     aatcccggcc ttcaacagat caaggtgctg gttctcggcg ccgggcgcga tcagggcaat    355380
     gatgggcagg ccgccggtcc ggggttcccg cttgagccgg gcgcagattg cggacccggt    355440
     aaggctcgtt ggaccgcagt ccagcaccac ggcctggaat tcccgttcgt cggcctttgc    355500
     aagtgcttcc ttggcgccgc ctgccggctc actgacgaag ccatccacct ccagtatgtg    355560
     gctgaggaac agatagaact ccgcatcttg cgaacagatc aggacgagtg gcttcatcag    355620
     cgctaccccg agaaccacat tggcctcgac cgcgtcggcc gcgtgggctg gccatcgcgg    355680
     ctcctcaagg cctgacatga tcctcttgct ccaaaattgg tttcatgccc gtgccacctc    355740
     gggataggcg tcgatggctg cgatggcatc gtcgaccagt ttcgtaccgg ccgcggcgag    355800
     tttgcaaaac gtctcgaagc cgaagcgatg ggcgtcgcgc agggtcctgg acagaacgac    355860
     cagccgcccg gcggtgaaaa gcacgcgccc gaacccctca tggctcattt cgatcatcgg    355920
     cgatgccatc aggccggagc gctcctcgat cgcaagggcg acggcagtgt aaaacttgtc    355980
     gagcctccac agcacgtccg gatcgggatc gccgatgatt ggaatcgtac gccgctgttc    356040
     cttgctgacg atgaagtcgg ccagcaactc accgtccgct gtgccgtccc atgacccgtg    356100
     ggaatcctga gcacggatca gccgcacgag gcatttgacg aacgggctgg caagggccgc    356160
     ctcgtcatcg ttgacagcag ggctaatcgc gacttcaaac attttgctct ttcctcgttt    356220
     tagtcctcgt cctcgaagga gggtttcttt tcggcgacac cagcttcggc cagcaccttg    356280
     cgcagccagg gcggaggaca cgttctcagc atcatctgcg tgcgcaacag cacctcttgg    356340
     atggtttgtg gctgcggcac cttgattgga tggatttttg ccgaaataac cttggctgcc    356400
     gaaggcccgc cgatggccag acagaacagc agatggcagc ccttcagcgc ctccaccttc    356460
     ggcgtgacgc ggtcatcgcc ctcggtccga cgcttcccgc tctcatcgga aacgtcatcg    356520
     aaggccacgg cttccacgag atgccactcc tcgcgcgtca cgtcgtagac agcaaagcgc    356580
     ttggccgacc cgaaatgagc attgagattc ttcatgtctt gcgtggcgat ggctacgcgc    356640
     aatgcgccta ctcgtcgttc cggcattggt gcgtgaacct cgtcagtgac gagtgagagg    356700
     cgacgaacgg agctcatctg gcatttctcg tttccggaat ggatcaagcg cctcaggcgt    356760
     cggcgcgtgc tgattggcct ggaagatgtt ggcaacatcg aagatcaggt cgcgcgtccc    356820
     ccgatagagg attgtgagct tgtgctggct gccgagccgg tcgaagatcg ggaagccgac    356880
     gcgcatgagc ggaatgccaa ggcgtcgcga cgcctggcga ccgtgggaat gcgtaacgag    356940
     aagatccgcg cccgctgcaa gaacttccaa atcgccgaga tcgccgatct gaacccagtc    357000
     cgccggtact ttttgcagaa tcttcgacat atcggtcgtc gtgaccgccg ctgcgatttc    357060
     gcagcccatg ccggtgaaga aggttgcgag ttgatagagt tggtctggtt ccgcagcgat    357120
     cgcaattctc ttgcctccga aatggaaatg tccgtcgagc aatgcatcct ccaattgcgc    357180
     ccggcgacgg cgaacccggg ccggcaccgc cgcgcccgaa accgccgata gcagcgagac    357240
     gaaccggtcg acggccttca atccggtcag cgactggaac accgcgtaag gcacgccggt    357300
     caacccgtgc agcgttttcg ccgggtggcg catgtgctcg ccgatgacga tgcattgcgc    357360
     ggccgtgcca agctcgcgga tttcctcgac gctggtgccg ccataggtag tggttaccca    357420
     gcggtcagga accgtgccgt cgagtgagcc ggagacgtcc ggcaggataa ccggcttgag    357480
     cccaaaactt tcaaccatgt cacgcaaatg ctcgacgtca gcgacagtga gattgcatcc    357540
     gggcaggatc gcgatcttct tcggctgccg ggtccgtgcg cccgaccgtg taatcccttc    357600
     gatcatcgcc gcgacagcct tggcccagcc ttcttcgata gcgccgccga aatcaggcgt    357660
     gttggccagc acaacctccg tacccgcgag ctcttccgca tgcttcagct tgacgttggc    357720
     gatatcactc gcgcagtctt cgccacgggt ctccaccagc gcggtcgtgc acactcctat    357780
     cagctttggc ttagtgcggg ttttgaggtt gaggatcgcc tcttccagat ggtccgctcc    357840
     gccgagtatg gttgccacct catccatcgc cgttgtctgc aaggggatcg cttccttgaa    357900
     atgccgcacg aagagcacga gcgcgaagct ggtgcagcct tggctgccat ggaacagggg    357960
     catcgcaccc tcgactccaa gaaaagcgaa ggcggcaccc agcggctgcg acgacttcag    358020
     cgggttgacc gccgctgatt tgattttgcg aaggatgcgg accatcgaat ttcctcaacg    358080
     gttgccgaag cggtgagccg tcgcgccagc aaattcattg aaggcgttca cagtcgcggt    358140
     cccgttcttc atgctcgcca gattgtcctc cacagcaggc tggcgatccc acggcgccgg    358200
     ctcccgcacc tggtcccaga tcgggctatg aatggcgagg tcgatctgcc ggacaagttc    358260
     caccatgccg tcatagccgg cataaggatg ttggcgctcc tggttgatat cgagccaggg    358320
     tgtcttggcc ttcagcgcga tgaattgcgt gcgcccgccc gacagcatga tgtcggcctt    358380
     gtgttttgag agcatggcgt aaagatcgag cgctgccatc tgctcgaaca tgtggttttc    358440
     gtccttgagg atccgcttga tccgctcctt gtcttcgact gtggatttct tgaccgaggt    358500
     gccgacgatc tccatgccga tctccatcag cgcgtggacg actgaccagg acttcacacc    358560
     gcccgtattg agcagcacgc gcttgccttg aagccgctgg cggtaggcct cgagcttctt    358620
     ccacgcaatc gcctcctgct cagcgatcag cgtgtccgtg cgctcgagga tctccgcatc    358680
     ggcgcccttc ctcaccagca gctcagcaat gttgcgaagt gcctccgagg tatcggttat    358740
     gccgtagaag gagccctcga agaacgggat gtcccagcgc cccgccatct tgcgggccag    358800
     attgatcagt gcgctcgagc acaccaacat agccgcctgg gagcggtgcg cggatgcaac    358860
     gtcgatgtaa cgcgcatcgc ccggaatgca ggcgcgcacc cggatgccga gccgatcaag    358920
     cagcggcttc accagccaga attcgccgga gaggttgaat tcgccaagga tgttgatgtc    358980
     gtagggcccg gcgtcgtcgg gttccaccgt gccgatgaca tgatcgagca acgcttcggc    359040
     ggcgagtttg ttgccgaggt tcttggagcc ggccaagccc ggcgcattga tcggcaccac    359100
     ggccaagccg aatttttcgg ccgcgcgttt gcacacggcc tcaatgtcgt cgccgatcag    359160
     cgccgtcacg caggtcgaat agacgaagac tgccggcggc gcatatgttt ccttgatctc    359220
     gcggatcgcc ctgaacagct tccgctcgcc ctgccccatc acgacgtcga gttcggtgag    359280
     gtcggttgtg aagcttgtcc gccacagggt tggcccggac gaggctgcgc ctctgttgtc    359340
     ccatgaattg ccctcgcagg cgagcggtgc atggaccagg tgcgcaacgt cggtgatcgg    359400
     ctgcaggacg atcttggcgc cgtcaaaggc gcagccgccg gctgccgccc cgggggtcag    359460
     cggcttcgag cagccctgct tgcgcgcctt ggcatccttg ccgcggttgt tatcgcaggc    359520
     gggctcgtcg aaaacgtcct ggatcttggc actgagcgag gtcattgcgt cagtctccga    359580
     agtccattgg gcgattggcg gcctcggcga aaagccggca cgggcttagc gggtgaggtc    359640
     ataggaatag tccgtcacgc ccgtttcgct cgtctcgcga tcgagcttgt cgaatatctt    359700
