spacer

EBI Dbfetch

ID   M10051; SV 1; linear; mRNA; STD; HUM; 4723 BP.
XX
AC   M10051;
XX
DT   02-JUL-1986 (Rel. 09, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 7)
XX
DE   Human insulin receptor mRNA, complete cds.
XX
KW   insulin receptor; tyrosine kinase.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4723
RX   DOI; 10.1016/0092-8674(85)90334-4.
RX   PUBMED; 2859121.
RA   Ebina Y., Ellis L., Jarnagin K., Edery M., Graf L., Clauser E., Ou J.-H.,
RA   Masiarz F., Kan Y.W., Goldfine I.D., Roth R.A., Rutter W.J.;
RT   "The human insulin receptor cDNA: the structural basis for
RT   hormone-activated transmembrane signalling";
RL   Cell 40(4):747-758(1985).
XX
DR   MD5; e4e6ebf2e723a500c1dd62385c279351.
DR   Ensembl-Gn; ENSG00000171105; homo_sapiens.
DR   Ensembl-Tr; ENST00000302850; homo_sapiens.
DR   Ensembl-Tr; ENST00000341500; homo_sapiens.
DR   EuropePMC; PMC1755608; 16014681.
DR   EuropePMC; PMC2739203; 19682364.
DR   EuropePMC; PMC3164640; 21909271.
DR   EuropePMC; PMC452597; 15146055.
XX
CC   [1] suggests that the insulin receptor may be the cellular homolog
CC   of the v-ros transforming (oncogene) protein.  [1] notes
CC   similarities between the insulin receptor and several growth factor
CC   receptors and oncogenes.  Insulin receptor is a heterodimer
CC   consisting of 2 alpha and 2 beta subunits.  Beta-prime may be a
CC   cleavage product produced upon binding of insulin.  [1] suggests
CC   that translation may begin at the 'atg' start codon at positions
CC   79-81 with protein cleavage occurring after position 120 to yield
CC   the signal peptide.  [1] gives illustrations of the various domains
CC   present in the protein.  A draft entry and sequence for [1] in
CC   computer-readable form were kindly provided by K. Jarnagin
CC   (30-JUL-1985).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4723
FT                   /organism="Homo sapiens"
FT                   /map="19p13.3-p13.2"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     137..219
FT                   /note="insulin receptor signal peptide"
FT   CDS             139..4287
FT                   /codon_start=1
FT                   /gene="INSR"
FT                   /note="insulin receptor precursor"
FT                   /db_xref="GOA:P06213"
FT                   /db_xref="H-InvDB:HIT000194074.15"
FT                   /db_xref="HGNC:HGNC:6091"
FT                   /db_xref="InterPro:IPR000494"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002011"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006211"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016246"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="PDB:1GAG"
FT                   /db_xref="PDB:1I44"
FT                   /db_xref="PDB:1IR3"
FT                   /db_xref="PDB:1IRK"
FT                   /db_xref="PDB:1P14"
FT                   /db_xref="PDB:1RQQ"
FT                   /db_xref="PDB:2AUH"
FT                   /db_xref="PDB:2B4S"
FT                   /db_xref="PDB:2DTG"
FT                   /db_xref="PDB:2HR7"
FT                   /db_xref="PDB:2MFR"
FT                   /db_xref="PDB:2Z8C"
FT                   /db_xref="PDB:3BU3"
