spacer

EBI Dbfetch

ID   AJ242600; SV 1; linear; mRNA; STD; INV; 3234 BP.
XX
AC   AJ242600;
XX
DT   07-JAN-2000 (Rel. 62, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Loligo opalescens mRNA for glutamate receptor (gluR gene), splice variant 1
XX
KW   alternative splicing; gluR gene; glutamate receptor.
XX
OS   Doryteuthis opalescens
OC   Eukaryota; Metazoa; Lophotrochozoa; Mollusca; Cephalopoda; Coleoidea;
OC   Neocoleoidea; Decapodiformes; Teuthida; Myopsina; Loliginidae; Doryteuthis.
XX
RN   [1]
RP   1-3234
RA   Battaglia A.A.;
RT   ;
RL   Submitted (25-MAY-1999) to the INSDC.
RL   Battaglia A.A., Neurobiology Laboratory, Stazione Zoologica "Anton Dohrn",
RL   Villa Comunale Naples, 80121, ITALY.
XX
RN   [2]
RA   Battaglia A.A., Nardi G., Iaccarino P., Gentile S., de Santis A.,
RA   Gilly W.F.;
RT   "Cloning and functional characterization of an AMPA-selective receptor
RT   subunit in squid (Loligo opalescens) giant fiber motor system";
RL   Unpublished.
XX
DR   MD5; c5c15961326ac84079524d93a4dbc6ab.
XX
CC   splice variant 2 (AJ534693)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3234
FT                   /organism="Doryteuthis opalescens"
FT                   /mol_type="mRNA"
FT                   /country="USA:California"
FT                   /dev_stage="adult"
FT                   /tissue_lib="stellate ganglion"
FT                   /tissue_type="nervous system"
FT                   /db_xref="taxon:1051066"
FT   5'UTR           1..141
FT                   /gene="gluR"
FT                   /function="promoter"
FT   CDS             142..2916
FT                   /gene="gluR"
FT                   /product="glutamate receptor"
FT                   /db_xref="GOA:Q9U0T0"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001508"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR019594"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q9U0T0"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="CAB65182.1"
FT                   /translation="MAPAIGLPPASTFPQLCFVILALSGSAIAAKGSTKRISIGSVFDV
FT                   ESEKIQTAFRFAVDRFNTIENSAQLKLNPLSRGNRRTDSFSLGNALCSIMSKGVFAVFG
FT                   KANSSMLATVKSYSDTFQIPYLTTSMAMNTTDQSPYMLFLRPINIRAIVDLIEHLGWRV
FT                   VHYIYISNEGLMRVQQLFQVMGKSDLQMTLNVKRASDVTSYVILKELHHTNPELDIHAV
FT                   LDMSIPMASELMNLLSEDPRVHNRRFHFLLVEPGIQELDFAKIGLYGYNVSGFQLVDFN
FT                   NMTVRLFLSDWTKIDPAEWPGAGVKTITYEAALAVDAVSLFTRAMKNLSNLGLFESLFI
FT                   RARSGANSSKTCAAERLNVWNKGKHVLKAMKETEFDGLTGRVAFDDRGHRKEFTLDVLD
FT                   IGITRGAVKIGYWTPRDGLTMLKRKMVRPINAPSSENRTRIVTTIQTPPYIMKKPKPID
FT                   GHPLIGNDKYEGYCVDLARKVAHEVGFDYVFQMVKDGAYGSKLANDSWNGMVGELIRLE