     gtcgaggatc gtcgtcagca cgcgtaatcc accctggtag cccatgaggg gaaagcgatg    359760
     gtgatggtgc cggtcgaaga ttggaaacat cagccggatc agcggcgtgc cggtgtcgcg    359820
     ctccagatac ttgccatagg aattgccgat cagcaggtcc accggctctg taaaaagcag    359880
     cgaacgcatc gcccagagat ccttgcccgc ccagacctgg gcatcctggc cgaaggacga    359940
     ggatgcaagc aactccttca tctcggcctc ccaggccgat gtgccgttgg tcgcgaggca    360000
     atgtgtcggc tcgccgccgg tctccatgac gaagcgggcc atggcgtaga cgaagtccgg    360060
     atccccatag attgcgtact tcttgccgtg cagccatgac tggctgtccg ccatggcgtc    360120
     aaccagtcgg ccgcgctcca tccggatcgt ctcggggatc tcctggccgg aaatcgctga    360180
     gaccttcatc aggaattcgt cggtcgcctg gactcccagc ggatagtgga aggatgccgt    360240
     cgcctgcccg acctcgttgc aatattccag cgtcttgcgg gtgttgtaat gctgcagcga    360300
     cagtgtcgcc tccgcgttga gtgccccttt cacgtcttcg atcttcgtgc caccgtcata    360360
     catgcggtat tcaccgtccg acggcgtgtc gaactggtct gaggcgtctt gaatgacggt    360420
     ataaatgaca cccatcaggt cgaggaggcg cttgagttcc cggttgtttc cgacgcagaa    360480
     tccgtcgaag cctggaatga tgttgatggt cccagcggct tgcgagcgct cgctgccctt    360540
     ccagaaatgc tccagcacgc ccttcaccat gccgtcgtag ccatcgacat ggctgccgac    360600
     gaaggcaggc gtatgagcga aaggcacgtc gaagtcgcac gggaccgagc cttcgttctt    360660
     ggcgttctct atgaagctcc gcaggtcgtc gccaatgacc tcggccatgc aggtggtcga    360720
     gacggcgatc atcttggggt cgtagagctt gtatgtattg gcgagcccgt cgaccatgtt    360780
     cttgaggccg ccaaacactg ccgcgtcctc ggtcatcgag gaggaaaccg ctgacgaagg    360840
     ctccttgaaa tgtcgcgaca gatgcgagcg gtagtaggca acgcagccct ggctaccgtg    360900
     gacgaaagac atggtgcgct cgaagcccgc ggccgcgaac accgcaccga gcggctggca    360960
     ggccttggcg gggtttatga caagcgcctc gcgagcgagg ttcttttcgc ggtattccca    361020
     agtcttggtc aattcgcgtt gatcggtgac gatctgatca gggtgcggac attcgaaatt    361080
     cagtttcttc tcggcaagca tttgtctgta ttccggctcg cggaacaatg gagcatggtc    361140
     gagaactttt tcggccgatt gcggcatggt ggttaccttt tccatctggc tgcggcaagc    361200
     ggcagcacag ggacatcgaa acttgaaggg cctctcgcgg atcgagtgcc cccgagcatt    361260
     tatcggcctc cctgcctggc agggaggcca gtcctcattc ggcggcgacg gccctcagcg    361320
     gtgcgtcctt catcttcttc cacggcgcgc ggtagagacc ccagaccggg ttgttgatgg    361380
     ccagatccat gtcgcgggcg aaaatggcga agccgtcata gccgtgatac gggccggaat    361440
     agtcccagga gtgcatctgg cggaacggga tgcccatctt ctgcaccggg tacttctcct    361500
     tgataccgga gccaacgaga tcagggcgga tgccttcgat gaacttctcc agctcgtaac    361560
     cggtgacgtc gtcatagatg agcgtgccat ttttcacgta atggccggtg cgctgatagt    361620
     cgtcgttgtg ggcgaactca tagccggtgc cgacgatcac catagcgagg tcctcgtaag    361680
     cagtgatgac gtgacgagga cgtagcccgc cgacatagag catcaccgtc ctgccttcga    361740
     ggcgcggttg gtacttggcg atgacggcat cgaccaaggg ccggtatttg gcgatgacct    361800
     tttcggtctt ctcctcgatt tccgggccga aatgcttggc gatgttgcgc agagaggcct    361860
     cgatctggga ggggccgaag aaattgtatt ccatccaggc gatgccgtac ttttcctcca    361920
     tgtgccggca gatgtaattc atcgaccggt agcagtggat caggttgagc ttggccttgg    361980
     gagcgcgctc tatttcggcg agtgtggcgt cgcccgacca gttgccgacc acccgaagcc    362040
     caatctcttc gagcaggatt cgcgaggccc aggcatcgcc gccaatgttg tagtcgccga    362100
     cgacgttgac gtcgtatggg ccggactcga acgcgacatc gtccttgtcg aagacccaat    362160
     cgcggatcgc atcattggca atgtggtggc cgagcgattg tgaaacgccg cggaaacctt    362220
     cgcagcgcac cggtacaatc gtcttttcgt gctccttggc tttcttgcgc gacacggcct    362280
     cgatatcgtc cccgatcagg ccgatcgggc attcggactg caccgagatg ccgccactga    362340
     gcggaaacag gtcctcgatc tcgtcgatga tcttttccag cttcttgtcg ccgccgaaaa    362400
     cgatgtcctt ctcctggaag tcggaggtga actgcattgt cacgaacgtg tcgatacccg    362460
     tcgtgccgac gtaatagttg cggcgttgcg accaggaata ttgcccacag ccgaccggcc    362520
     cgtgcgagat gtggaccata tccttgactg gaccccacac cacgcccttg gagccggcat    362580
     aggcgcagcc gcggattgtc atcacgcccg gaatggattt gatgttcgat ttgacgtcgc    362640
     attcggaaag gcccttgtcc tccccgccgg cctcgtcctt gctcgttgcg acactgaggt    362700
     gcttcttgcg acgcttcgcc gccttgtctg gatattggga cagcacgtct tcgataagct    362760
     tcgcatgcaa agcgccgtca ttctcatagt cgaggcccat gggacctgcc cctttcaagg    362820
     ttcgggtaac gcctcgccaa cgaggccttg tttcgtacaa aggggcgcca ggtcacggtc    362880
     ggcgccccct gtcggtagcg gcggctactg agcgacggcc aatttcgctt ccttggcctg    362940
     aagctcggca agcatttgct cgtccgtctt catgatgccg aagtcgagca gcatgtcctc    363000
     gagctcctcc atggtgattg gggtcgggat ggtgccctgg cccgaattga catggatctt    363060
     ctcggccaac gcgcggtact cccctgcctg tttggagtcc ggcgcatact ggattaccgt    363120
     catctttctc agttcggcgt gctggacgat gttgtcgcgc ggcacgaagt ggatgagctt    363180
     ggaattgagt ctggcggcca gcgcctcgga gaggtcgagc tcgcggtcgg tctgtcgctc    363240
     attgcagatc agcccgccga gccgcacgcc gcccgaatgg gcgtatttca ggataccctt    363300
     ggcgatgttg ttggcggcat agagcgccat catctcgccg gacatgacga tgtagatttc    363360
     ctgggccttg ttttcgcgga tcggcatcgc aaagccgccg cacaccacat cgcccagcac    363420
     gtcgtaggag acatagtcga cattatcata ggcgccgttc tcctcgagga agttgatcga    363480
     ggtgatgacg ccgcggccgg cgcagccgac acccggctcg gggccgccgg actccacgca    363540
     cttgatgtct ttgtagccga tcttgagcac gtcctggagt tcaaggtctt ccacagaacc    363600
     ttcttgggcg gcgagatgca gaacggtatc ctgcgccttt gcgttcagga tcagccgggt    363660
     ggagtcggct ttggggtcgc agccgacgat caggattttc tgtccgaggt cgaccagggc    363720
     ggctagcgta ttttgagagg tggtggactt gccgatgccc ccctttccgt agaatgcgat    363780
     ctgacgcaga cctgacatgt tgcttccttc cttctttcca tccatagcgg ttaccgcgac    363840
     ttcaatgccg gtcggcagat cccgccgcct cgcaccgatc gtttcaaaac tcgtgccaat    363900
     tcggccagtt agatcgaaga agaaatttta tgattgcttt tcagctattt aacatttggc    363960
     aaaaatatta aattggctaa atagacttgt gtcgcgggcc cgacaaaggc gacaggagat    364020
