spacer

EBI Dbfetch

ID   FP929062; SV 1; linear; genomic DNA; STD; PRO; 3601020 BP.
XX
AC   FP929062;
XX
PR   Project:PRJNA39155;
XX
DT   25-MAR-2010 (Rel. 104, Created)
DT   05-JUL-2010 (Rel. 105, Last updated, Version 3)
XX
DE   Clostridiales sp. SS3/4 draft genome.
XX
KW   .
XX
OS   butyrate-producing bacterium SS3/4
OC   Bacteria; Firmicutes; Clostridia; Clostridiales.
XX
RN   [1]
RG   metaHIT consortium -- http://www.metahit.eu/
RA   Pajon A., Turner K., Parkhill J., Duncan S., Flint H.;
RT   "The genome sequence of Clostridiales sp. SS3/4";
RL   Unpublished.
XX
RN   [2]
RA   Pajon A.;
RT   ;
RL   Submitted (24-MAR-2010) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
XX
DR   MD5; 3e99325ada826dc43acc3a57936d3ad9.
DR   EnsemblGenomes-Gn; CK3_T_35470.
DR   EnsemblGenomes-Gn; CK3_T_35480.
DR   EnsemblGenomes-Gn; CK3_T_35490.
DR   EnsemblGenomes-Gn; CK3_T_35500.
DR   EnsemblGenomes-Gn; CK3_T_35510.
DR   EnsemblGenomes-Gn; CK3_T_35520.
DR   EnsemblGenomes-Gn; CK3_T_35530.
DR   EnsemblGenomes-Gn; CK3_T_35540.
DR   EnsemblGenomes-Gn; CK3_T_35550.
DR   EnsemblGenomes-Gn; CK3_T_35560.
DR   EnsemblGenomes-Gn; CK3_T_35570.
DR   EnsemblGenomes-Gn; CK3_T_35580.
DR   EnsemblGenomes-Gn; CK3_T_35590.
DR   EnsemblGenomes-Gn; CK3_T_35600.
DR   EnsemblGenomes-Gn; CK3_T_35610.
DR   EnsemblGenomes-Gn; CK3_T_35620.
DR   EnsemblGenomes-Gn; CK3_T_35630.
DR   EnsemblGenomes-Gn; CK3_T_35640.
DR   EnsemblGenomes-Gn; CK3_T_35650.
DR   EnsemblGenomes-Gn; CK3_T_35660.
DR   EnsemblGenomes-Gn; CK3_T_35670.
DR   EnsemblGenomes-Gn; CK3_T_35680.
DR   EnsemblGenomes-Gn; CK3_T_35690.
DR   EnsemblGenomes-Gn; CK3_T_35700.
DR   EnsemblGenomes-Gn; CK3_T_35710.
DR   EnsemblGenomes-Gn; CK3_T_35720.
DR   EnsemblGenomes-Gn; CK3_T_35730.
DR   EnsemblGenomes-Gn; CK3_T_35740.
DR   EnsemblGenomes-Gn; CK3_T_35750.
DR   EnsemblGenomes-Gn; CK3_T_35760.
DR   EnsemblGenomes-Gn; CK3_T_35770.
DR   EnsemblGenomes-Gn; CK3_T_35780.
DR   EnsemblGenomes-Gn; CK3_T_35790.
DR   EnsemblGenomes-Gn; CK3_T_35800.
DR   EnsemblGenomes-Gn; CK3_T_35810.
DR   EnsemblGenomes-Gn; CK3_T_35820.
DR   EnsemblGenomes-Gn; CK3_T_35830.
DR   EnsemblGenomes-Gn; CK3_T_35840.
DR   EnsemblGenomes-Gn; CK3_T_35850.
DR   EnsemblGenomes-Gn; CK3_T_35860.
DR   EnsemblGenomes-Gn; CK3_T_35870.
DR   EnsemblGenomes-Gn; CK3_T_35880.
DR   EnsemblGenomes-Gn; CK3_T_35890.
DR   EnsemblGenomes-Gn; CK3_T_35900.
DR   EnsemblGenomes-Gn; CK3_T_35910.
DR   EnsemblGenomes-Gn; CK3_T_35920.
DR   EnsemblGenomes-Gn; CK3_T_35930.
DR   EnsemblGenomes-Gn; CK3_T_35940.
DR   EnsemblGenomes-Gn; CK3_T_35950.
DR   EnsemblGenomes-Gn; CK3_T_35960.
DR   EnsemblGenomes-Gn; CK3_T_35970.
DR   EnsemblGenomes-Gn; CK3_T_35980.
DR   EnsemblGenomes-Gn; CK3_T_35990.
DR   EnsemblGenomes-Gn; CK3_T_36000.
DR   EnsemblGenomes-Gn; CK3_T_36010.
DR   EnsemblGenomes-Gn; CK3_T_36020.
DR   EnsemblGenomes-Tr; CK3_T_35470.
DR   EnsemblGenomes-Tr; CK3_T_35480.
DR   EnsemblGenomes-Tr; CK3_T_35490.
DR   EnsemblGenomes-Tr; CK3_T_35500.
DR   EnsemblGenomes-Tr; CK3_T_35510.
DR   EnsemblGenomes-Tr; CK3_T_35520.
DR   EnsemblGenomes-Tr; CK3_T_35530.
DR   EnsemblGenomes-Tr; CK3_T_35540.
DR   EnsemblGenomes-Tr; CK3_T_35550.
DR   EnsemblGenomes-Tr; CK3_T_35560.
DR   EnsemblGenomes-Tr; CK3_T_35570.
DR   EnsemblGenomes-Tr; CK3_T_35580.
DR   EnsemblGenomes-Tr; CK3_T_35590.
DR   EnsemblGenomes-Tr; CK3_T_35600.
DR   EnsemblGenomes-Tr; CK3_T_35610.
DR   EnsemblGenomes-Tr; CK3_T_35620.
DR   EnsemblGenomes-Tr; CK3_T_35630.
DR   EnsemblGenomes-Tr; CK3_T_35640.
DR   EnsemblGenomes-Tr; CK3_T_35650.
DR   EnsemblGenomes-Tr; CK3_T_35660.
DR   EnsemblGenomes-Tr; CK3_T_35670.
DR   EnsemblGenomes-Tr; CK3_T_35680.
DR   EnsemblGenomes-Tr; CK3_T_35690.
DR   EnsemblGenomes-Tr; CK3_T_35700.
DR   EnsemblGenomes-Tr; CK3_T_35710.
DR   EnsemblGenomes-Tr; CK3_T_35720.
DR   EnsemblGenomes-Tr; CK3_T_35730.
DR   EnsemblGenomes-Tr; CK3_T_35740.
DR   EnsemblGenomes-Tr; CK3_T_35750.
DR   EnsemblGenomes-Tr; CK3_T_35760.
DR   EnsemblGenomes-Tr; CK3_T_35770.
DR   EnsemblGenomes-Tr; CK3_T_35780.
DR   EnsemblGenomes-Tr; CK3_T_35790.
DR   EnsemblGenomes-Tr; CK3_T_35800.
DR   EnsemblGenomes-Tr; CK3_T_35810.
DR   EnsemblGenomes-Tr; CK3_T_35820.
DR   EnsemblGenomes-Tr; CK3_T_35830.
DR   EnsemblGenomes-Tr; CK3_T_35840.
DR   EnsemblGenomes-Tr; CK3_T_35850.
DR   EnsemblGenomes-Tr; CK3_T_35860.
DR   EnsemblGenomes-Tr; CK3_T_35870.
DR   EnsemblGenomes-Tr; CK3_T_35880.
DR   EnsemblGenomes-Tr; CK3_T_35890.
DR   EnsemblGenomes-Tr; CK3_T_35900.
DR   EnsemblGenomes-Tr; CK3_T_35910.
DR   EnsemblGenomes-Tr; CK3_T_35920.
DR   EnsemblGenomes-Tr; CK3_T_35930.
DR   EnsemblGenomes-Tr; CK3_T_35940.
DR   EnsemblGenomes-Tr; CK3_T_35950.
DR   EnsemblGenomes-Tr; CK3_T_35960.
DR   EnsemblGenomes-Tr; CK3_T_35970.
DR   EnsemblGenomes-Tr; CK3_T_35980.
DR   EnsemblGenomes-Tr; CK3_T_35990.
DR   EnsemblGenomes-Tr; CK3_T_36000.
DR   EnsemblGenomes-Tr; CK3_T_36010.
DR   EnsemblGenomes-Tr; CK3_T_36020.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01699; Clostridiales-1.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF02004; group-II-D1D4-5.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   RFAM; RF02276; Hammerhead_II.
XX
CC   This is a reference genome for the metaHIT project
CC   DNA source: Rowett Institute of Nutrition and Health, University of
CC   Aberdeen -- http://www.rowett.ac.uk/divisions/ghp/
CC   Sequencing technology: 454
CC   Genome coverage: 16x
CC   Annotation was added using ab initio prediction IMG/ER --
CC   http://img.jgi.doe.gov/submit (Markowitz, Szeto et al. 2007).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3601020
FT                   /organism="butyrate-producing bacterium SS3/4"
FT                   /strain="SS3/4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:245014"
FT   CDS             complement(727..1002)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39905"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ30"
FT                   /protein_id="CBL39905.1"
FT                   /translation="MKYKGNVYSYFNLSGILFCIFIAWASYYNYKNLQITGLLAFFVFC
FT                   VLKCAMLAKFKKDILEKDTPLLFKVSNHVFGIAFIIMDIFIFYVNR"
FT   CDS             complement(1017..1385)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39906"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ31"
FT                   /protein_id="CBL39906.1"
FT                   /translation="MTKYGATETEAERLVDRAYENTQPYSARAKGFPSNPSIGQTCVID
FT                   VTIHVDDAATAAGIASEIMAASPYVTLAAALYAANILLTAGSMIYGYTVVLHISYTYGY
FT                   TNDGVLGWTPGYVSYEIY"
FT   CDS             complement(2113..2556)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39907"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ32"
FT                   /protein_id="CBL39907.1"
FT                   /translation="MEEKFLMDLIGCYREYFPENIPVECRKTAALIVFRFAIPDEELDH
FT                   ICKLLIETELGKLESAVYQAYRFYISEPFRAALAYILLHQDLPLSEVRYGLTDARQQSR
FT                   TRIRNTKKGEQFVAEQMQRIERINRNLLLLSEEIQAGEDSHNI"
FT   CDS             3148..3426
FT                   /transl_table=11
FT                   /locus_tag="CK3_00150"
FT                   /product="Plasmid maintenance system killer protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39908"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ33"
FT                   /protein_id="CBL39908.1"
FT                   /translation="MIKSFAHKGLREFYESGSKKGIQPEHAPKLGRMLDRLDASISPQD
FT                   MNLPGYRLHPLKGDKQDMWAVTVNGNWRLTFYFEGQDAYLLDYQDYH"
FT   CDS             3441..3755
FT                   /transl_table=11
FT                   /locus_tag="CK3_00160"
FT                   /product="addiction module antidote protein, HigA family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39909"
FT                   /db_xref="GOA:D7GQ34"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ34"
FT                   /protein_id="CBL39909.1"
FT                   /translation="MTNRKPTHPGAVLLEDVIKPLGLTITEAAKMLGVSRKTLSEFVNE
FT                   KAMLSPDMAIRIAKATNTSPESWMNMQQKLTLWEAEQHLPENVIPFPSVHSEEAATLQM
FT                   "
FT   CDS             4595..5626
FT                   /transl_table=11
FT                   /locus_tag="CK3_00170"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39910"
FT                   /db_xref="GOA:D7GQ35"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ35"
FT                   /protein_id="CBL39910.1"
FT                   /translation="MSFNYKSLLPTPAQIKAEFPLTPECVELKAARDKEVADVITGKSK
FT                   KFLVIIGPCSADREDAVCEYMSRLAKVNEQVKDKLVIVPRVYTNKPRTTGGGYKGMLHQ
FT                   PDPEKKPNMYEGLVAIRKLHMRVIEDYGFTTADEMLYPENYSYLSDVLSYVAIGARSVE
FT                   NQQHRLVSSGMDVPVGMKNPTSGDLGVMLNAVYAAQHGHDFIYRTWEVETKGNPLAHTI
FT                   LRGAVSKHGQCLPNYHYEDLELLYSLYQERELLNPACIVDANHSNSNKRYMEQIRIVKE
FT                   VLHSRRHSEEIHNFIKGVMVESYLEPGSQKIGEHIYGKSITDPCLGWDDTEKLIYDIAD
FT                   EIK"
FT   CDS             complement(5774..6670)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00180"
FT                   /product="3-methyladenine DNA glycosylase/8-oxoguanine DNA
FT                   glycosylase"
FT                   /EC_number="4.2.99.18"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39911"
FT                   /db_xref="GOA:D7GQ36"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ36"
FT                   /protein_id="CBL39911.1"
FT                   /translation="MISKNLKNFNLRQIADSGQCFRMIPCAPNDPQTAYRVISSGHFLI
FT                   VEQNRDEVIFHCPDDESAFWDHYFDLGTDYGAYIRAVDPADEYLSKAAAFGSGIRILNQ
FT                   DLWEMIITFIISQQKTIPAIRALVEALSEKYGTRYELSSGYYYAFPTPEELNHASLDDL
FT                   LALKLGYRAKYIKRTCEDVCSGKMDLDRLRGLNYSDSMEALLSCYGIGVKVANCICLFG
FT                   LHHIGAFPVDTWIKKILLREYAPKSRCTSHVPESRLCAALIEENFSKYPGFAGVLQQYI
FT                   FFYEREFSSKAAQTANV"
FT   CDS             complement(6689..6973)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00190"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39912"
FT                   /db_xref="GOA:D7GQ37"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ37"
FT                   /protein_id="CBL39912.1"
FT                   /translation="MTLQEYKKQKMQNPDFSAAYDEIQPEMDIIRAIIDARISQNMTQK
FT                   ELSERTGINQTEISRLENGSRNPSIKLLQRLAEGMGMTLKISFVPRQTR"
FT   gap             7097..8219
FT                   /estimated_length=1123
FT   CDS             complement(8369..8761)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00200"
FT                   /product="Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39913"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ38"
FT                   /protein_id="CBL39913.1"
FT                   /translation="MLKTGIKGRQEVVVSDANSAKTMGSGTLDVFATPAMTALMEKTAW
FT                   MSVADQLDEGCGTVGTLLNVTHDAPTPLGMTVWCETELVEVDGRRLVFDVAAYDAKGKI
FT                   GGGRHERFIIQNEKFQAKANKKALAE"
FT   CDS             complement(9065..9289)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39914"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ39"
FT                   /protein_id="CBL39914.1"
FT                   /translation="MMFLQFKNSWQTFTRNHPKFPAFWRAVYKHGIQENMIIEFKVTEP
FT                   DGKELASNIRVTKSDLELFENLKKMITDQ"
FT   CDS             9613..10242
FT                   /transl_table=11
FT                   /locus_tag="CK3_00230"
FT                   /product="Uncharacterised ACR, YkgG family COG1556."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39915"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ40"
FT                   /protein_id="CBL39915.1"
FT                   /translation="MLEDAKKRMAENVICNLKKRNMEGIYCRDKKEAVETVLSLIEPGA
FT                   SIGWGGSASIRELGILAELEKSGHEMRDYPMKDKETMGNPSYLGSCSADCFLMGTNAIT
FT                   VKGELVNIDGAGNRVACLIHGPKQVIIVVGMNKIVRSIEDGIDRIQTQACPIIADATGR
FT                   KTPCGVKGVCMDCQSPDCMCCSIVVTRRSRYDGRIKVVIVGENLGY"
FT   CDS             10266..10655
FT                   /transl_table=11
FT                   /locus_tag="CK3_00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39916"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ41"
FT                   /protein_id="CBL39916.1"
FT                   /translation="MFFIGGITQGTKELIYNAAAMICGRCGRYGRYQVFMTYMCLSFFF
FT                   IPIFKWGRKYYVKTSCCGTVYQLNEEVGKRIAAGEDVSIREEDLTLVSEGHDAPAWDVP
FT                   LKRCSNCGYETKENFEYCPKCGKRF"
FT   CDS             10659..11354
FT                   /transl_table=11
FT                   /locus_tag="CK3_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39917"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ42"
FT                   /protein_id="CBL39917.1"
FT                   /translation="MKITYIHHSAFLVETESAYLLFDYFQGKLPEFSEEKPLYVFASHR
FT                   HPDHFSKVIFELEEKHPKIHYILAFDIWSKRVPESCKEKTRFLNPGQILDDGTLKVEGF
FT                   KSTDEGVAFWCSVDGLEIYHAGDLNHWYWDGEDPEWNKNMTKAYREEIAKMHGRTADIA
FT                   FLPLDPRLGEYFYLGIDDFVREVDTKLIFPMHFWGEYDVAERLKQLPCSAGYREKVMEI
FT                   HEESESWEI"
FT   CDS             11499..11873
FT                   /transl_table=11
FT                   /locus_tag="CK3_00260"
FT                   /product="Lactoylglutathione lyase and related lyases"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39918"
FT                   /db_xref="GOA:D7GQ43"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ43"
FT                   /protein_id="CBL39918.1"
FT                   /translation="MKFTFAHNNFNVTDLDKSLKFYEEALGLKEVRRKEAADGSFILVY
FT                   LGDGVTPHQLELTWLRDWEKDHYDLGDNEFHLAFRVDDFEAAHAKHKEMGCICFENEKM
FT                   GIYFITDPDNYWLEIVPTRK"
FT   CDS             12009..13283
FT                   /transl_table=11
FT                   /locus_tag="CK3_00270"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39919"
FT                   /db_xref="GOA:D7GQ44"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ44"
FT                   /protein_id="CBL39919.1"
FT                   /translation="MILIKNGRVVDAKSNTDEILDVVIDGGKIKTIGKVEDDGSYEQVI
FT                   DADGCVVAPGLIDVHVHFRDPGLTYKEDIQTGSAAAKKGGYTTVVTMANTKPPVDNVET
FT                   VKYIIEEGKKTGINVLPAACVSVGMKGQELTDMGALKAAGAVGFTDDGIPLMNEKLVYE
FT                   AMKKAKELNVPLSFHEEDPAFISENGINAGAVAKELGITGSPALAEDSLVARDCMIALH
FT                   TGASVNIQHISSATSVKAVKLAKELGANVTAEVTPHHFTLDETAVLEHGAMAKMNPPLR
FT                   TAKDREGIIEGIKDGSIDMIATDHAPHSAEEKAVLPVWKAPSGIIGLETALGLAVTELV
FT                   KKGHLTTMQLVEKMCVNPAKLYHFDKGYLTEGGDADIVIFNENEEWTVTDDEIASKSHN
FT                   TPFIGTKLFGRVKYTICGGKIVYKD"
FT   CDS             13432..14118
FT                   /transl_table=11
FT                   /locus_tag="CK3_00280"
FT                   /product="HAD superfamily (subfamily IA) hydrolase,
FT                   TIGR02254"
FT                   /EC_number="3.8.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39920"
FT                   /db_xref="GOA:D7GQ45"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ45"
FT                   /protein_id="CBL39920.1"
FT                   /translation="MKKYQVLLFDVDGTLLDFDKAERIGIERVLTHFGVPATEENMQKY
FT                   HHLNKSYWQKLERGEITREQVLSLRFEDFFSDFGIKVNGAEVDGLYRQTLNESAFLLDG
FT                   VMDLLNGLKNRYELHIVTNGVAETQYKRLAAAGLDKLFQGIYVSEESGYQKPQQEYFDY
FT                   CFEKMGRNDVENMLIIGDSLTSDIRGGNNAGIDTLWYNPHHQENTAGVHVDYETDTLEK
FT                   IGEMLS"
FT   CDS             14409..15233
FT                   /transl_table=11
FT                   /locus_tag="CK3_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39921"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ46"
FT                   /protein_id="CBL39921.1"
FT                   /translation="MNKNTTDITLSAYFNDIVIGYYEDEDLVKQFGRQLGFDVDMDTFM
FT                   AVSFQYPSDMNVKPEDREKLTDAANAIIALSDINKKIGGKQIITCDSGDCVILIMKDKS
FT                   AMRDLIPQIKETALQEVEKISADRKIRVGIGTIENGIKGIKHTYSNAQDAVKAGEIFKK
FT                   DRVILEYMGMEIYSSINQMVVNFGDRLTRTVLKQLGETEKRVLAKYYKCKEDIAETARQ
FT                   LGMSEDDVKTSLNMVRINTGLDVNDTEDNFKLHFIMIAKKVLENDERIKKNR"
FT   CDS             15374..16924
FT                   /transl_table=11
FT                   /locus_tag="CK3_00300"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39922"
FT                   /db_xref="GOA:D7GQ47"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ47"
FT                   /protein_id="CBL39922.1"
FT                   /translation="MVKDKQAGICRTEGDTNMKTMLERGAGILMPVSSLPSPYGIGTFG
FT                   SAAYEFVDFLKKARQKYWQVLPVGPTSYGDSPYQSFSAFAGNPYFIDLDTLVKEGLLTQ
FT                   DEINACYWGDNPTQVAYDAVFWYRFPLLKKAYARSEYREEQGYEKFCMDSWFWLNDYAF
FT                   YMALKFHFDNKEWLAWPEDIRFRKKEAVESYREELKDEIDFWKFLQYKFYQQWGKLRAY
FT                   ANEQGISIIGDIPIYVALDSADVWTHPELFLLDEENLTPLKVAGVPPDAFSETGQLWGN
FT                   PLYRWDVQEKTDFAWWKERMKASARLYDVVRIDHFIGVTQYYAIPAGSEDGKTGEWLKG
FT                   PGKKLTDAINMVIGDTKIIAEDLGIFVPEVKELLEETGYPGMKIIEFAFSGDRFNEHLP
FT                   HMYSPNSVVYGGTHDNETLVGYFKPEARQWWELQYIADYMGVSHQHEVVDKVLKTAYAS
FT                   VASVVIFQAQDILKLDSWARMNTPGTVGNNWRWRMKPGELTQDHINHLSWLVDTFGRF"
FT   CDS             17283..17495
FT                   /transl_table=11
FT                   /locus_tag="CK3_00310"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39923"
FT                   /db_xref="GOA:D7GQ48"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ48"
FT                   /protein_id="CBL39923.1"
FT                   /translation="MNNGTVKWFNSEKGYGFISNDNGGDDVFVHFSAIVGDGFKTLEEG
FT                   QKVTFDTEQDPKNSKKLRAVNVVKL"
FT   CDS             17725..19362
FT                   /transl_table=11
FT                   /locus_tag="CK3_00320"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39924"
FT                   /db_xref="GOA:D7GQ49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ49"
FT                   /protein_id="CBL39924.1"
FT                   /translation="MISANNVTLRVGKKALFEDVNIKFTEGNCYGLIGANGAGKSTFLK
FT                   ILSGQLEPTNGEVAITPGQRLSFLQQDHFKYDEYTVLDTVIMGNKRLYDIMKEKDAIYM
FT                   KEEFTDEDGIKAAELEGEFATMNGWEAESDAENLLNGLGIETDLHYKTMKDLLGPQKVK
FT                   VLLAQALFGNPDILLLDEPTNHLDLDAIAWLEEFLINFENTVIVVSHDRYFLNKVCTQI
FT                   ADIDYGKIQLYAGNYDFWFESSQLMIKQMKEANRKKEEKIKELQEFIQRFSANASKSKQ
FT                   ATSRKRALEKIELDEIRPSSRKYPYIDFRPAREIGNEVLSVEGLTKTIDGVKVLDNISF
FT                   TLGREDKVALVGPNELAKTTLFKILSGEMEPDSGSYKWGLTTTQAYFPKDNSAEFNNDD
FT                   TIVDWLTQYSPEKDVTYVRGFLGRMLFAGEDGVKKVKVLSGGEKVRCMLSKMMISGANV
FT                   LMFDEPTDHLDMESITALNNGMKKFPGVIIFSSRDHQVVETTANRIMEIINGQLIDKIT
FT                   TYDEYLESDEMARKRFTYTITESEEDDD"
FT   CDS             complement(19514..20872)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00330"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39925"
FT                   /db_xref="GOA:D7GQ50"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ50"
FT                   /protein_id="CBL39925.1"
FT                   /translation="MAAENDLGRDDIKKLVVRIAIPSMLAQFVSVLYSIVDRMYIGNIP
FT                   GSGDMALAGAGVCGPVVTMVGSVAFLVGIGGAPLMSMKMGQGDKKAAERILANCFLMLA
FT                   VCSILMVACIYPIRIPMLRYFGASDITLPYANAYFTIYLTGTVFALMSTGMNQFIICQG
FT                   FAKTGMYSVILGAALNIILDPIFIFGLHMGVSGAAVATVISQMASCAFVLRTLFGKNMP
FT                   VRITFGGYSWRLIRRVLTIGFTPFIIIAMDNVMIITMNAILQKYGGAERGDLLITCATI
FT                   AQSFMLVVTMPLGGITSGTQAVLAYNFGAGKTDRVKNAQKYIFSLAAAYTALLFVLART
FT                   IGGLFVRLFTADPVVAAEALRAIRIFTLAIIPLAFQYEIVDGFTGLGQVQVALPLSFFR
FT                   KGAYFVSLFLLPAMFGAEAAFYAEPVSDIFGPIASVSVYLTSMKKVLAKAGAN"
FT   CDS             complement(21002..21559)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00340"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39926"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ51"
FT                   /protein_id="CBL39926.1"
FT                   /translation="MKMKSGNERKKIIRELLNRTDQEFTDEELIHQLIMTNITENSNET
FT                   EKLSFGQRASDAVAKFAGSWAFIFSFIAVMVGWMAVNVILGTKAFDAYPFILLNLVLSC
FT                   IAAIQAPLIMMSQNRQEAKDRQRAENDFKVNLKSELIIDDLHKKMDLIIENQKKINHRL
FT                   DMLEQTGKAIDTPKAGSPIHNA"
FT   CDS             21933..22487
FT                   /transl_table=11
FT                   /locus_tag="CK3_00350"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39927"
FT                   /db_xref="GOA:D7GQ52"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ52"
FT                   /protein_id="CBL39927.1"
FT                   /translation="MEKTTAKHMSTAQMTVTALMTAITCILAPMALPIPISPVPISLTN
FT                   LVIFFMAYILGMKLSVASYVLYLLLGTVGLPVFSGFSGGVGKLLGPTGGYLIGFIFLAA
FT                   IAGFFVEKFPAKIYMHVVGMIIGMAICYIFGTAWLAGQLGMSFVAALGVGVIPYLPGDT
FT                   AKIIIAIIAGPQIRKTVSRFM"
FT   CDS             23124..24440
FT                   /transl_table=11
FT                   /locus_tag="CK3_00360"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39928"
FT                   /db_xref="GOA:D7GQ53"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ53"
FT                   /protein_id="CBL39928.1"
FT                   /translation="MKSVHEALDQILPEIIAMSEDIYCHPELGFKEFRTRKKAIEALDK
FT                   AGIPHEDVAYTGIRAVLDSGKPGPNIGLITEFDAVPTFGHPYASEDSCAAHTCGHYGQL
FT                   GVMMSLFLAIRESGMLKDLCGKVTLLVTPAEEFCDMDYRKGLIKEGKISHPSGKQEMIA
FT                   TGIFDDVDIMLSCHAMGIDMTKYHAEIGSSLNGFIMKRAIFTGKASHAGANPEGGVNAL
FT                   NAVNLAMTGINFLRETFRADDAIRVHFYVPEGGQSVNTVPGRTQLEMYVRAKTVPAIFE
FT                   TNAKVTRAIRAGALAINCDLEIQDTPGYFPLHQDENLTELVKKHILDYIDESMVAQGTH
FT                   GFASGDMGDLSLMWPIVEIGVAGFEGSIHGKDFKTADPEQAYCVPAHYFADTVADLLSD
FT                   GGASAWKIKEAFKPVMNKKNYLETLDSLNKSTFYEKENN"
FT   CDS             24443..25618
FT                   /transl_table=11
FT                   /locus_tag="CK3_00370"
FT                   /product="Uncharacterized ABC-type transport system,
FT                   periplasmic component/surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39929"
FT                   /db_xref="GOA:D7GQ54"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ54"
FT                   /protein_id="CBL39929.1"
FT                   /translation="MKKKFLCSTLAMAMAASMLFGCASESKTETTAAAGETTAAAAETT
FT                   AEAAKAETNGEKLKVTLLVTGSFGDKAFNDSAQAGMEKLEAELGDKVEVNMVEMGSDKT
FT                   KFEGSMLDACESDADLIITGLWDMKEITEKVAQEFPEKKFIIFDTDVDYTLGDLSNVYS
FT                   MSYKQNEGAFLAGVLAASATKSDMEYANEDNVIGFVGAKDTAAVINDSAVGFIEGAQVV
FT                   DPDVKVLVSYVGSYVDSATAKELAITQYSNGADVVFVAAGPASVGVIEAAAESKKYCIG
FT                   VDSDQALAYEGKDEANFIISSAIKGVGDSIYNAVEKAVDGTLPYGEYQILGIEDGVVGL
FT                   ADNDIYQSAVSEDAKKAVEDAKEKLLAGEVTVDSAYGMDEATLKGIINGAQ"
FT   CDS             25965..27521
FT                   /transl_table=11
FT                   /locus_tag="CK3_00380"
FT                   /product="nucleoside ABC transporter ATP-binding protein"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39930"
FT                   /db_xref="GOA:D7GQ55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ55"
FT                   /protein_id="CBL39930.1"
FT                   /translation="MEQEIILEARNITKVYPGGVVANHNVNLQIKKGEIHALVGENGAG
FT                   KSTLMKMLFGMLAPTEGQIFVDGKEVHFSSSSDAIAAGLGMVHQHFMQVPSMTVAENLI
FT                   LGAETGTAFKVDRKEAVRITTELSDKYNLKVEAKEKVEDISLAMRQKLEILKALYRGAH
FT                   ILILDEPTAVLTPQETEELFEQLKLLRENGHTIIFISHKLNEVKALCNRMTILRDGKTM
FT                   GTYEISDLDEQEISRLMVGRDVSLNIEKEEMEFGKNVFSVKDLVYVDQFGKTRLDHVSF
FT                   TIKEGQILGIAGIDGNGQSELVEAIVGTLKQQQGTITMNGKDISNAPVLARQEAGISHV
FT                   SEDRMKFGTAPKLSLEDNAISKVYYTDKLKTHGLLDSKKISEFTNRILKEFLVKYDNSK
FT                   QSIAELSGGNVQKVVVGREFDYEPDLLIMNQPTRGIDVGAIEFIRKKIVDMRSRKKAIL
FT                   LVSADLSEILSLSDTILVMHEGRIVGHISDVKNTSENELGLYMLGVKEDSKEQIGGAYC
FT                   E"
FT   CDS             28564..29514
FT                   /transl_table=11
FT                   /locus_tag="CK3_00400"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39931"
FT                   /db_xref="GOA:D7GQ56"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ56"
FT                   /protein_id="CBL39931.1"
FT                   /translation="MGILQEILKTLSLPEFYFAMFRSATPVLLTTLGAMISSRSGTSNI
FT                   ALEGTMLISAFVGVVVSAFSQSAWVGFLGAVLAGFIVSNILAYFILKLNSNAVISGIAL
FT                   NTFASGGTIFVLYLITGEKGASTSLSSLKLPSVTIPVVKDIPVIGAVLSGHHVLTYAAL
FT                   ILVAVVWYMFKYTRLGMHIRAVGESPDAAESVGIPVKKIKYIALCLSGMMTGMAGAFLS
FT                   MGYVGLFSSGMTAGRGYIALATQAIAAGNAVIGMLASLLFGFCQSLANYLQNSSIPLQF
FT                   IQMMPYLIIIIAYTVYCAMVEHNKKKKQMKAAAGK"
FT   CDS             29743..30693
FT                   /transl_table=11
FT                   /locus_tag="CK3_00410"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39932"
FT                   /db_xref="GOA:D7GQ57"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ57"
FT                   /protein_id="CBL39932.1"
FT                   /translation="MSHIVELHLHLDGSLRPETVWELAKEQGVELPAKSAEEVKYMMEV
FT                   PEDCKTLEEYLERFDLPLLVLQKADAIERVTFELVEDLAKEGVEYAELRFAPQFSIKDG
FT                   LTQDEVVEAAIRGAERGMKLYPQIRVGLILCCMRGADNEELNMQTVETAKKYLGDVVCA
FT                   VDIAGAEGLFPTENFAPVFAKVREYGVPMTLHAGEAAGPDSMKTALSFGTKRIGHGVAA
FT                   INDPELIKRLIDENVTLEVCVTSNYHTKVVPAINMHPIHKLLEAGVHVTVNSDNRTCSR
FT                   TTLQKEKEVLKEELGFTDEEIEKMQEYAWEARFLK"
FT   CDS             31825..32571
FT                   /transl_table=11
FT                   /locus_tag="CK3_00430"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39933"
FT                   /db_xref="GOA:D7GQ58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ58"