FT                   ADMAIAPLTISAVRERVIDFSKPFMSLGISIMIKKPADQKAHVFSFLDPLSYEIWMCIL
FT                   FAFIGVSVVLFLVSRFSPSGWHVEDESNITNDFTISNSLWFSLGAFMQQGCDFSPRSIS
FT                   GRIVGSVWWFFTLIIISSYTANLAAFLTVERMSTPIESAEDLAKQTEIEYGTLRSGTTE
FT                   AFFKTSKVAVYERMWAYMTSKTPSVFTDKIQDGITSVRDSNGKYAFLVESSTNDYINNR
FT                   LPCDTMKVGSNLDSKGFGIATPAGSDLGDKLTLAVLKLREDGELDKLQKFWWVGKGQCT
FT                   PQDKNTDGGQSALTLSNVAGIFYILIGGLILAIIVAVAEFLYKSKVDSKKSKTSFGLAL
FT                   KSKARLSFRSHPAREDSSSGTLLRKSMSRYTYTGPSQSMGFDTVPEGNTHTQV"
FT   sig_peptide     142..237
FT                   /gene="gluR"
FT   mat_peptide     238..2913
FT                   /gene="gluR"
FT                   /product="glutamate receptor"
FT   3'UTR           2917..3217
FT                   /gene="gluR"
FT   polyA_signal    3218..3234
FT                   /gene="gluR"
XX
SQ   Sequence 3234 BP; 903 A; 747 C; 773 G; 811 T; 0 other;
     CACGAGCGAG CATGTAACGT CACGAAGGCA CCACCCAGAC TATGGAGGAT CTGATCCCAG        60
     TTTTTCCGCG TGACCCTTAC GACCAGTGAC AACGATTACA ACACCGTGTA GTTCTACTGT       120
     GGTACCACCA ACAGACCCAG GATGGCTCCA GCCATCGGAC TACCACCGGC CAGCACGTTC       180
     CCCCAGCTGT GTTTCGTTAT TCTCGCTCTA TCCGGATCTG CAATAGCAGC TAAGGGGTCT       240
     ACAAAACGCA TATCAATAGG CTCAGTATTC GACGTTGAAT CGGAAAAAAT CCAGACGGCG       300
     TTTCGCTTTG CTGTGGATCG CTTTAACACA ATCGAGAATT CCGCCCAACT GAAATTGAAC       360
     CCCCTTTCGC GAGGAAATCG ACGAACAGAT AGTTTCTCCC TCGGCAATGC ACTCTGTTCC       420
     ATTATGTCCA AGGGTGTTTT TGCTGTATTC GGAAAGGCGA ACTCTTCAAT GCTGGCGACA       480
     GTCAAGTCGT ACAGTGACAC CTTCCAAATT CCGTATCTAA CTACAAGTAT GGCCATGAAC       540
     ACAACAGATC AGTCGCCCTA CATGCTATTT TTGCGTCCCA TTAACATCCG GGCTATTGTC       600
     GACCTCATAG AGCACTTGGG GTGGAGGGTG GTTCATTACA TATATATTTC GAACGAAGGT       660
     TTAATGCGTG TTCAGCAACT GTTTCAGGTG ATGGGGAAGA GCGATCTTCA AATGACCCTG       720
     AACGTCAAAC GTGCGTCCGA TGTCACTAGT TACGTAATTC TTAAAGAACT TCATCATACC       780
     AACCCCGAGT TGGACATTCA TGCCGTGCTG GATATGTCAA TACCTATGGC GAGTGAACTA       840
     ATGAATCTGC TGAGTGAGGA TCCACGAGTC CACAACAGAC GATTTCACTT CTTGCTAGTA       900
     GAGCCAGGAA TCCAAGAATT GGACTTTGCC AAGATTGGAT TGTATGGCTA CAATGTAAGT       960
     GGCTTCCAAC TGGTCGACTT CAATAATATG ACTGTTCGGC TATTTCTCTC GGACTGGACG      1020
     AAAATCGACC CAGCAGAATG GCCCGGGGCT GGGGTGAAAA CAATCACGTA CGAGGCGGCG      1080
     TTGGCAGTCG ACGCCGTCAG CTTGTTTACG CGTGCAATGA AGAATTTGTC CAATCTCGGT      1140
     TTATTTGAGT CCCTTTTCAT CCGCGCTAGG AGTGGAGCCA ACAGCAGCAA AACTTGTGCA      1200
     GCCGAGCGTC TGAATGTGTG GAACAAAGGT AAACATGTGC TCAAGGCAAT GAAAGAGACG      1260