     gtcggatgag gccggcaatc gcctcgagat gacgttgctc cgggccggcg tcgggaagcc    364080
     tccacggaaa gaacccgcgg gcatgcagag cggtgaagag cggttgtggt cgtgacgccc    364140
     tcgtccatgg cggcgcgggc gtaaccggtt agccgatccg acttgtagaa ctcggtgaac    364200
     atagagattc gtcagcgtca cgaggctcgc cacgcacttc cgaatggccc atgttcttcg    364260
     tcttcgagcc aaccgactgg atcagtttct ggtaggcaac gttcgcgacc cgcaacgctg    364320
     tctccgcagc cttgttcgct cgcctgcgaa cttcaggcgt cgaccaagct tggacactag    364380
     gtcaggcagg ctttcgccaa cgtcgtcgtc ggcaagctct ggcgttcgct tgatgagacc    364440
     gtagattgcg tggacgacct cctgcggtgt ggggaaggac gcaccacgag agaaaagcgc    364500
     tcataggtat cgaggagcgc cgcttcgtag aggaaccgga atttgcggga taagatcaaa    364560
     agagcgtcat cattaagata acggaagagt gtcattcgtg gcatttaccc gaggtgccca    364620
     cgaattgtat gccaccgctt agcgagccaa ctttttcatg aacttagcga cacagcgaaa    364680
     gttgcgattt tggcgatagg tacggtacgc ctggcgctct tgcttgccgt ggaaccatca    364740
     tcgcggtcac aacgaagtcg tgcgcttcaa ttgcggtgcc aactctttcc tgcgattatt    364800
     ggcgggggga gcgggcgatg attaaaggct caattgctgg atgcttgttg gttctgacac    364860
     cgctgccggc attggccggc gatttcggtg gtctgacgtt aacttcgacg tgcgaccaat    364920
     ataacaagtc atcaggttcg aaccgcgccg gcttcgtcca cgacttgatc gtcggaacaa    364980
     gtgccgcaac gggcaaagac taccaatccc accgcgttga cattcaagcg tgtgttgcag    365040
     cgacgttcgc cccaccctgc gtgacgggaa caacatccat ccgcgaagtg ttggccgctt    365100
     gcatgctgat ggtaggcaac taaatcgatg agagcagtat cccgtgcctg tggctgttga    365160
     agcggtttgg acgagcaaag agatcatcct cgcgatcatc gcgacagggc taatttcggc    365220
     tttggcaggc tgggtagccg atttcgttaa ggagcgttgg tccgaaaagc ggtcagcgcg    365280
     atacgcggcg atgcggtgcg cgatcgcctt tgaaagctac gccgcagatt gctggaacaa    365340
     tgccaatatg agcgagggcc attttcatat ggccgaggag gcctattcgg agtcccttcc    365400
     accggcgcct gtcattccgg aggatattga ttggcgttca gtggatccga ttttggcgga    365460
     tgcggtcttg tcctttatga cgtccagcaa gatcgcggaa tcagaggcgg cttacgcacg    365520
     cgtctacgaa ggcaacccct tcgacttcga cgatgctact cggatgctgg gacgtcgggc    365580
     gctggaaata tcgtccaaac tccgctcacg atatggcatg cgaccaagtg cagagtacga    365640
     gaagatgcat aagcggttga aaggcagcgg ctagcctgtc tggctggatt gacaagaccc    365700
     gccaccgtag cagcgggcca aattccaatc cggtggggat ttcactcgta ccggaaatcc    365760
     tgcagcgagg cgtgacgcaa atcctcctcg cctcgcccga tcagcccagg cttggcccat    365820
     atactccagc gcacccaatt ttttggcgat tatgtacttt acaaaccaag cctcaatagg    365880
     tatcgtgaac tatatatcag ggttgccatg tctatctttt ccaagcctta ttttcatgat    365940
     gaagcagccg ctttcgagca ccttgaggag gtgctctgga ggggcgagcc ggtatgtccg    366000
     cactgcggca cgatcaacaa cgctaccaag ttgcaaggtc aggctacccg agttggcgtt    366060
     tggaagtgca aagaccgcca ttgccggaag cagttcacgg caaaggtcgg gactgtgttc    366120
     gagaacggcc gcattccttt gaacaaaatg ttgcaggcgg tgcacctgat ggtctcctcc    366180
     aagaagggga tcagctcgca ccaactgcac cgcatccttg agatccagta caagagcgca    366240
     tggtttctgg cgcaccgtat ccgtgaggca atgcgtgacg gttcactggc gcggattggc    366300
     ggcggtggcg gctttgtgga ggctgacgag actttcatcg gtcgcgagcc cggaaaagca    366360
     aagaagcgcg cctaccatca caagatgaaa gtgctttcgc tgctcgaccg cgagaccggc    366420
     caaacgcgca gtatggtcgt ggacgacctg aagccggcga ccataactcc aaacttggaa    366480
     gagaacatcg ccaaggaagc ccgcgtcatg accgaaggcc ggacactatt tccacctcaa    366540
     caagagcttt gctgaacaca gcatcgttcg gcatggacag gaggagtatg ttcgctacga    366600
     cgctcgccat atccacccac accaacacga ttgaaggcta tttttcgatc ttcaagcgcg    366660
     gcatgaaagg cgtttaccag cactgcggca agaagcacct gcaccgctat ctggcggaat    366720
     gtgagcgctg taccggcacc acctttcgcg cgtggtcgtg agcagcgatg ttcggagcct    366780
     ttgagggctt cgacacatga cgatttcaga gcttacgctt aagtccaagg attctgagcc    366840
     ggcgcgacgt ttcgaggtgt tcacgggttc tggacggcgg cgcgattggt tgccggagga    366900
     gaaagcgcgg atcgtggcgg aaagctacga tgctggcgag accgtgagcg cagtggcccg    366960
     gcgacatgca ttgtccccgc agcagctgtt cgcctggcgc cggtccgcgc gggtgccgtt    367020
     ggcgaatgcg ccagcaccgg agccgttgtt tgttccagcg gtggtcgcgg cacaggagcc    367080
     cgaaccggcg gggaagcgcg cgagatcgac acggaagcgg aaggccgcgc gagaaaccgg    367140
     cgtgatagag ctggagattg acggcgtcgc catgcgggtc ggtcgtggcg ccgacgccag    367200
     gacagtggcg gcggtgatcc gtgcgctgaa ggcgccgtcg tgatcgggcc gacgggtgtg    367260
     gtcaaggtga tggtcgcgac gaagccggtg gacttccgca agggggccga gggcctggcg    367320
     gcgctggtgc gcgagacgat gggcgccgat ccgttctctg gcgcggtcta cgtcttcagg    367380
     gccaagcgcg ccgaccgggt caagctggtg tacttcgacg gcaccggcgt gtgcctgctg    367440
     gcgaagcgtc tggaagacgg gaagttctgc tggcctgcca tcaccgatgg cgtggtgagg    367500
     ttgtcggcgg cgcaattgca ggcgctcctg gaagggttgg attggcggcg cgtgcatgac    367560
     gcccgcgaga cgcgcgcgcc ggtcgcggca agttgattcc atgggaggct agaggcgctg    367620
     gcaaagcatt ggaatgcatg attgaatcgg ccttgtgagc aacccggccg agcctcagac    367680
     caacgatccg atcgcgcttc aggcgatgct ggcggcggag cgcgccgaga acgagcggct    367740
     gcgccagatc atcaaggaac tgcagcgcca ccgcttcggc cgcagagcag agagcctgcc    367800
     ggtcgaccag ctgctgctgg gccttgaaga ggccgagcag atcgaggctg aaggcttcgc    367860
     cgcggaggac accgccgata ctgccaagcg cgaggctcgc gccaggaagc gccgcgccaa    367920
     ccgtggatca ctgcccgcgc atctgccgcg tatcgagcag atcatcgaca ttcccgacta    367980
     tatctgcccg tgctgcaagg ggatgctgca cgtcatgggc gaggatcgtt ccgagcgcct    368040
     cgacatcgtg ccggcccaat tccgcgtcat cgtcacgcgc cggccgaagt atgcctgtcg    368100
     gagctgcgag gagattgtag tgcaggcgcc ggctccgtcg cggctcgtcg agggcggcat    368160
     cccgactgag gcgaccgtcg cccatgtgct ggtctccaag tacgccgacc atcttcccct    368220
     gtatcgccag gcgcaaatct acgcccgcca aggcgtgaac ctggatcgct caacgcttgc    368280
     cgattgggtc ggcaaggcgg ctttcctgct ccgccccatc cacgagcggt tgttcgagcg    368340
     gctgaaggcg tccgggaagc tcttcgccga cgagaccacg gcgccggtgc tcgatcccgg    368400