FT                   /protein_id="CBL39933.1"
FT                   /translation="MSEYSVELKGLNKVYSNLLKEDTIALKDINLQIRPGEFISIIGPS
FT                   GCGKSTLLRIIGNLDKPTSGTIEYRDGADQQMGFVFQDSVLLPWKNVRQNAEFPLVIQK
FT                   KQTKENEEKLDELLELAGLSEFKTALPRELSGGMKQRVSIVRALSYDAPLLLMDEPFGA
FT                   LDALTRDHLNEELLKIWQKTKKTVIFVTHSIEEATFLSDRVLVMSARPGRVKEMVEIDL
FT                   PRPRGEATRNDPKFTEYNKYLRGIIG"
FT   CDS             32568..33350
FT                   /transl_table=11
FT                   /locus_tag="CK3_00440"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39934"
FT                   /db_xref="GOA:D7GQ59"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ59"
FT                   /protein_id="CBL39934.1"
FT                   /translation="MKKNGKLQGLLRTIGEYALSVGVFIALWWIYVAVKHVPAYILPSP
FT                   PKVWSSLVKMFVKGTVYAHLWTTTYEVILGFVIGAFLGIVLGYVFIKIDALKTMLMPYL
FT                   IFLQTAPKIALVPLFVVWFGIGLVSKVVLIISMVLFPVLSGMMLGLESIPPDVRNLMKI
FT                   LKASKWQVFSQVEMQYSLPALFASLKVGIVQAVIGAIVAEWMSGKQGLGYILTYASSTY
FT                   DTPMLLAGIIVTIILGIATYQVISVLEDKFLYWHESKN"
FT   CDS             33415..34212
FT                   /transl_table=11
FT                   /locus_tag="CK3_00450"
FT                   /product="Uridine phosphorylase"
FT                   /EC_number="2.4.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39935"
FT                   /db_xref="GOA:D7GQ60"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ60"
FT                   /protein_id="CBL39935.1"
FT                   /translation="MSVNFTSASSPTMNGKMPHIQCTAEEIGEIVLLPGDPGRVAMFED
FT                   LLEDYKIVSNYREYVVGTGYYNGIKVTVCSTGIGGPSTEIAVLQLIALGAKALIRIGGT
FT                   GVLKEDVPCGAMVLNTGAVRKGGASCFYAPSEYPALASFEVLDCLKRACEERKNEYSMG
FT                   ICMSVGSFYHGQGRQMPFETGYDENAVLEQYEKWNILNMEMEAETIFTLASLNNVLSGS
FT                   ICAVHCNRITDQWLVDFEPAQKEMCRTALAAGEKLYKEYLHRK"
FT   CDS             34370..35467
FT                   /transl_table=11
FT                   /locus_tag="CK3_00460"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems, periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39936"
FT                   /db_xref="GOA:D7GQ61"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ61"
FT                   /protein_id="CBL39936.1"
FT                   /translation="MKKKILATVLTAAMAVSMLAGCSSESASKASEAAATTAEATTAAE
FT                   ETKAEKTTAAEAKDTGDLKTVSIQIDGSAVPYYAPLYLAQENGYFAEEGLNVEFYYAAA
FT                   ADIVKNVAAGNVEFGFPNADAVVAAKAQGIPVKVAHTTYQEGLGAIIFGSDSGISTPAD
FT                   LKGKKVAVTSLGSANYFQLQAAMESAGLTIDDVQVEIVGTGAILTALTEGQVDAIVFSK
FT                   LRTIELNNSGYAASEITCDQFLPSFGNVLVAGDKLVAEDPETVDGFCRALNKAIEYIID
FT                   GHVEEAVDMSIEKYAPTFAEKRDVVVQILNDVFVKTLWQSDYTKENGIGASNPEKWQAL
FT                   IDESKEIGNIDETFDASELLYTPAK"
FT   CDS             35511..36290
FT                   /transl_table=11
FT                   /locus_tag="CK3_00470"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39937"
FT                   /db_xref="GOA:D7GQ62"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ62"
FT                   /protein_id="CBL39937.1"
FT                   /translation="MFYRKYRKTILPALFLPLFLIVWELYIRIFHVPNYLLPGPAELAN
FT                   SMVKLFVSGDVMKHIRVTMEEILVGTVIGIVIGLVLGYIMAKIRFIERLIMPFVIIIQT
FT                   APKISLAPLFILWMGLGIESKAALVILVVSFPIMINEVSAIRSIEDNVYNLMKVLKASK
FT                   WQTFCKIEVPYSIEMMLSGIKLALTQAMTGAVIGEMIGAKAGLGYLLTLGSETYDIKMI
FT                   LNAVILLSVIGLALYLISELIEKRALYWKVIDKSVVG"
FT   CDS             36407..37261
FT                   /transl_table=11
FT                   /locus_tag="CK3_00480"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39938"
FT                   /db_xref="GOA:D7GQ63"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ63"
FT                   /protein_id="CBL39938.1"
FT                   /translation="MRATHFLNVPAFIEENPEQSGGRKSAIETEKLSMKKMISWNVNGL
FT                   RACLGKGFLEYLKESDADIFCIQESKLQEGQVDLELPGYHQYWNYAEKKGYSGTAMFTK
FT                   EEPIAVTYGLGIEEHDHEGRVITAEFPEYYVVTCYTPNSQDGLKRLDYRMQWEDAFRAY
FT                   LKELETKKPVIFCGDLNVAHQEIDLKNPKTNRKNAGFSDEERAKFTELLEAGFVDTFRY
FT                   FYPDQEGIYSWWSYRFSARAKNAGWRIDYFCVSESLKDRLVDAKIHTEVMGSDHCPVEL
FT                   DIQ"
FT   CDS             37439..39292
FT                   /transl_table=11
FT                   /locus_tag="CK3_00490"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39939"
FT                   /db_xref="GOA:D7GQ64"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ64"
FT                   /protein_id="CBL39939.1"
FT                   /translation="MNLVTAEHLTKSYTERLLFDDTDFSINEGDKIGLIGINGTGKSTL
FT                   LKLVAGLEEPDSGRIVRGRNLDIRYLPQNPVFHPGETVLESVLRENEGHEHVWDIESQA
FT                   KSMLNRLGIPDFNEKVEHLSGGQKKRAALASVLLSTAELLILDEPTNHLDSEMADWLED
FT                   YLKKFKGALLMITHDRYFLDSVTNRIVELDNGKLYSYQANYEGFLELKAERMDMEKASE
FT                   RKRQSILRTELAWMQRGARARSTKQKGRIQRFEALRDKKGPVEDGKVEMESISSRLGRT
FT                   TIEISDLCKSYGDKVLVKDYTYFFLKDDRIGYIGPNGSGKSTLMKMIAGWVKPDSGTIE
FT                   IGQTVKLGYFSQENEDMDTSLKVIDYIKNVAEYVKTKDGSISASQMLERFLFPPSVQYT
FT                   VIEKLSGGERRRLYLLKILMSAPNVLILDEPTNDLDIQTLMILEDYLDSFQGIVITVSH
FT                   DRYFLDRVVGRIFAFEGDGKLQQYEGGFTDYQAAKAEREAKLAESAAENPAAAKKSADK
FT                   GNDAAETDSASRGNAKPREKKLKFSYKEQREWDTIEDDIAALEEAVENLEKEIEASATN
FT                   FTKLNELMKEKEEKEAQLEEKMDRWVYLNDLAEQIEAQKNR"
FT   CDS             39484..41376
FT                   /transl_table=11
FT                   /locus_tag="CK3_00500"
FT                   /product="Type II secretory pathway, pullulanase PulA and
FT                   related glycosidases"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39940"
FT                   /db_xref="GOA:D7GQ65"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ65"
FT                   /protein_id="CBL39940.1"
FT                   /translation="MAEYRNRNRILYPLGVTQEADGVRILVQGRAKEVCLLLYRPGEKT
FT                   PCEEISFDPKYRMGDVWELALDRTDFASFEYNFMIDGKIVTDPNARVITGREKWADRKR
FT                   AGKPVRGRVLSEEFDWEDDVNPETPYAETILYKLHVRGFTAHVSSGVSARGTYAGVMEK
FT                   IPYLKELGITAVELMPVTEFDEIMMSSSGSGFHNAKQEPTGYLNYWGYGPSYLYAVKTA
FT                   YASRETMSAEGEFKTLVKELHKAGIECIPEMYFTGKELPGEILSVLRYWVEEYHVDGFH
FT                   LTGFPDLSLAAEDPFLKRTKLFAENWNDVMNRRPKQGYVTPGDGAVSVEEKNLAEYNMQ
FT                   FMEDMRRFLKGDEGMLSAFELRNRRNPMEYAVINYMANTNGFTLMDTVSYDRKHNEKNG
FT                   EENRDGSDYNYSWNCGAEGPTRKKKIVELRKQLLKNAYLLLFLSQGVPLLMAGDEFGNS
FT                   QDGNNNAYCQDNAVSWLNWKLLESHKDQVDFVKRLIAFRKSHKMFHMDREPRIMDYKSC
FT                   GRPDVSYHGENAWKPEFENFRRQFGILYWGAYAKRPDGSDDANFYVAYNMHWEPHMFGL
FT                   PHLPKGAKWRVICNTGAPDAADLPTDGTGKVPKNQMMLAVPPRGIVILESFSEK"
FT   CDS             complement(41533..42012)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00510"
FT                   /product="LuxS protein involved in autoinducer AI2
FT                   synthesis"
FT                   /EC_number="4.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39941"
FT                   /db_xref="GOA:D7GQ66"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ66"
FT                   /protein_id="CBL39941.1"
FT                   /translation="MEKITSFTVNHLKLIPGVYVSRRDIAGDSHVTTFDIRMTRPNFEP
FT                   VMNTAEVHTIEHLGATFLRNHRLYKDKVLYFGPMGCRTGFYLLLSGDYESADIIPLLQE
FT                   MFLFIRDYEGEVPGAAARDCGNYLDMNLPMAKYLAGKFYDEVLEDIREEQLVYPE"
FT   CDS             42301..43194
FT                   /transl_table=11
FT                   /locus_tag="CK3_00520"
FT                   /product="2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
FT                   (catechol pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39942"
FT                   /db_xref="GOA:D7GQ67"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ67"
FT                   /protein_id="CBL39942.1"
FT                   /translation="MKLLAYEVDKRSFLGVLNEDETWVYPVSAAGMEYRSMKDLIREAG
FT                   PSEMEMLDYISKKAPGDVMGAAPVDEIRVVSPIAEPDQDIICLGINYMDHAEESARFEK
FT                   RAFEKPEKAIYFSKRVNRTNDPDGIIPAHKNLTNQLDYEAELAVIIKKDAKDVKPGEVK
FT                   DYIFGYTIMNDVSAREVQTEHKQWYFGKSLDGFTPLGPCIMTADSTAFPPVLKIQSKVN
FT                   GELRQNSNTGLFIHGIEEVICELTQGMTLKAGTIIATGTPAGVGMGFVPPKFLETGDVV
FT                   ECIIEGIGTLRNTVGE"
FT   CDS             43471..44256
FT                   /transl_table=11
FT                   /locus_tag="CK3_00530"
FT                   /product="NCAIR mutase (PurE)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39943"
FT                   /db_xref="GOA:D7GQ68"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ68"
FT                   /protein_id="CBL39943.1"
FT                   /translation="MEDIREMLKKVAAGELSVDNAVLELKKEPFTAAGYDDLGFAKLDT
FT                   HRKLRQGAAEVIYGAGKTPEQIAGIVEAMKKRGQETILITRVDEEKSRETEQLLAELYP
FT                   TGSGYQYFKEAKVAICGSFPEKDGVGTIVVATGGTSDIPVAEEAALTAEALGNQVERLY
FT                   DVGVAGLHRLISHMDSIMNARVIIAIAGMEGALASVIGGLADCPVIAVPTSIGYGASFG
FT                   GVSALLSMLNSCASGVSVVNIDNGFGAGYLASMMNHMRG"
FT   CDS             44363..45787
FT                   /transl_table=11
FT                   /locus_tag="CK3_00540"
FT                   /product="conserved hypothetical protein TIGR00299"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39944"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ69"
FT                   /protein_id="CBL39944.1"
FT                   /translation="MKTLYFDCGMGAAGDMLMASLYEICPDKERFLKMMNEMGLPGLSV
FT                   EAEPSVKCGITGTHMKVTIHGEEEESVDVDLQGHEHHHDHDHDEDHHHTHDHEDSHHTH
FT                   DHHHDHEGDHHDHSHEAHHHSHELAELAAEQTIHEHTHTHDHDHDCGHDHTHDHGHTHH
FT                   HHASMAGISHIIEHLNLPEEVKTDIVAVYRLIAEAESHVHGKTVEEIHFHEVGTADAIA
FT                   DIAGVCLLMHMIAPKKVIASPIHVGSGNVHCAHGILPVPAPATAFILQGLPIYSGVIKG
FT                   ELCTPTGAALLKHFVTEFKEMPVMRTSAIGYGMGKKDFERANCVRVLLGETEETGSEVA
FT                   ELSCNLDDMTPEALGFVQEILFAAGALEVYTIPIGMKKSRPGILLTCMCRCNDKEKMVS
FT                   LLFKHTTTLGIRESISKRYTLTRTMKEHETPYGVVREKVSEGYGVVRGKLEYEDLAKIA
FT                   KEHGMSLEDVKKLIGK"
FT   CDS             complement(45925..47100)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00550"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /EC_number="3.5.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39945"
FT                   /db_xref="GOA:D7GQ70"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ70"
FT                   /protein_id="CBL39945.1"
FT                   /translation="MSKVNELIQQYTDDAIEIRRHIHRHPELSMEEKNTTEFISQQLLK
FT                   YGIEISDIPFKSGVLGILKGGEDGHIILLRADIDALPMVEKSGLPFASENTGVCHSCGH
FT                   DIHTTSLLLAARVLSSLRDELKGTVLFLFQPAEERLSGSQMVIDSGVFENYHPDFAVGL
FT                   HCWPDIPAGTIGIRRGSFMASSDTVKLTIRGKGGHGAHPHKSIDPVMTSAYILTELQTI
FT                   ISRTIAPLDSAVLTIGKITGGTAANIIPDEVVMEGTVRTVSNETRALMEEKIRQIVSHG
FT                   AAAMGAECDIVYQKGVPAVVCDNHVVDLIEQAAAEELGADHVVTLATPSMGSEDFSRYL
FT                   EKVPGAMFRIGTRNDDPASSRPLHNAGIVFDEQAITSGASVFAGLALRYLH"
FT   CDS             complement(47104..48450)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00560"
FT                   /product="Na+/glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39946"
FT                   /db_xref="GOA:D7GQ71"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ71"
FT                   /protein_id="CBL39946.1"
FT                   /translation="MAETMTLTTVLIDISTISTLLFVGFLIRQKIPFFYKYYIPTSLIA
FT                   GILGLLLGPQVLGQFSPIHLHFSQWISQWTNFLFAFIFTTSFLGTSTGKFGRDVLSTTC
FT                   VTGAVFMAQILAGLGIAFLLSKFMSNVPYAMGFLPVSGFYGGHGSAGIMGGCFATEGWE
FT                   DATGIALTYATTGMFMAVIGGMWIINWGAKKGYTRKQMSSVNLDQKDITGIVPKEERKS
FT                   MATAISSSSVIDPLAFQMMIVGTIIAISHILREAIIKVFPFWSKIPLYTMCLIMGAIIG
FT                   IVLSKTKYNQYIDRGSMKRISGVALEYVIAMNVATIKLSVLASFLVPILVTSIAITILT
FT                   AVICIILAKKWYGKDWFEMAMGAYGQCTGSLATGLLLIKVLDPNGDTLAAESVSGSSTL
FT                   GSFWQQPYNTIGPMLILSSPLLTTLGTAGFLIAFLIVGTVLFGRTVKKA"
FT   CDS             complement(48496..49224)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00570"
FT                   /product="Uncharacterized protein, putative amidase"
FT                   /EC_number="3.5.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39947"
FT                   /db_xref="GOA:D7GQ72"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ72"
FT                   /protein_id="CBL39947.1"
FT                   /translation="MTNYIRKMSGKQYMKRLAENPTVIIPTGACEIYGPQLPMGSDLIA
FT                   AKRIAELVAEKTGALIAPTIEAGESSALASFPCTFAMPRKILEDWLDWLVGKLIKDGAK
FT                   NFVFITGHAGNVDTVNYIGKKYMNEHDIKLVQIDWWRFTNANGSDIFQYSGQMAHGHAS
FT                   ECGTSVFMYLFPELVDMDELSRVEPLPASEFPDFIGFQRFTEKTPNGTIGDATVATKEK
FT                   GEKIVTRCVDRIVSYMEKKF"
FT   CDS             complement(50632..51174)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00590"
FT                   /product="Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39948"
FT                   /db_xref="GOA:D7GQ73"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ73"
FT                   /protein_id="CBL39948.1"
FT                   /translation="MKKFVCSVCGYVYEGEAAPEKCPQCGAPASKFVEQSGEMNWAAEH
FT                   VVGVAQGVSEDILADLRANFQGECSEVGMYLAMARVAHREGYPEIGLYWEKAAYEEAEH
FT                   AAKFAELLGEVVTDSTKKNLEMRVEAENGATAGKTDLAKRAKAAGLDAIHDTVHEMARD
FT                   EARHGKAFAGLLKRYFG"
FT   CDS             complement(51376..51777)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00600"
FT                   /product="Fe2+/Zn2+ uptake regulation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39949"
FT                   /db_xref="GOA:D7GQ74"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ74"
FT                   /protein_id="CBL39949.1"
FT                   /translation="MKALKFSRQRESIRECLKNRKDHPTADAVYVTISKDYPKISLGTV
FT                   YRNLNLLADMGEIQRFSSGDGSEHFDYNTDPHYHFVCKACGAIIDMPLDLVCDTSDLLT
FT                   APFPGRVDSHTVFFYGECEDCLKKKNEKV"
FT   CDS             52152..57005
FT                   /transl_table=11
FT                   /locus_tag="CK3_00610"
FT                   /product="cytidyltransferase-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39950"
FT                   /db_xref="GOA:D7GQ75"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ75"
FT                   /protein_id="CBL39950.1"
FT                   /translation="MYNRHIRHLVTELGNRLSDKEFLKKIGLSRRSMQQLFDKDRWEVI
FT                   FEKAFPVTRRFSCAEILEFCRVDMEKLSNEPEEGWLSFAYKYSTHILYPDADFAVSAAP
FT                   YAPSALYFLNVLQYFFDEERKVLPFDPYDDFRFLTEEEYAGFERAGEYAHFIREFRDQY
FT                   IYEMMRLNREATPFETLGHIAGVHYVAMVAARGLYEAGVPIDLALASGAAAGHDLGKFG
FT                   CKPDERVPYLHYFYTNQWFTAYNMEGIGHIAANHSTWDLELDNISVESLVLIYADFRVK
FT                   QMRGEDGREITKIYTLKDSFDVILSKLDNVDEAKRNRYRVVYSRLYEFERYMRSKGVDV
FT                   DLTGNPDPAEQPVDIVVQSGKQVVRSFVFWGIEHNIDVMHRLGTERQFGNILEAARSEK
FT                   DWKNVRAYLNMFNEYSIHLNHRQKEQTISFLYELLLNREGDIRRQAAALIGKMFADFNA
FT                   GYRKELPKNMPDPDAKTALTLWEEYLGQLICPDYRLTLQQKNRIQNSLKFVMVSAMERS
FT                   SEKVREELFEVFMKWFDGHHRLVGDPVFYLLDCIFSLPLDLCSKGSRLERLICFAISHM
FT                   DDPDEKVQIAAVRVLKVLTQAVPPESACYEIVCDAAHRINPRTITLLFLQYRIYTNLRL
FT                   DTTAQREVLYGHDVVSDIFLENLKSATPWILKSVNIKLLADQVDHGKRDHLLHICAHFS
FT                   NLIKVSEQVGVRHDAGRALLRLAHLLATDQRNEIAVELLKGLEVGEYEFSKYIPEYLGE
FT                   FALWLPPEQLDDMIERLHILLANGNERIVSVALDTLGVLLECYSRYTVRFHESEEVSEE
FT                   RRMKLLGLILSCLANYREQVRQEALLVIGQHIFGSQILAERDKSRMFSLCAKKLLFLLN
FT                   ENKGGELSLYYRAATLSHIDRFIAHYQLFGGLVETRTREKIAFFPGTFDPFTLSHKEIA
FT                   KKIQELGFTVFLAIDEFSWSKKTQPHLVRRQIVNMSIADEFYVHLFPDNTPVNIANPAD
FT                   LRRLREMFPTEELYIVVGSDVIHNASSYKKDPEENSIHSFNHIVFRRPGEAHPTEVYEQ
FT                   ITGKVVQLELPQELEDISSTKIRENIDNHRDISSLIDPVVQEYIYHKGMYLREPEFKPI
FT                   LRAKAIAFENAAGRDREVLDELGNTVLYGHPDAQAILTKIQVENDRLLILRNTVEGERP
FT                   AGFVSYREIGNEDLFGVLKDMELANLVRGKSSREILLITGIYAREDGTGDSGVIRDAPQ
FT                   QLLVEVLAKELEKNYSFALFVAERGTATKEVVYVLERQGFIRPHMADENDKRTIYMVDM
FT                   HEPLMFLHNLDTTIKEPFASNPAVLDAVEKNHKKLQIAMTKLYPGNLVLSLSSGIMYHR
FT                   LVDRITALNDVPREPLVPRRLGKNMCVPFGKILRGKVVPNTVTKTLHTDKVYEPDLNSF
FT                   TIEPFPYYSPLKSQIETIKSFDRPVILVDDLVHTANRLQVLVPQLREDGIPIKKVVVGV
FT                   LSGYGRDLMQCLKVPVESIYSMPNLRQWFVESTLYPFIGGDTVRREEMKVAGLQPSINM
FT                   ILPYATPRLSGCSREALVEFSACCIENSRDLFQVLEAEYRKMYAKNLTLSRLSEAVILP
FT                   LCPDKGSCMEYDENLAASVYLENDLETLWRMKEFLIKG"
FT   CDS             57158..58420
FT                   /transl_table=11
FT                   /locus_tag="CK3_00620"
FT                   /product="Malate/lactate dehydrogenases"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39951"
FT                   /db_xref="GOA:D7GQ76"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ76"
FT                   /protein_id="CBL39951.1"
FT                   /translation="MVTYYKIGDMFCASAHGDLPYEKTEKPAAGTKLTWLFTGGPGSRR
FT                   ASFLVNHPAELFMEKEDVSWLNTNRLNASAYDGQTRELPADLLAQLDAGTLRAVNASHP
FT                   KFEEILAYKPKEGKKRVHVLAIGDVGSMLLTGLHLLGGDVISSIGICDISDKVTARWEF
FT                   EENQIAYPWDYDAMPEVDVVDQDHLFDCDVFVFVASKGIPPVGSGVKDVRMYQFENNSK
FT                   IIGHYAKMAREKNFKGLFCAVSDPVDPLAKTAFLESNKNEAGEYDWMGLLPEQIQGFGL
FT                   GVMNARAAYYAKRDPRFKQFLTEGRSFGPHGQDLVIADSIENYNDELSKELTNLTVTAN
FT                   LHMRAIGYKPFVAPAFSSGAISILMTLRKQWHCGSVFLGGVYMGVKNRYTEQGLETEAL
FT                   ALPDALYERIVFAAENLAKIV"
FT   CDS             58680..59711
FT                   /transl_table=11
FT                   /locus_tag="CK3_00630"
FT                   /product="Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39952"
FT                   /db_xref="GOA:D7GQ77"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ77"
FT                   /protein_id="CBL39952.1"
FT                   /translation="MDEVLRAALDGIDTEIVEDMEILEQDPFKYRGRRLLFAVPLGRNG
FT                   INRGYYEVLAWLRGGDQVLAGATAGMIIDAESEFYTKATARELAVAANRAGCAFVGRPL
FT                   VEGTASLDNYLIQAANMNTDRFGAYKKSAAILAHQILEETWQPKEESHLLVLHASNHRT
FT                   SNTLAIWQKVKECLDERIRIQEINLRNGTLVDCSGCPYQMCLHFGEQGKCFYGGAMVEN
FT                   IYPAVKWADAILLLCPNYNDALSANMTAFINRLTALFRTTRFYDKALFGIIVSGYSGSD
FT                   LLAGQLVTALNMNKTFYLPGNFCMMETANNAGAAMKLPGIEDRIKEFSEKMTHILIKET
FT                   QNS"
FT   CDS             59931..60980
FT                   /transl_table=11
FT                   /locus_tag="CK3_00640"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39953"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ78"
FT                   /protein_id="CBL39953.1"
FT                   /translation="MRKRFSAAMALALSCAMVLTACSGGSKPAETTAAAAADTTAAAAE
FT                   TTAAAAAAPSGDAQKLTMGTGGTTGTYYAFGGVIANVLNSKDIGVNINVQSTGASKANI
FT                   YLVNDGEADLAIVQNDVMDYAYNGTDLFVEEGAAKDFTTVAALYAEVCQIVSSGDIKSV
FT                   ADLKGKRVSVGDAGSGVEFNARQILEAYDISFDDIQVNNLGFGDSADALKDGKIDAFFC
FT                   TAGAPTTAIVELATTNAINLLEIDDEHAKKLADAHPFYTTYAIPGGSYKGVDDDVQTVA
FT                   IKATLIASPKLSEETVYNLTKAIFDNKDEIASTHAKGEELDLEYAVSGISVPFHPGAEK
FT                   YFKEVGAIK"
FT   CDS             61570..63543
FT                   /transl_table=11
FT                   /locus_tag="CK3_00660"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39954"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ79"
FT                   /protein_id="CBL39954.1"
FT                   /translation="MAEKDNMKVNTSPVADVETGTAEDVEAIMKKYDRESNTRIWEGTP
FT                   KQVIRFLLAAFSVLMLYMNLFANWDERVRRSLFVGFVIILSFLVYPMKKGSSKKNSVPI
FT                   YDIILMVLGAGAYFYFVFNFKTIIGHATRISQTEVIVGVIGILILAETCRRVVGIPILC
FT                   VATFFVGYAFYNGLGQGRAFAVVLKSIVYNLFYTTSGVIGTPIGVCSTYIALFILFGAF
FT                   LEATGISEFFIQLANSLAGASTGGPAKVAVISSALCGMVSGSSVGNTVTTGSVTIPLMK
FT                   KTGYQGEFAGAVEAASSTGGQIMPPIMGAAAFLMAEMVGVQYGEIAMRAIFPALLYFTG
FT                   IFITVHLEAKRLGLKGIPKDELPKFGPLFVRQGYLLIPLVALVAMVMMGYTMSRAAIIA
FT                   TALAILVSMPNKETRMNPTRFINALEAGGKNTLSVAVACGVAGIIAGVVTMTGLGQLLI
FT                   SAIVGVAGDRVIVALFLTMLTCIVLGMGVPTTANYIIMATTCAPILVNGMGINKIAANM
FT                   FVFYFGIVADITPPVALAAYAGSAIAKSNPMKTALNASRLAIAAFIVPYIFAFNPAMLF
FT                   IDTGVLGVVTIIVTSLIGLFGVAAGLEGYMFANLNVIERLLSIVGGLCLIIPGTVTDIV
FT                   GIVLVGISAALQIMKKKKAAVA"
FT   CDS             64049..65536
FT                   /transl_table=11
FT                   /locus_tag="CK3_00670"
FT                   /product="L-threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39955"
FT                   /db_xref="GOA:D7GQ80"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ80"
FT                   /protein_id="CBL39955.1"
FT                   /translation="MELLYGSTRGGETGVTASQAVLKGLADDGGLYVPERIPTLDVTMD
FT                   ELAGMTYQETAYAVMKQFLTDYTEEELKYCISHAYDEKFDTEEIAPLAKADGMYFLELF
FT                   HGKTIAFKDMALSILPYLMTTAAKKNHAKNEIVILTATSGDTGKAAMAGFADVPGTRII
FT                   VFYPKNGVSRVQELQMLTQKGANTSVVGIEGNFDDAQTGVKKIFGDKEFAKELDAMGFQ
FT                   LSSANSINIGRLVPQVVYYVYAYAKLLANGEIEKNEKVNVVVPTGNFGNILAAYFAKQM
FT                   GVPFGKLICASNDNKVLYDFFRTGTYDKNREFILTTSPSMDILVSSNLERLLYLSCGRD
FT                   AAKTKAMMEQLSTNGKYEITEDMKEFMKDFAAGYADMEENAKEIRKVFDDTGYLIDTHT
FT                   GVAAAVYEQYKAKTGDTTKTVIASTASPYKFSRSVMEAVLGKKEDADEFALIDEMERIS
FT                   GVKIPQAIEEIRDAKILHNRQCKPEEMEETVKQTFSK"
FT   CDS             65680..66546
FT                   /transl_table=11
FT                   /locus_tag="CK3_00680"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II,
FT                   various bacterial and amitochondriate protist"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39956"
FT                   /db_xref="GOA:D7GQ81"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ81"
FT                   /protein_id="CBL39956.1"
FT                   /translation="MLVTAKEMLEKARDGKYAVGHFNINNLEWTKAILQTAEELRSPVI
FT                   LGVSEGAGKYMTGFKTVVGMVNGMLEEMKITVPVALHLDHGTYEGCLKCIDAGFSSIMF
FT                   DGSHYPIEENVEKTKELIRICREKGMSLEAEVGAIGGEEDGVIGMGECADPNECKMIAD
FT                   LGVDMLAAGIGNIHGKYPANWKGLSFETLAAVKEAVGDMPLVLHGGTGIPEDMIKKAIS
FT                   LGVAKINVNTECQLAFADATRKYIEAGKDLEGKGFDPRKLLAPGAEAIKATVKTKMELF
FT                   GSVGKAD"
FT   CDS             66759..68876
FT                   /transl_table=11
FT                   /locus_tag="CK3_00690"
FT                   /product="Uncharacterized protein related to glutamine
FT                   synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39957"
FT                   /db_xref="GOA:D7GQ82"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022147"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ82"
FT                   /protein_id="CBL39957.1"
FT                   /translation="MSETINVEAIFGENVFNDSVMKERLPKSVYKKLKQTIEDGSELDP
FT                   TIADVVAHAMKDWAVDNGATHYTHWFQPLTGVTAEKHDSFIGNFDSQGKVLMDLSGKEL
FT                   IKGETDGSSFPSGGLRATFEARGYTAWDCTSAAFLKKDATGVTLCIPTAFCSYRGEALD
FT                   KKTPLLRSMQAIDKEATRIFHLFGHTEVKRVTPSVGPEQEYFLIDRDKYLKRKDLIYTG
FT                   RTLFGAMPPKGQEMDDHYYGVIRERIGSYMKELNEELWKLGVTAKTQHNEVAPAQHELA
FT                   TIYTKANLAVDHNQIVMETMKKVASRHGMACLLHEKPFQGVNGSGKHNNWSLASDTGIN
FT                   MLDPGVTPHENIQFLLVLACIMKAVDRHADLLRQSAAVPGNDFRLGAQEAPPAIISIFV
FT                   GEQLEDVIDQLISTGSATHSKTGGTLKTGVTTLPDFDKDATDRNRTSPFAFTGNKFEFR
FT                   MVGSSDSVSSANVVLNTIVAEAFKEAADELEKADDFDLAVHDMIKKLLADHRRIIFNGN
FT                   GYSEAWVEEAERRGLPNLKCMVDAIPSLVTEKAFKLFGDFGVYTKEELVARAEIEYESY
FT                   AKSVNIEAKAMINIAGKQLIPAVVRYTTVLAQSLSAVKAACPEADNSVQTELLIEVSDL
FT                   LSDMKVARAKLEDLVEEYQHIDSMEKRAHFCYDEIIPAMQALRDPADQLEMIVDKEYWP
FT                   IPSYGDMIFEV"
FT   CDS             complement(68960..71095)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00700"
FT                   /product="FOG: Glucan-binding domain (YG repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39958"
FT                   /db_xref="GOA:D7GQ83"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ83"
FT                   /protein_id="CBL39958.1"
FT                   /translation="MRQKKRAAALLLSAVMAFSAVSPALPALAAVWQKNASGSYIGSDG
FT                   SVLTGILSRGVDVSQWQQNINWSAVAADDIQFAMIGTRYNNAVDPYFDANVRGAAAAGL
FT                   RVGVYLYSYATTTAMAESDADFVLNLIKDYPISYPVVLDVEAQEMNGLTPSQIADIINA
FT                   FCKKVETAGYYPMVYTNDYWISNKIDMTKVHYDVWIARYDAKPAYQGAALWQASNQGTV
FT                   NGISGNVDINFTFKDLSSKLPANRWRLIGDKWYYYKNYVKQTGWINDGQSWYYLNADGT
FT                   QFKGWLLLDNQYYYLLPTTGQMKTGWLKAEDAWYYLNSDGTMAKDWIQVNGTYYYLLNG
FT                   AMVTGWLRIGNDYYYMRGNGSMVTGWRKMDGKYYYFNGNGKLVRGWADIDGKRYFLQQD
FT                   GTMVTGWQTIDGLLYYFDASGAMAAGWTKLDGYWYYFNNEGKLMTGWMQLDGKFYYLHT
FT                   DGRMVIGWQSDGTNKYYMDTVSGVMAVGWKQIDKSWYYFNQAGHMITGWLNDGGKYYYL
FT                   NPADGKMIANGSFVVNNVNYTFNQSGVCLSETSAIDGGSAGSVYTPGTAGTVANGNYMG
FT                   TPAAGNAQNGITTGNSGSGNAAAGSAPGGSTTTTTGSTTPGYSQTNTGMSAGNYQTGGP
FT                   GTSNSSSGSASTTAPSGNTTGSNNNYYTNTGSMTGPGSSNTNYNYSSGSSGTTAPGSSG
FT                   SSSSSSNLTEYQTGGPK"
FT   CDS             complement(71429..73282)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00710"