FT                   /db_xref="PDB:3BU5"
FT                   /db_xref="PDB:3BU6"
FT                   /db_xref="PDB:3EKK"
FT                   /db_xref="PDB:3EKN"
FT                   /db_xref="PDB:3ETA"
FT                   /db_xref="PDB:3LOH"
FT                   /db_xref="PDB:3W11"
FT                   /db_xref="PDB:3W12"
FT                   /db_xref="PDB:3W13"
FT                   /db_xref="PDB:3W14"
FT                   /db_xref="PDB:4IBM"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06213"
FT                   /protein_id="AAA59174.1"
FT                   /translation="MGTGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLT
FT                   RLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFP
FT                   NLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRI
FT                   LDSVEDNHIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTI
FT                   CKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCV
FT                   NFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCH
FT                   LLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRR
FT                   SYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTTTQGKLFFHYN
FT                   PKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDKASCENELLKFSYIRTSFDKILLRWE
FT                   PYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHP
FT                   GWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSS
FT                   SQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDS
FT                   QKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAE
FT                   DPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGL
FT                   RHFTGYRIELQACNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMW
FT                   QEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRIRATSL
FT                   AGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLG
FT                   PLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKG
FT                   EAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMA
FT                   HGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCM
FT                   VAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVV
FT                   LWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFL
FT                   EIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGR
FT                   DGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS"
FT   mat_peptide     220..2424
FT                   /gene="INSR"
FT                   /note="insulin receptor alpha subunit"
FT   mat_peptide     2425..4284
FT                   /gene="INSR"
FT                   /note="insulin receptor beta subunit"
FT   mat_peptide     2425..2469
FT                   /partial
FT                   /gene="INSR"
FT                   /note="insulin receptor beta-prime subunit"
XX
SQ   Sequence 4723 BP; 1068 A; 1298 C; 1311 G; 1046 T; 0 other;
     GGGGGGCTGC GCGGCCGGGT CGGTGCGCAC ACGAGAAGGA CGCGCGGCCC CCAGCGCTCT        60
     TGGGGGCCGC CTCGGAGCAT GACCCCCGCG GGCCAGCGCC GCGCGCCTGA TCCGAGGAGA       120