     gcgcggccgc accaagacgg gccaactgtt cgcctatgca cgcgacgatc gcccctgggg    368460
     cgggatcgat ccgcccggcg tcgcctatct ctatgcgccc gatcgaaagg ccgagcagcc    368520
     actgcggcac cttcagggct tcgtcgggat tctgcaagtc gacggctacg cgggataccg    368580
     ggcgttggcc gagcgcaatg ccgtgagcct ggccttctgc tgggcccatg tccgtcgccg    368640
     cttctacgaa ctggcccagt ccgggcccgc gccgatcgcg acagaggcgc tccagcgcat    368700
     cggcgagctc tacaagatcg agagcgagat ccggggccgc ccggcggagg agcgctgcgc    368760
     tgctcgccag cagagaagcc gacccatcat cgacgccctc gagccgtggc tgcgcgggaa    368820
     actcgcgctg gtcagccaga agagcaagct cgccgaagca atccgctacc cgctgtcgcg    368880
     ctgggctggg cttggtcgct tcctcgacga cggccgcgtc gagatcgact ccaacgtcgt    368940
     cgaacgctcg atcaggccaa tcgccctcaa tcggaagaat gcgctcttcg ccggttccga    369000
     cggcggtgga gagcactggg cgacgatcgc ctcgctcgta gaaaccgcga aactcaacgg    369060
     cctcgacccg tacgcctacc tcgccgacgt catcacccgc atcgtcgcag gccatccgca    369120
     aagccagctc gactacctgc tgccctgggc gtatgccccc gcgccactca aggccgtggc    369180
     ctgagaacag cggttacggc ggaatttgac ttccgctaca acaaccgcgt ggcgttgggc    369240
     gttgacgatg ttgcccgggc tgaaaagctc gccaaggggc tcggcggaaa gcgcctgacc    369300
     tatcgcaggc ctgacgtcac cacagcctaa gcgccggctc acaccgcgcg agctttggga    369360
     ggcgatgaag cggaagcacc gctaggcggc gcttcggtat tgaggtttgt gaacctgtgc    369420
     gtctcgaagc tcgtcgggca ctttaaggcc cttggatacg acgagaagtt ccgagccaac    369480
     gcgctttacc tgagccgagt agttgagaga aatctcatac tgcctgcgcg tcttgtagag    369540
     agcgcttatt tcgtcgcagc ggtcgtaggt gattatccaa ggcctatcga ggcccaggat    369600
     tttcgtcgcg accgctgcat ggtcctcggg atcgtagaag ctcgtataga gggtcgagcc    369660
     ttttttgaag tacggcggat cgatgcaaag gaatgtgcgt tcggggaggt ttcgttcgac    369720
     gtgcttgagg aagtctagcg cgtcctttct gtgcaggtgg atgtggtccc ggtatctttg    369780
     cactcgccta attcgccgct ctaattcgct cttggtgaag cggcaatcaa tcttgtagtc    369840
     gcctacctga ccgaggccac cgataacccc tgcgttcttg atgattccgg agcgatttgt    369900
     tcgattcagg aagaacgtgg tgaaggctat ttctagtggt gataggccgc gctgatttcg    369960
     ttgcatttca cgtcttcgac gccattcgtc gagcgtgaca ggcgttcgat tcatcaagtc    370020
     gatgaaatcg tctgtttggt tgaggacgac attccaaaac gcccatattc cgcggtcgat    370080
     gtcgttgatg tgaatgtcgc tgacgtagcc gccgtaaagc aagccgagcg ccagcccgca    370140
     tcccccggca tagggttccg catagtgccc gtactgcaat ttgttcagac ggatgatttg    370200
     ggacacaagt cccgtcagtg gagcttttcc gcccggatag cgcagcggtg aggttgccaa    370260
     aggcatatcg caaacgaccc ttcactttga aatgatgggg gattttagcg agttcgtttc    370320
     gccacggcca tagctatttt cgcggcttta tggattcggc cgttttggtc aacaatggcg    370380
     taatcgtcgc cagatcgttc gcgagttgca acctgtcaaa attcgccgat gtctgatgat    370440
     gcttggttgc gtttccgttg cgggcaatac gcatcaacgc atcgcggatc ggattgagtg    370500
     ccctgccgct tgcgaggccc aagtctgaca tcctttgatt gctgaagaat gcgttgaaat    370560
     cagtgtccgc attcttgcct gcgagggccg ccagcgattc aacaaatgcc cacacgccaa    370620
     tcgtcaggag caacgtatgt tcgacgtgca ccgcgcaaat cgaatagtag agtgcctcaa    370680
     gcttggaatt tgtgttgtcc tcaagagcct ttgcaaggcc cttttcgtat tccagatggg    370740
     atacgggccg cggcttctgg ggctgggctt tccggcggct tttcaccacg gccggcgtga    370800
     ttgttttcag cgaaatgggc tcggtgcgct cgccggtgat atccgaactg gccgccagct    370860
     tgcggccgta ggtatcgatc tgcgcacgat tccgacgtga atttatcttt tcgccttctt    370920
     tgagatcatc aacgaaccga gcgagctgct tctttatgtc gtcggacggt cgagtgtacg    370980
     tcacatcgtc agggctgctt gagtcgatgc cgatcgcctc tcgcacaatg ctgctgttca    371040
     ggaaacgttg cgctgtcgtc agcttgcctt ggcgttcgtc cttcgagatg aagcctaggc    371100
     tttcggcggc atccaatacc gcgagggcaa ccctgttgcg acttgacccg aagtggcgcg    371160
     ctttctgcgc ggcatcccag tcaagcagac caacgccgcc ctgcgcgcca tcgtggatga    371220
     tccccatcca atatttgagg tcgtcatggt cgccgaaaac aacagcgctt agcttcttga    371280
     tcggaacatg gcccgaggtt gacgatagcc gggcaaaatc cttccggaga tgcggcggcg    371340
     caaggtccgg atcattaagc agtttgatcg cgcatacccg tcggttgcct tcccaaacct    371400
     ggtaggtctt ttttgtggcg gccgatccgg aaccgggaat ctgaacgagt ccaaccaatt    371460
     gcagcggatt tggcccggct tccgcaatgc ttctggcgag attgaaaact tgttcatcct    371520
     tgcacagata ctctataatc tcgtcttgag attccatagg ctcatggcga gggttttcct    371580
     catacaggta gattcgattc acctcaatag aatccggctg tcgagttgtt gccactgcgt    371640
     ttccccccaa gaattgtccg tcatcggaac aggacatttt tagtatgacg gatgagaaac    371700
     acctaacgca atctcagaag tttgaacagg cagcccgcga attgggctgt gatgattcag    371760
     aggaagtgtt cgacgctaaa ttgcgggcga ttgccaagca gaaaccaaaa gatgagcacc    371820
     cgcgccagaa agccggcaag cctcggtcgc actcaaagta ggggcgacgc cggtcatgcg    371880
     tgtagcccgt atctagcggt tggtgcgaaa agtacataat cgcagttttt tcgcaagcgg    371940
     gggtgtatgg cgagttgtca ctggacggat acgattcaaa actcgtgctg catgacgtcg    372000
     agcatgagct ttacccagga tcgttggact taaccattca cggcgttgtc gaccatacag    372060
     ttaagatctc tctggtcgat tgcatccgga tgggcagcaa cagaaaagca gatgctaaat    372120
     ggactatttc aaaacatttc gtcaccatat aatatttggt ggtattaatt tcaacgacat    372180
     agatagatat attaacttct attcttcccc gtctgactga ctcctccaaa ctgttctgtg    372240
     actccgatac attttgaact attatcgacc tcgatcttgt caaagcgacc ttggctgcta    372300
     atgctgattt tttcaaggcg tacgatacac atgctgatcg acagagccgt gtcacgcaat    372360
     caggcgaccg caaacaaccg gtcagcgaca gctcggcgta cctcttcgtc atggaagatg    372420
     ccgacgatcg ctgccccgcg cgccttagct tcggtgatga ggtcgacgac ggtggcccgg    372480
     ttggcggcgt cgagggatgc agtcggttcg tcgaggagta tgatgggata gtcgacgacg    372540
     aagccgcggg ctatattgac acgctgctgc tcgccaccgg agaaggtggc tggtgcgagc    372600
     ggccagagcc gttcgggaat gttgaggcgc gtgagcagcg ttttggagag cgccttggcc    372660
     tggtcggccg ggatgccctt ggcgatggcg gggcccgcga cgacgtcgag ggcgggcacc    372720