FT                   /product="CTP:phosphocholine cytidylyltransferase involved
FT                   in choline phosphorylation for cell surface LPS epitopes"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39959"
FT                   /db_xref="GOA:D7GQ84"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ84"
FT                   /protein_id="CBL39959.1"
FT                   /translation="MDRLGLLCRNIYENNKMTQRELAAAMNLSLGTCNHLVKEGLDREL
FT                   FTFDPADGSYSLLKGGVELLRNYRMDSAVILAAGFGSRFVPLTFETPKGLLEVYGERMI
FT                   ERQIKQLHEAGVTDITIVVGYLKEKFEYLIDKFGVKLLYNPEYHNKNTLTTLYRARECF
FT                   IGRNTYLLSSDNWMRSNMYHTYECGAWYSSVFMKGETSEWCLETSKKGLLTGVKVGGED
FT                   SWVMYGPVFFSKEFSEKFFPILEEYYHTPGTEQMYWEQVLADLLNGEVDSHLPGKHHFP
FT                   VPEMYINKQPENQVYEFENLEELRLFDERYRNHSDNIAMELISRVLQVPESEITGIKCL
FT                   KTGMTNKSFLFKVHDKSYICRIPGPGTELLINRKQEKAVYDAVKDYGITEHVVYMNGET
FT                   GYKISEYYEGARNSDPRNWDDVARCMALVEKLHDSKLHVDHSFDIRERITFYEALCRGY
FT                   EKKLFEDYPEVKSHMMTLLDRLDRLNRPKVLSHIDSVCDNFLFLPNGDLRLIDWEYSGM
FT                   CDPLIDVSMCAIYSYYNDLEVEKLITTYLHREPTAEERFVYYAYIALGGFLWCLWAVYK
FT                   SSVGEEFGDYTIVMYRYAKRFYKKIITAPEFLGIGDGGTLR"
FT   gap             73745..73958
FT                   /estimated_length=214
FT   gap             77146..77359
FT                   /estimated_length=214
FT   CDS             77540..79156
FT                   /transl_table=11
FT                   /locus_tag="CK3_00740"
FT                   /product="O-Antigen ligase."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39960"
FT                   /db_xref="GOA:D7GQ85"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ85"
FT                   /protein_id="CBL39960.1"
FT                   /translation="MANRIKKKEETKSSYQDNVALIMGAFTLIVLCVLPLVFHDFYFDI
FT                   LETKYQFYSAAAIAALVIMGGYGLASGKMIEWFSKFNFQTWRKSMNVCDWAMLVFWICN
FT                   VLSWIFCKDWKWEAFWGTSGRYNGVFLMTVYMASYFLVTRFFKLKQWYLDAFLAVGIFV
FT                   CVFGITDYFQMDILGFKVNMMDEQKAIYTSTFGNINTYTIYVAALLAVSMVLFTQEKNQ
FT                   KRMLWYFGNMVLSSFALIMGTSDNAYLSLAAIFGLAPLWLFRTKTGLRRYVISAATFVT
FT                   VILCINGINQAYASSVLGIDSAFGLIAKQKFLPVLAALLWIASAALVARSRKPQALMNR
FT                   TSSDEMNKIAVYIWLGVIAVVCLGVVFVLYDANAAGHADKYGAISSYVVFDDNWGTQRG
FT                   YVWKRAVEIFTKKLTPIQKVFGYGADTFALLMQYYFPADMQNGKMVIFDSAHNEYLHYL
FT                   VTIGFAGMASYIVFMMSSVVAMAKRMKEQPVVAAVMLAVLAYMIQATVNINLPIAMPII
FT                   LQLLAMGVGCRKTAVSEEKKD"
FT   CDS             79224..80531
FT                   /transl_table=11
FT                   /locus_tag="CK3_00750"
FT                   /product="histidinol-phosphate phosphatase family
FT                   domain/HAD-superfamily hydrolase, subfamily IIIA"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39961"
FT                   /db_xref="GOA:D7GQ86"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ86"
FT                   /protein_id="CBL39961.1"
FT                   /translation="MMQAVIMAGGKGTRLAALTKDEIPKPMVPVAGKPLLLWQVERLKE
FT                   NEITDIIMVIGHLGDKIKEYFGDGEKFGVSIRYFEETEPLGTAGSFYYLKDMIHGDRFV
FT                   MMSGDLFFDIDFQRMIRFHEEKGAVATLFVHPNGHPFDSDLLVLDKDDKITAFDSKHNV
FT                   RDYWYKNCVNAGIFVFEKKICDYVPEPVKRNLENDVIKGMLEAGEPIYGYCSPEYVKDV
FT                   GTVDRVNQTLADIERGVIAGKCLRNKQRCIFMDRDGTINQYKGLVYKEEDFTLEDCAVD
FT                   AIRKINQSGRLGIVITNQPVVARGLCEIEDVENIHKKMETLLGKEGVFLDDVFYCPHHP
FT                   DKGYPEENPAYKIPCECRKPKTGMIQKAVERYNIDLAGSWMIGDTTMDIQTGINAGMRT
FT                   ALVLTGEAGNDKKYDVKPDLVCRDLLDAVEKILQMD"
FT   CDS             80756..81751
FT                   /transl_table=11
FT                   /locus_tag="CK3_00760"
FT                   /product="Predicted kinase related to galactokinase and
FT                   mevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39962"
FT                   /db_xref="GOA:D7GQ87"
FT                   /db_xref="InterPro:IPR001174"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014606"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ87"
FT                   /protein_id="CBL39962.1"
FT                   /translation="MIITQTPFRMSFFGGGTDFPDFYKEHGGAVISTTFDKYCYVNVRH
FT                   LPRFFDYSTELSYSKIERVTDVNDINHPAIREAMKYLDMQEIRLTYEADLPARSGLGTS
FT                   SSFAVGMLNAFYALKGKYADKRKLADDAIYLERVLCNESGGVQDQIAAAFGGLNRINFN
FT                   ADGYEVNPVIISPERKQQLNQNLMLFFTGFSRFSSDIQQTTEKALVDKQKQLLEMLSLV
FT                   DDAEKVLTSKTDLNEFGRLLDYTWKLKRGISNRISTDSIDGLYAKGMVAGALGGKLLGA
FT                   GGGGFLLFYVEPDKQEAVHKAMEELLYVPFEFENSGTRVIHYTPETYEKR"
FT   CDS             81818..81910
FT                   /transl_table=11
FT                   /locus_tag="CK3_00770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39963"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ88"
FT                   /protein_id="CBL39963.1"
FT                   /translation="MKILCDIVEAAGFAYLERTVPAKLVTGRTV"
FT   CDS             81944..83212
FT                   /transl_table=11
FT                   /locus_tag="CK3_00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39964"
FT                   /db_xref="GOA:D7GQ89"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ89"
FT                   /protein_id="CBL39964.1"
FT                   /translation="MKLVLKNIGKVQNATVEINGITVIAGENDTGKSTVGKALFSVFNS
FT                   FYNIDKKLASEREGSIYNQLQSMLRESLLDEYFYINPSELAKEVITFNEKKETGDELKK
FT                   EIFDAIAAYDNRIPEAISKDAIEATADRIIKILLIPDDEILKSILQKNLDVEFCGQIGN
FT                   VFCEDESSIQLGIRNESTEVVISKDRVMDVIKPIRLGTEAIYIDDPFVLDELSGGSGRM
FT                   WIGVPRYPDHRTHLKTCLKVASRNLNVVDEIVTNEKFDQIYEKISKVCEGDVVRDKRTS
FT                   VGYRVGEYRLDVKNMSTGLKTFAILKSLLTNNYIEANGTIILDEPEIHLHPEWQLLFAE
FT                   LIVLLHREFGLHILLNTHSPYFLNAIEVYSAKYQVSEKCKYYLTENVDKVSQIKDVTDC
FT                   VEKIYSKLARPLQELENERYHYE"
FT   CDS             83205..83795
FT                   /transl_table=11
FT                   /locus_tag="CK3_00790"
FT                   /product="Rab geranylgeranyl transferase alpha-subunit,
FT                   insert domain."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39965"
FT                   /db_xref="GOA:D7GQ90"
FT                   /db_xref="InterPro:IPR009087"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ90"
FT                   /protein_id="CBL39965.1"
FT                   /translation="MSDHNLYDVFSDYKSTLKECSKDNSDPKNVKFMTESQLEVINFDG
FT                   IKTKYTNDLALSEICAASVDALLQMDEDLAFVEFKNGKVDKRNVKDKARDSLLMLCDLM
FT                   KRTISYTREHLDFIVVYNEERNPQPNQLKKQAVLDSPSRTAIGKYFLSKGNEELIRFDL
FT                   ERYEHLYFREVHTYTKAEFDKYIEEKFAGGTVS"
FT   CDS             83816..84712
FT                   /transl_table=11
FT                   /locus_tag="CK3_00800"
FT                   /product="Glycosyltransferases, probably involved in cell
FT                   wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39966"
FT                   /db_xref="GOA:D7GQ91"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ91"
FT                   /protein_id="CBL39966.1"
FT                   /translation="MSVYQKENPEYFRAALSSIFYQTVLPTEIVLVCDGPLTAALDAVI
FT                   LEYEDSCSKDTPRSTRTDMNDRVMPDGKRDMPGTVFRVVRLTENQGLGKALNEGLRHCT
FT                   CEWIARMDTDDLAAPDRCEKQLKYLERHPDVDVLSGTIAEFQGDALDVQAAEKVVTSYK
FT                   TVPQTPEEIFRYIKQRNPINHPCVMFKKSSVELSGGYQPCPYFEDYDLWVRMYRDQAVL
FT                   ANLSDTLLYMRVNGMHQRRGGIQYAKYIVEFRMKMYRYQVITFGEFLPMTVARVLVSLM
FT                   PNGVRKYLYDKKLRKHK"
FT   CDS             84931..85908
FT                   /transl_table=11
FT                   /locus_tag="CK3_00810"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39967"
FT                   /db_xref="GOA:D7GQ92"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ92"
FT                   /protein_id="CBL39967.1"
FT                   /translation="MKLLTITVPMYNVANYIEECLKSFLVPGAEEALEVLVVNDETPDN
FT                   SREIAEKFVEKYPEIYRIIDKKNGGHGSTVNRGIEEASGKYFKVVDGDDWVDQKAFENF
FT                   LAHLQKTDADMVLSNYHWVDDKTKNRKEEVSEICPGIEYGKDIPFSEVKDHIFAKMHAI
FT                   TYKTSVLRNQPERLDEKCFYVDAEYVIFPLPYIQTVSAIPDFVYQYRIGMSTQSMSIEN
FT                   MMKRCSQHERVLKRIMDFYDKHKTCAAAEMIRDMAARLAVSQYKIYLSFPQSHKTRMVA
FT                   MEKEIREKFPEVYSQMKNPAVQVLRSTGYLTYGLVSMAVRYARK"
FT   CDS             85924..87312
FT                   /transl_table=11
FT                   /locus_tag="CK3_00820"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39968"
FT                   /db_xref="GOA:D7GQ93"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ93"
FT                   /protein_id="CBL39968.1"
FT                   /translation="MQSKKNGRQFEQYKRVVKFLGSVVIVLLEVILYYYVWMNYYNRNM
FT                   TIAFWRRGNWLIIGEYLALLLLLHRTYGGLKIGIYKYWNLVYSHMISIIGVNAFSYVQV
FT                   VLFDKKMHNPTALMILTVVDFLVVMVWALAYKKVYAFLFPRKQLLLVYGDKSMFHLMGR
FT                   IDSREDKYEIAKTISIDEGIGTIIGQAGEYDGVIIGDIPSEKRNELMKRCYAGNIRSYT
FT                   VPKISDILLRTSVELNIFDSPLYLSRNIEGLPWDQQVLKRIEDVLVSGLMLLITSPFFL
FT                   IIALLIKCTDRGPVFYTQTRLTLNGKEFPIYKFRTMVVDAEKKSGPVKAGDKDPRILPV
FT                   GHFLRATRLDELPQLLNILKGDMSLVGPRPERPELATIITKNIPEFEYRLKVKAGLTGY
FT                   AQIYGKYCTTSYDKLKLDLTYIRNYSIWMDLKLILMTPKVLFMKESTEGFEEGGFEDPA
FT                   LKEK"
FT   CDS             complement(87378..88799)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00830"
FT                   /product="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39969"
FT                   /db_xref="GOA:D7GQ94"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ94"
FT                   /protein_id="CBL39969.1"
FT                   /translation="MAVQASLGKNFIMNILLAASSLIFPLITYPYVSRILLPDGTGRVA
FT                   FAVSVVSYFTMTASLGIPTYGIRACAGVRDDKKGLSQTVQEIFLINAAMTLLVCLVFAL
FT                   CLAFVPKFQDDRVLFLVCGISLLFNLVGMEWLYKALEQYQYITFRSIAFKALSVVLMFA
FT                   MIRSQEDYLQYGFLTIFASVGSNIFNFFHARRYITFVPQRPYHLKRHLRPILILFALTV
FT                   TTTIYTNLDTVMLGFLKDSETVGYYNAAVKIKELLATIVAGLGSVLLPRISYYIKNRQF
FT                   EKFRELIRRSFAFVTVFAIPLCVYFIVMSDYSIDLFYGPAYENSVLPMRLILPTLICIG
FT                   LTNTIGIQILVPTDREKLVVYSTCAGAVTDLILNAVLIPVLGASGAALGTLAAEIVVLL
FT                   VQLWFIRGEIRSFCTLMQLKKILLALVPATVILLFLHTALHLHTFFMLCVTAAVFFPVY
FT                   LVVLLLLRYKIKLRG"
FT   CDS             90237..91439
FT                   /transl_table=11
FT                   /locus_tag="CK3_00850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39970"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ95"
FT                   /protein_id="CBL39970.1"
FT                   /translation="MKEKQLKRRVQEKIADPQCGDDLFLIGYAMYLATTVWVTTMFPMT
FT                   KMVQALCMLISLICIAIKIFLYGKYSMKKVLILVVTGLYCVVGLYRNHYVYPLIWFVLI
FT                   AGSDQVPFEKILKVYLLIVGAIVFLAFAASMLGVIPNLQYETSTRGIRNSFGIIYPTDC
FT                   GAHVFFWMLTFFYLKGKNLRGVHYLFGLITTWAVYHFCNARIDAGSILMTTSLFGLGNF
FT                   ISYDSKCSRRIKRIWERLWERLGGMVMPLLAFVSILFTYLYSDGNPLWAKMDSTLLARF
FT                   RLGKQAFEEYGLKLFGQKIPMNGNGGTVEWIEDYFFLDCSYVNILLTWGLILFLSVMIL
FT                   FIYSCTKNRKDLYFQYAIAAIAVNSMIAHHLMDVAYNPFVLAIAAGVIMRASGLGKNRI
FT                   K"
FT   CDS             complement(91489..91935)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00860"
FT                   /product="Uncharacterized phage-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39971"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ96"
FT                   /protein_id="CBL39971.1"
FT                   /translation="MSSVKTISELMLSFGSMSNKKIQKICYYAYSWYLTLYGEQLAPFQ
FT                   FEAWVHGPVSRELYHYYKSYGWSDIPQYHGLVMVDNEMAAFARKIWTLYGSYSADELEQ
FT                   MSHKEYPWQAARGTCRYYESSDTLLDDDDIIAYFSKNKDFFISA"
FT   CDS             complement(91963..92607)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00870"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39972"
FT                   /db_xref="GOA:D7GQ97"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ97"
FT                   /protein_id="CBL39972.1"
FT                   /translation="MECHFSIFSLYMELSKTIYAISSYMTLRMDAYDFMYNEALLATTE
FT                   KSGHNIYHIFDKVKHCLKDKADERSVTIHIKSNGECGELKAYDCLDLLPFILLDNAIKY
FT                   SDRKTHIQVDIKDTPASCIFLVSSISPRLADGECERIFDRGFRGENARKVTDEGLGIGL
FT                   YTAKKICDLHNSSIEAYEKPIPNSYPGNRKDFDKNKCLFVMDIQLNKEYNI"
FT   CDS             complement(92642..93655)
FT                   /transl_table=11
FT                   /locus_tag="CK3_00880"
FT                   /product="Fucose 4-O-acetylase and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39973"
FT                   /db_xref="GOA:D7GQ98"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ98"
FT                   /protein_id="CBL39973.1"
FT                   /translation="MNNLHPTSNREPWIDFAKGITLLLVIIGHTVSGVLSGAIYSFHMP
FT                   LFFILSGITAKLSSSAQQFSDKTQRSFRHLMFPFFLIYTIQTVVYLLRHFSNIQQDASF
FT                   LPAYLKERILAGIFSSGVTISVFGTEVLYVGVIWFFPALFIGKTLFDYMHLKLTAKQFP
FT                   LICLLCSIAGVVIGQYQCLPLSFDVVLAIMPLFYIGQHFNVFNVKKSPSKKFFLYALIW
FT                   GIFLIITYVLGHHCLELASRRYPAYPLCFITALSGTLMLSEFSVLCCQYNFLSRPIQYI
FT                   GKNSLYLLCIHTLEWDYLTKLWNISSNMYICTIIRILLDLSLFLLFMILRSKCFKR"
FT   CDS             94374..94685
FT                   /transl_table=11
FT                   /locus_tag="CK3_00890"
FT                   /product="Predicted UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39974"
FT                   /db_xref="GOA:D7GQ99"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQ99"
FT                   /protein_id="CBL39974.1"
FT                   /translation="MEKKYNIAVAGTGYVGLSIATLLAQHHKVTAVDIIESKVEMLNNH
FT                   KPPIQDEYIEKYLADDVSGIRKLDLTATLDAKTAYSTADFVVIAAPTNVYAKFSVPDS"
FT   CDS             95385..96497
FT                   /transl_table=11
FT                   /locus_tag="CK3_00900"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39975"
FT                   /db_xref="GOA:D7GQA0"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQA0"
FT                   /protein_id="CBL39975.1"
FT                   /translation="MYDYLVVGSGLYGATFAQQAKAHGKSVLVIDKRPNIAGNIYTEKV
FT                   EGINFHKYGAHIFHTNNMEVWDYLQQFTVFNRFTNSPVANHKGELYSMPFNMYTFNKMW
FT                   GVVTPEEAQAKIDEQRKEITGEPQNLEEQAISLVGRDIYEKLVKGYTEKQWGRDCKDLP
FT                   AFIIKRLPVRLTFDNNYFNALYQGIPIGGYTKMVEHMLDGIEVRLGVDYLEHKDELDAL
FT                   AAKVIYTGPIDAYFNYSLGYLEYRSVRFENEILDKPNFQGNAAVNYTDRETPWTRIIEH
FT                   KWFEFGKDENGNDLPKTIISREYSSEWKPGDEPYYPVNDAKNGALYTQYKKLADQETDV
FT                   IFGGRLGEYKYYDMDAVVASALAMCEKELA"
FT   CDS             96529..97356
FT                   /transl_table=11
FT                   /locus_tag="CK3_00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39976"
FT                   /db_xref="InterPro:IPR025536"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQA1"
FT                   /protein_id="CBL39976.1"
FT                   /translation="MSQNKQSKPLDIKIIIAAHKKYRMPQDDIYVPLHVGAEGKDSIGY
FT                   QGDSTGDNISNLNPYFCELTGMYWMWKNLQADYLGLAHYRRHFCFRKKKAENDEESKWK
FT                   SVLNSKEAQILCKQYDVIVPEKRHYVIETLESHYAHTHYIEHLEKTREIIGERYPQYFD
FT                   SYDKILKRKSGYMFNMFLMRADLVDKYCSFLFDVLFELDKRVDTSNYSAFQARYPGRVG
FT                   EILLNVWLDKEVGEQGLKIKEIQHIHMEPINWWNKGTAFLKAKFLGKRYEHGF"
FT   CDS             99470..101449
FT                   /transl_table=11
FT                   /locus_tag="CK3_00930"
FT                   /product="haloacid dehalogenase-like hydrolase."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39977"
FT                   /db_xref="GOA:D7GQA2"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQA2"
FT                   /protein_id="CBL39977.1"
FT                   /translation="MDLKKILNGYPQRSADNIIKMIQPYDVVSFDVFDTLLKRDVESES
FT                   DVFDLVERKYNSTHDKKIDGFKEFRKKAESEAREKNVSKEVTIDDIYACLNNKTVGEAV
FT                   VNELIAADLCSIEKEVETAVCTANQLMMAVFDYCKETGKRILIISDMYWPASFVEELLR
FT                   NNGIVGYDAICVSAEYGVQKRQKGALFKVVAEKENIGIKRWVHIGDNKKGDYLSAKSAG
FT                   IATVNIATHYRNTEYLHKSERTDLDKNVISSFINNRISVIDVTGNGEKVEYNDVKLGYE
FT                   IYGPLLYFFVKWLHAGIPQNVTVLFFARDCYVVKKAYEALYGAEDRYKYFLGSRKSLIL
FT                   AALHKDASLETVARMLKSEQAQMTVHGFLTKLNLNPEDYESEAVASGLKLSTVIYRDRL
FT                   TENQYFVEFYNRILPDVIDKANQNYEGIKNYINELNCTKDVVVVDIGWRCTMQFCLQEV
FT                   FPEYNWKGYYLGVREDAVVDAGSQAEGFYLNGENDIEKRCFLASMTALIEIFFSAPHGS
FT                   VTGYSGNGEVLFAPYECQDDEEHRKFFNDIQNGALRFTTDFGKAAVSEFVNATCSNMLL
FT                   GVEVLCEKANRRELKKIGNYPFHLGVGVVNAADPKPLWKYIMNPKFFLYDFSNSTWKVA
FT                   FLKRLIKLKLPYYKIFCWIYRHKE"
FT   CDS             102601..103257
FT                   /transl_table=11
FT                   /locus_tag="CK3_00950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39978"
FT                   /db_xref="InterPro:IPR025536"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQA3"
FT                   /protein_id="CBL39978.1"
FT                   /translation="MIYIAAHKEFDVPRLENYVPLQVGAEGKERLGYLQDNTGDNISIK
FT                   NQNFCELTGLYWIWKNTTDEYKGLVHYRRYFGKSNLSSKMTNVYTYDEMLGFLKGADIV
FT                   LPYIEYFKQNAKEELLVECCTPEIFDELRRIVANMHPEYITAFDQYFAQNKSVLFNMMF
FT                   CRAEIFDAYCEWLFSVLFELEKTVDLSKLNSYQKRLYGFLSERLLNVWLIKNNKK"
FT   gap             103306..103492
FT                   /estimated_length=187
FT   CDS             103500..104762
FT                   /transl_table=11
FT                   /locus_tag="CK3_00960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39979"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQA4"
FT                   /protein_id="CBL39979.1"
FT                   /translation="MKKILISLLTYTLALLIIFNCYSLMCMVYPNRIFYILTNVNFVLL
FT                   LLLRRKIKLKKNASVLCAAYLLCMLLLIVRGFFSYEFMFSCVLPFVFTVVYFDKTDVVL
FT                   DFWEKYTNIIAVICLLSLMFFVFASNLHLISPTAIYSADEVGWGTNTYKDYYHLYCEGQ
FT                   EVYALGYSGVRNTALFVEGPMLTFVGCLALYYELFLRVKGIRKIVAASIIISIASSLST
FT                   TGLLLIAVMMYLRFYERIKNNKFLKFFCLPAIIAVLVYFGAYVIQDKFVSNVYSASVRT
FT                   DDILASLKCFTSDPINGIGYNNLKGINPFRLYKRTDAGLSTGLGGILAYGGLLWGLWYI
FT                   VPVVIAVKKYISQPKYRNVLGFLFLYMALLVVTVVQSRILCTVCMTMSWIITMDSSIAK
FT                   EQLVEVKERKAVGKKIRVKMM"
FT   CDS             104770..105915
FT                   /transl_table=11
FT                   /locus_tag="CK3_00970"
FT                   /product="Polysaccharide pyruvyl transferase."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39980"
FT                   /db_xref="GOA:D7GQA5"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQA5"
FT                   /protein_id="CBL39980.1"
FT                   /translation="MENGYRTKVGVITYHSAYNFGSVLQALATQEAIKRLGYEADIINY
FT                   RMKRQKQYYQKLYRTAFGSKTFIKDLIMMPVRGKRLQRAKAYEQFIESRLNLTKEFEVP
FT                   EAAMQVFAEYPCIVSGSDQIWNFHSNELEGQAIDYMKPYLLSDFNGKKVSYASSISNMS
FT                   DVELDSIIGYISQFDHLSFREASSNKRINEKYKLGSINVPDPTFLLSRKDWIDLLDLKQ
FT                   SKDERYILYYSLRSYKPQRERIALLKQISERTGYKVKVVTPFVYLNYPDDCFEIHPEFG
FT                   PLEFISNIMNAEMIITDSYHGTILSVNFEKNFFSMCENTGSEFRKTDILCQLGLENRII
FT                   ADIEESFTKLDSAIDYTQVRLKVEALRTIGYDYLKNALSSD"
FT   CDS             106096..107493
FT                   /transl_table=11
FT                   /locus_tag="CK3_00980"
FT                   /product="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39981"
FT                   /db_xref="GOA:D7GQA6"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQA6"
FT                   /protein_id="CBL39981.1"
FT                   /translation="MTEQNKSSKLSELKKNTLIIGIATFGSKAISFILAPLYSYYLTTA
FT                   EYGTMDLVTTTASLLLPILMADVYESVFRFTSDPDEDNNKVLTNCSLIALIGTIIGALL
FT                   IIPISLIYQNLPVILIIYLYVVIDGFTLIFSWYERGSGKIKVFAFSGVVNSAFQLVFTF
FT                   LFIVLLRYGLNGWYIGFLFAKIITFVYLFINVRPFKVIKRQHLDKAYQKRLLKHCIPLM
FT                   PTTVMWWVLNVSDRYAIGIFMGMAANGIYAVSNKIPSILNAFESIFYQAYQTTAINSLD
FT                   DKERNNFYSRIFNNYFVFMMLGYVGILVVSRPMIIYLFDSSYADSWLYIPPLLAGAVAH
FT                   AIASNLGSYYVLFYQTKGAFLTSVWGALTNIVLNFLLIPYFGLMAAALTTLTGYIVMFF
FT                   FRWRDIKKFITIKLELKRILIMLSISAIQTALYFWNSWFGIAAMALVGCIALAINKDML
FT                   LRLVKRK"
FT   CDS             107553..107930
FT                   /transl_table=11
FT                   /locus_tag="CK3_00990"
FT                   /product="Coenzyme F420 hydrogenase/dehydrogenase, beta
FT                   subunit N-term."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_00990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39982"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQA7"
FT                   /protein_id="CBL39982.1"
FT                   /translation="MYMVQQVNKLGKSDWYMAWYQDDEVLMNSSSGGAFTAIAEVVLQD
FT                   NGVVFGATFDEKTWDVYHKPVTCIEELNDIRGSKYYQSQAFLAYADCKKYLDAGIEVLF
FT                   SGTACQVMSFQPILIAHSLAI"
FT   CDS             107944..108588
FT                   /transl_table=11
FT                   /locus_tag="CK3_01000"
FT                   /product="hypothetical protein"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39983"
FT                   /db_xref="GOA:D7GQA8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQA8"
FT                   /protein_id="CBL39983.1"
FT                   /translation="MNIKRIINKIGSPSFFKFNKRDYEGKIAKDEVFNARFRNGGVTLS
FT                   RKEKKSPEWRTVVVYRKYQVNKGNLWGYIYERKLNRMAEKTGIDFLGNCNIGDCLLIGH
FT                   WGKIVINGNAKFGNETMITHGVTIGRDIRGKHKGYPTFGNRVCIRTNSTIVGNISIGDD
FT                   VLIAPNTFVNFDVPPHSIVIGNPAKIIARENATEGHLPDINMDPSLRVEMV"
FT   CDS             108602..109600
FT                   /transl_table=11
FT                   /locus_tag="CK3_01010"
FT                   /product="Coenzyme F420 hydrogenase/dehydrogenase, beta
FT                   subunit C terminus."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39984"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQA9"
FT                   /protein_id="CBL39984.1"
FT                   /translation="MENIIEQENLVNQDVTFPVAYACYNKDLQTRLDSTSGGAFTTLAT
FT                   YFLKEKDAVIFGAAFDRNCNVKHIRVDTLDDLGRLRGSKYPQSNVCNSFLEAKAALDSG
FT                   RAVFYTGTPCEIAGLKNFLGRKYENLFTMDFVCHGVGSDLVWRGYNGQFKNKGEIKKIT
FT                   FKAKTHGWKKWYFKVDYQNGNVWQRRGSMTMFMRSYLSYANIRPSCFECHFKGLQRTSD
FT                   FTISDCWGVAESNQNINDNKGLSALLLQNDRALLIFDVIKDNLEYLGYDAEELMAGNWT
FT                   AVKSVKANPIRERFFTDAFEIGTIESLKKHFKPSAKNWIRYYYNRLKGKEK"
FT   CDS             109680..110798
FT                   /transl_table=11
FT                   /locus_tag="CK3_01020"
FT                   /product="NAD dependent epimerase/dehydratase family."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39985"
FT                   /db_xref="GOA:D7GQB0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQB0"
FT                   /protein_id="CBL39985.1"
FT                   /translation="MNILILGGSGILSTDFTKTCLDKGNVVYTLNRGNRTHFIDPRVKL
FT                   IKADLRNEPENVLREKIFKEIPSYDVIVDFLSFIPNHLKRTLSILNGQFIQFIFISSST
FT                   AYKKKCEDEILTEQSEIGNEKWDYAYNKYLCEEFLRKSSINYTIIRPYVTYGKNRIPFP
FT                   IIPGDQYTLLARIMANKPVIMFEHGDAICTLTHTEDFAKTLYELLLNEKAYKEAFHITS
FT                   TSEQTWLEVYTILCELLNRKPNICSLDRADTEKYMPEFYEILVGDKGTNMRFDNTKVSN
FT                   AIGHSVYNTVSLRDGLKQSVDFFMNHSYMQKIDYKFDGECDYIAAKISKQKCCILESSV
FT                   RRNKDVLYYHIMRFPLTNYLVRAKRAKKMDSK"
FT   CDS             110830..111369
FT                   /transl_table=11
FT                   /locus_tag="CK3_01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39986"
FT                   /db_xref="GOA:D7GQB1"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQB1"
FT                   /protein_id="CBL39986.1"
FT                   /translation="MPLSFNSKGEAKMNQGIPPYASDIDPDSPYCEFDDGVLVYQDKQG
FT                   HWLDMNQQPKPKKPRKYTPHQSTRYKNIVIGENGKAKSYDVKTGGLKDTNKELPELYNK
FT                   RENCCGCGACYAVCPTRKFLENNGEGSIGQFGEKYVLSHGAIYMEEDEEGFLYPVVDAS
FT                   LCIRCYKCETVCPIKN"
FT   CDS             111502..112377
FT                   /transl_table=11
FT                   /locus_tag="CK3_01040"
FT                   /product="Pyruvate-formate lyase-activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39987"
FT                   /db_xref="GOA:D7GQB2"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQB2"
FT                   /protein_id="CBL39987.1"
FT                   /translation="MIPEKNILLTNIQRFSLHDGPGIRTTVFLKGCSIHCPWCSNPENL
FT                   LHREQRYVKMDHNGKVEEEGTYGKWYSPDELYSEVIKDKSFYGYCNANSATYLDSLPGG
FT                   VTFSGGECMLQMKELDPMLQRLNDEQIHTIVETSLFCSSVQLSIAIKHIDLFYVDIKVL
FT                   NDDLCSSSLGGRIELYKNNLVTLLNSGKPVVFRLPVIGGYTDSEENRKAVVELIESKAK
FT                   SYSNLLKIEILKEHNLGTNKYQSLIDGGNEIMLPEYNGVSDELMGQYKIEIEEGLMIVG
FT                   SSIPVEICKI"
FT   gap             112946..113980
FT                   /estimated_length=1035
FT   CDS             114036..114209
FT                   /transl_table=11
FT                   /locus_tag="CK3_01060"
FT                   /product="IS66 Orf2 like protein."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39988"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQB3"
FT                   /protein_id="CBL39988.1"
FT                   /translation="MGTGFLLLYKRFEDGRLSWPRNIQEAAELTEDQYRYLMTGLNPLD
FT                   PRIKDVDPKHIY"
FT   CDS             complement(114562..115341)