     GAGTTTGATG GCCTTACTGG TCGAGTGGCA TTTGACGATA GAGGTCACCG CAAAGAGTTC      1320
     ACTCTGGATG TTCTTGATAT AGGAATTACC CGCGGCGCAG TCAAGATTGG TTACTGGACC      1380
     CCGAGGGATG GATTGACTAT GCTCAAGCGT AAAATGGTCC GCCCTATTAA TGCGCCCAGC      1440
     TCTGAGAACA GAACAAGGAT TGTGACTACG ATCCAGACTC CTCCTTACAT AATGAAGAAA      1500
     CCGAAGCCGA TAGACGGTCA CCCTCTTATA GGCAATGACA AGTACGAAGG ATATTGTGTA      1560
     GACCTTGCTC GAAAGGTTGC GCATGAAGTT GGCTTTGACT ACGTGTTCCA GATGGTAAAA      1620
     GATGGCGCCT ACGGTTCGAA GCTCGCAAAT GATTCGTGGA ATGGTATGGT AGGAGAACTA      1680
     ATAAGGCTGG AGGCGGATAT GGCCATTGCC CCACTGACGA TCTCAGCTGT GCGGGAGAGG      1740
     GTCATTGATT TCTCCAAACC CTTTATGAGC CTGGGAATCA GTATCATGAT AAAAAAACCA      1800
     GCGGACCAGA AAGCTCACGT GTTCTCGTTC CTCGACCCGT TATCCTACGA GATCTGGATG      1860
     TGCATCTTGT TTGCCTTCAT TGGAGTCAGC GTGGTCTTGT TTTTGGTCAG TCGCTTCAGC      1920
     CCTAGCGGGT GGCACGTGGA AGATGAGTCG AATATTACGA ATGATTTTAC CATTTCCAAC      1980
     AGCCTCTGGT TTTCGCTGGG CGCCTTCATG CAACAGGGAT GTGATTTCTC ACCTCGATCG      2040
     ATTTCTGGAC GTATAGTCGG AAGCGTATGG TGGTTCTTCA CCCTGATCAT TATTTCGTCT      2100
     TACACTGCCA ACCTGGCCGC CTTCCTCACA GTGGAAAGAA TGTCCACTCC GATTGAATCC      2160
     GCTGAGGATC TTGCCAAACA GACGGAAATC GAATATGGAA CTTTAAGGTC AGGCACAACA      2220
     GAAGCTTTCT TTAAGACTTC TAAGGTAGCG GTCTATGAGC GAATGTGGGC TTATATGACA      2280
     TCAAAGACCC CTAGTGTCTT TACGGATAAA ATCCAAGATG GCATAACCAG CGTTCGAGAT      2340
     TCCAACGGAA AGTATGCTTT CCTCGTCGAA TCCTCTACTA ACGATTATAT CAACAACCGT      2400
     TTGCCCTGTG ATACAATGAA AGTCGGATCA AATCTTGACT CAAAAGGTTT CGGCATCGCT      2460
     ACACCAGCCG GCTCCGACTT AGGAGATAAA CTCACACTTG CTGTTCTCAA GTTGCGCGAA      2520
     GATGGAGAGT TAGATAAGCT GCAAAAATTC TGGTGGGTGG GGAAAGGTCA GTGTACGCCA      2580
     CAGGACAAGA ATACTGATGG AGGCCAAAGT GCCCTTACAT TGTCCAACGT GGCTGGCATT      2640
     TTCTACATCC TTATCGGAGG ACTCATATTA GCCATCATCG TCGCAGTCGC GGAATTCCTT      2700
     TATAAATCTA AAGTTGACAG TAAAAAATCA AAGACATCAT TTGGACTTGC CCTGAAATCA      2760
     AAAGCCAGAC TTTCTTTCCG AAGCCATCCT GCTCGGGAAG ATAGCAGCTC GGGAACCCTT      2820
     CTCAGAAAGT CCATGTCAAG GTATACCTAC ACGGGCCCAT CCCAGAGTAT GGGATTTGAC      2880
     ACGGTACCGG AAGGTAACAC TCACACTCAA GTGTGAGATG TTAAATTGAC CAACTGCAGT      2940
     GAACCAGCGA GTGACACTCA GTCGTTACCT GCCATTCAGG ACATTTTTTT GCTCATTATA      3000
     AACACAATTC AGAACGAAAG AAGAAAAAAT TGTTTAATGA AAGGAAGAAA AGAAACAGGA      3060
     TCGAAACCCT GTTCGTAAAT GCTCACTGGA AAGGGAGACA CTTGTTCGCC TAAAACAAAA      3120
     GGGAATTCTA ATGTTCAGGT GGAAACACGA ATGAGTGTAT CCGCGTGTGG GTCAGCTGGG      3180
     ATTATTGTTA GCAAGATGGC AGCGTACCCA CACTGGCAAA AAAAAAAAAA AAAA            3234
//



spacer
spacer