spacer

EBI Dbfetch

ID   AAA59452; SV 1; linear; genomic DNA; STD; HUM; 4149 BP.
XX
PA   M32972.1
XX
DT   10-JUL-1990 (Rel. 24, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 11)
XX
DE   Homo sapiens (human) insulin receptor
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RX   PUBMED; 2210055.
RA   Seino S., Seino M., Bell G.I.;
RT   "Human insulin-receptor gene. Partial sequence and amplification of exons
RT   by polymerase chain reaction";
RL   Diabetes 39(1):123-128(1990).
XX
DR   MD5; 4c7ab6fae5c07f3becb459d31ae2d7fc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4149
FT                   /organism="Homo sapiens"
FT                   /map="19p13.3-p13.2"
FT                   /mol_type="genomic DNA"
FT                   /dev_stage="foetus"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:9606"
FT   CDS             join(M23100.1:1824..1923,M32823.1:174..725,
FT                   M32824.1:114..435,M32825.1:318..466,M32826.1:188..332,
FT                   M32827.1:189..403,M32828.1:277..403,M32829.1:124..374,
FT                   M32830.1:106..273,M32831.1:187..388,M32832.1:123..158,
FT                   M32833.1:161..435,M32834.1:93..232,M32835.1:85..244,
FT                   M32836.1:92..194,M32837.1:261..328,M32838.1:136..380,
FT                   M32839.1:117..227,M32840.1:45..204,M32841.1:115..244,
FT                   M32842.1:101..235,M32972.1:83..437)
FT                   /codon_start=1
FT                   /gene="INSR"
FT                   /product="insulin receptor"
FT                   /note="precursor"
FT                   /db_xref="GOA:P06213"
FT                   /db_xref="HGNC:HGNC:6091"
FT                   /db_xref="InterPro:IPR000494"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002011"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006211"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016246"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="PDB:1GAG"
FT                   /db_xref="PDB:1I44"
FT                   /db_xref="PDB:1IR3"
FT                   /db_xref="PDB:1IRK"
FT                   /db_xref="PDB:1P14"
FT                   /db_xref="PDB:1RQQ"
FT                   /db_xref="PDB:2AUH"
FT                   /db_xref="PDB:2B4S"
FT                   /db_xref="PDB:2DTG"
FT                   /db_xref="PDB:2HR7"
FT                   /db_xref="PDB:2MFR"
FT                   /db_xref="PDB:2Z8C"
FT                   /db_xref="PDB:3BU3"
FT                   /db_xref="PDB:3BU5"
FT                   /db_xref="PDB:3BU6"
FT                   /db_xref="PDB:3EKK"
FT                   /db_xref="PDB:3EKN"
FT                   /db_xref="PDB:3ETA"
FT                   /db_xref="PDB:3LOH"
FT                   /db_xref="PDB:3W11"
FT                   /db_xref="PDB:3W12"
FT                   /db_xref="PDB:3W13"
FT                   /db_xref="PDB:3W14"
FT                   /db_xref="PDB:4IBM"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06213"
FT                   /protein_id="AAA59452.1"
FT                   /translation="MGTGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLT
FT                   RLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFP
FT                   NLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRI
FT                   LDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTI
FT                   CKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCV
FT                   NFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCH
FT                   LLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRR
FT                   SYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYN
FT                   PKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWE
FT                   PYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHP
FT                   GWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSS
FT                   SQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDS
FT                   QKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAE
FT                   DPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGL
FT                   RHFTGYRIELQACNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMW
FT                   QEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRIRATSL
FT                   AGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLG
FT                   PLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKG
FT                   EAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMA
FT                   HGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCM
FT                   VAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVV
FT                   LWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFL
FT                   EIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGR
FT                   DGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS"
XX
SQ   Sequence 4149 BP; 952 A; 1145 C; 1159 G; 893 T; 0 other;
     atgggcaccg ggggccggcg gggagcggcg gccgcgccgc tgctggtggc ggtggccgcg        60
     ctgctactgg gcgccgcggg ccacctgtac cccggagagg tgtgtcccgg catggatatc       120
     cggaacaacc tcactaggtt gcatgagctg gagaattgct ctgtcatcga aggacacttg       180
     cagatactct tgatgttcaa aacgaggccc gaagatttcc gagacctcag tttccccaaa       240
     ctcatcatga tcactgatta cttgctgctc ttccgggtct atgggctcga gagcctgaag       300
     gacctgttcc ccaacctcac ggtcatccgg ggatcacgac tgttctttaa ctacgcgctg       360
     gtcatcttcg agatggttca cctcaaggaa ctcggcctct acaacctgat gaacatcacc       420
     cggggttctg tccgcatcga gaagaacaat gagctctgtt acttggccac tatcgactgg       480
     tcccgtatcc tggattccgt ggaggataat tacatcgtgt tgaacaaaga tgacaacgag       540
     gagtgtggag acatctgtcc gggtaccgcg aagggcaaga ccaactgccc cgccaccgtc       600
     atcaacgggc agtttgtcga acgatgttgg actcatagtc actgccagaa agtttgcccg       660
     accatctgta agtcacacgg ctgcaccgcc gaaggcctct gttgccacag cgagtgcctg       720
     ggcaactgtt ctcagcccga cgaccccacc aagtgcgtgg cctgccgcaa cttctacctg       780
     gacggcaggt gtgtggagac ctgcccgccc ccgtactacc acttccagga ctggcgctgt       840
     gtgaacttca gcttctgcca ggacctgcac cacaaatgca agaactcgcg gaggcagggc       900
     tgccaccaat acgtcattca caacaacaag tgcatccctg agtgtccctc cgggtacacg       960
     atgaattcca gcaacttgct gtgcacccca tgcctgggtc cctgtcccaa ggtgtgccac      1020
     ctcctagaag gcgagaagac catcgactcg gtgacgtctg cccaggagct ccgaggatgc      1080
     accgtcatca acgggagtct gatcatcaac attcgaggag gcaacaatct ggcagctgag      1140
     ctagaagcca acctcggcct cattgaagaa atttcagggt atctaaaaat ccgccgatcc      1200
     tacgctctgg tgtcactttc cttcttccgg aagttacgtc tgattcgagg agagaccttg      1260
     gaaattggga actactcctt ctatgccttg gacaaccaga acctaaggca gctctgggac      1320
     tggagcaaac acaacctcac catcactcag gggaaactct tcttccacta taaccccaaa      1380
     ctctgcttgt cagaaatcca caagatggaa gaagtttcag gaaccaaggg gcgccaggag      1440
     agaaacgaca ttgccctgaa gaccaatggg gaccaggcat cctgtgaaaa tgagttactt      1500
     aaattttctt acattcggac atcttttgac aagatcttgc tgagatggga gccgtactgg      1560