FT                   /transl_table=11
FT                   /locus_tag="CK3_01080"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39989"
FT                   /db_xref="GOA:D7GQB4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQB4"
FT                   /protein_id="CBL39989.1"
FT                   /translation="MAYRMKDYTYNDKLTKEQNILMDRLYKLRMSGMAEAFAKQLLDPN
FT                   TGLESFEVRFADIINQEWNQRENKKFNKLLKQATLKYPAADLDATIYEPERQLNTHVIE
FT                   LLAECKWIDEPNNLLITGGAGSGKTYIACALCIAAMHQMRTVKYIRANSLMTESEHAHQ
FT                   ESTYYEYSNKMASYDLLVIDDFGLMDLDMNKCRDLLEIIEARDCRKSTIIISQLPVDKW
FT                   YSLFGDHTYADACLSRMTAKAYRLHFPGNDRRISNSN"
FT   gap             116342..117480
FT                   /estimated_length=1139
FT   CDS             complement(117830..118486)
FT                   /transl_table=11
FT                   /locus_tag="CK3_01120"
FT                   /product="Phosphoheptose isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39990"
FT                   /db_xref="GOA:D7GQB5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQB5"
FT                   /protein_id="CBL39990.1"
FT                   /translation="MNRLSENVQKHLELFCERYPTLVPIKEDILNTYTILEECYKNGGK
FT                   LLIAGNGGSAADAEHIVGELMKKFKISRPVPETLAEKLEIIDPVIGKQLANDLEQGLMA
FT                   IPLVAHEALTTAYLNDVGSLSVYAQQLYGYGRPGDVFLGISTSGNSQNILYATVLAKAI
FT                   GMKTIGLTGRAGGNMSKLADITIRVPADETYMIQELHLPVYHCLCLMLEEYFFGR"
FT   gap             119179..119488
FT                   /estimated_length=310
FT   CDS             complement(119811..121058)
FT                   /transl_table=11
FT                   /locus_tag="CK3_01150"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39991"
FT                   /db_xref="GOA:D7GQB6"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQB6"
FT                   /protein_id="CBL39991.1"
FT                   /translation="MKNLKIAVAGTGYVGLSIAALLSQHHDVVAVDIVPEKVQMINERI
FT                   SPIQDEFIEKYLSEKDLHLTATLDSNAAYKDADYIIIATPTNYNSQTQHFDTSAVEDVI
FT                   QQVITQNPDAIMVIKSTIPVGYTKTVREKFASNNIIFSPEFLRESKALYDNLYPSRIIV
FT                   GTDLDDEHLVKAAHEFADLLQEGALKKDIPTLFMGSTEAEAVKLFANTYLALRVAYFNE
FT                   LDTYAESKGLSTQQIINGVCLDPRIGNHYNNPSFGYGGYCLPKDTKQLLANYADVPENL
FT                   IEAIVASNRTRKDFIADRVLSLAGYYDYGEKAEFSKDTERTVTIGVYRLTMKSNSDNFR
FT                   QSSIQGVMKRIKAKGATVIIYEPTLQDGETFFGSMVINDLKKFKELSQAIIANRYDKSL
FT                   DDVKEKVYTRDIFQRD"
FT   gap             121128..121718
FT                   /estimated_length=591
FT   CDS             121988..124570
FT                   /transl_table=11
FT                   /locus_tag="CK3_01160"
FT                   /product="KAP family P-loop domain."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39992"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQB7"
FT                   /protein_id="CBL39992.1"
FT                   /translation="MKYFKEQLPYGLAGFLIILFLDIGNTFTKIVNSIGRYEFATITLV
FT                   MLAIVCIYFRLDVSMKLPISSEFDAWMIRGLYTVGLYIVFMTVAFVIGNPIFARYKLLG
FT                   ACIFTIVDLAFLFYRMKVIETRQREKREQKKKQTYTLKDLYEGKLAGYSGEMLVLDEEA
FT                   VDYDLLHREDLIENIIRTVADCYPNKKLVLSLSGKWGSGKTTVLNIVKKRLQESENILI
FT                   IDDFDPWNYEDEAALLSGILDTIFKHSQVDYSVSKLRKWKRDLLALIFNAHESTRGVKL
FT                   SFLNEDKATVSVIRDRINEYMSLSKKRFVFILDNIERLGPEKILFLLKTVADVLNFDKV
FT                   IYVLSYDPEVLKSMLAQQHYGMEYLKKIVQVEFCIPEFDGEVKRDVLLCCMDNILQVYK
FT                   TDENQQKLILKHMSLIAEYIQDIRDIKRFLNSIMSSFYFLSKDQGKRLAGQLNIGDYTL
FT                   LEFIKRENRELYDIIWNNATYFVSKDREMLFGHEFLYKERLEKKNKEIKEFYQKLFENE
FT                   KYNRYKILLKELFPSVKHYAEDKMNVLNYEFGDDDYEKTIKERRIYSGYFFTMYFTHRM
FT                   NKNLGNQNTVEELIWLCNRKDTEKAAEELEKACSTCDIEEQVILFERIQLYVTDLSTEG
FT                   WETLFDVLYDYAATADEMMLFFRLDPKRRAIYILSLALEKVSDRFLEGFLLHMKNEYSR
FT                   MQEISEIIWHNKVEGSEEKEIKYNGRAGKVYEELLAMALYVIGNELDLYDDLNYREHNI
FT                   WGWYHAVKRDSSVDIKEAFHHMLTPKNIYRFLWDMTSKSLSGVYGYRLNEDNFKMFCDL
FT                   EEIEECIRQHVPETSDEKFVWEIYDTFKNETGEDGRTVYRQREVKLRL"
FT   gap             125227..125508
FT                   /estimated_length=282
FT   CDS             125623..126375
FT                   /transl_table=11
FT                   /locus_tag="CK3_01190"
FT                   /product="Sugar transferases involved in lipopolysaccharide
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39993"
FT                   /db_xref="GOA:D7GQB8"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQB8"
FT                   /protein_id="CBL39993.1"
FT                   /translation="MNEWVRELEQMGIIVDINIDAFDLSVSGKKSLNRVGKYAAVTFAR
FT                   NLFSTRQMIAKRALDIVGSLVGMVILGIATIFVAPAIKLDSPGPVFFGQTRVGKNGRKF
FT                   TFYKFRSMYKDAEARKKELMASNEVKGLMFKMEDDPRITKVGKFIRKTSIDELPQFWNV
FT                   LRGDMSLVGTRPPTVDEFEHYEAKHKCRLSMTPGLTGLWQISGRSDIKDFDEVVRLDMQ
FT                   YIDNWSILKDIKILILTVKVVLTGRGSR"
FT   CDS             126397..127788
FT                   /transl_table=11
FT                   /locus_tag="CK3_01200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39994"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQB9"
FT                   /protein_id="CBL39994.1"
FT                   /translation="MDYNTDEQEIDLKDLMFAVFHKWRPLILVAVICGLLLGGIKGIMT
FT                   YKKQSDPKVRKEADLTYSADLELYEKNKDTYTREIENLRTDIENQQEYLDHSIWINMSP
FT                   YDVCEARVDLYVSTGYEIMPGMAYQNRDYTDTILQAYQSMLTSSAVMEDVAKQVGTEPR
FT                   YLQELVTVTIGTIGVDKNQFSRLLTINVNHTSKEKAKTVLDAFLAHVADMQAQITASIG
FT                   EHTVSTVNEGISSKVDLDLADLQRQQSQKLTDLNDSLQTKQKDLDELEEPEKEDSSKVA
FT                   ALKSAIKFGLVGGFGGAFIVAFVVCIVFLMGDKVYSAKELKERYKVKILGKLSSGKKVG
FT                   IVDAWLNRLEGRTCNADETAEYRLIAANVKNYAGDMKKLLITGSAPADTLMRVAEALKS
FT                   ELGEIQTVVGNCMLEDVETVRELPLCDGVILVEQCETSKYSAIETEIEKIHDLKKSVVG
FT                   CVVIE"
FT   CDS             127898..129736
FT                   /transl_table=11
FT                   /locus_tag="CK3_01210"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39995"
FT                   /db_xref="GOA:D7GQC0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQC0"
FT                   /protein_id="CBL39995.1"
FT                   /translation="MCGIVGFTGHRQAAPVLLDGLAKLEYRGYDSAGLAVRNGENEVEI
FT                   VKAKGRLRVLAEKTNDGTAMHGTCGIGHTRWATHGEPSELNAHPHCSDDRNVVGVHNGI
FT                   IENYQELREKLQHKGYNFYSDTDTEVAIKLIDYYYKKYEHTPVDAINHAMVRIRGSYAL
FT                   AIMFRDYPEEIYAARKDSPMIIGVADGESFVASDVPAILKYTRNVYYIGNMEMCRLQKG
FT                   NVTFYNLDGDEIEKDLVEIQWDAEAAEKAGFEHFMMKEIHEQPKAVRDTVNSVVRDGKI
FT                   DLSGVGITEEEIQKLQQIYIVACGSAYHVGVAAQYVIEELAQIPVRVELASEFRYRRIL
FT                   FAPNSLVIIVSQSGETADSLAALREAKAHGVKTLAIVNVVGSTIAREADHVFYTLAGPE
FT                   IAVATTKAYSTQLIASYILSIEFARVRGMIDEDRAAELIAELQTIPDKIEKLLEDKERI
FT                   QWFAAKQMNAQNMFFIGRGIDYAVSLEGSLKMKEISYIHSEAYAAGELKHGTISLIEPG
FT                   TLVIGVLTQQDLYEKTVSNMVECKSRGAYLMALTTYGNYSIEDCAEFVIYIPKTDPLFA
FT                   ASLAVIPLQLLGYYVSVAKGLDVDKPRNLAKSVTVE"
FT   CDS             129788..130816
FT                   /transl_table=11
FT                   /locus_tag="CK3_01220"
FT                   /product="Fucose 4-O-acetylase and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39996"
FT                   /db_xref="GOA:D7GQC1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQC1"
FT                   /protein_id="CBL39996.1"
FT                   /translation="MNAGKEKNRVQYFDIARGIAMICIILGHLNNSLINRVVFTFHVPI
FT                   FFFITGYFMNSKCGIKDYARNKLRTLIVPYIVTCIVIIILGTLKGFIQGDAISELGRWS
FT                   YAAVYGAGDSYNEPFYIPGIGAIWFLWATFWGCIFLRLSLQFERHVRLGVIIGLFIFGY
FT                   FSRQIFWFPLSIQAGACAVLFMYIGYIARNVKDNIGKLSAEAKTFGLFFAAVVWFFFMK
FT                   DFQSFWLVHCDIGRGIVDVFGSMCACVIVIYISKMIEIKFRIAGKFLAFFGRYSLLVLC
FT                   VHIIELDLFPWWMITGRFEGMGISESGQLWFVIAGKLVVDLGFAYIISRVPIVKKVFGY
FT                   ES"
FT   CDS             130862..131875
FT                   /transl_table=11
FT                   /locus_tag="CK3_01230"
FT                   /product="Fucose 4-O-acetylase and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39997"
FT                   /db_xref="GOA:D7GQC2"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQC2"
FT                   /protein_id="CBL39997.1"
FT                   /translation="MSDKKARIQYWDMAKGFTILLVIIGHISNVNPYLRAIIFSFHMPF
FT                   YFMANGYFVRDYSVGNTIRKAAKSLLIPYFIVCMISTVWYTVEGWQRTGMDNLVHIKDK
FT                   LIAMVLGMSRSSTILRDIHSVWLVWFVICLFAARILYVVVMKQIAELKLPVQLLIIFFI
FT                   SMVGIVIGKKYAYLPWSLDVALVSFPFLMAGDYLAKYELFKNKFNITMLVAGFMWIIPL
FT                   GMKLHIELATRSYPMGPVCVLEAIGGSVCVAGFFCFLEKKGITSSALSWLGRNSMVVLA
FT                   VHCLEMMYFDWDRYMFSVLPVADMWWMAAGVKVVGIVVVAWIVVVVRDMVKRKNNT"
FT   CDS             131933..132361
FT                   /transl_table=11
FT                   /locus_tag="CK3_01240"
FT                   /product="FAD dependent oxidoreductase."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39998"
FT                   /db_xref="GOA:D7GQC3"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQC3"
FT                   /protein_id="CBL39998.1"
FT                   /translation="MYDYLVVGAGLYGAVFAHEAKKKGKKVLVIDKRPNIAGNVYTEDM
FT                   EGIHIHKYGAHIFHTNNRRVWEYVNQFAEFNRFTNSPVANYHGELYSLPFNMYTFNKMW
FT                   GVVTPEEAHCFQLLKKQWSKLDYTAILTYAECGRQYHG"
FT   CDS             132430..132702
FT                   /transl_table=11
FT                   /locus_tag="CK3_01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL39999"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQC4"
FT                   /protein_id="CBL39999.1"
FT                   /translation="MSGVATLSNEKNYTVFQFGNHVIRFIAPYSLERYTAVKEWDNGYL
FT                   VVMAKYKHNEKPEEEYIDLVPILQNLYFDVDKFLNPIKSVEVANG"
FT   CDS             132695..132916
FT                   /transl_table=11
FT                   /locus_tag="CK3_01260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40000"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQC5"
FT                   /protein_id="CBL40000.1"
FT                   /translation="MVDVKQVADAADMIVNGYAFTRCAEGFRVLNLNRPDRAVVFSSDG
FT                   KVLETSMDDIEVRIARDYLEKNRKFMED"
FT   CDS             132918..133205
FT                   /transl_table=11
FT                   /locus_tag="CK3_01270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40001"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQC6"
FT                   /protein_id="CBL40001.1"
FT                   /translation="MPKYYEYKIAGYYLYFTSYCVIECMHVHASDRKLTETGSAKFFVK
FT                   DNGDTLVQNRGILNDREIRKIQEFIKQNYQEMYLKWSEYSQEGFYEKNIC"
FT   CDS             133286..133360
FT                   /transl_table=11
FT                   /locus_tag="CK3_01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40002"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQC7"
FT                   /protein_id="CBL40002.1"
FT                   /translation="MERLLIGGKVKRNLKCLKNLMQQE"
FT   CDS             133845..135185
FT                   /transl_table=11
FT                   /locus_tag="CK3_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40003"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQC8"
FT                   /protein_id="CBL40003.1"
FT                   /translation="MKKPGNKKLLKSNRISGFQKADHQKLPIDKTRRIISQKFHFFKIF
FT                   KVGLIGALIFGILFELALEHVPGLLLWSIYGIIVTVILKEIWDIVKERYKSTDEYKNMM
FT                   SSSQSPWQKTVIVFGCLFDIVLQSGEVFFGAILMLSVTGGAVWASVHGNARTAAAVKAF
FT                   IAYGPADEAAQMEEKKTDIDVEETIVDKTVVSSDDKYSNVESSRTLEPQDIRDELSMEV
FT                   YSVKNSDYSLMDETAVKAEQIEKARRMRLEIPTKDWSISAEERAKFLFMTGEYAISTNW
FT                   TAEQAAVKLKADIEAVIACQYLNDFDIRADQSLRNLVSEASAQDNTLVSSREKDHIITV
FT                   RLDAYTIYGKASLARLLAEDFHCYALAYQYYNGDRDIITSYYLQSVKWLFESLKYAENS
FT                   PESQINILVSLRYRYNDIMTYSEPKSEQWERAKLLSDALDEIIEERK"
FT   CDS             135752..135991
FT                   /transl_table=11
FT                   /locus_tag="CK3_01300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40004"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQC9"
FT                   /protein_id="CBL40004.1"
FT                   /translation="MFLIPAIPMYCRMVYVLNEIPFQEKFLRHLPPVFESDRGGAVLVK
FT                   KEKFCNTPALRFTPASVRPIIKYNKYNTGGWYYE"
FT   CDS             135984..136562
FT                   /transl_table=11
FT                   /locus_tag="CK3_01310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40005"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQD0"
FT                   /protein_id="CBL40005.1"
FT                   /translation="MNKLKRCGIIFLSCMTLSTATTTVFTANTIIAEAHSGRTDANGGH
FT                   RDNKNKSGLGSYHYHCNGHPAHLHTNGVCPYAVGGQTDNSSAGNSSTAAAEAPSITYDL
FT                   MNSYSRVFDPDYYYNTYPDLQTAIGTDKLALFTHFYNSGMAEGRKGCAEFDVNVYKENN
FT                   TDLQTAFGSDLRKYYEHYMNTGWAEGRTH"
FT   CDS             137557..138513
FT                   /transl_table=11
FT                   /locus_tag="CK3_01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40006"
FT                   /db_xref="InterPro:IPR014976"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQD1"
FT                   /protein_id="CBL40006.1"
FT                   /translation="MPIEDEYRKIYDNEVNRELKREIAIYEDETEINNYQPLSHNCKEK
FT                   CVNKCDHQCYKSLGKLMRKNIVFYCYGEDEVVAKFNNGLFADLEKAIKVAYKMRLPHRE
FT                   PKMDGLPSEVLLDAIVQSLVPGAYKLAVRTIFRQNDNNEIKGYDLTYFTNVNGKITLWL
FT                   GQAKMGSKQYCKNGILDDLNKKYSSLYLAEQIYFLADKPSGLTNEGKQLADLLSELNML
FT                   NALENDKKRAEQLMDFLKSKNIDICIPCLLAYDNSNIYSETMNIENKMKVEMNWMKHYF
FT                   EKNFKFEDIKPKLIFIIFPIENIEALRGNEGFYAGLC"
FT   CDS             138497..138718
FT                   /transl_table=11
FT                   /locus_tag="CK3_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40007"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQD2"
FT                   /protein_id="CBL40007.1"
FT                   /translation="MLDYVNLLLDAINKYNEDDVDSKNRLRDLVCIISENDSVKSDPLI
FT                   KELLYTASHKMRIFGYNVQNGFYKQEKY"
FT   CDS             138690..139382
FT                   /transl_table=11
FT                   /locus_tag="CK3_01340"
FT                   /product="Superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40008"
FT                   /db_xref="GOA:D7GQD3"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQD3"
FT                   /protein_id="CBL40008.1"
FT                   /translation="MDFINKKNINEKHISELQALYNQSIVNMYRSKVRNNNILDKSQKS
FT                   IIDFYQSLDIKRMLISAPTSYGKTFIMREILYLNQEKYKNILLVFPTVALLRENALNME
FT                   ELNQDKKMGYNVIKSIDREIDCQDRNIFVLTPERAMQLLAQYPNIEIDFFFYDEMYKID
FT                   EDYCNDETDDNDEKKNSYAERTFLDEARAKTFRILFIFAFKKSKRLLFSWTQPEKREVW
FT                   KRNAKIYC"
FT   CDS             139363..140880
FT                   /transl_table=11
FT                   /locus_tag="CK3_01350"
FT                   /product="Superfamily II helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40009"
FT                   /db_xref="GOA:D7GQD4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQD4"
FT                   /protein_id="CBL40009.1"
FT                   /translation="MQRYIAENNIQVKEIEFEPTKRIMVKAYNKVIDEDYTNLPYIEKP
FT                   GIVKIHSKVNDRICDVVNYIEQKGYGATILYCTTPAKANEYATKLAENYQGNVVKNERF
FT                   SEFIEHLKRNYNIDGSINEWSFVNVLEMGFGMHHGKMPKYIQKEILDLFNEGIFNLLFC
FT                   TSTIVEGVNTNAKNMVVLNHSKGTKELTVFDFKNIIGRAGRYYHNFVGRYFLVDKELEK
FT                   FEHTEDLTLNFVTYDDQELDPVDIDNSEYMDLSDINKNLKHKREEQFKEYLLTNDIYEK
FT                   NRLIKREYQEILLRFLLNNNILYNKFYRYLSYPDILMQFTTYHAMNTVLDIFEKSGLLD
FT                   ATIVRRYKAVSNTYCNEGFHGLLRYEIDNARGDKVKHKRIDKAYMDAFKTQKDIIEHKI
FT                   PKILALFETIFSYASLLRRKTLDNFSLSKVSRFYETGVKSYIGEQLIEFGFPVDAIKRI
FT                   EDNNLRLLSMDASASQKYILEHLEDIKQLLDSYERGLLDKALKSICS"
FT   CDS             140968..142950
FT                   /transl_table=11
FT                   /locus_tag="CK3_01360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40010"
FT                   /db_xref="GOA:D7GQD5"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQD5"
FT                   /protein_id="CBL40010.1"
FT                   /translation="MILIYAYINKFKNYTTQEIIFDPRWQINFSNKKLSIQYRGQSSAS
FT                   AVIRGDRKPDNLHILVGKTGSGKTNLLQMIGAKHDVRYHRKWEGEDDSYFLLYSISDTE
FT                   FFLEICDMEIMQFPKPVERDDSTIPEPIRENARRAGTLRTVRFALEKALKPGETAVRFC
FT                   AVKEYGYERNLSELKVRDMAMIMNCYDVHAFIRPPYPDDKEDFTDFRSDWIGRAAFPYQ
FT                   RTSLWQICGYIREYLTSLEPGSGKRQVSFVLSTHNFADRYPLKLSKAVEKEYWTFYERM
FT                   QDEKRAIYDTEARERVRKRKKKKTLTNKQMFIHDLWTDYAKYLRKWVEKIRNFNAEEEL
FT                   AEDLDAYQEFMDYYIGKTRRESIDPTVLPDGEKMSIVRRCIWLAEYIDRAGDGDPHGLL
FT                   WQIMGDIKDIAGFLEKLDDRYFTVDICSIPVVDMERAEYRELFDDLFERMEQYRPDDAG
FT                   IFTECLLPYEFTRLSTGEYQYAKVLGGMEDYLKLSSSGRTNRGLDKIILMDEPEAYMHP
FT                   ELARQFIARMLKIVEKYQGPSTIQIILSTHSPFMLSDVLPEEITRLTIDRETGNALVKN
FT                   GSDKEYFGANIHTILADGFFLDYTIGEYSRSFLQNAFSRLERYADHGDADESFLMSMEQ
FT                   LIQHIGDRMIRRAFELQMEKVRNRD"
FT   CDS             144127..144279
FT                   /transl_table=11
FT                   /locus_tag="CK3_01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40011"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQD6"
FT                   /protein_id="CBL40011.1"
FT                   /translation="MNNNSKEELKGNEFNRLLLVPCEEKLLIGECAASAEYKVNVACKN
FT                   NSALQ"
FT   CDS             144515..144619
FT                   /transl_table=11
FT                   /locus_tag="CK3_01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40012"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQD7"
FT                   /protein_id="CBL40012.1"
FT                   /translation="MLIRPEFFRKNVVVCQRNELKTENGKRQTAAELW"
FT   CDS             144717..145139
FT                   /transl_table=11
FT                   /locus_tag="CK3_01400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40013"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQD8"
FT                   /protein_id="CBL40013.1"
FT                   /translation="MVVSKNYKIKEQNGMYYIVPSSVPGCPQCGGEMKIRDSKRRKVIF
FT                   ADGTVDTFVLRRYKCTVCGRVHLELPDIMVPHKHYSRSAIIDTINGERNCSAEQSTIYR
FT                   WNREKMQLERLLVQVEDKSPEAKRTDGDNNCRCAGN"
FT   CDS             145180..145299
FT                   /transl_table=11
FT                   /locus_tag="CK3_01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40014"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQD9"
FT                   /protein_id="CBL40014.1"
FT                   /translation="MKKRQVKYPKRGNEKAAGELPVKGKMKKQQADACNLCDQ"
FT   CDS             145655..145852
FT                   /transl_table=11
FT                   /locus_tag="CK3_01420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40015"
FT                   /db_xref="GOA:D7GQE0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQE0"
FT                   /protein_id="CBL40015.1"
FT                   /translation="MEKRKISQYRLIKEFGLSSGQMSRLKKNTYVSTHTLETLCRILDC
FT                   RIEDVMEVSFEDEEKENKAN"
FT   CDS             complement(145898..146116)
FT                   /transl_table=11
FT                   /locus_tag="CK3_01430"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40016"
FT                   /db_xref="GOA:D7GQE1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQE1"
FT                   /protein_id="CBL40016.1"
FT                   /translation="MIDYSPLWNTLKSKGINQYRLIRSYHFSSGQLHRIRKNEHVSTHT
FT                   LETLCRILNCSVADIVRISFDRVEKES"
FT   CDS             146406..146696
FT                   /transl_table=11
FT                   /locus_tag="CK3_01440"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40017"
FT                   /db_xref="GOA:D7GQE2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQE2"
FT                   /protein_id="CBL40017.1"
FT                   /translation="MVKYTRLWETMQRKGISQYRLIKTYGISNGQLNRLRKNLYISTHT
FT                   VETLCRILDCRVEDVMEIVFDESDELLWSPGLEEERQKQEELEKKKKRQGQ"
FT   CDS             146993..147424
FT                   /transl_table=11
FT                   /locus_tag="CK3_01450"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerases 2"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40018"
FT                   /db_xref="GOA:D7GQE3"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQE3"
FT                   /protein_id="CBL40018.1"
FT                   /translation="MTGRNVGKTCRTHYRGTFNDGTQFDSSYDRGEPLEFVCGAGQMIK
FT                   GFDAAVADMEVGEIKEIHLMPEEAYGMPNPNMILTLEIANLPGSEDLEVGQQVYLTNQS
FT                   GQPFPVKVTAKDEKMITLDANHEMAGKELNFKIELVEVK"
FT   CDS             147505..148053
FT                   /transl_table=11
FT                   /locus_tag="CK3_01460"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40019"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQE4"
FT                   /protein_id="CBL40019.1"
FT                   /translation="MKATGIVRRIDDLGRVVVPKEIRRTLRLREGTPLEIFTDREGEII
FT                   LKKYSPMMELNAFAGQYADAMAQSTGLMVCITDRDQVVAAAGGAKKDFFQKPISRALEH
FT                   VIQERMTVQAGKDERAFTPVTDDDSEGITAQVITPIICEGDAIGSVIVMSREPRAKFAD
FT                   AEVRLAATAAGFLGRQMES"
FT   gap             148220..149567
FT                   /estimated_length=1348
FT   CDS             complement(149758..150627)
FT                   /transl_table=11
FT                   /locus_tag="CK3_01470"
FT                   /product="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40020"
FT                   /db_xref="GOA:D7GQE5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQE5"
FT                   /protein_id="CBL40020.1"
FT                   /translation="MNITQKQKGILFMILSALSFASMQVVVRMSREIPTMEQICVRNLF
FT                   ILIVSFFIIRKKRGSYYGPKKYQPYLFGRSFFGFLGLITLFYASSHAAQGDVTVLNKLS
FT                   PIFVTLLAAVFMKEKLSPIQIPALALSVIGAFIVFRPSFQSDPFPLVVALLSAITSGVA
FT                   YTFLGYFKGKVDGITVIMHFSTFSVFGSLPFVISNFVMPDPHQFMLLMLISLFGSLGQV
FT                   FITYAYRFAPASEISIYNYSGILFSIVLGAAILGEPVKSTSILGGALVAIASIMVYIYG
FT                   NSKKQAGK"
FT   CDS             151153..151548
FT                   /transl_table=11
FT                   /locus_tag="CK3_01480"
FT                   /product="Protein containing tetrapyrrole methyltransferase
FT                   domain and MazG-like (predicted pyrophosphatase) domain"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40021"
FT                   /db_xref="GOA:D7GQE6"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQE6"
FT                   /protein_id="CBL40021.1"
FT                   /translation="MYTFEDLKQIMKTLRAEDGCPWDRAQDHDTLKKHLVEECAEVLEA
FT                   IDAHDTENLCEELGDVLFQVMFHSEIEAEQGNFTVDDVVNGICEKMIRRHPRVFGGEIP
FT                   EVENEKDLWEAIKKQEREEKKKRAAAH"
FT   CDS             151698..151973
FT                   /transl_table=11
FT                   /locus_tag="CK3_01490"
FT                   /product="Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40022"
FT                   /db_xref="GOA:D7GQE7"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQE7"
FT                   /protein_id="CBL40022.1"
FT                   /translation="MNKTELIAAVAEQAELSKKDAEKALKAFTDVIAAELVKGEKVQLV
FT                   GFGTFEVSEREAREGRNPLTGEKITIAASKNPKFKAGKALKDMVNA"
FT   CDS             152133..152372
FT                   /transl_table=11
FT                   /locus_tag="CK3_01500"
FT                   /product="Ribosome-associated heat shock protein implicated
FT                   in the recycling of the 50S subunit (S4 paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40023"
FT                   /db_xref="GOA:D7GQE8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQE8"
FT                   /protein_id="CBL40023.1"
FT                   /translation="MRLDKYLKVSRIIKRRTVANEACDSGRVMLNDKIARASAEVKVGD
FT                   VIEVAFGTKAVKVRVTSVQETIRKEDTKEMFEYI"
FT   CDS             152559..152837
FT                   /transl_table=11
FT                   /locus_tag="CK3_01510"
FT                   /product="sporulation protein YabP"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40024"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQE9"
FT                   /protein_id="CBL40024.1"
FT                   /translation="MEENPGMAHKIVLNNRNLGNLTGILDVISFDENSIVLDTDMGLLT
FT                   IKGKDLHVNRLSLEKGEIDIEGRTDSLVYSAGGGAKSGESFFAKLFK"
FT   CDS             153343..153672
FT                   /transl_table=11
FT                   /locus_tag="CK3_01530"
FT                   /product="Septum formation initiator."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40025"
FT                   /db_xref="GOA:D7GQF0"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQF0"
FT                   /protein_id="CBL40025.1"
FT                   /translation="MGENRNRRNKRKSKNSLSNRMALIGITVVVASLAVVVHIGGASLR
FT                   ERDLEYQAREQALEKSLAKEEARAAELEEYRVYVQTKQYIEKVAKEKLGLVNKDEILFK
FT                   ADESS"
FT   CDS             155320..156945
FT                   /transl_table=11
FT                   /locus_tag="CK3_01550"
FT                   /product="tRNA(Ile)-lysidine synthetase, N-terminal
FT                   domain/tRNA(Ile)-lysidine synthetase, C-terminal domain"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40026"