     CCCCGCGCTC CCGCAGCCAT GGGCACCGGG GGCCGGCGGG GGGCGGCGGC CGCGCCGCTG       180
     CTGGTGGCGG TGGCCGCGCT GCTACTGGGC GCCGCGGGCC ACCTGTACCC CGGAGAGGTG       240
     TGTCCCGGCA TGGATATCCG GAACAACCTC ACTAGGTTGC ATGAGCTGGA GAATTGCTCT       300
     GTCATCGAAG GACACTTGCA GATACTCTTG ATGTTCAAAA CGAGGCCCGA AGATTTCCGA       360
     GACCTCAGTT TCCCCAAACT CATCATGATC ACTGATTACT TGCTGCTCTT CCGGGTCTAT       420
     GGGCTCGAGA GCCTGAAGGA CCTGTTCCCC AACCTCACGG TCATCCGGGG ATCACGACTG       480
     TTCTTTAACT ACGCGCTGGT CATCTTCGAG ATGGTTCACC TCAAGGAACT CGGCCTCTAC       540
     AACCTGATGA ACATCACCCG GGGTTCTGTC CGCATCGAGA AGAACAATGA GCTCTGTTAC       600
     TTGGCCACTA TCGACTGGTC CCGTATCCTG GATTCCGTGG AGGATAATCA CATCGTGTTG       660
     AACAAAGATG ACAACGAGGA GTGTGGAGAC ATCTGTCCGG GTACCGCGAA GGGCAAGACC       720
     AACTGCCCCG CCACCGTCAT CAACGGGCAG TTTGTCGAAC GATGTTGGAC TCATAGTCAC       780
     TGCCAGAAAG TTTGCCCGAC CATCTGTAAG TCACACGGCT GCACCGCCGA AGGCCTCTGT       840
     TGCCACAGCG AGTGCCTGGG CAACTGTTCT CAGCCCGACG ACCCCACCAA GTGCGTGGCC       900
     TGCCGCAACT TCTACCTGGA CGGCAGGTGT GTGGAGACCT GCCCGCCCCC GTACTACCAC       960
     TTCCAGGACT GGCGCTGTGT GAACTTCAGC TTCTGCCAGG ACCTGCACCA CAAATGCAAG      1020
     AACTCGCGGA GGCAGGGCTG CCACCAATAC GTCATTCACA ACAACAAGTG CATCCCTGAG      1080
     TGTCCCTCCG GGTACACGAT GAATTCCAGC AACTTGCTGT GCACCCCATG CCTGGGTCCC      1140
     TGTCCCAAGG TGTGCCACCT CCTAGAAGGC GAGAAGACCA TCGACTCGGT GACGTCTGCC      1200
     CAGGAGCTCC GAGGATGCAC CGTCATCAAC GGGAGTCTGA TCATCAACAT TCGAGGAGGC      1260
     AACAATCTGG CAGCTGAGCT AGAAGCCAAC CTCGGCCTCA TTGAAGAAAT TTCAGGGTAT      1320
     CTAAAAATCC GCCGATCCTA CGCTCTGGTG TCACTTTCCT TCTTCCGGAA GTTACGTCTG      1380
     ATTCGAGGAG AGACCTTGGA AATTGGGAAC TACTCCTTCT ATGCCTTGGA CAACCAGAAC      1440
     CTAAGGCAGC TCTGGGACTG GAGCAAACAC AACCTCACCA CCACTCAGGG GAAACTCTTC      1500
     TTCCACTATA ACCCCAAACT CTGCTTGTCA GAAATCCACA AGATGGAAGA AGTTTCAGGA      1560
     ACCAAGGGGC GCCAGGAGAG AAACGACATT GCCCTGAAGA CCAATGGGGA CAAGGCATCC      1620
     TGTGAAAATG AGTTACTTAA ATTTTCTTAC ATTCGGACAT CTTTTGACAA GATCTTGCTG      1680
     AGATGGGAGC CGTACTGGCC CCCCGACTTC CGAGACCTCT TGGGGTTCAT GCTGTTCTAC      1740
     AAAGAGGCCC CTTATCAGAA TGTGACGGAG TTCGATGGGC AGGATGCGTG TGGTTCCAAC      1800
     AGTTGGACGG TGGTAGACAT TGACCCACCC CTGAGGTCCA ACGACCCCAA ATCACAGAAC      1860
     CACCCAGGGT GGCTGATGCG GGGTCTCAAG CCCTGGACCC AGTATGCCAT CTTTGTGAAG      1920
     ACCCTGGTCA CCTTTTCGGA TGAACGCCGG ACCTATGGGG CCAAGAGTGA CATCATTTAT      1980
     GTCCAGACAG ATGCCACCAA CCCCTCTGTG CCCCTGGATC CAATCTCAGT GTCTAACTCA      2040
     TCATCCCAGA TTATTCTGAA GTGGAAACCA CCCTCCGACC CCAATGGCAA CATCACCCAC      2100
     TACCTGGTTT TCTGGGAGAG GCAGGCGGAA GACAGTGAGC TGTTCGAGCT GGATTATTGC      2160
     CTCAAAGGGC TGAAGCTGCC CTCGAGGACC TGGTCTCCAC CATTCGAGTC TGAAGATTCT      2220
     CAGAAGCACA ACCAGAGTGA GTATGAGGAT TCGGCCGGCG AATGCTGCTC CTGTCCAAAG      2280
     ACAGACTCTC AGATCCTGAA GGAGCTGGAG GAGTCCTCGT TTAGGAAGAC GTTTGAGGAT      2340
     TACCTGCACA ACGTGGTTTT CGTCCCCAGA AAAACCTCTT CAGGCACTGG TGCCGAGGAC      2400
