spacer

EBI Dbfetch

ID   L12344; SV 1; linear; mRNA; STD; MAM; 1189 BP.
XX
AC   L12344;
XX
DT   19-MAY-1993 (Rel. 35, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 6)
XX
DE   Pig ficolin mRNA.
XX
KW   ficolin; multimeric protein.
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-1189
RX   PUBMED; 7686157.
RA   Ichijo H., Hellman U., Wernstedt C., Gonez L.J., Claesson-Welsh L.,
RA   Heldin C.H., Miyazono K.;
RT   "Molecular cloning and characterization of ficolin, a multimeric protein
RT   with fibrinogen- and collagen-like domains";
RL   J Biol Chem 268(19):14505-14513(1993).
XX
DR   MD5; 1b22724db673de7a52be891bc129d41b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1189
FT                   /organism="Sus scrofa"
FT                   /mol_type="mRNA"
FT                   /tissue_type="uterus"
FT                   /db_xref="taxon:9823"
FT   CDS             4..975
FT                   /codon_start=1
FT                   /product="ficolin"
FT                   /db_xref="GOA:Q29041"
FT                   /db_xref="InterPro:IPR002181"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR014715"
FT                   /db_xref="InterPro:IPR014716"
FT                   /db_xref="InterPro:IPR020837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29041"
FT                   /protein_id="AAA92455.1"
FT                   /translation="MDTRGVAAAMRPLVLLVAFLCTAAPALDTCPEVKVVGLEGSDKLS
FT                   ILRGCPGLPGAAGPKGEAGASGPKGGQGPPGAPGEPGPPGPKGDRGEKGEPGPKGESWE
FT                   TEQCLTGPRTCKELLTRGHILSGWHTIYLPDCQPLTVLCDMDTDGGGWTVFQRRSDGSV
FT                   DFYRDWAAYKRGFGSQLGEFWLGNDHIHALTAQGTNELRVDLVDFEGNHQFAKYRSFQV
FT                   ADEAEKYMLVLGAFVEGNAGDSLTSHNNSLFTTKDQDNDQYASNCAVLYQGAWWYNSCH
FT                   VSNLNGRYLGGSHGSFANGVNWSSGKGYNYSYKVSEMKFRAT"
FT   polyA_site      1189
XX
SQ   Sequence 1189 BP; 248 A; 362 C; 387 G; 189 T; 3 other;
     gcgatggaca cacgcggagt ggccgcggcc atgaggcccc tggtcctgct cgttgccttc        60
     ctgtgcaccg cagccccagc cctcgacacc tgtccagagg tcaaggtggt gggtctggag       120
     ggctcggaca agctctccat cctccgaggc tgcccggggc tgcctggagc cgcagggccc       180
     aagggagagg cgggcgccag tggaccgaag ggaggacaag gccctcccgg agcccctggg       240
     gagccaggac cccccgggcc caaaggagac cgaggggaga agggcgagcc tggaccaaaa       300
     ggagagtctt gggaaaccga gcagtgtctc acaggacctc ggacctgcaa ggagctgctg       360
     accagggggc acattctgag cggctggcac accatctacc tgccagactg ccagcccctg       420
     acggtgctgt gtgacatgga cacggatggc ggggggtgga ccgttttcca gcgcaggagc       480
     gacgggtcgg tggacttcta ccgggactgg gccgcgtaca agcggggctt cggcagtcag       540
     ctgggagagt tctggctggg gaacgaccac atccacgccc tgacggccca gggaaccaat       600
     gagctccggg tggacctcgt ggacttcgag ggcaaccacc agtttgccaa gtacaggtcc       660
     ttccaggtgg cagacgaggc agagaagtac atgctggtcc tgggagcctt tgtagagggc       720
     aatgcaggtg attccctgac gtcccacaac aacagcctgt tcaccaccaa agaccaggac       780
     aacgaccagt acgcctcaaa ttgtgcagtg ctgtaccagg gagcctggtg gtacaacagc       840
     tgtcacgtgt ccaacctgaa cggccgctac ctcgggggct cgcacgggag ctttgcaaac       900
     ggcgtcaact ggagttcggg gaaagggtac aactacagct acaaggtgtc ggagatgaag       960
     tttcgggcca cctagggcgg gacagtgctt ccagaaccct ccctggggag gggccacggg      1020
     gctcccgctc actatccgcc cgggtgtgaa gggccacatc ccaaccctgg ggggcggcca      1080
     tgccctctgc acctccacca gcttccaatc ttctgtccct ctcaggagga caagagtgac      1140