FT                   /db_xref="GOA:D7GQF1"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQF1"
FT                   /protein_id="CBL40026.1"
FT                   /translation="MAGKTAVKTDVKAGRFRQKVLSFMKKNHMTDRGDSVLAAVSGGAD
FT                   SVCLLLLLHEMAAELGIKVFAFHMNHGIRGAEADRDERFVMELCERLNIPLTVAHEKVE
FT                   EYAAERGLSGEEAGRILRYHHLGETAEKYQCAKIAVAHHEDDDAETVLLNLFRGSGLAG
FT                   LSGIRPVRENIIRPLLCVSRKEIEEYLNEQELSWCEDSTNKENDYTRNKIRNELLPWVT
FT                   ENINSRAAEHILAVSEFAAQADAYFEMEAERILEESCSKRREEGKQPNSKNAGEADGKE
FT                   PGTGQSSKVAENEMKMCTKINTDIFDPQPEILKTYIVRRMILNAAGKAKDITERHIRSV
FT                   MDLSGPGGGHTVDLPYGLKAVRGYETLGIVQNKNPSQMSESDQKQERKPVFENKINLET
FT                   DMDEILDLGGTHIRLHAVHRKKELEIPKNQYTKWFDYDKINVGLSIRYRKNGDYLTLSG
FT                   GGKKKLRRYMIDEKIPENERDRIPVLADGDHVLWVVGYRISDYYKITDETEHILEAEVI
FT                   LPGGGEPEGGRQAGIWNCKGEDHG"
FT   CDS             156938..157465
FT                   /transl_table=11
FT                   /locus_tag="CK3_01560"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40027"
FT                   /db_xref="GOA:D7GQF2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQF2"
FT                   /protein_id="CBL40027.1"
FT                   /translation="MADKIRVLLNEEEVDRRIKEIAEQINKDYEGKAVHLICILKGGVF
FT                   FTCELAKRLTVPVTLDFMSVSSYGSGTESSGVVKIIKDLDQPLEGKNVLIVEDIIDSGR
FT                   TLAYLIDILHKRNPNSIHLCTLLDKPERRVKKQVKVDYTCFTIPDEFVVGYGLDYDQKY
FT                   RNLPFIGVVEQQ"
FT   CDS             159911..161992
FT                   /transl_table=11
FT                   /locus_tag="CK3_01580"
FT                   /product="Glycosidases"
FT                   /EC_number="3.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40028"
FT                   /db_xref="GOA:D7GQF3"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQF3"
FT                   /protein_id="CBL40028.1"
FT                   /translation="MLKAALFSDGTKEYRIPEEPECGDKVTIRFRTGAGDVDHVYAVVR
FT                   DAVSREEGRRLELKKKESIGRFDFYETEILVGETPLRYDFEAVKGSEVCHYNRLGVLEA
FT                   GGMDAPFVITPGFHVPEWAKGALMYQIFVDRFNNGDPTNDVLGDEYVYIGFPVTKVEKW
FT                   DDRLSVLDVDRFYGGDIQGIWDKLDYLQSLKVEVLYLSPVFVSPSNHKYDCQDYEHIDP
FT                   HYGVIVKDEGGLVTGDASDNGNAKRYSVRTSDRENLEASDEFFARFVQEVHKRGMRIIL
FT                   DGVFNHCGSFNKWMDREKIYEKDGGYEPGAYLTADSPYRDFFLFGDQDGWPDNDSYEGW
FT                   WGHNTLPKLNYEGSEKLYQYVLDIAKRWLSPPYSIDGWRLDVAADLGHSPEVNHRFWRD
FT                   FRKTVKEANPDALILAEHYGDASDWLSGDQWDTVMNYDAFMEPVSWFLTGLEKHSERKD
FT                   EHLLHNSQAFMCSMLSNMSRMQTGSLYAAMNELSNHDHSRFLTRTNRVVGRLYKPEDAE
FT                   NAEKGINYGTFRSGALIQMTWPGAPTIYYGDEAGVCGWTDPDNRRTFPWGKEDLELTEF
FT                   HRYLTGIRNRTSVFRRGAFKPLLAENGMIAYGRFDADEQGVVVVNSEDYAQRVRIPVWE
FT                   AEVTADAMVRVMLTDAKRYNVGSLKYPVVDGVMEVELPGNGAMIFIARSSGQDDEKIA"
FT   tRNA            162039..162120
FT                   /locus_tag="CK3_T_35470"
FT   tRNA            162345..162417
FT                   /locus_tag="CK3_T_35480"
FT   tRNA            162576..162646
FT                   /locus_tag="CK3_T_35490"
FT   CDS             162760..164532
FT                   /transl_table=11
FT                   /locus_tag="CK3_01590"
FT                   /product="Methionine synthase I (cobalamin-dependent),
FT                   methyltransferase domain"
FT                   /EC_number="2.1.1.13"
FT                   /EC_number="2.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40029"
FT                   /db_xref="GOA:D7GQF4"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQF4"
FT                   /protein_id="CBL40029.1"
FT                   /translation="MNLREYLKTTNLITDGAFGTYFAAKYQTQDIPELTNITAPEKVKK
FT                   IHEEYLNAGAKFIRTNTFASNTETLQEDFAEVEKNIQAAVEIARDAVNGRDAWIAGDIG
FT                   PIPVNGTEDAAAAADEYYQIAKTFAECGVTVLDFETFADLDGILPAIKKICAEYEMFIM
FT                   VSFSVNQFGYSAAGLSAKRLLADAAAVPEIDAVGLNCGVGPAHMRQILEKAGRPGDKFL
FT                   LAIPNAGYPTLTRNKLQFGNTPAYFAEKMKELQALGADILGGCCGTTPEFIGELSSWDG
FT                   ILNKIVLDTETDNGEQTGHVQRHGFLYDENGERKQKKLIAVELAPPFDADDEKLLESAH
FT                   LLKNAGVDVLTFPDSPSGRTRVDSVLMASKVRQATGLNVMPHICCRDRNAIAMRSLFLG
FT                   AAINDIHNFLIITGDPIPSTARQTVKAVFNSDSTGLMKIAKEMNEDVFAKNPLCYGGAI
FT                   NQGRKNLDVEIGRVKKKMEEGAEFFLTQPVFTKEDAARLRRIKEETGATILCGIMPLIS
FT                   RKNAMFMKNEIAGVNVTDEIVARYPEKANRKEGEAAGIQLAKEVMKMVEDFADGYYFSF
FT                   PFNRVYMLQDIMGK"
FT   CDS             164696..165934
FT                   /transl_table=11
FT                   /locus_tag="CK3_01600"
FT                   /product="Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40030"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQF5"
FT                   /protein_id="CBL40030.1"
FT                   /translation="MIKTITAAELINGRTFDRTIIDIRPAEEYKKGSMDAALNIPEDKL
FT                   VEYLENPEEADLESGTIGDGKAWEEGVNVGKLLAAIPKDKPVWVLCHTGNKSLYVAELL
FT                   SDAGFDAGSVEGGYRSFLRLSLSMMVMNEEEVTERTKAIERSIITKYRKSIWRRFTKGV
FT                   HDYELIKEGDKIAVCISGGKDSMLMAKLLQELQLHGKVKFDLVFLVMNPGYNEDNWNII
FT                   LNNAKLLGIPINVFESDIFNIVADVDKSPCYLCARMRRGYLYSHAKELGCNKIALGHHF
FT                   DDVIETTLMGMLYSGKVETMMPKLHSKNFEGMELIRPMYMVREADIKAWRDYNHLHFIQ
FT                   CACRFTERCATCGGEKGSKRDEMKELIAELRKRCDTIDMNIFNSVHNINLKTVIGYHKG
FT                   DWSYNFLDDYDKQ"
FT   CDS             166130..167242
FT                   /transl_table=11
FT                   /locus_tag="CK3_01610"
FT                   /product="Transglutaminase-like superfamily./Putative cell
FT                   wall binding repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40031"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQF6"
FT                   /protein_id="CBL40031.1"
FT                   /translation="MKKRKFYFRTLVGAGLIAAAAAFPAFADNWIHQENGWVCKTADGY
FT                   MQTGWYQDKNNGGKWYYLWPEAGNRLGCMQTGWLQKDGKWYFFDTRSGSSGAMLTGWQW
FT                   IDGKCYYLDPAAGGAMAISNTLSDGSRVGSDGAWVDGSGNAVYQAGKGIPGSGNTVNSN
FT                   TNTNTSQNQSSDTSKKSKRPAWWDNENLTEVQKVAKDFVNNYIADDMTDFEKEMEIIQY
FT                   MVQNITYDYDNFLEETVPGTSYGTTGALLYGTAVCAGYTDTFTLLADACGLETMEVSGE
FT                   GNGVGGWGGHAWNKIKLDGEWYHVDVTWEDPIMNGDPENGYGYGNLRNEYINITDSKMA
FT                   KDHRWTAKEPACKATKYGRSAVSKYMKKRY"
FT   tRNA            167478..167557
FT                   /locus_tag="CK3_T_35500"
FT   CDS             167891..168454
FT                   /transl_table=11
FT                   /locus_tag="CK3_01620"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40032"
FT                   /db_xref="GOA:D7GQF7"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQF7"
FT                   /protein_id="CBL40032.1"
FT                   /translation="MGLLELFILAVGLSMDAFAVSVCKGLSVTKMEPKHALLCGAYFGG
FT                   FQALMPALGYLLGSQFESMITQIDHWIAFVLLGIIGSSMIKESREDEEEEVSASFDVKT
FT                   MLALAVATSIDALAVGVTFAFLHVNIVWAVTFIGCTTFVLSAIGVKAGNVFGMKYKSRA
FT                   ELVGGVILILMGIKILLEHLGFLG"
FT   CDS             168653..170437
FT                   /transl_table=11
FT                   /locus_tag="CK3_01630"
FT                   /product="Uncharacterized vancomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40033"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQF8"
FT                   /protein_id="CBL40033.1"
FT                   /translation="MEKRNTNRQREYRDDYRQHSPAWIRAQRRKRKRIIRRRIMIGSAV
FT                   ICIVLIAGVIRIFSGGKSHGKETESSAIEESTFQASDISVNGISLKGMTRSEAKAAIEK
FT                   EYPWKVTITYNGESIDAENLIDSDLDAFLDGICTGKAEGEYTFAVEDSEDLQSAAAEAA
FT                   ADAAAKWDVKAKNGSISEYDAATDKFLFADGTPGKAVNQEKLIKDLVEAATSGNYDAVI
FT                   QAEVDESQPELSAANAKEQYKTLSTFTTETTANEKRNTNVKLAAKAINGTIVQPGEEFS
FT                   FNKVVGPRTAEKGYQEAAAYSGGEVVQEPGGGVCQVSSTMYRVAFQSGMQITFRRSHTF
FT                   EPNYVTPGQDAAISWDIPDFRFINTSKAAIGIRANYSNRKMTVSFYGVPVLEDGITWSL
FT                   ESEKTDELPPPEPTYVEDPTLDPGTEVTQKAATNGSRWVTYKIVSKNGTVIEKTEDHAK
FT                   TYKGHAAVIRRNTGTVKVSPDETSAVESTSAAAVDGMPDGYVPGESVAPESSAAATTAA
FT                   GSSSASTTVASTGGSETKGTHSETTAASTTAAATEAATTAAPETEATTAAAPNGPGDET
FT                   SAAAPAEAIGNIAGFPGN"
FT   tRNA            complement(170603..170674)
FT                   /locus_tag="CK3_T_36020"
FT   CDS             170839..172170
FT                   /transl_table=11
FT                   /locus_tag="CK3_01640"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40034"
FT                   /db_xref="GOA:D7GQF9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQF9"
FT                   /protein_id="CBL40034.1"
FT                   /translation="MLNGGLAGKLILFSIPLAFSSILQQLFNSADVAVVGRFAGDQALA
FT                   AVGSCVALVGIFVNLIVGLSVGPNAALANLIGQKNRGKINSMVHTILTFGAVLGIVLLV
FT                   IGMLVARRILVASGTPETVLDQALLYIRIYFVGIPFMVAYNFGAAIVRSYGDTRRPMCY
FT                   LIVSGVLNVILNLLLVIGFHLGVAGVAIATVISNVVSTFLIISHLYRRNDEFSFRFDRM
FT                   RIDTNELKKVLAIGIPAGIQGAIFSVSNVFIQSGINMFGEAAIAGSSLALNFEYFTYDI
FT                   AGAFAQAAVTFTSQNFGAGNMKRCRKIFWLCLLFGFGFTEILSVIFIVWEDFFVSIYTT
FT                   SAAVAAYGIIRMDRVCALEGLTATYEVASSCLRGTGKSLEPSVITILGTVVFRLIWLTT
FT                   IFRMFTTYDMLMNVYVASWLFTGCSMFVVYFFHMRKIDKLLGAR"
FT   CDS             complement(172413..173096)
FT                   /transl_table=11
FT                   /locus_tag="CK3_01650"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40035"
FT                   /db_xref="GOA:D7GQG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQG0"
FT                   /protein_id="CBL40035.1"
FT                   /translation="MSPINKKNDTALTLRSVTKSYDGQPVLSDLSLEFSSGTFYCLMAP
FT                   SGNGKTTMFRLILGLEKPDSGVILFGTSAGDTGNNDIKASSGTVSKSDPCRIRGMRPLI
FT                   SAVFQENRLLEGYTAIENLRFALGKRYSSEALTAYLLRLLPEDALNKPVCEFSGGMKRR
FT                   VAILRAILAPTDIILMDEPFTGLDADTKQLTIDLVKELCAGKLLIIATHAEDDAELLGA
FT                   KIIHL"
FT   CDS             complement(173080..173853)
FT                   /transl_table=11
FT                   /locus_tag="CK3_01660"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40036"
FT                   /db_xref="GOA:D7GQG1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQG1"
FT                   /protein_id="CBL40036.1"
FT                   /translation="MDHRFSGFLRRLSIILFWIVLWQTAASLIRNHIFLVGPVDTLRAL
FT                   CEQIVLPDFWSAIAFSFWRISIGFFLAFFLGLFTGSLAYRFPIVDEFLEPPVQLMKTVP
FT                   VASFVILALIWTGSKNLSVFISFLVVYPMIHVNTKAGLISADRELLEMAEVFHVPFIRR
FT                   AFYIYRTALYPYLKSACRTALGMGFKSGIAAEVIGVPDGSIGEGLYLAKIYLSTAELFA
FT                   WTVVIILVSSLFEKGFLWILKKCAGKGADVNESDQ"
FT   CDS             complement(174251..175330)
FT                   /transl_table=11
FT                   /locus_tag="CK3_01670"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems, periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40037"
FT                   /db_xref="InterPro:IPR027024"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQG2"
FT                   /protein_id="CBL40037.1"
FT                   /translation="MRKMLSVMMAAAIAGSLLAGCSSSTTETTAAASSAEETTTAAEET
FT                   TTEAASESAAENTGDETVVRVGGLKGPTTMGLVKLMDEAANGESENSYEFTMVTAADEM
FT                   TAMVAGGKVDIALLPANVASVLYNKTNKNISVIDINTLGVLYFVSADSSVTTIDQLKGK
FT                   TVYLPGKGTTPEYALRYVLSAAGLGEDDVTLEFKSEASEVASVLAEDPNAIGLLPQPFV
FT                   TAALAQNEKLSIIMDLTKEWDNVQGEGSGSRLVTGVTIVNNDFLKEYEDLVDTFLQEHE
FT                   ASIAFTAEDPDAAAELIAKAEIVAKAPIAKKALPYCNITFISGDEMKAALSGYLQALYD
FT                   QNPASVGGELPDDSFYYVK"
FT   CDS             175550..175672
FT                   /transl_table=11
FT                   /locus_tag="CK3_01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40038"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQG3"
FT                   /protein_id="CBL40038.1"
FT                   /translation="MSIQHETGEKHVLKAKAAYAKPKIIGNGVAGKRRNRNLTL"
FT   CDS             175942..177414
FT                   /transl_table=11
FT                   /locus_tag="CK3_01700"
FT                   /product="Iron only hydrogenase large subunit, C-terminal
FT                   domain"
FT                   /EC_number="1.12.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40039"
FT                   /db_xref="GOA:D7GQG4"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027631"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQG4"
FT                   /protein_id="CBL40039.1"
FT                   /translation="MKTNDEALLKIKYNVLRTVSRLAFEGRLEEERDNIPFKLIPGPKA
FT                   QFRCCVYKEREIIRQRIRLVEGKCPSDKQSDNIIQVISSACEECPITRFVVTDNCQKCM
FT                   GKACQNACNFGAISIGRDRAHIDPSVCKECGRCAQSCPYNAIAELIRPCRRACPVDAIT
FT                   MDPETGICQIDEKKCIQCGACVRSCPFGAISSKVYVVQVIEAIKAGKKVVAMVAPAAEG
FT                   EFGQDITMESWRTALKKVGFADMVEVAAGADMTAAYEAMEWAEAFKEGKKMTTSCCPAF
FT                   VNMIKKHYPTLIDNMSTTVSPMCAVSRMLKAIDPETVTVFIGPCMAKKSEAADKSIENN
FT                   ADYVLTFGEAIEMLRGKEVELEPAEETKQEGSVFGKRFGNGGGVTNAVIECFKERGESA
FT                   DVKVARCSGAAEVKKALLLLKVGRLPEDFIEGMMCQGGCVGGPSNMKQEMAFKKDRDAV
FT                   IAKADGRGVWENLKNYDMDSFSMHRSYEKPEA"
FT   CDS             complement(178038..179018)
FT                   /transl_table=11
FT                   /locus_tag="CK3_01720"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40040"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQG5"
FT                   /protein_id="CBL40040.1"
FT                   /translation="MAQIPVISINANGMETNPGFTYTPSMLVKALQAVVYGDVFMRVLY
FT                   ATRPYEAVPGSANALHEKWKKICVKALSTKSAGMMTFVKNIRGIIHDFDNLERTNVHKP
FT                   KVGIVGEILVKFSPTANNHIVELLESEGAEAVMPDLMDFLLYCFYNSNFKADNLGMKRS
FT                   TAHLCNMAISLLEYMRKAARIALEKSTHFTPPSRIKELAVMANGFVSLGNQTGEGWFLT
FT                   GEMLELIKSGVNNIVCVQPFGCLPNHIVGKGVIKELRYANPKANIIAVDYDPGASEVNQ
FT                   LNRIKLMLSTAQKNLEKEEYVDPNLAKTLKKVEELSSKRVNKCRL"
FT   CDS             complement(178934..182359)
FT                   /transl_table=11
FT                   /locus_tag="CK3_01730"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40041"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQG6"
FT                   /protein_id="CBL40041.1"
FT                   /translation="MNQCYRLGIDIGSTTVKVAVIDDNNKILFADYERHYANIQETLAS
FT                   LLKKCKGELGELSLRPNITGSGGLTLSGYLHIPFVQEVVAVATALQDYAPRTDVAIELG
FT                   GEDAKIIYFTGGIDQRMNGICAGGTGSFIDQMASLLQTDAAGLNEYAKNYKAIYPIAAR
FT                   CGVFAKSDIQPLINDGATREDLAASIFQAVVNQTISGLACGKPIRGNVAFLGGPLHFLP
FT                   ELRNAFIRTLNLTGDAIIAPDHSHLFAAVGAAMNAKDHAEIFSLDKLIADLSGGIKMKF
FT                   EVKRMQPLFKDEADYKEFTDRHDQYKVRRGDLSTYEGNVFLGIDAGSTTTKVALVGEDG
FT                   SLLYSFYSSNNGSPLATAISSIKEIKSLLPDSAKIAYSCSTGYGEALLKAAFMLDEGEV
FT                   ETISHYYAAAFFDPSVDCILDIGGQDMKCIRIKDGTVDSVQLNEACSSGCGSFIETFAK
FT                   SLNYSVQDFAKAALFAQNPVDLGTRCTVFMNSNVKQAQKEGASVADISAGLAYSVIKNA
FT                   LFKVIKITSAGDLGKNVVVQGGTFYNDAVLRSFERISGCNAVRPDIAGIMGAFGAALIA
FT                   RERYMHRPHETTMLSLDDIINLTYTTTMSRCRGCVNHCVLTINRFEGGRQYVSGNRCER
FT                   GLGVEKAKRDIPNLFTWKYHRIFDYEPLTADKATRGIVGIPRVLNMYENFPYWATFFKE
FT                   LGFRVMLSPQSSHQIYELGIETIPSESECYPAKLAHGHISWLIKRDVPFIFYPCIPYER
FT                   KEVPGAGNHYNCPMVTSYSENIKNNMEELKEKNVKFLNPFMAFTSEAVLSKQLQEVFKK
FT                   EFDIPESETKKAAKKAWDELAQARTDVEKKGEEVLQYLKDTGKHGIVLAGRPYHIDPEI
FT                   NHGIADMITSYGFAVLTEDSVSHLGKVERPLVVTDQWMYHSRLYAAATFVKTQDNLDLV
FT                   QLNSFGCGLDAVTTDQVSDILTRSGKIYTVLKIDEVNNLGAARIRIRSLISALRVREER
FT                   RYTRNIVSSSYNRVIFTKEMKKNYTLLCPQMSPIHFELIEPAIRSFGYNLVVLQNDDKT
FT                   AVDTGLKYVNNDACYPSLIVIGQIMDALLSGKYDLDHTAVLMSQPEAAAVRRTTSDLSA
FT                   AHSKKPEWRRSRSSPSTRTVWRRIRASPTRRPCL"
FT   CDS             182757..183620
FT                   /transl_table=11
FT                   /locus_tag="CK3_01740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40042"
FT                   /db_xref="GOA:D7GQG7"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQG7"
FT                   /protein_id="CBL40042.1"
FT                   /translation="MNFMNKMERKFGRYAIPNLMYYIVILYAVGVLVQMMAPAFYIQYL
FT                   MLDARAILHGQIWRVVTFMIWPPSGSLFFNLIAIYLYYNLGMTLERVWGTFRFNVYFFM
FT                   GVIGHVLAALLIYIITGQVYILTTDYLNFSLFFAFAATFPEMQFYLFFVLPIKAKYLAL
FT                   FDGLYFVYGFLFGGMSQRIAIVMSLLNFIVYLFMSRGSRLNPKEIRRKQVFHSQMREAQ
FT                   KTAEKIGRHRCAVCGRTEEDDPNLVFRYCSKCEGDYEYCQDHLYTHKHVTKGGMDPRQA
FT                   NSNQEA"
FT   CDS             183622..185058
FT                   /transl_table=11
FT                   /locus_tag="CK3_01750"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40043"
FT                   /db_xref="GOA:D7GQG8"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQG8"
FT                   /protein_id="CBL40043.1"
FT                   /translation="MKKTKIICTMGPNSDDREVMKQLLLNGMDVARFNFSHGTHDEQRA
FT                   RYKQLREVAEEVGKPVAALLDTKGPEIRTGVLKDGKKVTLTAGEEIILTTEDIVGDAKR
FT                   VHINYNGLNEDVTEGNVILIDDGLIELHVERVEGTEIYCRIMNGGELGERKGVNVPNVK
FT                   IKLPALTDKDKEDIRFGIELGFDYIAASFIRSADAIREIRQMLDEGGSSMGIIAKIENA
FT                   EGLENLDEIIEASDGIMVARGDLGVEIAPEKLPHLQKMMIKKCSAACKVVITATQMLDS
FT                   MIRNPRPTRAEVSDVANAVYDGTDVVMLSGETANGKYPVEALKMMAHIVEETESHMSGD
FT                   FYEKRTVSDDNRHNISNAVSYASVATAQSLDAAVIIAPSISGYTARMLSKWHPSTKLVG
FT                   MSPSISAVRKMMLYWGVTPFQAKRAESTDTLIENSIDILKENGIVKTGDIAVVTAGVVD
FT                   YAKRHEPAASTNIMRVVNID"
FT   CDS             185086..186360
FT                   /transl_table=11
FT                   /locus_tag="CK3_01760"
FT                   /product="Diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40044"
FT                   /db_xref="GOA:D7GQG9"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQG9"
FT                   /protein_id="CBL40044.1"
FT                   /translation="MEKKPFVTKEQLEEIAKTYPTPFYLYDEKGIRENALKLKEAFSWN
FT                   KGFREYFAVKATPNPFILKILQELGCGTDCSSKTELLMSDACGFSGHDIMFSSNDTPPE
FT                   EFKLAYDLGAIINLDDFTHIECLEKTIGTIPETICCRFNPGGLFKVATDIMDNPGDAKY
FT                   GMTEAQITEAYKILKAKGAKNFGIHAFLASNTVTNEYYPILAKILFELAVKLKKETGAD
FT                   IKFINLSGGIGIPYRPDQEPNDIKVIGESVRKVYEEVLVPAGMGDVAIFTELGRFMLAP
FT                   YGALVTRAIHEKHTYKEYIGVDACAVNLMRPAMYGAYHHITVMGKENEPCDHKYDVTGS
FT                   LCENNDKFAIDRMLPKIDKGDLLFIHDAGAHGFAMGYNYNGKLKSAELLLKEDGSVQMI
FT                   RRAETPKDYFATFDFCDILKNVKNV"
FT   CDS             complement(187971..188069)
FT                   /transl_table=11
FT                   /locus_tag="CK3_01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40045"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQH0"
FT                   /protein_id="CBL40045.1"
FT                   /translation="MSIIDFIAVVSFGLACFGLGYTLGKDTVNAKK"
FT   CDS             188370..190145
FT                   /transl_table=11
FT                   /locus_tag="CK3_01790"
FT                   /product="Na/Pi-cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40046"
FT                   /db_xref="GOA:D7GQH1"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQH1"
FT                   /protein_id="CBL40046.1"
FT                   /translation="MDFFGVLTMLGGLALFLYGMETMGKGLEKLSGGRLERILEKLTSN
FT                   PIKAVLLGAGVTAIIQSSSATTVMVVGFVNSGIMKLTQAVGIIMGANIGTTVTSWLLSL
FT                   TGIESGNFFVQLLKPTSFSPVLALIGVCFIMFSKKEKKKDAGTIMVGFAILMTGMETMS
FT                   GAVKPLANVPEFTGILTMFSNPVLGMIAGAVLTAIIQSSSASVGILQALCATGAVNFST
FT                   ALPIIMGQNIGTCVTAMLSGIGASKNAKRAALVHLYFNIIGTVIFMIVFYTINAVVHFS
FT                   FLDTAANAMGIAVIHSSFNIAATIMLLPFGSGLVKLACLTIPEEKKEAPVQNQEKDAFR
FT                   LLDQRFLDTPAFAVEQCRQTTIQMAKLARECFFTAVDLLHGYDDEKAARVETLENLVDR
FT                   YEDELGTYMVKLGGKNLSKSDSHTVSLLLHCIGDFERISDHGMNLKDSAKEMKEKEMQF
FT                   SSKAEKELGIFFDAVKEILNLSIDAFETNNTDEAARVEPLEEVIDDINTVVKANHIRRL
FT                   QKGKCTIEQGFVLSDISMNLERVSDHCSNIAVSVIEIDRDGFDTHGYLDNLKRDGDPHF
FT                   AAMVEQYRGKYMLPV"
FT   CDS             190214..190879
FT                   /transl_table=11
FT                   /locus_tag="CK3_01800"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40047"
FT                   /db_xref="GOA:D7GQH2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQH2"
FT                   /protein_id="CBL40047.1"
FT                   /translation="MALIYAVEDDKNILEIEMFALKNSGYQVEGFECARDFYKKLEEKQ
FT                   PDLALLDIMLPDEDGLEIVAKLRRRPETKKLPIIMVTAKSTEIDKVKGLDVGADDYLTK
FT                   PFGVMELIARVKAVLRRTMEEDKFLTLGDIFLDDEKHMVYVKDVPCSLTFKEYELLKLL
FT                   LHNAGIVVTREIILERVWGIDFEGESRTLDMHIRTLRQKLGEAGSMIRTVRNVGYMIE"
FT   CDS             190876..192282
FT                   /transl_table=11
FT                   /locus_tag="CK3_01810"
FT                   /product="Signal transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40048"
FT                   /db_xref="GOA:D7GQH3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQH3"
FT                   /protein_id="CBL40048.1"
FT                   /translation="MKRKIHMELLATAVFAILLTLLCALFVFYGVYRKQVIGDLKADAL
FT                   VMKNMHIFDNISDLHPDAYDLNPDTLRITVVNANGSVIFDSNADFSVMENHEDRPEIHM
FT                   AAKVGEGSGTRRSTTLDRNLFYYAIRIDNGRILRIAREGDNIFALTQNMMMTVVGVFVL
FT                   LFFFCIMMANYFTKNLVAPIEQMAENLSEPGTQAAYKELVPFMNKIRQQHEDILKSSQV
FT                   RQEFTANVSHELKTPLTAISGYAELIEHGMSGENTERFASEIHKNAARLLTLINDIIQL
FT                   SQLDGGKKDVEYRDLDLFPLARECVDMLQMNAQKQNVTIRVQGGEAPVFADKQLMEELI
FT                   YNLCDNAIRYNKKDGTVTVTTGIENGHTFLSVKDTGIGISAEHQERVFERFYRVDKSRS
FT                   KATGGTGLGLAIVKHIVAQHGAKLTLESEQGKGTEIRVEFSEALKQHEIETAKQRQEVH
FT                   AERSENGSSD"
FT   CDS             192456..192644
FT                   /transl_table=11
FT                   /locus_tag="CK3_01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40049"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQH4"
FT                   /protein_id="CBL40049.1"
FT                   /translation="MERRRCKTGSCPWYRSISQAKGQGIQITTMGQNPLYANVLLFGEL
FT                   INISSYFIAWKFRGDIP"
FT   CDS             192644..192706
FT                   /transl_table=11
FT                   /locus_tag="CK3_01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40050"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQH5"
FT                   /protein_id="CBL40050.1"
FT                   /translation="MPDSRKFKEKAGGYDDERGG"
FT   CDS             192712..194064
FT                   /transl_table=11
FT                   /locus_tag="CK3_01840"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40051"
FT                   /db_xref="GOA:D7GQH6"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQH6"
FT                   /protein_id="CBL40051.1"
FT                   /translation="MDTLMQLVTKGNDFLWSFLLLVLLCGTGLYYTIRLRFIQVRKFGE
FT                   GVRQVFGHFSMNGEKHEKGEMTPFQSIATAIAAQVGTGNLAGAATALIGGGPGAIFWMW
FT                   ISAFLGMATIYGEAVLAQTYKTEVNGEVTGGPVYYIKAAFKGTFGKALSTLFAVFIILA
FT                   LGFMGNMVQSNSIGAAFVEAFQVFHVELSPVIVGIVVAVIAAVIFLGGTKSLATVVEKI
FT                   VPIMAGVYIVGSLVLICMNITALPAAFLSIIEGAFAPEAVLGAGAGITVREAIRYGVAR
FT                   GLFSNEAGMGSTPHAHARAKAESPHHQGLCAMVSVFIDTFIVLNLTVFSVLTTGVMSTG
FT                   KDGTALTQAAFMKGFGSAGIIFVAVCLFFFAFSTILSWHFFGLVNVKYLFGEKASKLYS
FT                   LIVVACIVIGSCLKLELVWSLADFFNGLMVIPNVLALLALSGLVARASKER"
FT   CDS             194862..195926
FT                   /transl_table=11
FT                   /locus_tag="CK3_01850"
FT                   /product="protein RecA"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40052"
FT                   /db_xref="GOA:D7GQH7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQH7"
FT                   /protein_id="CBL40052.1"
FT                   /translation="MNKDDKLKALDAALTQIEKAYGKGSVMKLGDSGANMNIETVPTGS
FT                   LSLDIALGLGGLPKGRVVEIYGPESSGKTTVALHMVAEVQKRGGIAGFIDAEHALDPVY
FT                   AKNIGVDIDNLYISQPDNGEQALEITETMVRSGAVDIVIVDSVAALVPKAEIDGDMGDS
FT                   HVGLQARLMSQALRKLTAIISKTNCIVIFINQLREKVGVMFGNPETTTGGRALKFYSSV
FT                   RLDVRRTESLKQSGEVIGNHVRVKVVKNKIAPPFKEAEFDIMFGKGISREGDVLDLAAD
FT                   ANIVEKSGSWYAYKGAKIGQGRENAKTYLAQNPLICEEIENQVRELHGLEAQHVAPGEA
FT                   AAAPAVNEAEEADE"
FT   CDS             196020..196532
FT                   /transl_table=11
FT                   /locus_tag="CK3_01860"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40053"
FT                   /db_xref="GOA:D7GQH8"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQH8"
FT                   /protein_id="CBL40053.1"
FT                   /translation="MKEWLQEEHREKKMYAGADGDAVPEEFREARNKGLYYLQFSGKTE
FT                   NEMRKKLAEQGFSPASVEDAVLFLKHYRYLDDEDYARRYVEKNDHKKSIRQMKFDLRQK
FT                   GVSDDLVEMVFEDMEVDESAQILGLLRKKNYDPEEPDPAKRQKIYAFLARKGFSYDAIN
FT                   SAMKQWE"
FT   CDS             198398..199198
FT                   /transl_table=11
FT                   /locus_tag="CK3_01880"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40054"
FT                   /db_xref="GOA:D7GQH9"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQH9"
FT                   /protein_id="CBL40054.1"
FT                   /translation="MAKIGFIGMGNMGTAIMRGLLKIYKPEELLFTSTHEAKMQKITEE
FT                   TGVAHVSTATDCAEQVKYLVLAVKPQVLPTVFKELNGKIRKDQVVISIAAGYAIADLQA