     cgcgggatga cgcgcaggaa ctggctaacg tagccgatcg cgctgcggcg gatttcgacg    372780
     acctcccaag gttcggcggc gaggagatcg acggtttcgt tcctatgtac gacgaggatc    372840
     ttgccggcat ccggcttata attggcgtaa agcgagcgca ggagcgtcga cttgccggcg    372900
     ccggaaggac cgacgaggca gacgcactca ccggcgttga ccgtgagttc gatattgtcg    372960
     aagacaggca ggacaatgcc gccctgggcg tgcagcgtga aggtcttggc aaggccaacg    373020
     gcgcgaagtg cggggtccgt tgctgaggat atcaccagac aattctcctt gagggtcatc    373080
     ggaccgtatg cttgcggtcc gctttctatc aaaatacttg acgaccttgc ctccacactc    373140
     cgcgaacaac gggaatgtcg gcgatttcaa cgatgtggca gagatcggcg cggccgccga    373200
     ttccaatcat ccctctgtcg caaaagccgg tcaccgaggc agggaccgaa ctaaccgtgg    373260
     aaatggcctt cgtaagactc atcccgatcg gatcccttgt cagttgaaag gctccatgca    373320
     acaggctcgc cggaacgtaa tccgaggcaa ggatgtcgag gtgaccggtt gtcgccagct    373380
     cacgggcgct tatgtttccc gagtgcgagc tgccgcgaac gatattcggt gcgcccatta    373440
     agatgcaaat gccaagggag cgcgcaatct ccgcagcagc ccgggttgtc ggaaattcag    373500
     agatcaaaac tccagcgtca ttcgcttctc gaacatgttc aggtgtttga tcatcatggc    373560
     tggcgagcgg cagttgccga gcgcgcgcaa gggcaataat tcggcttcgg ttttgaggtc    373620
     ctatcgtccg tgaggcatcg atccatgctt cgattcgacg gtcggcgtcc tctgccgacc    373680
     agccatactg cttgatctgc atttcacgga agcggtcgag ttggggcgat tggcgatgac    373740
     caggggcatg gtccatcacc gatacgagtt tcacaagcgg atcgccgacc aaaggcgtga    373800
     acacggacat cacctcttcg tcggtcacct cgcaacgcaa atgcagaaaa tgatccgctc    373860
     gaagcagtcc atgggccctg gcttcacgaa tcccgtcgat gagaacgggc aggatgcgag    373920
     ctcgatcagc ttgtctggta tgatcccggg tcgttgatcc tatgcaaagg gaatcaaaaa    373980
     ctgtcgtgat gccggctgct atgaccagcg catcgtgtgc catgaccgcc gaaagatgat    374040
     tccacaccac gccggcgcgc ggcagtgcat gcttctccga attgtcggta tggagatcga    374100
     tgaggcctgg cgtcacatag ccgccttcga ggtcgatcgc gccaggcact gtgcttctgc    374160
     cggcggcgat gtcgtcgatg tagccatcga tgatgtggac tgttccatca taaacttcat    374220
     ccggcaaaac aagtcgcgcg ccggttaatg tcagttcgtt cggggagagc tttgccgctg    374280
     cacggtgcgg tgaagtatcc gttcttatga tcattcagag caccgaggaa acgagaagct    374340
     gcgtgtaggg atgatgcgga tcgtccagaa cctggtcggc gaggccggtc tccaccatgt    374400
     ttcctcgcca catcacgatg atgcggtccg ccaatagtcg ggcaacagac aggtcgtggg    374460
     tgactatcac gacagccact ccgatattca tgaccaggca ccgcagcagg tcgagcagcc    374520
     gggcttgaac cgatacatcg aggccgcccg tcggttcgtc cataaagacg aggcgcggct    374580
     tggtaacgag aattctggca atttgcagac gttgctgcat gccaccggaa aacgttttcg    374640
     gtcgatgatc tgtgcgcagc aggtcaatct caacctgggc aagccaattc tgagcttcct    374700
     ctcgtatgcg accatagtgg cgtgcaccga ctgccattgg ccgctcccct atattgccac    374760
     cagcggtgac ttccattcta aggccatctc gcgggttttg gtggacgagt ccccagtccg    374820
     tccgcatcag cttgcggcgt tccggctccg ataaggtcaa aatgtccgtc ggtcctttat    374880
     gattcagatc gtaaatgacg gaaccctgat caggcatcaa acgtcccgac aggcagctga    374940
     gcaacgtcga ctttccggat ccggattccc cgacaatcgc gatgatttcc cctggaaaga    375000
     gatcgaacga aaggtcccgg cagcctaccg tctttccata cattttcgtg agctgccgga    375060
     cggaaagcag cggctggcgg cgggcgggct ggaactgagc cgctgctctc atcgtgattc    375120
     cgatcccgtt gcgattttcg agggtaagag caattcgatg tcggcgggat cgccacgatc    375180
     cggtccaagg tgaccatggt tccggcgagt agtgcagtag tcggtgtccg agcaaacgaa    375240
     catccgacga cccttgtcac tcatcacgat ctcatcaaga taactgtcag tcgccccaca    375300
     aagggagcag cattgcctcc atcgctgcac acgaaacgga tggtcttcga aatccaggct    375360
     ctgcacctgt gtgtaggggg ggacggcgta aatccgcttt tcacggcccg cgccgaaaag    375420
     ctgaatggct ggattgttcg ctatcttcgg gttgtcaaat ttgggaatag gtgaaggcga    375480
     catcaaatat cgcccgtttg tcataactgg atagctgttg gtcgtcgcaa tatgaccaaa    375540
     gcgcgcgata tcttcgtaaa gctcgacact catcagacca tattctgcat aggcatgcat    375600
     cttacgggtt tcggagtccc tcggttccag ccggcgcaac ggttcgggcg acggcacttg    375660
     gtagacgata atttgtccct ccttgagagg cgtttcgggc acccgatgac gcgtctgaat    375720
     gattgtggca gcctctgtta tttcggtcgt agcgatgccg gccacacgct tgaaaaaacg    375780
     ccggatggag acggcattcg ttgcgtcgtc cgcgccctgg tcaatcacct tcagcgtgtc    375840
     gtttggtcca atgacactgg ctgtgacttg aatgccgccg gtcccccacc cgtacgccag    375900
     cggcatttcg cggctgccaa acggaacctg aaggcctgga acggccatgg acttcaaaat    375960
     gcatcgccgg atcatccttt tggactgttc gtccagatac gcaaaattgt agggttggcg    376020
     gaagctgcgg ccggctgcgt tgtcatgagg tcccgtcatt ccgcggcctc cttgcttgaa    376080
     cggcggcggt tatgctcctc ccgcaactgt cttatgaatt gcaggtcgcc ctggaaatcg    376140
     acatagtgag gcaaagtgag atgcgagacg aaaccggccg cctcgagatt gtcggtatgg    376200
     gacagaacga actcttcatc ctgaacaggg tattttgctt cctcgccgta ttcgcgacag    376260
     cgcaacgatc ggtcaacgat tgccattgcc atcgccttgc gctcactctt tccaaatgag    376320
     agaccatatc cgcgggtgaa gcgcgcaggc tcgtcttccg agcccccaaa gaaatccagc    376380
     atctggcatt ccgtgacgat gatgtcgcca atagaaacag aaaagcccaa ttcctcgggt    376440
     aggatttcta tcgtgacatc cccaaccctt gtttccccta cgtagggatg ggcagcgcca    376500
     tagccacgca gcgctgaata cgccaaaccc acgacaaatc cctcatcgcc acgggccaga    376560
     ttttgcaagc gctgatcgcg accggcgggc atggcaagag gatctcgggt gagatcgaaa    376620
     accggtgact ggtcgggttc cggcaactcg gcttcaatca ggtcttcgtc ggaaatgctg    376680
     tcgaaggcac gcggaaaagt tggatccagc ggatcatccg cgaccttcgc tttcggcata    376740
     tcgcaatcaa caatatcgag atgatcaaaa tcaagcagcc tatgtgtgta ctcataggtc    376800
     gaaccgagaa tctgccctcc gggaatgtcc ttgaaggttg ctgagacgcg tcgctgaatg    376860
     gccatccggg ctgtatcgag cgcgtttgac actgccaagc gcggtagagt cgtgcgaaac    376920
     gcccggagaa ggaagatcgc ctcaacggcg tcgccttggg cttgtttcaa tgccaatgcc    376980
     gcaagctctc tatcgtagac agagccctca cacatcactc ggtcgacagc gagaccgaac    377040
     tgctcggcaa tctgccggac cgtaagttcg ggaactgctg ggtctccccg ccgatcctcc    377100