     cgttactcca gcaacatgta ttctcaataa agacacttgc ttaccmrna                  1189
//
ID   L12345; SV 1; linear; mRNA; STD; MAM; 1042 BP.
XX
AC   L12345;
XX
DT   09-APR-1993 (Rel. 35, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 8)
XX
DE   Sus scrofa ficolin mRNA, complete cds.
XX
KW   ficolin; multimeric protein.
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-1042
RX   PUBMED; 7686157.
RA   Ichijo H., Hellman U., Wernstedt C., Gonez L.J., Claesson-Welsh L.,
RA   Heldin C.H., Miyazono K.;
RT   "Molecular cloning and characterization of ficolin, a multimeric protein
RT   with fibrinogen- and collagen-like domains";
RL   J Biol Chem 268(19):14505-14513(1993).
XX
DR   MD5; 21a87a265ce545ca13da07296f7de75e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1042
FT                   /organism="Sus scrofa"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9823"
FT   CDS             13..993
FT                   /codon_start=1
FT                   /product="ficolin"
FT                   /db_xref="GOA:Q29042"
FT                   /db_xref="InterPro:IPR002181"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR014715"
FT                   /db_xref="InterPro:IPR014716"
FT                   /db_xref="InterPro:IPR020837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29042"
FT                   /protein_id="AAC69641.1"
FT                   /translation="MELSRVAVALGPTGQLLLFLSFQTLAAQAADTCPEVKVVGLEGSD
FT                   KLSILRGCPGLPGAAGPKGEAGANGPKGERGSPGVVGKAGPAGPKGDRGEKGARGEKGE
FT                   PGQLQSCATGPRTCKELLTRGHFLSGWHTIYLPDCQPLTVLCDMDTDGGGWTVFQRRSD
FT                   GSVDFYRDWAAYKRGFGSQLGEFWLGNDHIHALTAQGTSELRVDLVDFEGNHQFAKYRS
FT                   FQVAGEAEKYKLVLGGFLEGNAGDSLSSHRDQFFSTKDQDNDNHSGNCAEQYHGAWWYN
FT                   ACHSSNLNGRYLRGLHTSYANGVNWRSGRGYNYSYQVSEMKVRLT"
XX
SQ   Sequence 1042 BP; 209 A; 319 C; 360 G; 154 T; 0 other;
     aagcatgagg acatggagct gagcagagtt gccgtggccc tggggcccac tggccagctc        60
     ctcctgttcc tgagcttcca gaccctggct gcccaggctg ccgacacctg tccagaggtc       120
     aaggtggtgg gtctggaggg ctcagacaag ctctccatcc tccgaggctg cccggggctg       180
     cctggagccg cagggcctaa gggagaggcg ggcgccaatg gaccgaaggg agagcgaggc       240
     tcccccggcg tcgtcgggaa ggcaggaccg gctgggccca aaggagaccg aggggagaag       300
     ggcgcgcgtg gagagaaagg agagcctggg cagctccagt catgtgccac aggacctcgg       360
     acctgcaagg agctgctgac cagggggcac tttctgagcg gctggcacac catctacctg       420
     ccggactgcc agcccctgac ggtgctgtgt gacatggaca cggatggcgg ggggtggacc       480
     gttttccagc gcaggagcga cgggtcggtg gacttctacc gggactgggc cgcgtacaag       540
     cggggcttcg gcagtcagct gggagagttc tggctgggga acgaccacat ccacgccctg       600
     acggcccagg gaaccagtga gctccgggtg gacctcgtgg acttcgaggg caaccaccag       660
     tttgccaagt acaggtcctt ccaggtggca ggcgaggcag agaagtacaa gctggtcctg       720
     ggaggcttcc tggagggcaa tgcaggtgac tccctgtcat cccacagaga ccagttcttc       780
     tccaccaaag accaggacaa cgacaaccat tcgggaaact gcgcggagca gtaccacggc       840
     gcctggtggt acaacgcctg ccactcctcc aacctgaacg gccgctacct ccggggactg       900
     cacaccagct atgccaacgg cgtcaactgg aggtcgggga gagggtacaa ctacagctac       960
     caggtgtcgg agatgaaagt gcgtctcacg tagggggggc ccggcccggc tcctccccat      1020
     ccaccggccg gcagcctcca ca                                               1042
//


spacer
spacer