spacer

EBI Dbfetch

ID   D87894; SV 1; linear; genomic DNA; STD; FUN; 1674 BP.
XX
AC   D87894;
XX
DT   27-SEP-1996 (Rel. 49, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Rhizopus oligosporus DNA for chitinase, complete cds.
XX
KW   chi3; chitinase.
XX
OS   Rhizopus microsporus var. oligosporus
OC   Eukaryota; Fungi; Fungi incertae sedis; Early diverging fungal lineages;
OC   Mucoromycotina; Mucorales; Mucorineae; Rhizopodaceae; Rhizopus.
XX
RN   [1]
RP   1-1674
RA   Yamazaki D.;
RT   ;
RL   Submitted (14-SEP-1996) to the INSDC.
RL   Daisuke Yamazaki, The University of Tokyo, Department of Agricultural
RL   Chemistry; 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113, Japan
RL   (Tel:03-3812-2111(ex.5170), Fax:03-3812-9246)
XX
RN   [2]
RA   Takaya N., Yamazaki D., Horiuchi H., Ohta A., Takagi M.;
RT   "Intracellular chitinase gene from Rhizopus oligosporus: molecular cloning
RT   and characterization";
RL   Microbiology (Reading, Engl.) 144:2647-2654(1998).
XX
DR   MD5; aaffbb9c0c27696108c87fee57d3acb1.
DR   StrainInfo; 193640; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1674
FT                   /organism="Rhizopus microsporus var. oligosporus"
FT                   /strain="IFO8631"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:4847"
FT   CDS             join(271..326,386..500,555..591,651..1645)
FT                   /codon_start=1
FT                   /gene="chi3"
FT                   /product="chitinase"
FT                   /db_xref="GOA:Q92270"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q92270"
FT                   /protein_id="BAA13489.1"
FT                   /translation="MEPPPATNGPVIAGYFANWGIYDRKYNVVDVATQANKLTHILYAF
FT                   ANVQPDGQVVLGDAYADIEKHFPANQAVNRKEDGWNDPGKNLYGNFKQFYLLKQQHRHL
FT                   KVSLSIGGYTWSTHFGPVARDPQKRRLFVDSSIKHLANLGLDGLDIDWEYPKDDEEAFY
FT                   YVHLLYELRLALDRYQQQCQQLIQSRLLLTVAVPCGPDHYRKLRLTEMQPYVDLFYLMA
FT                   YDYAGSWDSFADHQAAVYGGRLNTEQAVQHYIACGIPPYKLVVGMPLYGRGFCNTAGPG
FT                   HPFQGLPRGTWEEGQFNYKTLPKPGAVEYHDFNRLASWSYDPQAREFITYDTPQMVAAK
FT                   CNYIQQRRLGGAMFWELSADCPQRSLINAAYDGLGRRLDQVPNHLDYPMSEYDNVRNGM
FT                   K"
FT   exon            271..326
FT                   /number=1
FT   intron          327..385
FT                   /number=1
FT   exon            386..500
FT                   /number=2
FT   intron          501..554
FT                   /number=2
FT   exon            555..591
FT                   /number=3
FT   intron          592..650
FT                   /number=3
FT   exon            651..1645
FT                   /number=4
XX
SQ   Sequence 1674 BP; 506 A; 331 C; 347 G; 490 T; 0 other;
     AATAATGAAA CCACTAATTC AAGAGTATTG TGTGTATGCC TTGTTATTTC TTCATGATCC        60
     AAGGGTTTCT CGCGTCAACA GTATGTTCTG AGCTTTTTGT TGTTGTCATA TCTACTTATT       120
     CATGTTTGGA ATGAAATGTC AATTGTCTCA TCTTCCTAAA GTGTATACAA GTTTTTGTTC       180
     TACAATAGAA CTCTACAACA GCTGAATATA ATGATAAAAA TAGATATTTT CTTGGCTCTT       240
     TTTTTCATTT TACTTTTCTT GACTTCTCAT ATGGAACCAC CTCCAGCAAC AAACGGACCT       300
     GTTATTGCAG GTTACTTTGC TAATTGGTAA CATTGCATAA CAAAGGCAAA AGGGGAGCTT       360
     AACTCAACTA ACTAGAATGT AATAGGGGAA TCTACGATAG AAAATACAAT GTTGTTGATG       420
     TAGCTACTCA AGCCAATAAG TTGACTCATA TTTTATATGC ATTTGCTAAT GTCCAACCGG       480
     ATGGTCAAGT TGTTCTTGGG GTAGTATAAA TTATTGCAAG ATATAGAATA TAATAATAAT       540
     AATTATAAAT ATAGGACGCT TATGCAGATA TTGAAAAGCA TTTTCCAGCA AGTAAAAAAA       600
     TAATAATAAA CAAATATAAA ACCTCTCCCT AATTCATACA TAATATGTAG ACCAAGCAGT       660
     CAACCGAAAA GAAGATGGAT GGAATGATCC AGGCAAGAAC CTTTACGGTA ACTTTAAGCA       720
     GTTCTATTTA CTCAAGCAAC AACACCGTCA TCTCAAAGTG TCGCTTAGCA TTGGCGGATA       780
     TACATGGTCC ACTCATTTTG GCCCGGTTGC GCGTGATCCT CAGAAACGCA GATTGTTTGT       840
     AGATAGCAGC ATCAAACACC TAGCCAACTT GGGTCTGGAC GGGCTAGATA TTGACTGGGA       900
     GTACCCCAAA GATGATGAGG AAGCGTTTTA TTATGTGCAT CTGCTCTATG AGTTGCGACT       960
     GGCGCTTGAC AGATATCAAC AACAGTGCCA ACAACTGATT CAGTCGCGAC TATTACTCAC      1020
     AGTAGCCGTG CCTTGTGGCC CTGACCATTA TCGTAAATTG AGATTGACCG AAATGCAACC      1080
     TTACGTGGAC CTATTTTACC TCATGGCATA CGACTATGCT GGTTCATGGG ATTCTTTCGC      1140
     AGATCATCAA GCGGCTGTTT ATGGTGGCAG ATTGAATACA GAACAAGCAG TACAGCACTA      1200
     TATCGCCTGT GGTATCCCTC CATATAAGCT AGTCGTAGGC ATGCCTTTAT ATGGTCGAGG      1260
     ATTCTGCAAT ACGGCGGGGC CAGGTCATCC TTTCCAAGGA CTGCCTCGCG GTACCTGGGA      1320
     AGAGGGTCAA TTTAATTACA AGACATTGCC AAAACCGGGC GCTGTAGAAT ACCACGACTT      1380
     TAATCGACTA GCCTCATGGT CTTATGACCC TCAGGCTCGT GAATTTATCA CCTATGATAC      1440
     ACCTCAGATG GTTGCTGCAA AGTGCAATTA CATACAACAA AGACGGTTGG GTGGTGCCAT      1500
     GTTTTGGGAA CTAAGTGCGG ATTGTCCTCA GAGAAGCCTG ATCAACGCGG CCTATGACGG      1560
     CTTAGGAAGG CGATTAGATC AGGTACCTAA TCATTTAGAT TATCCAATGA GTGAGTATGA      1620
     CAATGTACGA AACGGTATGA AATAAAGCAT CCCTTTTGGC AGGTGGTTCT CAAA            1674
//



spacer
spacer