FT                   GLGDSARIVRSMPNTPAMVGEGMSGVSYDEALFTDEEKDVIDGFFTSFGKMEKVDEKLM
FT                   DVVGSASGCSPAYVYMFIEALADGCVKNGLPRQAAYKMVAQAVLGSAKMVLETGKHPGE
FT                   LKDMVCSPGGTTIEGLAALEENGFRGAIIKACDANFEKNKNLKG"
FT   CDS             199376..199912
FT                   /transl_table=11
FT                   /locus_tag="CK3_01890"
FT                   /product="NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes"
FT                   /EC_number="3.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40055"
FT                   /db_xref="GOA:D7GQI0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQI0"
FT                   /protein_id="CBL40055.1"
FT                   /translation="MEKTTRLKRDLAYTGTILKIYRDTVVANGIEEEYDYIHHDGAAAV
FT                   LPVTKDGKILMVRQYRNALDRFTLEIPAGKLDAPDEPKIECAARELEEETGFRSETLEF
FT                   LMTVNTTVAFCDEQIGVYIAKDLIPSKQHLDADESIDVEEWEVKDLLDMIYTGKMTDAK
FT                   TIAAILAYAQREGIR"
FT   gap             199928..200876
FT                   /estimated_length=949
FT   CDS             200982..201500
FT                   /transl_table=11
FT                   /locus_tag="CK3_01900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40056"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQI1"
FT                   /protein_id="CBL40056.1"
FT                   /translation="MFWLSFFLFLGTVLGTVFFNKMSAEMKSTLESWFSGILTSSEIVS
FT                   ADRYSLFVGVLKKRFVWILLGILICQAVFARILFYAGAVYLAFTSAITVCVLTMHAGIY
FT                   GILRFFGLVFPQGFFYTLAAYLLWIMVVEQADGKEKIRLWMMVFFMVLGIISEIFINPN
FT                   FSALIFQLF"
FT   CDS             202144..202998
FT                   /transl_table=11
FT                   /locus_tag="CK3_01910"
FT                   /product="tyrosine recombinase XerD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40057"
FT                   /db_xref="GOA:D7GQI2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQI2"
FT                   /protein_id="CBL40057.1"
FT                   /translation="MEEEKHASKNTTLSYQRDLLKMADYLEENGITDCGKVTKTALNSY
FT                   ILFLEKEGKAASTVSRALASTRSFFGWLFKEGRIRRDPADSMHAPKIEKKVPVILTVDE
FT                   VTKLLEQPSGANPKEIRDKAMLELLYATGIRVTELVNLKLSDVNMSIGFITCRDEHKER
FT                   MIPFGHAAKDALAKYLESASETFLKGTRSELLFTNYSGRAMSRQGFWKIIKYYGERAGI
FT                   EEDITPHTLRHSFAAHLLSNGADMRAVQTMMGHSDLASTQMYTAYAMDSAVREAYQGAH
FT                   PRK"
FT   CDS             complement(203234..204646)
FT                   /transl_table=11
FT                   /locus_tag="CK3_01920"
FT                   /product="Uncharacterized FAD-dependent dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40058"
FT                   /db_xref="GOA:D7GQI3"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQI3"
FT                   /protein_id="CBL40058.1"
FT                   /translation="MKSGEHFDVIIIGAGPSGIFCAYELIKEKPELNILMIEKGRPIEK
FT                   RVCPKRTTKVCVGCKPCSITTGFAGAGAFSDGKLSLSPDVGGNLPEILGYDKATELIRE
FT                   SDDIYLQFGADKNVYGVDKQQEIRKIRKKAINANLKLIECPIRHLGTEEGYKIYTRLQE
FT                   HLLANGIHMEFNTMVKDIIIEDGAAKGVITDKDETYYADEIVSAIGREGSDWFSHICDD
FT                   HGIDTEVGTVDIGVRVEVRDEVMEFLNKNLYEAKLVYYTPTFDDKVRTFCTNPSGEVAT
FT                   EYYENGLAVVNGHAYKSKEYKTNNTNFAILVSKNFTKPFKTPIEYGKHIAQLSNMLCDG
FT                   KILVQTFGDFQRGRRTTEERLCRNNIIPTLKDAVPGDLSLVLPHRIMVDIKEMLKALDK
FT                   VTPGIASDETLLYGVEVKFYSNKVVVDKDFETNIHGLRAIGDGASVTRGLQQASANGLS
FT                   VARSILARIDQK"
FT   CDS             204983..205699
FT                   /transl_table=11
FT                   /locus_tag="CK3_01930"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40059"
FT                   /db_xref="GOA:D7GQI4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQI4"
FT                   /protein_id="CBL40059.1"
FT                   /translation="MKIKTVNITDQVVEYLKENIESGKWNIGEKIPSENQMVMELGVSR
FT                   SSIRSALQYLIGIGVLKSYQGKGTFLINTQVENWDEAEYKITSEDCMDICKVLEFRKIL
FT                   EPGACVLAMENCDEKTVAALEVYLEQMKEFKGDRAKFVRADLKFHEVISRTSGNPLLEK
FT                   SLHKVFLESRKNHEQMNELFGYETGLHYHTEILEAFKNHDAERARDVMEQHLGGSIETL
FT                   KMSGKIEDREGGTGKK"
FT   CDS             205873..207120
FT                   /transl_table=11
FT                   /locus_tag="CK3_01940"
FT                   /product="L-alanine-DL-glutamate epimerase and related
FT                   enzymes of enolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40060"
FT                   /db_xref="GOA:D7GQI5"
FT                   /db_xref="InterPro:IPR001354"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQI5"
FT                   /protein_id="CBL40060.1"
FT                   /translation="MSVKIRDIRVICTAPEGINLVVVKIETNQPGLYGLGCATFAYRHL
FT                   TVKHLIEEYMKPLLVGRPVENIEETWQLMHQNGYWRNGPIENNAISGIDMALWDIKGKM
FT                   AGMPLYELFGGKVREGIPVYRHVDGRDINEICENIQMYQEMGITHLRCQCGGYGGLPYG
FT                   QTPETAPEGAHDGLYLDSKKYIRDTIQLFEQIRAKIGYDMQLVHDVHERIAPADAVALA
FT                   KGLEPFDLFFLEDPVPLEQLSWLRNLRQQTSIPIAQGELFNNPYEWRTVIAEQLIDFIR
FT                   VHISQVGGITPARKLQIFAEQFGVRTAWHGPGDMSPLAHAANIHIDLAAQNFGVQEWSG
FT                   IEPPNFVIQELKGPHGALLDVFPGMPEYRKGYVYANDKPGLGVDIDETEAAKYPCENTV
FT                   TTWTQTRGRDGALVTP"
FT   CDS             207154..208173
FT                   /transl_table=11
FT                   /locus_tag="CK3_01950"
FT                   /product="tripartite ATP-independent periplasmic
FT                   transporter solute receptor, DctP family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40061"
FT                   /db_xref="GOA:D7GQI6"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQI6"
FT                   /protein_id="CBL40061.1"
FT                   /translation="MSKKSSALAAAGILAAAVVLSGFSIYKDSHQKNSTDGTITLRMAQ
FT                   TSSQAGAIGQSMEAFADRIYDETEGKYKIETYHNGQLGAEIDTIEGCQMGTIDIAVVNQ
FT                   STIGNFINDFQALDIPYLITSTEQADAVFLGDIGTRFLDKLSGVQLYGLGIWESGFRNL
FT                   TNSKRDVNSVDDVAGLKIRTMENQVHIAFWKAMGADATPMSWGEAYTALQQGALDGQEN
FT                   PATVILTNNVAQVNNHLAMTEHAYSTVFLVMSPETWASFDDETKETFKRVMAECSIEER
FT                   EISRKMDSEAVAELEKQGMTVTYPDKQQFIDKAADLYAQWEEQYGDMISEIRALSVNK"
FT   CDS             208184..208669
FT                   /transl_table=11
FT                   /locus_tag="CK3_01960"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   small permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40062"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQI7"
FT                   /protein_id="CBL40062.1"
FT                   /translation="MEKFAAVFKKVQKINKAIIGAVLLLMIGVVFLQTFCRFVIFKSLT
FT                   WSEELSRYLFVALIVLGINLAATDHLFVRIELIDGYLKGKAQYVMDVIRKGIAIYVSLI
FT                   LMYSGYGLIEIGGYQISPAMGIPMSLLYGIMFIGFIMNFLALIVDTWEEFGKEKEVG"
FT   CDS             208669..209952
FT                   /transl_table=11
FT                   /locus_tag="CK3_01970"
FT                   /product="TRAP transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40063"
FT                   /db_xref="GOA:D7GQI8"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQI8"
FT                   /protein_id="CBL40063.1"
FT                   /translation="MQTAAIALIVVLLVGMACGLEITWALGLSCIAAVLLDPKLTFVVI
FT                   AQRIFANSNSFSMLAIPAFMLAGDVMSKGGLSKRLVAFADSLVGWISGGISLVSIVACT
FT                   FFAAISGSSVATTAAIGGLMYPEMVKRGYPESYAAAVQAIGGTLGIVIPPSIVLVIYGN
FT                   ITGTDVGALLMAGILPGVVCSIFLCLYAYYKAKKCGFPKSDKFSFKRFLVSFKDAVWAL
FT                   IMPVIILGGIYAGIFTPTESAVVAVVYGLIVCLAVYREISMKTIWEIVENTAEGTANLM
FT                   ILVVTAQMFGWLISYYQIPQAVTNFMLAFVSNKYMFWAIIIILLTICGMFLEVGATNLI
FT                   LGPILAPIAAAFGIDPVQFGLVFVFLLAMGQATPPFGTCMFVACGISKQSVGQVSKHLV
FT                   PFVVVEILCGILFALVPGISLLLPSIIG"
FT   CDS             210010..211050
FT                   /transl_table=11
FT                   /locus_tag="CK3_01980"
FT                   /product="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40064"
FT                   /db_xref="GOA:D7GQI9"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQI9"
FT                   /protein_id="CBL40064.1"
FT                   /translation="MAEMMKEVVVVEPHKYEVREVEIPELANEDEVLIQMKSAGVCGSD
FT                   HHIWHGSNPCSTYPRIPGHENAGVIAKIGKNVKNVKVGDHVIVDLLSSCGTCYQCTHGR
FT                   KNVCEHVKVRGSGADGGWRQYFTAPAKEVYKISDSVKWEDAALVEPFAIGSHCTGRGRV
FT                   VEDDVVFILGTGTIGSIILQTCKAKGCKTVICCDISDSSLERAKEYGADYVINSKTQDV
FT                   VAEIQKITDGHGCTVAFDSACFPGSLTMCLQPGILCNAGRMVPMGFCTEKEGITQAMIN
FT                   QRELDIIGSRMSQDAFEPTIARMEKGEYITEGIATTFIKFSEIDKVFHLMDHPDESAKK
FT                   MVILFD"
FT   CDS             211076..211837
FT                   /transl_table=11
FT                   /locus_tag="CK3_01990"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.125"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_01990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40065"
FT                   /db_xref="GOA:D7GQJ0"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQJ0"
FT                   /protein_id="CBL40065.1"
FT                   /translation="MELFNIAGKKAIVTGGTRGLGYGMAEGLMEAGCEVVIVGTSDKVY
FT                   DVAKGFCDRGFKCHGVKADFSKREQVYQGFNDCVAALGGDLDIIVNAHGIQRCHSAEVF
FT                   PIEEWDEVLNVNLNSVFILCQEAAKIMLKKGYGKIINIASMVSWFGGQTVPAYTAAKGG
FT                   VTQLTKELSNDWIARGVNVNAIAPGYMATEMNSALLDPENPRYQQITERIPANRWGTGD
FT                   DMKGACIFLASHASDYLGGAIIPVDGGYLVK"
FT   CDS             212104..213936
FT                   /transl_table=11
FT                   /locus_tag="CK3_02000"
FT                   /product="NADPH-dependent glutamate synthase beta chain and
FT                   related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40066"
FT                   /db_xref="GOA:D7GQJ1"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQJ1"
FT                   /protein_id="CBL40066.1"
FT                   /translation="MSRLEIMSPTRARIVMEGLYKDLERRIESSPPGLCPVDMARAFLE
FT                   LCHAQTCGKCVPCRIGLGQLNQLIRDVLNGKATMDTLDLMEKTALSIMDSADCAIGYEA
FT                   ANMVYKGLIGYRDDYVEHIRNGRCTCTYNQPVPCVAICPAHVDIPGYVALVEEGRYADA
FT                   IRLIRKDNPFPTTCGFICEHPCEARCRRNMVDDAVNIRGLKRFAADYAGFVDPPECAPS
FT                   TGKKVAVLGGGPGGLSAAYYLQLMGHQTTVYEMLPKLGGMLRYGIPNYRLPKDRLDDDI
FT                   NAILKTGVEVKQGLKIGVDITIQELREQYDAVLITIGASTDKKLGLPGEDADGVLSAVQ
FT                   FLRSVGKDEIIDLTGKEVVVIGGGNVSMDAVRTAKRLGAKKVSILYRRRRNDMTALPGE
FT                   IEGAIAEGIEIVTLKAPASLDVGEDHKIHGIYATPQMISAIKDGRASVKPTGEPDVYIP
FT                   CDILIKAIGQDIESGHFEKAGIPVSRGKIVTLKSGAFENMPGVFAGGDCSSGPASVIKA
FT                   IAAAKVVAANIDEYLGYHHEITSGVEIPEASLKDKTPCGRVNLTERDACERVCDFNAVE
FT                   NCMTEKEAKQEAGRCLRCDHFGYGIFKGGRSTLW"
FT   CDS             213930..215663
FT                   /transl_table=11
FT                   /locus_tag="CK3_02010"
FT                   /product="hydrogenases, Fe-only"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40067"
FT                   /db_xref="GOA:D7GQJ2"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQJ2"
FT                   /protein_id="CBL40067.1"
FT                   /translation="MVNMIIDGKHVSAEENITIMEAAERNGIPIPKLCYLKGINEIAAC
FT                   RVCVVELEGKEKLITSCNNVVKDGMVIYTNSPKVRNHRRNTVQLLLSQHDNRCVVCPRN
FT                   GNCQLQQVACDLNILDIPFRQEPEYQPWDKDFPLIRNSAKCIKCMRCVQVCDKIQGLGI
FT                   WDVEGTGSRTTVNVAGHKTIREADCALCGQCITHCPVGALSERDDTEKVWEAIENKDKI
FT                   VVAQVAPAVRAAWGEELGLTDEDAPVGKIFDALKRMGVNYAFDTVFSADLTIMEESTEF
FT                   IKRFTSGELKERPMFTSCCPGWVRFVKTQFPYMVNYLSTAKSPQQMFGAVMKTYFAEKL
FT                   GVSPDQIFALSIMPCVAKKGEREMDLFYGEYAGHDVDAVLTTRELVKMIRSAHIRPDTL
FT                   VEIPGDSPMHAGTGAGVIFGATGGVMEAALRTAYFALKGENPPADAFKAVRSGGFQENA
FT                   GVQEAEFANGDIKLHTAAVSGLGNTRRLLQQIERGEVHYDFVEVMACPGGCVGGGGQPI
FT                   HDGEELAFARGRKLYALDAKADIRYSHENPDIREIYSDFFGKPMSHKAHMLLHTEHWKN
FT                   N"
FT   CDS             complement(215841..216671)
FT                   /transl_table=11
FT                   /locus_tag="CK3_02020"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40068"
FT                   /db_xref="GOA:D7GQJ3"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQJ3"
FT                   /protein_id="CBL40068.1"
FT                   /translation="MNISAQIQQSVHIITEYYENRLQPFFDAIDDDLLWIGPAERQWMQ
FT                   GKENILNAFTQEEGRHHLTFRMSNISATPISCGTHACEIILTYLVYTYYPNGAMTVHDQ
FT                   RLHFTWRDKKVTGPDGKKHLVPKAAVIHISNAFPYDDRDKIYPVHYDEMKVPTTLTPAT
FT                   GPRITISGSNHVCHFLAANSILYIETGSRSPYTVFHTLNGEFNSTESISKLEKKYSDIF
FT                   LRVHASFMVNPLFVQSIRRFEITLTDGTVLPVPDRKYAKVTKALQEWGTSTSIN"
FT   CDS             216837..216896
FT                   /transl_table=11
FT                   /locus_tag="CK3_02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40069"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQJ4"
FT                   /protein_id="CBL40069.1"
FT                   /translation="MGLNDKIVEKTKIKENETK"
FT   CDS             complement(218475..219989)
FT                   /transl_table=11
FT                   /locus_tag="CK3_02050"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40070"
FT                   /db_xref="GOA:D7GQJ5"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQJ5"
FT                   /protein_id="CBL40070.1"
FT                   /translation="MYEDIKTACLYVRFSSHNQTEQSIEGQTRVCRDFCKRHNIRIVEI
FT                   YADRATSASKDIEKRVQFLKMIKDSEKGLFDAVIVYKLDRFARSRYDSATYKYRLKRNG
FT                   VQLISATENISNDPEGIILESVLEGMAEFYSAELSQKINRGMRESAYKHNSIGGAVPLG
FT                   YKIEDKKLVIDPKTAPIVKEAFEKYADGETVAEICRQFNARGYKTSKGTAFGKSSFTKI
FT                   FRNERYIGVYSFHDYRAEDAIPAIIDKDLWDRVQLRVGKIKNAPARNKAKVVYLLSGKI
FT                   FCGHCGSKMNGNCNAGNYYYYQCYGKKNGNVDCKKKNIRKEFIERLVAQDALSLLTDEY
FT                   IEQIATIACEKNQHEIELDSALPTIRDRIHQVDLSLNNLLKAIESGSAPDMLVKRMGEL
FT                   EKEKKDLQVQAKKESEDIVELDKAQVIYWLEQFRGGSIEDEEFCRMLIDLFVNSVTVWD
FT                   EDDNTYKVTVAYNLTSLPTKTYRLNKGGTLSDFTSNAPDKHPHKAL"
FT   CDS             complement(220017..220370)
FT                   /transl_table=11
FT                   /locus_tag="CK3_02060"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40071"
FT                   /db_xref="GOA:D7GQJ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQJ6"
FT                   /protein_id="CBL40071.1"
FT                   /translation="MDTLERILELQKQSGLTVKALEAATGISNGSFSKWKKGTYAPSAE
FT                   AVLRLAKYFHVSTDYLFCLSDSPYPKVEISLTEKEKILIDAYRAADDMGQLNIIYVCLD
FT                   EMKKAKGNNESAV"
FT   CDS             220844..220993
FT                   /transl_table=11
FT                   /locus_tag="CK3_02080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40072"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQJ7"
FT                   /protein_id="CBL40072.1"
FT                   /translation="MLRTLEGSALCSVLADRVKEYFKDEENRKKFEIWYQEKYGKPYKW
FT                   RKTQ"
FT   CDS             220990..221562
FT                   /transl_table=11
FT                   /locus_tag="CK3_02090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40073"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQJ8"
FT                   /protein_id="CBL40073.1"
FT                   /translation="MKVKRMIKSDVDTFKVGDIIKVKLTDGVKVQAMAMQQEEDGMIFC
FT                   LVDCLPGEYPMNSTRTNEGGYEESDLRKKLNGEILNLFPAELTDMMAPFDNGDLLRLPT
FT                   EKEIFGENYYGEYESPYVKQWKPMKKRRNRMAFDGTKDENLQWYWLMNKVRESAASFSG
FT                   VGGSGGAGDGGASDSLGVRPAFKIKNR"
FT   CDS             221602..222042
FT                   /transl_table=11
FT                   /locus_tag="CK3_02100"
FT                   /product="Archaeal holliday junction resolvase (hjc)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40074"
FT                   /db_xref="GOA:D7GQJ9"
FT                   /db_xref="InterPro:IPR002732"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQJ9"
FT                   /protein_id="CBL40074.1"
FT                   /translation="MKQVNKTMGNHFEEELCELLAEQGFWAHNLAQNQVGQPADVLAVR
FT                   DNIAVLIDCKVCSNNRFPLSRIEPNQEAAMTMWEAQGNEHCYFAMKLNDGQIYMIHFDE
FT                   LCLRQLYGQGSITESEFPEYKTFQEWLEEMDVYRNREPIENP"
FT   CDS             222086..223390
FT                   /transl_table=11
FT                   /locus_tag="CK3_02110"
FT                   /product="DNA or RNA helicases of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40075"
FT                   /db_xref="GOA:D7GQK0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQK0"
FT                   /protein_id="CBL40075.1"
FT                   /translation="MTNPEYQQKARMHLWLGNTPRTLYLYEVNGNSLILPFGCLRAILP
FT                   LLEGDMKKLFKEPKKVDYGGKVPLYDYQEEAVAAMLINHYGILQSPAGSGKTQMGIALA
FT                   CALGAKTLWLTHTKDLLTQSKSRAEQYVDSELLGTITEGKVNIGKAMTFATIQTMCKLD
FT                   LDQYRDEWDCVIVDECHRVSGTPTAVTQFSKVLNTLCARHKFGLSATVHRSDGMIKATY
FT                   AMLGQVVWTVPDEAVKSRVMTVSVLPKGTDVKLSPAYLNSDGTINYCKMITYLTECESR
FT                   NKIILNDLVENREHFNLILSERVDHLKYLYEQLPLKLRAQAAVIDGKMTSKKRKAEREQ
FT                   AIEDIRTGKKRYLFATYSLAKEGLDIPRLDRLYLTTPQKDYAVIVQSVGRIARTFDGKE
FT                   QPIAYDYVDCIRSLQKSFKQRCTSYRKCGCEFIGD"
FT   CDS             223576..223788
FT                   /transl_table=11
FT                   /locus_tag="CK3_02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40076"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQK1"
FT                   /protein_id="CBL40076.1"
FT                   /translation="MKMTKNVKNHFTTAQLLLAGVEESMGVEPDKWGIIPPEHSKASMI
FT                   RRCVQARQEILQVQKALEEGRCNDG"
FT   CDS             223781..225754
FT                   /transl_table=11
FT                   /locus_tag="CK3_02130"
FT                   /product="hypothetical protein"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40077"
FT                   /db_xref="GOA:D7GQK2"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQK2"
FT                   /protein_id="CBL40077.1"
FT                   /translation="MVKGTYIFDCEVFAHDWLFVFKEVATGEYTVIWNDNDEVLAFMEH
FT                   NPYLGGFNNKHYDNHILKAVMCGFTPEQVKEINDLIIVHELNGWDIPALREYRVYFDSF
FT                   DLKDDCQDGVSLKGIEAHLGIPIEETEVDFNVDHVLSESEKAQTTYYCKYDVDATEILF
FT                   KLRQGYLDNKVAVGRKRGLTDRQAMYMTNAKLTSVYLQAQKPEKPWTDERDYQYPDKLL
FT                   RQYIPQEVFDFFDKLHDPNIPNYLLFGGYDEQGVKHKGAALDFSIGECKCTIAYGGIHG
FT                   AIPTYVEEATEGRSIRNKDVASYYPHLMTIPLSKGQKYGFCSRNIPSPQVYVDTLEERV
FT                   QAKKAGDKVTANALKLVLNTTYGTMLNGKDGVAFNDLYDPLMGRSVCITGQLLLLELSM
FT                   HLVSECPTLKIIQLNTDGIMVSFDNSDEAKWQEITQEWQDRTGFELEEDFIQKIVQRDV
FT                   NNYVEVPVGDGKPKVKGGALVRGILTNANIDFTKMGLPAWENMSGGAWNINNNAVIVAR
FT                   AIQDYFVKGVDPEKTIMASKNILDFQVIAKVGGKYSGCYQMVGEDKVPVQKVNRVYATA
FT                   DRRYGTIYKTHAVTGKDAKVPSLPVHCMVDNNNELAIDVVDRNWYLKLAQKNIREFLGV
FT                   KPPRKNTRRINSLKKKSLALFD"
FT   CDS             225768..225938
FT                   /transl_table=11
FT                   /locus_tag="CK3_02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40078"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQK3"
FT                   /protein_id="CBL40078.1"
FT                   /translation="MEEKKISKVEFDNAVKQAIHEQVNDPNIEGMGKLLIPMTGMLFAT
FT                   KVKEILFGKED"
FT   CDS             225943..226452
FT                   /transl_table=11
FT                   /locus_tag="CK3_02150"
FT                   /product="Protein of unknown function (DUF2829)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40079"
FT                   /db_xref="InterPro:IPR021361"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQK4"
FT                   /protein_id="CBL40079.1"
FT                   /translation="MKFSEAEKALKAGKKIKLPKWEKAYWYMNQDGELINHFEGGEELP
FT                   TIALFPRDMIWVTRDDWEIVHEDEPKNVNEPAGEMKKLRNFGWAIAALKKGKKVARKNW
FT                   NGKGMFLFLAHSMDITTDADLSCVKDLEGDLVSPSIVMKTADDRFCVGWLASQTDMLAD
FT                   DWYEVQ"
FT   CDS             226473..227222
FT                   /transl_table=11
FT                   /locus_tag="CK3_02160"
FT                   /product="ERF superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40080"
FT                   /db_xref="InterPro:IPR007499"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQK5"
FT                   /protein_id="CBL40080.1"
FT                   /translation="MANIYEAMNVRQKLAKARLYFLNQKVQKSGKNMHLEFKYFELEDI
FT                   VPPATRIFARVGLTTEIDFTDEGAVMKVYNVDNIEEAPMQFRVPYREVKPIVSNAGKEV
FT                   TNPMQALGSSITYLRRYLWMAVLDITEPDDIDANLGSDDQAEDEEIPAPNPETAKKEKK
FT                   KKSAAPATPKEREEAKKEMTGTDGQADELQIKALKEACKTLMDKDSDQEEFVQQIAMKT
FT                   NGFTNVTRAACEQLIQNLGEMIAAYGE"
FT   CDS             227236..227475
FT                   /transl_table=11
FT                   /locus_tag="CK3_02170"
FT                   /product="Protein of unknwon function (DUF3310)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40081"
FT                   /db_xref="InterPro:IPR021739"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQK6"
FT                   /protein_id="CBL40081.1"
FT                   /translation="MADNVNHPAHYETGKFECIDVMVETQGVEATQNFCVCNALKYVYR
FT                   HKKKNGIEDLQKAIWYLNKAVELEEAKNDKTTNH"
FT   CDS             227453..228031
FT                   /transl_table=11
FT                   /locus_tag="CK3_02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40082"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQK7"
FT                   /protein_id="CBL40082.1"
FT                   /translation="MTKRQIIKWLESQSEKALAEVETQSEKALSTYYAERNEKIGLDST
FT                   ATAISALMQQAYSLTESFKEKVKAEYPGVDTLCGYYGSISYKLANMSSQSEIRSCLLKE
FT                   FEDGRTEIRKGIKARKNEMIKGITDNYRNVIANVSNMKNAKLAMEYLKSLGFDLSDLVK
FT                   ADENPVTTALSVEVDTRFLFIGGKKNEVE"
FT   CDS             228018..229070
FT                   /transl_table=11
FT                   /locus_tag="CK3_02190"
FT                   /product="YqaJ-like viral recombinase domain."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40083"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQK8"
FT                   /protein_id="CBL40083.1"
FT                   /translation="MKWNDDKTITITPPKRPKKITGTRFAAIMGLNKWTTPFNAWCAIT
FT                   RTYEEPFEDTIYTVAGKTIEPKQAEFMKKSYFMTNLITPMDVYGADYFQKTWGDFFKDS
FT                   PIFGGMWDYLLVDKDGKPTTVLEMKTTKRSEDWVEDVPEYYALQAALYAYLLGVDDVIM
FT                   VCSFLGDKDYENPDAYQCSTENTIVRPFKLSERYPELKKTVKKVEKWWKAHVEGGVSPK
FT                   FDEKADADILKVLRDNNLSPDTDIAALVAEAEQLKKHIDEVKGTVADDEKRYKTITDML
FT                   KKEAISQFKEGDKTVTISGASFDWVTSKTMKDPGYDMAKMQEDGIDIEKYHGTPEPQYR
FT                   FTPKARKESA"
FT   CDS             229067..229810
FT                   /transl_table=11
FT                   /locus_tag="CK3_02200"
FT                   /product="DNA-methyltransferase (dcm)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40084"
FT                   /db_xref="GOA:D7GQK9"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQK9"
FT                   /protein_id="CBL40084.1"
FT                   /translation="MIRYLSLFSGIGAFEKALDNLGIPYELLAYCEVDKYASKAYSLLH
FT                   HVPESMNLGDITKVDEKALPTDIDLLTYGFPCQDISIAGNKRGFVNEDGTKTRSGLFFD
FT                   ALRIIEHCKPKVAIAENVKNLTSKSMGSIFTIVLESLDNAGYNCYWQVLNSADYGVPQG
FT                   RERVFIVSIRKDVDDHSFRFPPVIPLEMCMGDLLDEEVPAEFYLSEEKTQSVIRHDSNH
FT                   PGHIADRGGGRVQPYCQGTIKTRRW"
FT   CDS             229818..229940
FT                   /transl_table=11
FT                   /locus_tag="CK3_02210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40085"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQL0"
FT                   /protein_id="CBL40085.1"
FT                   /translation="MKIIQAADLNHYGNDQMNRIYSPEGLAPTLKTVSGGGDVR"
FT   CDS             230203..230532
FT                   /transl_table=11
FT                   /locus_tag="CK3_02230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40086"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQL1"
FT                   /protein_id="CBL40086.1"
FT                   /translation="MAKIGLSEGFTLIPKGTHVFKIVEVKYKEDFGKMEIVMQLASGQK
FT                   HTERFSLLNADGEPNQGGLNAFSYFAKTALNDYTLTEIDHEELVGHYIRCEVDHEEVES
FT                   NKNSG"
FT   CDS             230535..230702
FT                   /transl_table=11
FT                   /locus_tag="CK3_02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40087"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQL2"
FT                   /protein_id="CBL40087.1"
FT                   /translation="MLKFVRLGDKEPADGFDEAEAHAPKKESKPAATAPAAAPAEKASG
FT                   KKFDLDSILG"
FT   CDS             230790..231329
FT                   /transl_table=11
FT                   /locus_tag="CK3_02250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQL3"
FT                   /protein_id="CBL40088.1"
FT                   /translation="MSERDKRVKAFEKLMRGGLSSTDVFCLKTQLMAMGFFTAPASTKY
FT                   HGNYEGGLFDHSFTVTSSLLSLTKRIGLNWKRKASPYIVGMLHDLCKCDSYIHNLDGTY
FT                   SYNPDILLPGHGDKSVILAQKIVDLTDEEMACIRWHMGAFDDKENWDKYGKSIEKYPNV
FT                   LWTHTADMMAARIFKI"
FT   CDS             231343..231534
FT                   /transl_table=11
FT                   /locus_tag="CK3_02260"
FT                   /product="Transmembrane Fragile-X-F protein."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40089"
FT                   /db_xref="GOA:D7GQL4"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQL4"