     ccccccgact tccgagacct cttggggttc atgctgttct acaaagaggc cccttatcag      1620
     aatgtgacgg agttcgatgg gcaggatgcg tgtggttcca acagttggac ggtggtagac      1680
     attgacccac ccctgaggtc caacgacccc aaatcacaga accacccagg gtggctgatg      1740
     cggggtctca agccctggac ccagtatgcc atctttgtga agaccctggt caccttttcg      1800
     gatgaacgcc ggacctatgg ggccaagagt gacatcattt atgtccagac agatgccacc      1860
     aacccctctg tgcccctgga tccaatctca gtgtctaact catcatccca gattattctg      1920
     aagtggaaac caccctccga ccccaatggc aacatcaccc actacctggt tttctgggag      1980
     aggcaggcgg aagacagtga gctgttcgag ctggattatt gcctcaaagg gctgaagctg      2040
     ccctcgagga cctggtctcc accattcgag tctgaagatt ctcagaagca caaccagagt      2100
     gagtatgagg attcggccgg cgaatgctgc tcctgtccaa agacagactc tcagatcctg      2160
     aaggagctgg aggagtcctc gtttaggaag acgtttgagg attacctgca caacgtggtt      2220
     ttcgtcccca gaaaaacctc ttcaggcact ggtgccgagg accctaggcc atctcggaaa      2280
     cgcaggtccc ttggcgatgt tgggaatgtg acggtggccg tgcccacggt ggcagctttc      2340
     cccaacactt cctcgaccag cgtgcccacg agtccggagg agcacaggcc ttttgagaag      2400
     gtggtgaaca aggagtcgct ggtcatctcc ggcttgcgac acttcacggg ctatcgcatc      2460
     gagctgcagg cttgcaacca ggacacccct gaggaacggt gcagtgtggc agcctacgtc      2520
     agtgcgagga ccatgcctga agccaaggct gatgacattg ttggccctgt gacgcatgaa      2580
     atctttgaga acaacgtcgt ccacttgatg tggcaggagc cgaaggagcc caatggtctg      2640
     atcgtgctgt atgaagtgag ttatcggcga tatggtgatg aggagctgca tctctgcgtc      2700
     tcccgcaagc acttcgctct ggaacggggc tgcaggctgc gtgggctgtc accggggaac      2760
     tacagcgtgc gaatccgggc cacctccctt gcgggcaacg gctcttggac ggaacccacc      2820
     tatttctacg tgacagacta tttagacgtc ccgtcaaata ttgcaaaaat tatcatcggc      2880
     cccctcatct ttgtctttct cttcagtgtt gtgattggaa gtatttatct attcctgaga      2940
     aagaggcagc cagatgggcc gctgggaccg ctttacgctt cttcaaaccc tgagtatctc      3000
     agtgccagtg atgtgtttcc atgctctgtg tacgtgccgg acgagtggga ggtgtctcga      3060
     gagaagatca ccctccttcg agagctgggg cagggctcct tcggcatggt gtatgagggc      3120
     aatgccaggg acatcatcaa gggtgaggca gagacccgcg tggcggtgaa gacggtcaac      3180
     gagtcagcca gtctccgaga gcggattgag ttcctcaatg aggcctcggt catgaagggc      3240
     ttcacctgcc atcacgtggt gcgcctcctg ggagtggtgt ccaagggcca gcccacgctg      3300
     gtggtgatgg agctgatggc tcacggagac ctgaagagct acctccgttc tctgcggcca      3360
     gaggctgaga ataatcctgg ccgccctccc cctacccttc aagagatgat tcagatggcg      3420
     gcagagattg ctgacgggat ggcctacctg aacgccaaga agtttgtgca tcgggacctg      3480
     gcagcgagaa actgcatggt cgcccatgat tttactgtca aaattggaga ctttggaatg      3540
     accagagaca tctatgaaac ggattactac cggaaagggg gcaagggtct gctccctgta      3600
     cggtggatgg caccggagtc cctgaaggat ggggtcttca ccacttcttc tgacatgtgg      3660
     tcctttggcg tggtcctttg ggaaatcacc agcttggcag aacagcctta ccaaggcctg      3720
     tctaatgaac aggtgttgaa atttgtcatg gatggagggt atctggatca acccgacaac      3780
     tgtccagaga gagtcactga cctcatgcgc atgtgctggc aattcaaccc caagatgagg      3840
     ccaaccttcc tggagattgt caacctgctc aaggacgacc tgcaccccag ctttccagag      3900
     gtgtcgttct tccacagcga ggagaacaag gctcccgaga gtgaggagct ggagatggag      3960
     tttgaggaca tggagaatgt gcccctggac cgttcctcgc actgtcagag ggaggaggcg      4020
     gggggccggg atggagggtc ctcgctgggt ttcaagcgga gctacgagga acacatccct      4080
     tacacacaca tgaacggagg caagaaaaac gggcggattc tgaccttgcc tcggtccaat      4140
     ccttcctaa                                                              4149
//


spacer
spacer