     gcaaccaaac catgtgagtt gaggatagcc tcctccccac cttttacggc aacataagcc    377160
     atctagatct ccccggatat gctgcgagga agagcgataa ttgcatttcc ggaggtaaag    377220
     agaacatcga ctccactcgg ataaagctca tgattgagct cccagtcctc ccaaaaccaa    377280
     gatgcaagcc catcaacgtc caccgaaact tcgcgctgga tgcccggtcc acgccaccga    377340
     acaggcggac cgccgtttaa agatggcacc tggacaacaa tcgtcgtcga gacctgaggc    377400
     tccaattctg ttccgggatt gaactcggcc aggcgcggca tcgtcatcgg attggccaca    377460
     atggcaaatg tcgatctttc aacgctgtcc acaaacggca ccccgcagtg aaacccaagg    377520
     tacttgcgaa ccgaaggtag attcgaccgg gaatcgagcc agaccggtgt ttcgcaatcc    377580
     gcaagcgtga ggcagacggc ggcggtcgcc ggatcaaggg gaccgactgc cgcagtggca    377640
     gagaccagcg tttgcggcct gccgacatat gcatacgcat ctaacacgcg gcggaatgtg    377700
     tcctggctat cgaagacagg atttgcgaat ccgggctcaa gcccggcagt atccaaaacg    377760
     ctgatcattc cggactgatg cctcgagcca ttgcgaaaaa gtggacctta gtcgaagccg    377820
     ctttgcggct cttgatctca cggcgggcgg attgcgcgat tccaaattcg gtaacgaacc    377880
     gaagtacgcc gctcgcactg tcatctgttc cttgcaacag cgcatcgaaa actgccgcca    377940
     gttgtgcatg acgctggtcg cgcccgagga cgaaggcgaa gcccgtcatg ccatcggcca    378000
     acctaacggc acatcgggtc atcgtgacct caccaaggtt gaatagggcg ccggtacccc    378060
     cggcgcgtcc acgcacaagc acgaggccgg tttccggtcg gcgaagccaa tcaaattgcg    378120
     gctggatggc caggttgtcc caggcccgct caagttcatc gcatcgggct cgcgcgagaa    378180
     ccgccatcca tcgctgccgc ttttcaactt caatccgcac cggtgttcgc cgcttcgatt    378240
     aaacgcccgg ctcaggtccg ggctcatcag ggtgttggac attgatgcct agatgtctag    378300
     gtatctccgg atagacatag ttcctttttg caacgatttg atgacagggc atcggcccat    378360
     caagtattat tgcgatcccg actggcagag cggccgcctg atccgccaga ggtggtctcg    378420
     cgaataagcc gccgtgttca cacgcgactc ttcgcgctta ttcgttcgtt tcaataagat    378480
     attcgtaccg gtcgcttcgt atgacgctga aagcgtattt gatcggtaag ccatccggcg    378540
     ttacgtcgac attggtctca aaaagtaccg ggctggacga agatattcgc aggagctgcg    378600
     cttcttgcgg gctaggtctt cgggccgtga tccgtgtcca tttccgctta tattccgcga    378660
     tgccgcagcg cttcaaggcg gcagtgggag agttcattcc ctcgaatgcg gtggcgaggc    378720
     caggaacgcg cgctgccgga tagtagctcg ttccggtcgc caaaggccaa tcattgatga    378780
     atgaggtcga cctgacctcg gtaaccagtg ctgagggagc gatgttcaaa tgacttgcaa    378840
     tatcaggttc gacagaagtt tcgttgatcg acagtatctc ccgcttcacg gacttgttct    378900
     gaccaaggag cttataagtg aacctgggat cgctgttcag tttgtgtgaa acgaaatcat    378960
     cagcaacaaa ggttccgaca ccatgctgaa ctcgcaaggc gccttcagat tccaaaacct    379020
     tgatggcatt gcgcacggta tgccgattga cgccaaatcg gtctgccaag acaaaatcgc    379080
     caggcaggcg gccatcctgg aaggctcccg catcaatatc attgagtaga gcggaccgaa    379140
     ccagttccca acgcttcatt gaacaccatt ttcttttcgg ttcgaatcaa tatcgtctcc    379200
     tggagcgata taactgctca ttgtgtatta tcggaaaagc gggcaatcgg aaaatgtatc    379260
     gccgggcagt ccaaggacgc atgaaagcgt tggagttaag cgcgtcgctt cagccccttc    379320
     cgcgacctca ttcggaacag ccggcccgga aataatgcaa acacgatcat ccgcagcaga    379380
     gccaggtcga aaaccatggg tagatttgta tttcggacag ccgaccggtt ggtctgccgg    379440
     atggtgtgcc ggggtctctt cgaaatcaca ttctggcggc gccgtgaaag tggcaattct    379500
     gttgcggagt tcaattggta gatgatcgct attccaggcc tctgcgccat actggagcaa    379560
     tttcttggtt acctctcggc ggtccatatc gctttcaacc aaaacgtgca gcgttgcacc    379620
     ttcggactgc cacacctttc ccggaatgat caggtccggc aagattgatg ttttgatgtt    379680
     acggtggcca tgatcgctga cgatcgcaat cgtgtaatca tcacgccgac ctgcccggcg    379740
     cagactatcc aaacaacgac caacgagaga atccgcgaaa gcgatcgcga aatgagcttc    379800
     gtcgctccca tagccgaagt catgctggaa ggcgtccgtg gcattgatct ccgtaatgag    379860
     aagatcaggt gcctcttctg actcgagcag actggcggcc gcggcgatcg taagctggtc    379920
     accgataagc gtcctggtaa tgctggatac gccgtccggc ccgctgaatt caggtacgta    379980
     agagggcagc gggatggccc ccagtcggcc gcgtggatcc tttatcttca gcagtgacgg    380040
     cgtactccca tcgctgggga tcttgatgaa gcccgggcca cgcagccagc aaggtggaac    380100
     atagatggac gtatcttccg gcttaatgag ggcgtgcccg atgcaagcca cgtcgaggcc    380160
     ggcacgcgag gcaagagtcg caatcgtcgg aacgaggagg tgttctgctt cagctgcaac    380220
     aaaggcgccg tcactcagga tgcgattgcc aaagatacca tgtatctcgg ctccgacacc    380280
     tgtgagtatg gaagcccgac ccggcatgga ggtcgctggt accgcagagc gcatgcggcg    380340
     tacgagatat ccatcggctg ccagtgacga taagtttggc agacggttgg catgtgcttg    380400
     gaaatagtcg gcgctcacgc catcgatcat tatgagaaga agttttcgat gcgtcattgc    380460
     aatctagctc actcaaaaga gattaacgtt ttatacatgc tatccagtgg cctgcgccga    380520
     cttgccgaag atctggcgtg accttggcac attctgcgct ggcaattgag cacctcgttc    380580
     taaagacgca gcctgatgga ggtgtaacag cgctcggaac ttcgcctttc agaactaccc    380640
     gtgctcggcg aagacttgga tggggaacgg gaagcgctga aaccagggct tcggtataag    380700
     gatgagcggg cgcatttcga aatatttcgg ccggtgcgat ttccacgacc ttaccgagat    380760
     acattacgat tacccgatct gctatatggc taaccactcg cagatcatgc gagatgaaca    380820
     ggatcgtaag agcatgcctt tccttcagat caagaagtag attaacgatc tgagcctgga    380880
     ccgaaacatc gagcgccgat acgggctcat cggcgacgac gaaatccggc tcggtggcca    380940
     gggccctggc gatggcaatc ctttggcgtt gccccccact aaaagcgtga gggtgacgcg    381000
     agccgtgtgc tggggatatt ccgacttgag ataagagttc ggcgatccgt acctgccgcg    381060
     cctgcgttgt cagatgagct ttgtggattg acagcgggtc accaacaatt tccgccacag    381120
     tcatgcgcgg gttgaggctg ctatacgggt cctggaacac catctgcatt tgccgccgaa    381180
     aagaatacat ctctttggac gacagagctg tcagatcggt ccctttaaat cggatccgac    381240
     cggaactcgg cgtgacaagc cgcagcaagc tccgacctaa tgtcgtcttg cctgagccgg    381300
     attcgccgac cacgcccacg atttcgccag gagcaatgca aaacgatatt ccatcgacgg    381360
     cttttatgga tcgtttcaac ctgaacggtg agatgttgcg gagtggcaga tggacgcgaa    381420