FT                   /protein_id="CBL40089.1"
FT                   /translation="MGFTEILTIIFIVLKLLGVITWAWWVCLLPEIIAGVLYVIVVIAQ
FT                   LVAIHKAHKSIKKHFDEF"
FT   CDS             231548..231667
FT                   /transl_table=11
FT                   /locus_tag="CK3_02270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40090"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQL5"
FT                   /protein_id="CBL40090.1"
FT                   /translation="MIVAIGVACFLAGLIVGIGGIAAIAIKAAGDEQKAQEEK"
FT   CDS             231670..232005
FT                   /transl_table=11
FT                   /locus_tag="CK3_02280"
FT                   /product="MazG nucleotide pyrophosphohydrolase domain."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40091"
FT                   /db_xref="GOA:D7GQL6"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011379"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQL6"
FT                   /protein_id="CBL40091.1"
FT                   /translation="MTGKEYQALAIRTCSIPYDCKADRLYHAVFGLNSEAGEVAGILQK
FT                   KYQGHEVNLEHMEKELGDCLWMIAEACDALGTDIDTVMQMNIDKLKARYPEGFTVENSL
FT                   HRKVGDI"
FT   CDS             232005..232514
FT                   /transl_table=11
FT                   /locus_tag="CK3_02290"
FT                   /product="ribonucleoside-triphosphate reductase class III
FT                   activase subunit"
FT                   /EC_number="1.97.1.4"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40092"
FT                   /db_xref="GOA:D7GQL7"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQL7"
FT                   /protein_id="CBL40092.1"
FT                   /translation="MNFHNITHDDMNNGDGLRVVLWVAGCEHHCKNCQNPITWDFTDGI
FT                   EFDKAAFHEICTELSKPYISGLTLSGGDPLHPVNRCQILWLVKKVKQFFPHKTIWLYTG
FT                   YTWEEINADNFYCRAILDYIDVLVDGRFEEDLKDVGYHWAGSTNQRVINVPQSLKEGRV
FT                   ILHERN"
FT   CDS             232501..234627
FT                   /transl_table=11
FT                   /locus_tag="CK3_02300"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40093"
FT                   /db_xref="GOA:D7GQL8"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQL8"
FT                   /protein_id="CBL40093.1"
FT                   /translation="MNVIKKDGTIEQFDGQKIVNAVSKSAARAMIELDDTQYHEIVSKV
FT                   MAIVTERFPEQVHVADMHNIVEQVLDEVNPKIAKSYRDYRNFKKDFVHIMDEVYQKSQS
FT                   IRFLGDKENANTDSTLVATKRCLIFNELNKRLYRKFFMTNDELQACKDGYIYIHDQSAR
FT                   LDTMNCCLCDISSIMSGGFEMGNVWYNEPKTLDTAFDVLGDIILATASQQYGGFTVPEV
FT                   DRILAPYAEKSYKKYCAEYMEIRNQQTFTQDVKDWAMSKVQRDYEQGFQGIEMKLNTVG
FT                   SSRGDYPFITMTFGLATDVFGKMASKTFLKVHMEGEGKPGFKKPVLFPKLVFLYDENLH
FT                   GEGGFNEDVFEAGIDCSSKTMYPDWLSLTGDGYVAEMYKKYGRVISPMGCRAFLSPWFE
FT                   RGGMKPADADDKPVFVGRFNIGAVSLHLPMILAKARAESRDFYEVLDYYLEMIRGVHKR
FT                   TYEYLGEMKASTNPIMYCEGGVYGGRLKPSEKIKPLLKPMTASFGITALNELQRLYNGK
FT                   SIAEDGEFALEVMQHINQKVTEFKNEDGWLYAIYGTPAESLCGLQIEQFRKKYGIIENV
FT                   SDRPYVSNSFHCHVTEDLTPIEKQDLEGRFWNMFNGGKIQYVRYPISYNREAVKTLVRR
FT                   AMQLGFYEGVNLSLAYCDDCGHQELEMDVCPVCGSTNLTKIDRMNGYLSYSRVHGDTRL
FT                   NAAKMAEIAERRSM"
FT   CDS             235735..236523
FT                   /transl_table=11
FT                   /locus_tag="CK3_02330"
FT                   /product="Primase C terminal 1 (PriCT-1)./Bifunctional DNA
FT                   primase/polymerase, N-terminal."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40094"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQL9"
FT                   /protein_id="CBL40094.1"
FT                   /translation="MKDYSKIPEELKNMNQWVCAWDNSKIPMKAFEKKAASSTAPDTWS
FT                   SFEQAEWAVENGYYDNLGFVFADNGLVGIDIDAGFEDGLMTPLCADIMTACKSYTEKSR
FT                   SGRGVHILLRGTLPFHGKNNLAGVEIYKARRFFIMTGKQLIFPTIIENQEAIDYVVEKY
FT                   FKEVEKENGGKSALVQKIYAPKFNKPEGGKIPVRPDYPPIASGGRNLSLTSLAGAMHNT
FT                   GYTPTQIYAELKFVNMTQCKPPLDDRELQTITESVTRYRR"
FT   CDS             236678..236752
FT                   /transl_table=11
FT                   /locus_tag="CK3_02340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40095"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQM0"
FT                   /protein_id="CBL40095.1"
FT                   /translation="MTTIIAMNAEDTVMTTIWMRMESG"
FT   CDS             236801..236956
FT                   /transl_table=11
FT                   /locus_tag="CK3_02350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40096"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQM1"
FT                   /protein_id="CBL40096.1"
FT                   /translation="MNGEKDTCATCSHFIGGGDWNLCCDLKYDLCYSCTPKCDKYKERK
FT                   EERHNE"
FT   CDS             236949..237380
FT                   /transl_table=11
FT                   /locus_tag="CK3_02360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40097"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQM2"
FT                   /protein_id="CBL40097.1"
FT                   /translation="MNNILSIQWSSGHMAIYMPAFFPCTAGKLNKLKKYIAMDVEHAEA
FT                   LLKQMQAFFQERIPECEEVFQREGKAYWNYQDKAADYEHQLADGKTPVGLPLTKEQKKD
FT                   WKKYAKDCAASARACKRTALQAKKQKEWFEAHLEGGTEE"
FT   CDS             238980..239135
FT                   /transl_table=11
FT                   /locus_tag="CK3_02380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40098"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQM3"
FT                   /protein_id="CBL40098.1"
FT                   /translation="MESYVERWKREQEEAKQKEVQKDNGRRAEETQSKREGQKAQKNRR
FT                   VSEEQS"
FT   CDS             239170..239712
FT                   /transl_table=11
FT                   /locus_tag="CK3_02390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40099"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQM4"
FT                   /protein_id="CBL40099.1"
FT                   /translation="MQAQKVEMPEGYNAKVTAFMMEIMPKEPLDLQDVAEMERRFLNYV
FT                   QKCSEWDMKVGNQAAYMAIGITKEQAWEWENVVKGNPARSDFIKKVRQFCGVFREGLMQ
FT                   DGKVNPVTGIFWQKNYDGMKDQTEMVLTPNNPLGEQKDMKALEQKYLESAYDGSEVAEG
FT                   TFTEITESPEGTEGQKD"
FT   CDS             complement(240857..241234)
FT                   /transl_table=11
FT                   /locus_tag="CK3_02410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40100"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQM5"
FT                   /protein_id="CBL40100.1"
FT                   /translation="MRKYIFTEKSHTFKRINKKTARTAYKNGLTVIICPCNLRPFTPWH
FT                   NEHRLNRKDRAQFVIDEIGVINDFNNLVNSFEYYNCINSETGKYSAFYIPVCTVDRFTG
FT                   EAPTPATLGTVEQYDYSYMQQ"
FT   CDS             complement(241379..241765)
FT                   /transl_table=11
FT                   /locus_tag="CK3_02420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40101"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQM6"
FT                   /protein_id="CBL40101.1"
FT                   /translation="MYDYLEQVTADVRDYVEQEINLTEWAGDRDGLEEKLNDDLWTCDS
FT                   VTGNASGSYYCNAWKAEEALAHNWDLLAEALEELGQDGTDVLKEGAEAMDVTIRCYLLG
FT                   QAIAAVLDDLEENGAFEEEEEEEN"
FT   CDS             242104..242355
FT                   /transl_table=11
FT                   /locus_tag="CK3_02430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40102"
FT                   /db_xref="GOA:D7GQM7"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQM7"
FT                   /protein_id="CBL40102.1"
FT                   /translation="MTSKELIKTLMTEHDITNAEMAKTLGITQAALWDRLNPKKSDNTT
FT                   VAKLGDMLSVMGYKIMVVPDETPIPEGGYEVGQTDMVG"
FT   CDS             242679..244346
FT                   /transl_table=11
FT                   /locus_tag="CK3_02440"
FT                   /product="phage uncharacterized protein (putative large
FT                   terminase), C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40103"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQM8"
FT                   /protein_id="CBL40103.1"
FT                   /translation="MDYSKMKSSIDRAILKSPLDVAAYDDKFALCRDYEGAEFRLAHEW
FT                   NQALQEEIRAGLKLAVDTRDFKTAEEFDNLLFRSLLFCAPHYFDAYLQAVEYGKPLDKK
FT                   FYLPRRHYLRRYVEGYQEVLEGKLDFLSISMPKRCGKSQLGINFTNMLSGKFPDRSTLM
FT                   EGTGDDLVQSFYKGCLEYIQQPNDYHFYDIFPESKLVQTNADTKVINLLHKSRFPTVMC
FT                   RSIDARQVGLSEATNLLYLDDCVEGREEAKNRQRLDDKWEVISGDIIGRAIEGTPIVIC
FT                   GTRYSLYDPIGHLQEEMRKQGKRCKIIETPALDPVTDESNFEYIREGRKVFTTQYFRDQ
FT                   REMLSAEQFESEFQQQPFEAKGILFPEASLNRYFELPVDREPDSIIAVCDTADKGADYC
FT                   SMPIAAVYGDEVYIVDVVFDDSPPEVTKPECAKALMDNLVVAGTFESNNAGTYFARDVQ
FT                   QILTDRKYVCNIRTKRTISNKQTRIEFASDNIIKHFYFKDPSLYARNSQYAMFMKQVTT
FT                   YTRSGKVPHDDAPDSLSLLENELRGLVGAKVEVFKRPC"
FT   CDS             246144..246650
FT                   /transl_table=11
FT                   /locus_tag="CK3_02460"
FT                   /product="Phage Mu protein F like protein."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40104"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQM9"
FT                   /protein_id="CBL40104.1"
FT                   /translation="MTSKVAQIADDILSLLIRAYQQGITATADMLACDLTVDVDSMEEA
FT                   IYEVIDGKTFEDRIADHVIAGDLSGLQTLVESEYHRVFNAAEEDGAYEFQSTRGLGVSK
FT                   KWVTVRDEAVRDTHKYLEGVSVALDEEFYTFDGDHASRPGEFTKAENNVNCRCVLKLET
FT                   DTSQD"
FT   CDS             246756..247346
FT                   /transl_table=11
FT                   /locus_tag="CK3_02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40105"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQN0"
FT                   /protein_id="CBL40105.1"
FT                   /translation="MSYLSDLLGDSYKEGMTEEEISTALQAAGAGQNNDAEINRLKAQL
FT                   SKANSEAADYKKQLRGKQTADEAAAAEQKATMDKLTQENTDLKRSIALADKKTKLVAMG
FT                   YDEKLADSTAIAMVDGDMDTVMKNQATFNESREKAIRAEQMKKTPRPAAGSDGTGGMDY
FT                   AKKIEEAQASGDLTAVAYYTRLKAQDEANQMKE"
FT   CDS             247366..248382
FT                   /transl_table=11
FT                   /locus_tag="CK3_02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40106"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQN1"
FT                   /protein_id="CBL40106.1"
FT                   /translation="MADTFATSFGVLNYSGMLFNKGNVRTPLSSIIGSKAKTTNHVEFV
FT                   TGQEYTSNGNGSQPAISESASLTAPDADVVTRSQKTNVTQIFQESVGISYGKQSNMGTL
FT                   SGINIAEQQANPMSELDFQVAAKIQKVNRDIEYTFINGEYNKATSDAEVNKTRGLVNAI
FT                   TTNTLAMAKKPLGLWDIADMVKKIYGANAPTDGLVLWCDAVTLFQVNADAVQNGLTVVP
FT                   AAREINGIALSSVVTPIGVVYLYLGECLPAGTAMLLNLDVLAPVYQPVPGKGNFFLEPL
FT                   AKTGAGEKYQLFGQIGLDHGPEWYHGKFTGISTTFEKPTYSRSVYVANAADIGKATG"
FT   CDS             248408..248719
FT                   /transl_table=11
FT                   /locus_tag="CK3_02490"
FT                   /product="Phage QLRG family, putative DNA packaging."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40107"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQN2"
FT                   /protein_id="CBL40107.1"
FT                   /translation="MTNEEKLTMLKSMTEETDNEVLSTYLTLAKGVVLSRAYPYSEEDT
FT                   VPAKYDTVHVEIAAYMLNKRGAEGETAHSENGVSRSYEDGDIPPTLLRRILPMAGVII"
FT   CDS             248716..249090
FT                   /transl_table=11
FT                   /locus_tag="CK3_02500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40108"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQN3"
FT                   /protein_id="CBL40108.1"
FT                   /translation="MKLMKRNLKPVHYCLYKGREPLLDDDGNETGEYQVGYESPVELQC
FT                   SVSPATGYAQVNMFGNLESYDKVLITDDTNCPIDENTLLFVDKEPEFGNDGNPLCDYRV
FT                   RRVAKSLNSISYAISKVTVS"
FT   CDS             249614..250015
FT                   /transl_table=11
FT                   /locus_tag="CK3_02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40109"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQN4"
FT                   /protein_id="CBL40109.1"
FT                   /translation="MIDCENEVYTRLAKILREKFPKIDIASEYVKSPSSFPHVSITQSD
FT                   CYIPTEWQDSSMKENMVIAMFEINVYSNKAEGKKTECKKIIKEINDALYSMNFRRTAMT
FT                   PVPNMEDATIYRITARFRVATDGKHFYRR"
FT   CDS             250021..250446
FT                   /transl_table=11
FT                   /locus_tag="CK3_02530"
FT                   /product="Phage tail protein."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40110"
FT                   /db_xref="InterPro:IPR014918"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQN5"
FT                   /protein_id="CBL40110.1"
FT                   /translation="MATSTYMTFLMHKKETAWEKLLDITEFPDLGGDPELLETTTLSDK
FT                   MQTYVNGVQSNDGMTFNANYDHTEYKALKALEGKNEEYAVWFGGTETASSPTPTGSEGK
FT                   FKFAGELSVYVTGGGVNEVRGMAITIAPSTPITEDEE"
FT   CDS             250486..250818
FT                   /transl_table=11
FT                   /locus_tag="CK3_02540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40111"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQN6"
FT                   /protein_id="CBL40111.1"
FT                   /translation="MAKQIVFTYEDKEYTLEFTRRTVKQMEDEGFVAQDIDRKPMTLLP
FT                   ALFAGAFKAHHRFEKQDVIDKIYAGMPHKDELIGKLAEMYNDPIVTLMEEPDEKAVKNV
FT                   SWEANW"
FT   CDS             250929..251258
FT                   /transl_table=11
FT                   /locus_tag="CK3_02550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40112"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQN7"
FT                   /protein_id="CBL40112.1"
FT                   /translation="MDYHDYWDADCEMARYYRDMDEKVKERQNEALWLQGLYFYEALVD
FT                   ASPVLNAMSKKHKPIPYRQAPIPLTEARHRQQQEEENHKKLNAGKEAMKQIMAGVNSKF
FT                   KRKEE"
FT   CDS             251262..254714
FT                   /transl_table=11
FT                   /locus_tag="CK3_02560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40113"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQN8"
FT                   /protein_id="CBL40113.1"
FT                   /translation="MAVEIEGLEFQIEAKSENAAKGVDALINSFNKLKAATKGGAGLNN
FT                   ISKKLDAISNAKLSMSGIEKIEDLTKSLNSLSNVKISSTISKRITEIGASLDGLNLSGV
FT                   EKVEALSTALQNMQGIQIPNMRNLTGNQTAAPTGTAAPVDPAGATNAGAVATAATSGIT
FT                   KYTSQIIAATTQTRGFLGVLQGVGGVFSRAFSAVGGVALKAFQAALKGVSTAAKSAVNA
FT                   CKKLGSTIGSKLSSKVKQTTSGMGQLFSSLKRIAMYRAIRFFFAQLTAAMKEGIQNLYM
FT                   YSSLMGGTFKGSMDSLATSFQYLKNSMGAMVAPLINMIAPAVDALIDKFAALLNIVNQF
FT                   FARLSGATTFTKAKKAAASYGDSISGAGKSAKKAAKDIKDATVGIDELNIISQKDSSGS
FT                   GSGSKNYGDMFETVPIDSSISEFTDKLKAALDAGDWKTLGTLLGEKFNEIVDSIDWSGI
FT                   GHKIGYGLNGAIQTAYWFLKTADFKNLGNHIAELLNGAMEEIDFTYLGRLLVRGVTVAL
FT                   DFMIGLLGGLNWSLVGKSIGDFFKGAFNEAQEWIASYNWNKMGKDLWKNLKACIKGIDF
FT                   AGVAQSFFKLLGSALAAAVSFIAGFVQGIWEDITGYFQEYLTNDDGTKKCGLDWVAGLL
FT                   EGIWDGIKNIGKWIKENVFDPFIDGFKECFGIHSPSTVMKEMGGYVVEGFLQGLNKFSE
FT                   IAGKVKKWAGKVIEWFTKGEDGKGIVEHFKEIGGNIVSGFKDKVGGTYTTVKSNVTTWA
FT                   SKVKDWFSNNSFGGVNSDTFSTFANNTIEGFRTKVGSAYTNTKTNVTTWASKVKEWFTN
FT                   SSFGGVNSTNFQTFAGNVIEGFRTKVGSAYTTTKSNMVTWATNVKEWFTNSGFGGVNSA
FT                   NFQTFANNVVTGFKDKIGSAYVNTKSNMTTWATNVKNWFSGIASASAFSGFATSVVDGF
FT                   KNRIGGYYTAAQGNMSTFGSRVKSWFTAHCSYNGFYNVASDVVSGFKNGIGELYHTCKS
FT                   TISSWGSSIISWFKDKLDVNSPSKVFYEIGGFAVAGFNNAIAQVGKSTKSVVGTWADSF
FT                   TNFSPTMALAVDTSALKYYDSAAFSRSISSNVQSSTEVSATGFREAMEDFYHEYVEPTM
FT                   VQMADDMRRQADKEEKTVVQVGNRVVTDAVTTQKKANGYSFTG"
FT   CDS             254729..255100
FT                   /transl_table=11
FT                   /locus_tag="CK3_02570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40114"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQN9"
FT                   /protein_id="CBL40114.1"
FT                   /translation="MAYLAINGYALPPCKRGVTPTVTTLVDSGRNANGTVVGQRIGRDQ
FT                   YKIDNLEWSWLTAEQWSKILSILDNFFVNVTFIDPVSNAPKTIKMYCGNRTAEPYWVDE
FT                   DGHPTHYRNCKVNLIDVGE"
FT   CDS             255105..257327
FT                   /transl_table=11
FT                   /locus_tag="CK3_02580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40115"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQP0"
FT                   /protein_id="CBL40115.1"
FT                   /translation="MQKVSKEYKASMKDSLRERAYIMISFGVVNQEAQAKAKVDSGEFA
FT                   YFSNPDNLFNEGTDDVVYATLEENFTRVDGSMYFLPRNKPGAMFYNTGLVGKNLVSDGL
FT                   YEVTINLHAAPTDFRGITINFGENYPTDFDFVTNTGQKVEFRDNDKAVFTTEEVLENVT
FT                   TLTLVIHKMKNFRSRLRIYSFRFGYGLVYYNDSVMSSSLESYVSPIGADIPQIDFSVTL
FT                   KNYDKYFNVDNPKSAINFLETGQEMDIYYGYQLPNSDEIEWVRGNHLLCSEWESDDYTA
FT                   TIRCQDVFRNMDTEYYKGLYAPNGKSYYDLAIEVLKAAGEKDYYVDPRLKKLYTKNPIP
FT                   RVSCKEALQIIANACRCVLSQSRVGTIQIKSSFVPEAAASSNGETDYSHVAKILTDDTK
FT                   DEYATLASNYTTADGTMFFLPRAASKRTLNTGFISEQQSDADGKFTTNPMVTIVQEAAC
FT                   MYYGVKFVFGNALPSGMVIRTYNNNELVTEYEVEEEITKTLVILRDFDDFDTMKIEFTG
FT                   TAEPYNRIVLNNFAFGDVTDFTMERQDMTSSPKAIKQELVKEVIVPCYSYQPGNAEESL
FT                   VSEDITVKSGDVETFYVGEPSYNFRATLDESASGVSITAWGNYYVTVKFSKTGTFRLEI
FT                   LGYRYKIVERYATKSLNSRGKSVKWANPLISDMAIATELAEWIGDYYTAGIEYEYDTRG
FT                   NPEIDANDIVYQENEFHDGMKVNIYRHTINFDQAFSGKVTARRVSS"
FT   CDS             257341..257772
FT                   /transl_table=11
FT                   /locus_tag="CK3_02590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40116"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQP1"
FT                   /protein_id="CBL40116.1"
FT                   /translation="MAWRTPKTDWHGSTNSEGVYTGDRFNASDFNRIKNNLTFLRDMAI
FT                   KLYKEFSLVSLGDDRVPGDYFYADEINQLEENLETLNANTLRMSYGSAPVYNDNGTTMD
FT                   FNELNRLEGATLDLYDRLTNESEGRRMFTWNFGMKGGDL"
FT   CDS             257773..258366
FT                   /transl_table=11
FT                   /locus_tag="CK3_02600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40117"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQP2"
FT                   /protein_id="CBL40117.1"
FT                   /translation="MAWKLLPVDYTDAVWAGLKRYNQINNEDGSVSFQDITAYTGKDKS
FT                   FFGAKDANRMNEALNTIMSMVENGTDLYTAFQNYFAEQKTLFEQEADSKATEFDNYTDN
FT                   LEQEYKASMAAFESQQQQIYNAWFQAMKDQLSKDAAGNLQNQCTELDERLTLLEQMTMQ
FT                   NDFSAPLATDDEAITLIVDDLDYAILADWKYKEE"
FT   CDS             258370..259233
FT                   /transl_table=11
FT                   /locus_tag="CK3_02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40118"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQP3"
FT                   /protein_id="CBL40118.1"
FT                   /translation="MATISVQTKKFADLEAILSVTGTEQMLIHDGNGVKVITVENLHKG
FT                   LQTDIDSVRNVLADGAAAHNCIYRGKNLGTSVTAEQYAAISSGKFTDLYIGDYWVINGV
FT                   TYRIAAFDYYYNCGDTNFTKHHVVIVPDTSLYKAQMNTSNVTTGGYTGSAMYKSNLAQA
FT                   KTTIKAAFGSAHVLTKRELLTNAVNGNTPSGWAWFDSDVELMNEVQVYGSVAWGAHDGN
FT                   GYNVASGDGQFPLFMFDRTKLHNREDYWLRDVSSATLFSFVSISGYATYYNASYSSGVR
FT                   PAFCIG"
FT   CDS             259283..259918
FT                   /transl_table=11
FT                   /locus_tag="CK3_02620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40119"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQP4"
FT                   /protein_id="CBL40119.1"
FT                   /translation="MSVLKSKRKPSQFEVFHHLNKVRKEVTDLLLRDFGYSKRKAAQRL
FT                   EKKFSGRSYEELTDVEKEIYDHFRKQQEAFDTWFIEDERKAVVDCLRSIGEHVYTANSI
FT                   YPTYYEELVERRVHQDMAIGQCYRLVQELQYAIETLPVDVNSFLRFGEDIQREIDLIKG
FT                   WRKSDNKFKGAISASATNFSNVNNNGNANNNNASNSNGVRPDFDTPIK"
FT   CDS             259965..261167
FT                   /transl_table=11
FT                   /locus_tag="CK3_02630"
FT                   /product="Reverse transcriptase (RNA-dependent DNA
FT                   polymerase)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40120"
FT                   /db_xref="GOA:D7GQP5"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQP5"
FT                   /protein_id="CBL40120.1"
FT                   /translation="MMVNTKHDTTSYENCSCQREIYDGNALYDAYLRAKSGSDWKPQVQ
FT                   RYEMAYLLDLSKMQRELKEHTYEFQPCSSFPLNERGKTRFITGEQIRDRIAKHSLCDEV
FT                   LTPAIKDHLIYDNGASQKGKGIDFTRRRLEAHLHKFFRENQSNDGYILLMDFSKYYDNI
FT                   RHDKLMELFEKYVDDDTALWFLEKIVDNEKVDVSYMNDEEYESAMDDVFNSLEHEKVDK
FT                   NLLTGKKFLRKHLNIGDQVAQDAGIAYPIPIDNYIKIVKSVKFYGRYMDDSYVIHKDKE
FT                   FLKGLLIEIVEIAHGLGITVNLRKTRICKLSEMWRFLQIQYSLTDTGRVIHKIHPKRLT
FT                   GMRRKAKKLALILSEKDFDDWFRSWFNGHCHYMSKLQRSNMLDLCKKLKEEHYYGKTDF
FT                   S"
FT   CDS             261451..261600
FT                   /transl_table=11
FT                   /locus_tag="CK3_02650"
FT                   /product="Phage uncharacterised protein (Phage_XkdX)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40121"
FT                   /db_xref="InterPro:IPR010022"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQP6"
FT                   /protein_id="CBL40121.1"
FT                   /translation="MEHSKNFKKVKEFYKNGIWSKKMAWNAVGKWITPEEYKEITGEDY
FT                   NKEG"
FT   CDS             261605..262033
FT                   /transl_table=11
FT                   /locus_tag="CK3_02660"
FT                   /product="toxin secretion/phage lysis holin"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40122"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQP7"
FT                   /protein_id="CBL40122.1"
FT                   /translation="MKEWICTAIGVAGSFIASLFGGWDAALATLVIFMAIDYITGLIVA
FT                   GVFHNSGKTENGALESRAGWKGLCRKGVSLLVVLVACRLDLITGTNFIRDAVVIAFVAN
FT                   ETISIVENAGLMGINIPPAITAAIEVLKKKSDTDSGAN"
FT   CDS             262081..263493
FT                   /transl_table=11
FT                   /locus_tag="CK3_02670"
FT                   /product="Muramidase (flagellum-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40123"
FT                   /db_xref="GOA:D7GQP8"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQP8"
FT                   /protein_id="CBL40123.1"
FT                   /translation="MTTQEFIDSIAGYIKKYAAAYNVCVFSPIIAQAILESNKGTSELA
FT                   VNAHNYFGLKYRKGRCKTCVGVYHKVGSEQNPDGTYTSSAMEWCKFGSMEDGVIGYFDF
FT                   TNISAYSNLKGVTDPRQYLENIKADGYATSMKYVDNLMAVIERYDLTRYDKEEMKMSNS
FT                   SLVSYTKISPNKNSPRNHAIDRITPHCVVGQLSAESICGCFTSPSRQASCNYGIGYDGR
FT                   ISLCVEEKDRSWCSSSPANDHRAVTIECASDKTHPYAMTNAVYASLINLCVDICKRNGK
FT                   KKLLWFGDKNKTLAYNPKSDEMVLTVHRWFANKSCPGDWLYSRMSDLAAKVTARLGGST
FT                   AEEKPASTTTLYRVRKTWADSASQKGAFYSLANAKACADKNHGYKVFDGSGNAVYPAES
FT                   KPAFSPYRVKVTASVLNIRKGAGTNYALAGSIRNGGVYTIVQESTGQGATKWGKLKSGA
FT                   GWISLDYTTKVS"
FT   CDS             263916..265766
FT                   /transl_table=11
FT                   /locus_tag="CK3_02690"
FT                   /product="ATPases of the AAA+ class"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40124"
FT                   /db_xref="GOA:D7GQP9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQP9"
FT                   /protein_id="CBL40124.1"
FT                   /translation="MTDLERRIGLVRERCSLTAFGAFALELLLLAEWDPDLNGTNGIYP
FT                   DELFQAWEKNGPNAEDGGKTDRAELDKEIRTIAGRNVEAASGRIIYRIREQVLRFIEQE
FT                   FPPDPDEFFLEIFSNFEKAEEPDPERSVYRDMIRVEQKKKEHSDGWILLNLAGKDGSGR
FT                   LENVKAFCREKKMGLILLDGSSLLELGREKFRNMFRELGVNALLKERVIAVTWEDTLGE
FT                   RELFRALREMGHEWDRLPVLVIIITETPLRPVIPGSAQVPAVFEIREPDPFARKDMGMR
FT                   YAKKWQIPFEDGFGEMWQRFRFTPGQFQNVLEQAKDMAFARNAEIPSREELRIACRRQA
FT                   EYRFHGKAVLIRPQFVWEDLVLPEASKKLLQDICSRSRNQELVYGTWEFSSRFPYGLGT
FT                   SILFTGSPGTGKTMAAQVMANELDLELYRINLSAVVSKYVGETEKNLNMIFEEASKSLC
FT                   ILFFDEADALFGKRTEVKDSQDKYQNMEAAFLLQKMEDYDGISILATNYQQNLDEAFKR
FT                   RIQYVVEFSIPDAGERLEMWNRVFPEACPVREDVDLQFLADQFELTGSNIKNIAVNSAF
FT                   LAAADGREIDMSHILRALQNEFQKSGKRLTGAEMGQYGMV"
FT   CDS             265789..266589
FT                   /transl_table=11
FT                   /locus_tag="CK3_02700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40125"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQQ0"
FT                   /protein_id="CBL40125.1"
FT                   /translation="MEYDYREYRKDSQAVLREKNSRREKMDHFLSSEGRKKEGREPEKK
FT                   LEIGNSYGTFEIGFSKAAAKKNREDVQKAPEKLAVISGLRKDRRKELRDYEYVRENGAV
FT                   PLPFLQKRAFVNPHVKEKSAAALKLDQEKTGSRLTESLSAMRNQGKLETVQEMLPFLDS
FT                   EREKEERAQLLEEQRTVGKLSTVKNQYLDQLKENELHKQREKERFIQSVDKILKNRSEE
FT                   LRAEKRVHNGSLEEYLKKVWKNVLTKDAEKDGDIENNGEKEEFV"
FT   CDS             266672..268411
FT                   /transl_table=11
FT                   /locus_tag="CK3_02710"
FT                   /product="Phage tail sheath protein FI"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40126"
FT                   /db_xref="InterPro:IPR007067"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQQ1"
FT                   /protein_id="CBL40126.1"
FT                   /translation="MAEYLSPGVYVEEFDSGSKPMEGVGTSTAGFIGLAERGPVEGLPQ
