ID K00650; SV 1; linear; genomic DNA; STD; HUM; 6210 BP. XX AC K00650; M16287; XX DT 26-JUL-1991 (Rel. 28, Created) DT 14-NOV-2006 (Rel. 89, Last updated, Version 4) XX DE Human fos proto-oncogene (c-fos), complete cds. XX KW c-myc proto-oncogene; fos oncogene; proto-oncogene. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; OC Homo. XX RN [1] RP 1-4165 RX DOI; 10.1073/pnas.80.11.3183. RX PUBMED; 6574479. RA van Straaten F., Muller R., Curran T., Van Beveren C., Verma I.M.; RT "Complete nucleotide sequence of a human c-onc gene: deduced amino acid RT sequence of the human c-fos protein"; RL Proc. Natl. Acad. Sci. U.S.A. 80(11):3183-3187(1983). XX RN [2] RX DOI; 10.1016/0092-8674(85)90285-5. RX PUBMED; 2414012. RA Treisman R.; RT "Transient accumulation of c-fos RNA following serum stimulation requires a RT conserved 5' element and c-fos 3' sequences"; RL Cell 42(3):889-902(1985). XX RN [3] RP 4166-6210 RX PUBMED; 3555978. RA Verma I.M., Deschamps J., Van Beveren C., Sassone-Corsi P.; RT "Human fos gene"; RL Cold Spring Harb. Symp. Quant. Biol. 51:0-0(0). XX DR EPD; EP11145; HS_FOS. DR Ensembl-Gn; ENSG00000170345; homo_sapiens. DR Ensembl-Tr; ENST00000303562; homo_sapiens. DR EuropePMC; PMC116128; 11711622. DR EuropePMC; PMC148030; 9837981. DR EuropePMC; PMC1752353; 9166000. DR EuropePMC; PMC19553; 9012824. DR EuropePMC; PMC293562; 8325983. DR EuropePMC; PMC3220474; 21937452. XX CC [2] sites; promoter region. CC C-fos is the human cellular homolog of the v-fos oncogene of CC Finkel-Biskis-Jinkins murine osteosarcoma virus (FBJ-MuSV). [2] It CC was found that both human and murine c-fos genes contained an CC enhancer-like element in their 5' noncoding regions that was CC necessary for increased transcription following serum activation. CC The FBJ-MuSV v-fos oncogene contains a deletion relative to murine CC and human c-fos proto-oncogenes that causes complete divergence of CC the COOH terminal protein sequences encoded. That deletion CC corresponds to positions 3182-3285 inclusive of this sequence. The CC FBJ-MuSV v-fos sequence is more closely related to murine than CC human c-fos sequences. The FBJ-MuSV v-fos coding sequence ends at CC a 'tag' stop codon coresponding to positions 3434-2436 of this CC sequence [1]. [1] notes two alu repeats beginning aproximately 500 CC and 1700 nucleotides downstream of the last base in this sequence. CC A TATA box is located at positions 701-707. Two potential CC polyadenylation signals are present in the 3' untranslated region. XX FH Key Location/Qualifiers FH FT source 1..6210 FT /organism="Homo sapiens" FT /map="14q24.3" FT /mol_type="genomic DNA" FT /db_xref="taxon:9606" FT misc_feature 402..453 FT /note="transcriptional activator region [2]" FT prim_transcript 734..>3329 FT /note="c-fos mRNA [1]" FT gene 889..1029 FT /gene="FOS" FT CDS join(889..1029,1783..2034,2466..2573,2688..3329) FT /codon_start=1 FT /note="c-fos protein" FT /db_xref="GOA:P01100" FT /db_xref="HGNC:HGNC:3796" FT /db_xref="InterPro:IPR000837" FT /db_xref="InterPro:IPR004827" FT /db_xref="PDB:1A02" FT /db_xref="PDB:1FOS" FT /db_xref="PDB:1S9K" FT /db_xref="UniProtKB/Swiss-Prot:P01100" FT /protein_id="AAA52471.1" FT /translation="MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVN FT AQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAG FT AYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTD FT TLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLD FT LTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPS FT GSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSS FT FVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL" FT exon <889..1029 FT /gene="FOS" FT /number=1 FT /note="c-fos protein; G00-119-917" FT intron 1030..1782 FT /note="c-fos intron A" FT exon 1783..2034 FT /number=2 FT intron 2035..2465 FT /note="c-fos intron B" FT exon 2466..2573 FT /number=3 FT intron 2574..2687 FT /note="c-fos intron C" FT exon 2688..>3329 FT /number=4 FT /note="c-fos protein" XX SQ Sequence 6210 BP; 1497 A; 1571 C; 1619 G; 1523 T; 0 other;