     CCTAGGCCAT CTCGGAAACG CAGGTCCCTT GGCGATGTTG GGAATGTGAC GGTGGCCGTG      2460
     CCCACGGTGG CAGCTTTCCC CAACACTTCC TCGACCAGCG TGCCCACGAG TCCGGAGGAG      2520
     CACAGGCCTT TTGAGAAGGT GGTGAACAAG GAGTCGCTGG TCATCTCCGG CTTGCGACAC      2580
     TTCACGGGCT ATCGCATCGA GCTGCAGGCT TGCAACCAGG ACACCCCTGA GGAACGGTGC      2640
     AGTGTGGCAG CCTACGTCAG TGCGAGGACC ATGCCTGAAG CCAAGGCTGA TGACATTGTT      2700
     GGCCCTGTGA CGCATGAAAT CTTTGAGAAC AACGTCGTCC ACTTGATGTG GCAGGAGCCG      2760
     AAGGAGCCCA ATGGTCTGAT CGTGCTGTAT GAAGTGAGTT ATCGGCGATA TGGTGATGAG      2820
     GAGCTGCATC TCTGCGTCTC CCGCAAGCAC TTCGCTCTGG AACGGGGCTG CAGGCTGCGT      2880
     GGGCTGTCAC CGGGGAACTA CAGCGTGCGA ATCCGGGCCA CCTCCCTTGC GGGCAACGGC      2940
     TCTTGGACGG AACCCACCTA TTTCTACGTG ACAGACTATT TAGACGTCCC GTCAAATATT      3000
     GCAAAAATTA TCATCGGCCC CCTCATCTTT GTCTTTCTCT TCAGTGTTGT GATTGGAAGT      3060
     ATTTATCTAT TCCTGAGAAA GAGGCAGCCA GATGGGCCGC TGGGACCGCT TTACGCTTCT      3120
     TCAAACCCTG AGTATCTCAG TGCCAGTGAT GTGTTTCCAT GCTCTGTGTA CGTGCCGGAC      3180
     GAGTGGGAGG TGTCTCGAGA GAAGATCACC CTCCTTCGAG AGCTGGGGCA GGGCTCCTTC      3240
     GGCATGGTGT ATGAGGGCAA TGCCAGGGAC ATCATCAAGG GTGAGGCAGA GACCCGCGTG      3300
     GCGGTGAAGA CGGTCAACGA GTCAGCCAGT CTCCGAGAGC GGATTGAGTT CCTCAATGAG      3360
     GCCTCGGTCA TGAAGGGCTT CACCTGCCAT CACGTGGTGC GCCTCCTGGG AGTGGTGTCC      3420
     AAGGGCCAGC CCACGCTGGT GGTGATGGAG CTGATGGCTC ACGGAGACCT GAAGAGCTAC      3480
     CTCCGTTCTC TGCGGCCAGA GGCTGAGAAT AATCCTGGCC GCCCTCCCCC TACCCTTCAA      3540
     GAGATGATTC AGATGGCGGC AGAGATTGCT GACGGGATGG CCTACCTGAA CGCCAAGAAG      3600
     TTTGTGCATC GGGACCTGGC AGCGAGAAAC TGCATGGTCG CCCATGATTT TACTGTCAAA      3660
     ATTGGAGACT TTGGAATGAC CAGAGACATC TATGAAACGG ATTACTACCG GAAAGGGGGC      3720
     AAGGGTCTGC TCCCTGTACG GTGGATGGCA CCGGAGTCCC TGAAGGATGG GGTCTTCACC      3780
     ACTTCTTCTG ACATGTGGTC CTTTGGCGTG GTCCTTTGGG AAATCACCAG CTTGGCAGAA      3840
     CAGCCTTACC AAGGCCTGTC TAATGAACAG GTGTTGAAAT TTGTCATGGA TGGAGGGTAT      3900
     CTGGATCAAC CCGACAACTG TCCAGAGAGA GTCACTGACC TCATGCGCAT GTGCTGGCAA      3960
     TTCAACCCCA AGATGAGGCC AACCTTCCTG GAGATTGTCA ACCTGCTCAA GGACGACCTG      4020
     CACCCCAGCT TTCCAGAGGT GTCGTTCTTC CACAGCGAGG AGAACAAGGC TCCCGAGAGT      4080
     GAGGAGCTGG AGATGGAGTT TGAGGACATG GAGAATGTGC CCCTGGACCG TTCCTCGCAC      4140
     TGTCAGAGGG AGGAGGCGGG GGGCCGGGAT GGAGGGTCCT CGCTGGGTTT CAAGCGGAGC      4200
     TACGAGGAAC ACATCCCTTA CACACACATG AACGGAGGCA AGAAAAACGG GCGGATTCTG      4260
     ACCTTGCCTC GGTCCAATCC TTCCTAACAG TGCCTACCGT GGCGGGGGCG GGCAGGGGTT      4320
     CCCATTTTCG CTTTCCTCTG GTTTGAAAGC CTCTGGAAAA CTCAGGATTC TCACGACTCT      4380
     ACCATGTCCA GTGGAGTTCA GAGATCGTTC CTATACATTT CTGTTCATCT TAAGGTGGAC      4440
     TCGTTTGGTT ACCAATTTAA CTAGTCCTGC AGAGGATTTA ACTGTGAACC TGGAGGGCAA      4500
     GGGGTTTCCA CAGTTGCTGC TCCTTTGGGG CAACGACGGT TTCAAACCAG GATTTTGTGT      4560
     TTTTTCGTTC CCCCCACCCG CCCCCAGCAG ATGGAAAGAA AGCACCTGTT TTTACAAATT      4620
     CTTTTTTTTT TTTTTTTTTT TTTTTTTTTG CTGGTGTCTG AGCTTCAGTA TAAAAGACAA      4680
     AACTTCCTGT TTGTGGAACA AAATTTCGAA AGAAAAAACC AAA                        4723
//



spacer
spacer