     ggctgtcaac ttcaagcaag ggcttgccac cataggtgat cgggactgca ccggtttcgg    381480
     gcgtttcaat atcgctaata ttagcattca taggacagcc tccggctccc cagcggcctc    381540
     cacgatttga cgccaatgca tgcaacgcac gctgtgcccg cggactgttt cgaggtccgg    381600
     tgggcggtag gcgcaatcag cggctgcatg gcagcatcgt gggcgaaagg agcagccaat    381660
     tgacaggttt gcgaggtccg gaggatcgcc gggcacggca gaaagccgcc gggaagatcc    381720
     gtctccggag tggaggcccg gccgcgcttt tagtagaccg cgagtgtagg gcatccacgg    381780
     atcgtcgaat atctgcatga catcgccttc ttcgacaatt cggccggcgt acatcaccag    381840
     aacccggtca gcgatctcgg cgacgacgct gaggtcatgc gtgatgaaca gcagtgccat    381900
     gccagtgtcc gcctgcaact cgtgaaggag gccgagaatt tgcgattgaa ctgtcgcgtc    381960
     gagcgctgtg gtcggttcat cggcgatgag taacttaggg cgacacgaga gtgcgatcgc    382020
     gatcattgct ctttgtcgca tgccaccgga cagctggtgc gggtaatcgt ccaggcggcg    382080
     ttgagcgtcg ggaataccga cgcgatcaag cattgccttt gcttgccggc gcgcctcacg    382140
     agcactgcac tgtttatggg ttcgaagaac ctccgcgatc tgctcgccta cggtgcagac    382200
     gggattaagc gccgccgcgg gttcttgaaa tatcatggca atttcgttgc ccaagatcgt    382260
     gcgttgacgt cgttgagaaa tccggagaag gtcctcccct ccatagagga ccttccccgc    382320
     aactacgcgc cccatcgact ttgggataag gttcaggata gaaaaggcag ttgccgattt    382380
     gcccgatccg gattctccga caaggcacac agtactccct tgctgaaccg agaacgacac    382440
     atcttcgact gctctgacag tgcgaccttg ggagtagaaa taggtgcgta gattttcgac    382500
     acggagaagc tcgctctgtt tcatcctaga cttacctagt tgctgggagg tctagctttt    382560
     cacttcgtga agtgaatgtt gtcggggcga aagtccattg tgtattcggt gttcgggagc    382620
     cactgaatac ctgatcggac cccgtagaat tccggtgcgc ggtacaaata cgtgcccgga    382680
     gcttcctcct caaaaaggtc gatcatcttc tggtagatgt cgtgacgacg tctcctgtcg    382740
     agggtcgtct cgccctcctc ggccagttcg tcgaagtgcg cctcgtcttt ccaaaggtcc    382800
     ttcgaccaag tcatgtagag ggtgaccgca ggatccgttg gcacgaccca gtcagagctg    382860
     tttcgtgcgg taagtaccgg attgtccttg gtgagttggg tccatccttc atcgacgcgg    382920
     acactggcat ttacgccaat cgccttccac atctgcacga cggcttccgc aacagcgacg    382980
     ccattggtgt agtacactgg gtgcgtcacg tagaagatcg gctgcccttt gtacgatgat    383040
     tccttaagca gctgacgagc tcgatccggg tcgaacggcg gagtcgggcg attggggtca    383100
     taaagctcgg gtccccatgc ctcgtattgc gccgaatgcg gaagcgtggc cttgccatcc    383160
     catagggcat cgacgagcaa ctggcgattg atcgccagat tgagggcctg tcggagcttc    383220
     acatcggcca tcaccggatt ataggtgttg tattgaatga agtggtggtt catcaagaca    383280
     ctgcgaactt tgcagcaacc cagactttcc acggctttta attgatccgg aggtatgctg    383340
     ttgacaatgt cgacttcacc atttgcaagt gcagttattc ttgccgacac ctctggtatg    383400
     gacctgaacg tcaatctgga gatcgtgggg cgtccacgga agtaggagtc atttgctttg    383460
     agatcgatgc tttcatcagg ctggagcttg acgaaatcga atggacctgt gcccactggc    383520
     ttttgcccaa aaccgctttc tccgaccgac tcgaaatatg ccttcggcac gatttcgctg    383580
     gtgtgatagg ccagcagctg aagcaggatc gggcttggtg ccttcgtcgt gatcctcaca    383640
     gttaggtcat cgacggcgtc gattcgctcg ataaccttga gaagattcct ggcttcgaca    383700
     taatcggaag ccggatccag gatgcggtcg aacgtgaatt tcacatcagc actggtgaga    383760
     ggctgaccat tgtggaaatg aacatcgggc cggagtgaaa actccatggt gcggtcatcg    383820
     atctgcttcc agctctctgc caagccgggc acgagttcat aggacgtccg gtctttgctt    383880
     ttggaaaagt ccctcgcgac cagcgtatca aacatgttgt aggtgatggg taagtccaca    383940
     ttcccgagag ctagcccagg atcgaaattg gcgcgaaccg tgttgacgcc aacggtgagt    384000
     ggcggcctcg tatcctcctg cgcgacagcg aaggtcggca gcagcatggc gatggccaag    384060
     agtagttttc gcatatgggg tctccaagat taaggtgatg gtggctagtc tttcctgcag    384120
     gaaatgggat tggagctgcg gctcttacgt gcggctccgg ggatcgaggg aggcacgcag    384180
     ccaatcaccg atcgtggctg ccgcgacggt gatcataacg atcacgacac acggaaatat    384240
     cgcgagccaa ggtgtggaga tcaggtagtt tctggcctcg ccgagtagcg atccgaggga    384300
     aacatttggc ggctgaacac ctacgccgag gaaagaaagt gaagactcca gcacgacgat    384360
     ctcggcaaag ctcaagctgg ccagaacgac gacgggcgag aacgtgttag gaagaacgtg    384420
     acgcatcgcg atacgccaag gcgacgcccc tgaacatcga gccgcttcga tgaaactgcg    384480
     tccttggagg gccacgacct gcccgcggac gatgcgggca tacctatagt aatccgaaaa    384540
     gccgatgatc agcaccaaaa cgagtggatg cgtaccagct aatgcgactg ctgtcagagc    384600
     caccaaagtg gttggcacag cggcctgcgc gtcaaccaca gccgacaggc attggtcggc    384660
     ccatcctcct aacgttccgg aaatcaatcc gcccagcgtg cccgcgacga cgccaataaa    384720
     gacaccggca aaagcgatga atagcgtggt gcgcgtcgcg aaaaggaggc gagaaaaaac    384780
     atcgcgccca agatgatcag ttcctaacgg atggtcgtct gtgccgcctg cgaaaacagg    384840
     cggctggaga cgactcaaca ggctttgctc ggagatatcg tgtggagtga ttgcgggagc    384900
     agctaaagcc aacaagatca taagaaacag aatggagagc gaaatgatcc tcgctgccgg    384960
     cgggcggcca cgccggggcg gagccagaac aagcttgtct tcggtttcgc caacaattgg    385020
     ttccgacacg cggatatcaa tgctcatgat cacctctcac gtatcctggg atccagcagg    385080
     ccgtaggcaa catcgacaag aaggttggcg aagataatcg ctgccgagaa aaccagaatt    385140
     ccgaattgaa gcagggcgaa gtcgcgtttc atgacagcat cgatcacgag acgccctgcg    385200
     ccaggccagg caaagactga ctccgtcacg accgcgcccg caactaggcc gccgaattgc    385260
     aaacccataa tagtcaagac agggagtatt gcgttcctca gcccgtgctt cagcacgaca    385320
     acagctgggc tcaatccttt gctgcgggca tagcgcatgt aatcctgcgc taagacctca    385380
     agcatgcagg ttcggacgag gtgagctgtg ttcgcgcacg tcgcaagagc gagcgtgatc    385440
     acgggcagaa taaaatgttt ccacgtcccc atgccgccac tcggcagaag cctgagggag    385500
     aggctgaaga ttaagatggt ggcgatgccg accacgaaat ttgggatagc ctgcatcaca    385560
     actgttgcag tcgtgagcga acgatcgaag agactattgt gacggagcgc agcccatagg    385620
     ccgccgcaca agccgatggc gacagacaac acaaacgctg gaacggttaa aagaagagtg    385680
     ttggggaccc gctccataaa aagttcgaca actggtcttt tggagaagaa actttgccca    385740
     aaatctcccc gaaggagcgc ttcgccatac cttagatatt gtgttgcgat gtcatcattc    385800
     agtccaagct ttgccctaag ctcaattcgt tgtgcttcgg gcatctctgg cggcataagg    385860
     aagcctgttg gatctcccgt caaccgtgtc gcaaaaaaca cgatggtaag aattgcccat    385920
     aaggtaagtg cgctgcgtaa agctctagag atgaagaaca caggtcttgc tccacgcaac    385980
     agcctgaagg gctatgagtg atgtacagat gtctaggtat cttaggaacc ttcgtgtaac    386040
     gctttgatga caatgggacc aaggaatttg gttttcctgc aaacggggag agctttggtc    386100
     gatgtaccgc ctcagccaga gccggttacg cagccagcgt tgtttgcgtc cctccggctt    386160
     cagctagccc tgctccatcg ctggccatga gaccgaaccc tcagaatttg gtcagccggc    386220
     gggtcgtttg cgggtgatcg aacgttgact ctatcgggtc ggtcacaaaa aagccgactg    386280
     ccagccaccc ggctgccgcg tcttcgaatt cgcgcacctt agtccggcag ctcggtgtga    386340
     gtggaggcgg gcaatgggtg agcgcgatgg cacggcgcta ccggcggcat tcgagccagc    386400
     tttcacttgg cagcgcgtgg cgggagcggc gtgagcccgg cccgcatgga gcacatcgga    386460
     tcgatggagc accgctcgtc acgaccaaac ctggcgagtc ccttctgagc ttcttcttgt    386520
     atgcggccat aaagccgcgc gccgatcgcc cttggctctg tcgtaattcc ccacaggcgc    386580
     taacttcatc gtgacaccat cccctgcaaa gcgggccggc taatccgcgg gtgcatcagc    386640
     gaattagcca cggtttcgcg ccgaattctc cgtgctaatc attgatttcg ataagatatt    386700
     catatctgtc gcttcgtatg acgctgaatt catatttgat cggcaaccca tcgggggtta    386760
     catcgacatt ggtctcaacc agtaccgggc tggacgacga tatccgtaag tgttgtgcct    386820
     cctgctgggt gggtcttcgt gccgttatcc gtgtccattt ccgcttgtat tccagaatac    386880
     cgcagcgcct caaggcgaca gtgaaggagc ttactccttc gaacgcaact gcaagacccg    386940
     gagctcggct gattggaacg tggctcgatc cggtggccaa gggccagtca ttgaggaacg    387000
     aaacccacct gacctcagta accaacacta acggaacgat cctcaaacgc tttgcgatat    387060
     cgggttcaac ggaagtctcg tagaccgaca gtatctctcg cttcaccgat ttgttctgac    387120
     cgaggacttt gtaagtgacc ctgcgatcgc tgttcagcct aggtgaaacg aaatcatccg    387180
     caacaaaagt cccgacaccg tgctgaaccc gcaaagcgcc ttcagattcc agggccttga    387240
     tcgcattgcg taccgtgtgg cgatttacac caaatcgttc tgctaagacg aagtcgccag    387300
     gcaagcgccc atcctcgaac gcaccagcat cgatgtcact gaggatagca gatcgaacca    387360
     cttcccagcg cttcatacct cacgaccttc ctttccgact tgcgtcaaca accttctccg    387420
     aaggaaaaag gactggggaa gacccgacga gcggaccacc ggcagccagc ggttgacgtc    387480
     tactgatttg cgcgaacagc cctggtcatg cgtaaggccg gagggtggct ggagcgaagt    387540
     gccgaggggc cgttaggcac atgcgtcgtc atgcgctcgg cggatttcgt cgtgatgatt    387600
     ttgtttgggg caccatctcg ccagacatcg caagcaacca tatggtcgat ggaataataa    387660
     ccgaccgggg cgacgccagc ggcaagcaac ccgtcgatcc ggttcagccc caacatcagc    387720
     cgcgaccgaa gctgcgtggc gagcgcacgg cgttttcgat ggcgacacac aattctcatg    387780
     gtgttttgcg aaataccgac atgtactgcc aagatgcgtt gtcaaacggg cgcctatgcc    387840
     agtctccgta acgctcgaga agctcaagtc cgctgatctt tgcgagcaag tcgagttccg    387900
     ttggataaac atatcgcatt ttaatcggca tcgtccggct tccgcccggt gtgatccaaa    387960
     ggtcttgaga aacaaaaagt tgtctaggtc tgtcatgcct ggtaaatcgc accatcgcgc    388020
     gccgttcatc gatatgaata acggtcgttc tttggtcacc atagaagcct gcgcctgaaa    388080
     aattctcagt atctggatag tacaagtgca ccacaaagcg accgtcaggc tttaacgact    388140
     tcgcgaccga ttcaaagcag ccaatttgtt gaccgacggt caccataagt gaaaaagtgc    388200
     tattaacgca gtagacgaga tcatattgag tgcccaggtc aaactctgcc atgtcgccaa    388260
     ggtgcgttgt gaccaaatcg ccaccggctt tggcacgaag cgatgcaagc atcctttgcg    388320
     agttatcgag accgtgaacc gaagctcccg tcgccgaaag gggcaaggcg atgtggccgt    388380
     ttcctacgcc cagttcgagc gtggttccgt tccttgcgaa gggcgtgaga aaattgactg    388440
     cccgcgcgtt ctcgacggac tcattgagcg cttccacata ttcatcgtag acatcgcccc    388500
     atatttcacc ataggcggtg taagcgtcct tcacttgcgc atgatctttc atgacgtctt    388560
     cctcaattgc ctgtccagcc agtatgttga tacaggccct tcggaaatcg cccgccagag    388620
     ttgcgcatac tggtttcgtg ttgccacagg tcacactgcc tcgggctcgc gagtacgggc    388680
     cttatctttg ccggccatgg gtgctttcgt gagctattct tcatccaaaa atctgacttc    388740
     agctcgaaca atgatgaagt gcggcggaaa gtccgttttg tagaatttcg cttggtgttt    388800
     cggcggataa ttttgatgca tgtcgtttcg aaagctcttg ccagcaacag cttggctcga    388860
     agagggtgag ctcgggggcg agaggacagc cgaccttgag catgactttg ccgcgagatg    388920
     cagggccgta tcctgcgtgc tttcgagttc attatcagac ggctgtcggc ttcgggtcac    388980
     agccgacgat gcggatcttc tgcccgaggt cgacaagggc cgcgagattt tttttgggag    389040
     gcggtgaact gccgatgccc cctgccgtag aatgcgatct gacgcagacc taacatgttg    389100
     cttcacttcc tccgttccca tccatcacga ctgcccgcga catgaacgct ggtcgacagc    389160
     tctcgctgcc tgtgccgaag cgattcaaaa ctcgtgccaa ctctggccga tcgagccgaa    389220
     cgaaactttg tggctgcttt tcatcgattt agcctgagca aaacaggaga tcggctaagg    389280
     ctgtgttgcg aatccgacaa aggcgacaag cgatgtcgga tggcgtgttt gagacgacgg    389340
     cctcggaggc cggaaggaag tcagggggcc tcgggtggcg agactaggcg attttgatcg    389400
     gaagaccgcg gcagggaagg cggtttacgc aaacttgcgt atcgctccag gtgcgttttg    389460
     gctcagcgtc gaccctactt gtgcggccgc catcgggacg ctttgccgcc aatggggcac    389520
     gtagtctacc aagtatccta tgtcgcgggc gacctacctt cggaaatatt gaatcgcgcc    389580
     gtcaaatctc ggatgcacac ttcgccattg gcctgatgat ttcgacgagc cttttatgac    389640
     ggttataaat aagacaacgt gctttcctct cgcggaatat gaaaaggacc agtcagttcg    389700
     aagcgtacat gtcacgtcag acattggtct cagagacggt agatgagtgg cttaaagtgc    389760
     gccgcagggt ttttgccagc ctctcgttct ccgcccgact tcgaaccgtc aggcgaagat    389820
     atcgatctgc gtcgtccatc gcttggtagc cgcattctct tacaaggacg gattcaaaga    389880
     gaacgaggcg gcgcttgagc tcagcggcgg ataccgaatt ttcaggcagc cggcatagga    389940
     tgaaattcgt ttgcgaagga actacgtcga gacccggtac cgtctgcagc tcctggatca    390000
     acagctctct atcctttctt aacagtctca gactgtcttc cagttcctct gcgaattcgg    390060
     gcagcaggaa cagtgtgtat tccgcaatgc cgttgatgtt ccacaacggc agtttccggc    390120
     gcacggccgc aaccagggcg ggatcgccag