FT                   LVTNFSDFKRKYGGYLSENEFGEYRFLAYAVEHFFINGGARCFIARVAPEDAKCAAAAV
FT                   PSEDSAVLTLTAKNPGMWGNNIRAVIAPASKAKTQILEIVQNASGKKYVVKNGGGFNPG
FT                   DVVSFSDGEKLVYNRVVKNQDNILEFEKEFEEDVVDKNLVPKKVISTCEFTLEVRYEDQ
FT                   TEVYENVSFNIDAPNYIEKKTAKSDLITAACAAGGAEIKAPFDELSAEGDAVVSVSFAG
FT                   GSNGSVSSITAADFIGYDNGASRRSGIQAFLDNDVVSILAVPGVTDPNVQLTLVAHCEN
FT                   LGSRFAVLDMPRDARKVDDMIAHREIFDSSYAALYHPWLQVFDPLDKKNFAIPPSGSIM
FT                   GIYARSDNSRGVHKAPANEVVRACVGLDCQFNKGEQDILNPKGINLIRAFPGMGIRVWG
FT                   ARTVSSDPSWKYINVRRLFIFIEESIKANTNWAVFEPNDEVLWVRVKRTIDVFLTGMWR
FT                   GGSLAGSVPSEAFFVNIGRDTMSQDDIDNGRLVCVIGVAPVKPAEFVIFRISQKTSDSG
FT                   SAE"
FT   CDS             268431..268856
FT                   /transl_table=11
FT                   /locus_tag="CK3_02720"
FT                   /product="conserved hypothetical phage tail region protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40127"
FT                   /db_xref="GOA:D7GQQ2"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="InterPro:IPR011747"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQQ2"
FT                   /protein_id="CBL40127.1"
FT                   /translation="MAGYPHGKFNYKVEIDGLEAGGFSEVTGFDASIDVIEYREGDMTQ
FT                   TPLKIPGLKKYGNITLKQGLVDSMVLYEWMTAGLEGDVERKTLTITLLDIAGSPAASWQ
FT                   IINAWPVKYTAPDFNATSSEVAIESLEIAHEGMTRVS"
FT   CDS             268997..269368
FT                   /transl_table=11
FT                   /locus_tag="CK3_02730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40128"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQQ3"
FT                   /protein_id="CBL40128.1"
FT                   /translation="MTFQTEFTFTLPRGYIDDTGMIHREGTMRLANAADEILPLKDPRV
FT                   QQNPGYLTIILLARVITKLGSLPAVDTRTVEKLFTMDLAYLQDLYERINTMEMPTYTGI
FT                   CPHCGKEIRIPVNFMEAGQ"
FT   CDS             269620..270099
FT                   /transl_table=11
FT                   /locus_tag="CK3_02750"
FT                   /product="T4-like virus tail tube protein gp19."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40129"
FT                   /db_xref="GOA:D7GQQ4"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQQ4"
FT                   /protein_id="CBL40129.1"
FT                   /translation="MLGHGLGSWADLCDNFSFRVFIDNQEFGFSRVMNLEQDQEVEEFQ
FT                   VGGMNFAPHIAVTPNKKGGRLILEKGKCFSSGQKQIKNWRAGYRINSLIDVFIYDRSGS
FT                   FAGSYGINGGVIVKWEVSGLDGLGNELLIQKFEIAHAGVQMGDARTGGTGASFRG"
FT   CDS             273786..274421
FT                   /transl_table=11
FT                   /locus_tag="CK3_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40130"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQQ5"
FT                   /protein_id="CBL40130.1"
FT                   /translation="MGYEKAVLIPEDGKKEIKVQFNPAEYNLSRSTTYAEKKVLGLDDP
FT                   FTQYIAGEAETLKITLMFDTYMPPGEKNAEESGSDVRLQTEKIAKLMELDPKKHRPPKV
FT                   TFRYGSLIFSGVITELNQTFTMFLANGMPVRAKLEVTFRSMGKENTHVPLESPDRTKCR
FT                   TLYEGQSLWGLAYEEYGDPEKWKEIARENHITNPLQVKPGQVLRLPAL"
FT   CDS             274468..275556
FT                   /transl_table=11
FT                   /locus_tag="CK3_02780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40131"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQQ6"
FT                   /protein_id="CBL40131.1"
FT                   /translation="MADLMTGTYSTENLRRDNGGFMIPDFSIEADGKQIRRSSKSGTLF
FT                   IDSVQLKLSADASGSLTFDVLNAYDLEARKFSDKVKEMLKPGNAVSAKFGYAGNLVEIF
FT                   SGYIHSVNYEYNDTPTISVTAVDMIRLMQDNEGGGRIYTGKSYTEIFQAVMKRYSSICP
FT                   SKNIKADPPAAVGQTLQIAQKGSDYSFVKDTLCRLECREFFVLAGKAYFIDASRKKQSV
FT                   VSLEWGRDILSFSCERNYIYETLRVQMVDQNRQTKSLEKEMTFEGQHQKRVIPSPGIKN
FT                   VSIDSEGDAERAVLQVKKAVDEERQKAVHCSGTCIGIPQIVPGRSLTIRKLDAWIDGTY
FT                   EILSVEHRIDENGYTTQFELGG"
FT   CDS             275578..276363
FT                   /transl_table=11
FT                   /locus_tag="CK3_02790"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40132"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQQ7"
FT                   /protein_id="CBL40132.1"
FT                   /translation="MDLFKEILDTKTSSSSPRFRMQMADLATAVVKENWDKEHPGCVKV
FT                   EYILGADGAKTSDWIRVLHGYAGKGFGSYALPEIGSEVLVGFIMGDMENAVVLGCLHNS
FT                   ENPLPEKTANEKNTVKEIRTKGGYELTISEEKGKEKLSVKTPGEQILMIDDENQKIEVQ
FT                   DKQGKEKILIDGKTNSVSITGDKKIELASKSAKLLLDGGANKIELTASQISINGKQMAE
FT                   LKGQSLKLEGTSVELKAKGTMKAEASGIAQLKGAMVKIN"
FT   CDS             276382..276792
FT                   /transl_table=11
FT                   /locus_tag="CK3_02800"
FT                   /product="Phage baseplate assembly protein W"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40133"
FT                   /db_xref="GOA:D7GQQ8"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR015801"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQQ8"
FT                   /protein_id="CBL40133.1"
FT                   /translation="MEEREKRAFLGTGFHFPLEIDETTGRFRMSSEEENIRESIKLILM
FT                   TGKGERVMRPEFGCGLKQYTYETMDYGTMVQMEREIKTALERWEPRIEDVEASVSPGEA
FT                   QNALMIRIAFRVRATNNPYNYVFPFFLQEGFE"
FT   CDS             276819..279812
FT                   /transl_table=11
FT                   /locus_tag="CK3_02810"
FT                   /product="Baseplate J-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40134"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQQ9"
FT                   /protein_id="CBL40134.1"
FT                   /translation="MKIPDMNEKNTRAFLDKVRERASSYTPEWRMDLENPDGGTALALL
FT                   FAGMYEDTLKKYAQLPRKSMLDFFNCVGTALAPARPAGGYAVFGLVNQEADGTEIRRGT
FT                   GLLARPEEDQEEIIFETRNDVYVTPSRICDMVQVIPEKDGIYRIHREEDQKVPGNFPLF
FT                   EEYGENVQEHTLYLAHNHVFYVKRSGSIRLTFRKSRNREPDAAVLRALADPESASVEYS
FT                   AGERFEPFAKVEAEPETGELILHKGENQPVTEKCELDGTYAFWIRIRCRNVSLLSELEF
FT                   ADIRVTSQTERSVPDVTLAGGIEQRGEYLPFGEQMGLYEEVYFSSEQALSQKNAQITLS
FT                   FRMNFLRIPSETYGQDRKRDWKLIMKRTDFIPDPEYDIGIDEVIWEYYNGNDWRKLPES
FT                   DRYSKVFRAASDQLERKTEITFNCPGDLTPVLVGAVEGRYIRARILKMNNLYRWNGQYI
FT                   TPVLRDTGFEYRYHEPFPMPELIERLNNMRSDRIYPEDLFRAGKDLKPFVPLEEESETL
FT                   YIGFDQPLRQWPIRIFFKLRSGSQNGNLLRYEYYNGKTWKALNMIDGTEGFGRIGIVTL
FT                   LGNSDFMPGILWEKERFWIRIRKTGDERNTEASQRTMIQEIWMNATEITAEETMDQEVF
FT                   SIEANEKNAVFRLAAGNITKAEVWVQEHREYSEEQLAKLRQDYEIRTEKTEDGTVRHVW
FT                   IRWEERENFASSTETDCHYMLDKNEGILQFSDGIHGRIPDDCGEASIRVRYRCGGGKRG
FT                   NVPAGAVNRFRETTGFVNQVINPMDMSGGVDRENVETAIQRQGWAFRHRGRAVTAGDYE
FT                   ALAMESSGSILKAKCFPGQGRVNLVLLLREHNRELENFDLVKRECLQYMEDKIPASLLE
FT                   NRKFRILEPQFIHMAVKAEVRVRDMNQILETRQRILKALHLFLNPMEGNFQGNGWEIGV
FT                   VPNQIQILNGLRGVQGVEIVTSLRLVLQTEQNGRLVELDAEELEKFPYAVAVEGEHQID
FT                   ITTGGGAD"
FT   CDS             281667..282785
FT                   /transl_table=11
FT                   /locus_tag="CK3_02830"
FT                   /product="phage tail protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40135"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="InterPro:IPR011748"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQR0"
FT                   /protein_id="CBL40135.1"
FT                   /translation="MAEDRKYFIFNKPMDYRRGTVDRMNAADGILRLTGAEPGWFFSRV
FT                   LDSREEEMTWHRLRTVCAERDGGWNMTLYSSDSRFLVWGDNSAPVDEVLADPELSLEEK
FT                   KQRMSSCFAKEIRGEADVLLFDVRGRYLWFLLEAGGAAGDFDGITEIRIDFPKQSWVSW
FT                   LPEVYQGSGKNRDFLERYLGVFQSFYEELTEKIGRSPDLFDPDCAQADFLSWMAGWLSI
FT                   EDIPAWNEEQLRYLLKNALRLYRIRGTVEYLKEMLTLYRDCEVYVVEHYQMQESDPEKI
FT                   RRWKKLYGDSPYTVTVLIHTGQNGGQKEYRTFMQIVRHAVPAHIDCRIVLLTPYIFLDQ
FT                   HTYLGVNSRLGEYRPMQLDGLSAMHFSRIGQL"
FT   CDS             282804..284543
FT                   /transl_table=11
FT                   /locus_tag="CK3_02840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40136"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQR1"
FT                   /protein_id="CBL40136.1"
FT                   /translation="MKNMKYFPFERNKYFYGKLLTVDDFETEQRYMNDKRRVLNRFLYG
FT                   TGVVCGLNVVPIDDMTISVEPGLALDFSGREIVVDTPAVKKLSMIDGFDSFIRSGDEKK
FT                   YLYLCMDYKETEREPVHNVTGESGVEYNRYQEGYELTVTEREPSQTVLSDAVFYEHTSV
FT                   IYMGKGVKITQTCPSYASCGDIFELKILVENMGQGQSIRFSYDLGLTCLEYAGENHLTV
FT                   MFDEEKHQKEDRYEIIYRVKASSTKNAEGILELAKGSFHLAFGGREMEAAAAGKQAVKL
FT                   ISGKVSDEVRKNYYRSAMEDILRNNYQQSIYLAKIYVIRAGASYLIDAVEPMPFGQFVY
FT                   NNVLADVMGKIGRTEDALMVKDQADFGSSHGKQIEKSKSEEPAVTTGHVIFDLGLGGNT
FT                   GQRFFSGDISHELGLGNVTIILGSCTGVRDEDSVIYGSPEIFTDEVPFRAELAAKADAK
FT                   TGTFRIGLRLVEPTMNRYVRVNWTAIRDAKEKVHDVEETALLIRPDILYLKTRETFFLE
FT                   PEFRGIAPTPVTWSIREENGGTIEPNGKYTAPNVPGIFEVSAASTRYENLRASIYVVVR
FT                   DGE"
FT   CDS             284580..285476
FT                   /transl_table=11
FT                   /locus_tag="CK3_02850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40137"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQR2"
FT                   /protein_id="CBL40137.1"
FT                   /translation="MRIQTLNSDYEILRMAESGERLDVLIARDEKHPEKGKCMLVVLKQ
FT                   DADIHKFLPFLAAQQENAPYDDFLGYFPREGRLYIVFRFYDYMTLSERLSSDTGFEERV
FT                   MIAGNILRRIVILNLPTYLQYEVLGEGNILAGKNGDIRFSYGFHELDRFDSITDRDVIE
FT                   RLTGVLKKIFPEELEKHSCPPLEQFFERIEKEKFPGIAAVLREYDITARAALTLQEAGK
FT                   IRPKSFGFRLWEKIKKLVRGLKYLLLALVIGALVGYLVYTIRYPSKKAEEAMNYKAIGT
FT                   LTIGETAGQDAGGQTGE"
FT   CDS             285482..287524
FT                   /transl_table=11
FT                   /locus_tag="CK3_02860"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40138"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQR3"
FT                   /protein_id="CBL40138.1"
FT                   /translation="MRFINDFDWKKTMQYGWRRILRALVRPFAALRLKFRRLSNPNTLV
FT                   NTVVTDVQAEVKKAVSKKPESLEEYLPVGRYYAAKKLLLAILIAVILLPILYFKFVHPV
FT                   VTARFLWKTIPVNTAEQYGYTGKVKLTDPETGVILYRGPLADGRITGTGTLYDYAGNIL
FT                   YKGQFENEMYEGRGTLFYGNGNVKYTGEFSQNQYQGKGSLYFEDETLEYEGGFAAGKYS
FT                   GSGSLYDKDGTLIYEGSFEAGRYSGEGTLYGEKGMIIYEGSFVKGLYEGQGTLYRNGKK
FT                   VYVGAFAGGIPQGEGKAYGNSGRADSWGTYADGEFVAGQTVLYDENGKIQYRGEVSNGQ
FT                   YEGKGSLYADGELIYEGDFHESLYEGSGTLYEGTEVLYKGNFLGGIYEGKGELYQDGVL
FT                   LYEGEFHDGLYEGNGSLYEQEHMIYDGEWKAGKYDGEGKIYQDEKLLYEGTFAEGMKEG
FT                   EGTLYDPETESVVYEGSFLKDLYDGTGILYDPAAGAILYEGNFSKGIYDGDGRLYDPVT
FT                   QNLIYEGTFLRGKREGSGKEYDPETKALVYEGGFREDVHDGDGTEYDKNGAKTYEGRFQ
FT                   LGSYSGSGVLYDAATGKVLAEGEFRNGVLLTPKAELDAAKNPTEPETAAKEPETETAAA
FT                   ESESAPETAAEAGNTAKENETAAESTAAQIPGRTKRTGIGPGYED"
FT   CDS             287562..288137
FT                   /transl_table=11
FT                   /locus_tag="CK3_02870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40139"
FT                   /db_xref="InterPro:IPR025351"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQR4"
FT                   /protein_id="CBL40139.1"
FT                   /translation="MGRSTSIADVGMSIVKLLRRELVPDTLQNPDAVGLCSPTDRGDYM
FT                   VGIHLYDIRESEELRVNTMIARGTEELQYPPSYVNLYYMITVTSTGDIKFRSGEEHKIL
FT                   GRIIQILADHPCLDRETLEPKTVRKQLDVEISMQNLTLEDKMRIYSVPNAGYKLSLFYR
FT                   AAPVEIESTRSRRAARVMDVDFGLEEKQ"
FT   CDS             288134..288892
FT                   /transl_table=11
FT                   /locus_tag="CK3_02880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40140"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQR5"
FT                   /protein_id="CBL40140.1"
FT                   /translation="MNGRGEHVRHRVSLVLELWDDFTDRPISDPSIVITASGLIRPLRK
FT                   EDGFYVFVNCPMPVHVEIRSERYETEKFDAGMQDGKAVILKKRLRPGKNYPLPAGTTCV
FT                   TGCAEPGTVIEVAAEESSGLWRLFSDYHSEKLPESMEIFNPYEKQLEGRRFFILDKDEK
FT                   NGEFFEVKQQESRSGKIVLEKALKHSYKKAGTKIYECSMARADRDGNFTIPLKIRARDE
FT                   KKILCRIREGEKVRSVQIFTGQQNKWNPAE"
FT   CDS             288920..291073
FT                   /transl_table=11
FT                   /locus_tag="CK3_02890"
FT                   /product="ATPases of the AAA+ class"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40141"
FT                   /db_xref="GOA:D7GQR6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQR6"
FT                   /protein_id="CBL40141.1"
FT                   /translation="MGRETDQYMNADEYVQELLINVRSLAGEYLNWKKQSVFAGEGRIR
FT                   DTEVSREGILELSQILRRGKHSFEEMHRKAEQSVRRRTVIPLEYLFHIKKAGKYLKHCV
FT                   SLALAAELDRNSGELFQEIPENYKKIYPTLELGLCLYTADSRVRIECMRNMLEEKETFD
FT                   FFFGTGNSRESRTEMRLDPRILQFLLSPETEPEKLEGFCRLYDGSDLEEQPMVIREEQM
FT                   ERTAALLGTVSEEKKILYLFGHPGSGRRFMIRHACRKLGRFCLEADIGKLDGNDPGKLL
FT                   DEMIRETQIRRAVLCIRNFHLLFQNGKMYQALGVVEKILMHLPQVILLADQTWPYSREE
FT                   FPAPVTELEISPPDIGERITLWEEALRQHPEAMPETFQTEHARLEILAGKFTFHPGQIM
FT                   SAAAETSRSVQWTGKRAEEEDLYRACRHQVSHRLGERAMQIEPAYGWDDLILPPDRKQM
FT                   LRNACDQIEYSHQVYGKWGFASKMVYGKGVSMLFYGPPGTGKTMGAQVLARELHLELYK
FT                   ADLSSVMSKYIGETEKNLGEIFEEVKKSQSILFFDEADALFGKRSEVKDAQDKYANAET
FT                   AYLLQKMEEYEGIVILATNYIQNFDEAFKRRIRFMIEFPLPDAKRRLKIWSQVYPRQTP
FT                   VSEDVDFEFLAGQFELSGSSIKNIAVSAAFRAAAAGTEVEMEQILNCLKEEMKKSGKNL
FT                   QREDFGPYYSLMNREEDTSHAII"
FT   CDS             291060..292913
FT                   /transl_table=11
FT                   /locus_tag="CK3_02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40142"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQR7"
FT                   /protein_id="CBL40142.1"
FT                   /translation="MPLFKKKKKEDPVRTAKKAEFSGKAKEALQEKDTAPSQIEQETTQ
FT                   PVKKNQTDWYTDMKERSERAREYSNRFAFTEESLSSVYSIKKLDKIRQASNVKFYEMSL
FT                   LEEGTVNCHERMMEDTGNEEKKAEAQEYYESAMSRIDTAKRLYSELLTSVEKRKEEIEK
FT                   DPKLAKKNSLIDRFRTMRKDKPMLQLIRRVRLFEDNPGYQEKADGFFGKMKEELTSLSE
FT                   SLLSDEDKELLKTGMEAKEQAGEIRENAEEVAKAISDAKDESKPMEGVFGMMKDTAMLV
FT                   KDAIFFIKDLNKSSSENILDKFVEIVTKGASILASAAGKIAELLSTFPFIGAIIGLIKN
FT                   GITFFSEGYKFVMSQRRISKLRKQKKLLKERMLKRKKKYANDPELKGLYSFVGEDKSGA
FT                   VKLDAKKLGKREKRGLIGGGSDARDTMRQAADSKKDGGKHLYYMAKEAESVEQYDELKE
FT                   VIYKNKNRKKDATIALAQQGVDVAANIAKFFPGTGDIVSASIKLGNSIVSGGKFVGSKA
FT                   FEYGKSVFGHARSKENKKVFRNKYAEHIYDNIAEVSDYLDGEGKIDLNKADPGSIRKAA
FT                   ESYDYAENMLVGMGADMPALIGAPSKEKLIEAMAEAFGAGE"
FT   CDS             292930..293463
FT                   /transl_table=11
FT                   /locus_tag="CK3_02910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40143"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQR8"
FT                   /protein_id="CBL40143.1"
FT                   /translation="MKQDLKLRDLRSLQELLDDLEWETELIGEETDYPSLAAVLPVEED
FT                   CDERAVFTYIDLPDEDSEFTKYLQIYLQIPLKIDRIPAGELIVFVNQLNMLTLIGSFSY
FT                   VPGAGGHEARVDYRYVMAMEKEALPDEGVVGEILLNLVKYAQMAEGLLASRIEGTPTEV
FT                   IMAAVGHELEAGWR"
FT   CDS             293467..293853
FT                   /transl_table=11
FT                   /locus_tag="CK3_02920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40144"
FT                   /db_xref="InterPro:IPR025460"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQR9"
FT                   /protein_id="CBL40144.1"
FT                   /translation="MGFCVLGGAMCTCSFGMAPSTLMVTPEKKTVSSMPVATIMDHVPM
FT                   KNVMPFGMCQSMANPAVAAATAAAFGVLTPMPCIPVIPAPWSPGSPTVLVGNTPALNQS
FT                   SKAICAYGGVIQITNPGTTNIQIP"
FT   CDS             293875..295566
FT                   /transl_table=11
FT                   /locus_tag="CK3_02930"
FT                   /product="HAMP domain."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40145"
FT                   /db_xref="GOA:D7GQS0"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQS0"
FT                   /protein_id="CBL40145.1"
FT                   /translation="MKKRIFGLRAKFAVLFLLFAVIIMFSVGAVTYRTYRSSMMKRYAS
FT                   EAVTIAKLAASYLDGDELVRYSITRERDEEYDRLEAILDNIKEQSGVLYLYVVKPVSED
FT                   STVYLFDAAAANETNYLAKLGDRGDWNENFKLAKEAMATGEPNSDLEPTMTQLGYLASA
FT                   YVPVKDHTGTPVAVVGVDFTMDEIQTFLKYSLKNLLVMMALLITGCFLVLLVLVNSSII
FT                   SPVRILKNGVEKMADGELGVQVPIKSRDEIGEISEVFNRMSFNIGAHIQEIMDLNDGYY
FT                   KFVPSAIFEILGKKSIKEINLGDNRTVPLEVLRMQINNFEEKTRQMDAGKLFGFLNRVY
FT                   QLSVPVIMEKDGVVDSYFNGGLSAIYTKVGKNALDSAISICQKLNEEKKAGRMPEFADI
FT                   ELAFAISIGSQMVGIVGHDRRLSEVTLSEQISMVDYLRKVAGKYKARILVTGTAVGRIP
FT                   NFDSRYHARILGMIHVSATDSLEKIYDVYDGDDEALREIKEYTKQSFEDGVKHFMAKRF
FT                   YEARRCFVEVLKVSQGDYAAREYLYLCNKYYMKEDTSEINVYIEDF"
FT   CDS             295580..296485
FT                   /transl_table=11
FT                   /locus_tag="CK3_02940"
FT                   /product="Uncharacterized conserved protein (DUF2156)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40146"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQS1"
FT                   /protein_id="CBL40146.1"
FT                   /translation="MSGYCVFTNSVKKEYEKRASRMGGIFPSTISVESILAWQDVCAAE
FT                   YRIEEDYLCIRIYDRIEKKSYLYMPLGMYSGESFQRLIDKLYGESRKDGEELLFRDVRE
FT                   EEIFWYRGLSGYRVRISSNEAYSDYIYRREELEQAFEKPGERYNKRYFIRNYRPSVRHT
FT                   EILDVSSCRDIVNRAFCRYHQCPSCTNGCLKDTIANFLEASDPKGTYGIIVSSNGEDIG
FT                   YAAGIIQGDTFVFLFKKNCRGYRGLDEYLQTELLKELPEHVRYINYTEDMGVEGLRNYK
FT                   RRLAPYYLKTRYQVSVERMG"
FT   CDS             296482..298794
FT                   /transl_table=11
FT                   /locus_tag="CK3_02950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40147"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQS2"
FT                   /protein_id="CBL40147.1"
FT                   /translation="MNMKKRWKAGILLLLVLMTVVWWNRKLLEINPFHPVMADTVYRVI
FT                   TCEDQSLLVADKSGNRIYRINQDRQIEFVLNGTRSQNGFYDAKQMYSGEDGSIYLLDVR
FT                   RTGSRKMEQERILKYDRNGKMVQVVSDIRYDENERVYKNAINRIDGLDGKIVWFQFSGD
FT                   GFSIMSQDGELRHFPYEEAEQYLVDFAINPATGFCAYLTKSGEIYEEQENGSFRKVYSA
FT                   DDNKLQIPWYIDYSLDGKLYFADIGTRGIYRVENETDAVLVMNTTGSAAPQELSEDELR
FT                   ESPIYYNFDMGDRLATTDTYGVIVGDLGAEAEYLTEFPLTGALKMQVCAVWAGAAICVL
FT                   GCVVLFIYGIYRVFRSKDQFIHIVAGMLAGTAILTALFTMIVLKDWTARMTEEITGRTT
FT                   SVSGLAAQLIPGDKLERIHSIQDYEGEDYQTIRSIARSIFASGNMQINDLYCVIYRIQD
FT                   GMITSTYSIEDYVGAIYPYDWPFEGSDEQHILETNEQMTYMGLSSSEGSFIFTNSPILN
FT                   SNGEAVGIMEVGTDLYNFQQDNWKMVREVMTSAAVLAVTMILIVSELLIFGQGQEKRRA
FT                   ALAAGGDKTCIPASMLRIQVFLIFFVTNIPKAFLPIYIMKQAETESVFGLSPAFLVSIA
FT                   LSAEVLFGALTSFGGSAVLRSIGRRKTALFGSILFVAGLCMRAVVPTITSFIIGNGVMG
FT                   AGWGIPSSDHSGHDRGERSGGKERGIYRIYGGILEWSELRRCIRRVSDQLDELPVCSHD
FT                   RWNHEHTVPFIQRTVYF"
FT   CDS             298736..299470
FT                   /transl_table=11
FT                   /locus_tag="CK3_02960"
FT                   /product="Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40148"
FT                   /db_xref="GOA:D7GQS3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQS3"
FT                   /protein_id="CBL40148.1"
FT                   /translation="MIVGIMSILSLLFSALYIFDGSGEEKISGILETEAAASAENLQGS
FT                   MSTAKFLLSPHVLLYFTGIVIPVVAGGYFLAYLYPLLGEELGMSETNIGYSYLINGICI
FT                   ICLGNFLTKQLTHRIGQKGSLALAAVLYAGAFLLYAVWPGIPTLIVLLILLGVSDSYGL
FT                   PAQSTYYTDMKEVQRYGYDKAMGVYSLFENMSQVFGSFIFGIIYVNGVTWGLTIAGAVI
FT                   LAAAVIFVIFGEKVGSGEVSGS"
FT   CDS             299467..300372
FT                   /transl_table=11
FT                   /locus_tag="CK3_02970"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40149"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQS4"
FT                   /protein_id="CBL40149.1"
FT                   /translation="MIKFETLTGERLIELKSYFSLRPTGCAESHLAYHLLWRPYYETKY
FT                   FADERGILWLQRIDYDDQATMLPVCKIEYMRENFRRLQDHFTETGVKMHMYLVDEEALA
FT                   AIDPDPSRYEVVEDRDSFDYIYSGDEMRLLPGRKYSKMKNRISRFLRDYGEKAEFVLLG
FT                   PEDEPEILEFLDQWSSKKESDDALNRLESEETGIREAIRLCREADITIAGVRVGGILEA
FT                   FSMGTECRKMDMTVTHVEKANTELRGLYNYLEKEFLLHSYPKTGFVNREDDMGLENLRR
FT                   TKESMHPVRMERKYTILEKE"
FT   gap             300376..300603
FT                   /estimated_length=228
FT   CDS             301036..301611
FT                   /transl_table=11
FT                   /locus_tag="CK3_02980"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40150"
FT                   /db_xref="GOA:D7GQS5"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQS5"
FT                   /protein_id="CBL40150.1"
FT                   /translation="MLIIAGLGNPGKEYENTRHNAGFMVMDALAEKIGADISEKKHKAL
FT                   CGKGVIGGEKVILMKPQTYMNSSGESIRAAADYYKVDPEDILIVYDDISLAPGQLRIRA
FT                   KGSAGGHNGIKSIIAHLGTQEFPRVKVGVGEKPSRMDLADYVLGHFSKEEQATMDEAVK
FT                   EAADAVCEIVNVGIAQAMNDHNRKKEEK"
FT   CDS             301744..305349
FT                   /transl_table=11
FT                   /locus_tag="CK3_02990"
FT                   /product="transcription-repair coupling factor"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_02990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40151"
FT                   /db_xref="GOA:D7GQS6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQS6"
FT                   /protein_id="CBL40151.1"
FT                   /translation="MAEVFANPLVDLAEYTDMKQDLDQGKGPVQISGVTDSQKVHVMHE
FT                   LSKDNPWRLVVTYDDTRAKEIFDDFSYFEPNTWLYPARDLLFYSSDIHGNLLTRQRMQV
FT                   FKHLLEDEGGVVVTTVDGLMDHLLPLSRIKESCLNIMVGQTLDMEEIKHLLTGMGYERM
FT                   GQVDGMGQFSVRGGILDVFPLTEEVPVRIELWGDEVDSIRSFDAESQRSIQQMDEVTIY
FT                   PAAELILTKEHIEEGILRLEADEKKQEKAFRDQKKPEEAQRIRRAVGELVESLKEGFDV
FT                   QTLDAYIRYFCKDTVSFLDYMKEVGAKVTLVSSGAAGKASEKKQAAGLALILDEPQRMK
FT                   EKAETVETEFRESMSHRLEQGYILPGQADLLFASKTVLADCHTPHSIFMTGLDQRLPGM
FT                   TPKAKYSLTGKNLNSYQNSFEILIKDLTKWKKDGYRVVLLSASRTRASRLAGDLREYDL
FT                   RAFCPEDAGRPVAPGEIMVTYGKLHKGFEYPLIKFVVITEGDMFGVEKRKKKRKKYNYE
FT                   GKKISSFSELSVGDYVVHESHGLGIYKGIEKIEQDHVIKDYIKVEYGDGGNLYLPATRL
FT                   EGIQKYAGADAKVPKLNKLGGTEWTKTKTKVRTAVREIAKELVELYAARQDAEGFQYGP
FT                   DTVWQKEFEEMFPYDETDDQLTAIDDTKRDMESKKIMDRLICGDVGYGKTEIALRAAFK
FT                   AVQEEKQVVYLVPTTILAQQIYNTFVQRMKDFPVRVDMMSRFRTPGEMKKTVEGLKKGY
FT                   VDIIVGTHRVLSKDVQFKNLGLLIVDEEQRFGVTHKEKIKQMKQNVDVLTLTATPIPRT
FT                   LHMSLIGIRDMSVLEEPPVDRVPIQTYVMEYNDEMIREAIHRELGRGGQVYYVYNRVNN
FT                   IDEVANHVASLVPDANVAFAHGQMNEHQLEKIMLDFINGEIDVLVSTTIIETGLDIPNA
FT                   NTMIIQDADRLGLSQLYQIRGRIGRSNRTSFAFLMYKRDKMLKEDAEKRLQAIREFTEL
FT                   GSGIKIAMRDLEIRGAGNILGAEQHGHMEAVGYDLYCKMLNEAVIALKGGQEEEETFET
FT                   VVDCDIDAFIPDGYIKNEYLKLDVYKRISAIETDDEYMDMQDELIDRFGDIPKSVDNLL
FT                   RVAELKAMAHRAYVTEVDINTQEIRIELYPKAKLDVTGIPALIAEYKTALRFAQGEKPV
FT                   LFYQDKGKKHKDCEPMMEKAKELLGKLGELAESKK"
FT   CDS             305382..305702
FT                   /transl_table=11
FT                   /locus_tag="CK3_03000"
FT                   /product="Abi-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40152"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQS7"
FT                   /protein_id="CBL40152.1"
FT                   /translation="MTIKKPKLSLDEQIEHLKDKGILFNIMDESDAKKYLEQNNNYFKL
FT                   TAYRKNYNKHPDGKNKGKYINLEFAYLVDMAIIDMRLRYQIVHMALDIEHHAKLQLLRK
FT                   LD"
FT   CDS             complement(307174..308016)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03030"
FT                   /product="pyruvate formate-lyase 1-activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40153"
FT                   /db_xref="GOA:D7GQS8"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQS8"
FT                   /protein_id="CBL40153.1"
FT                   /translation="METTGYIHSIDSFGSVDGPGVRFVTFLQGCHMRCRYCHNPDTWKL
FT                   ANADAVSEQPISENAAQAHANTVQNTASDSAAPSSVCNYKEMTPSALIRQALRYKRYWG
FT                   KEGGITVSGGEPLLQIDFMNELFRLAKENGVGTVLDTAGQPFTREDPFFSKLTDLMENT
FT                   DLVMLDLKHIDPEKHRALTGHSNENILAFARYLNEIGKPMWIRHVLVPGVTDDNENLHG
FT                   IRAFLDTLSNVKKVEVLPYHTLGIYKWESLGIPYTLKDVDPPTADTVKRAEEILGCSK"
FT   CDS             complement(308189..310492)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03040"
FT                   /product="formate acetyltransferase 1"
FT                   /EC_number="2.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40154"
FT                   /db_xref="GOA:D7GQS9"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQS9"
FT                   /protein_id="CBL40154.1"
FT                   /translation="MSEQNTRNGNADVFKKAWRGFQGAKWTDEVNVREFIQNNYTQYDG
FT                   TEDFLAAPTEATAKLWGRLQELQKEERKKGGVLECETEIVSSLTSYGPGYIDESLKELE
FT                   TIVGLQTDKPLKRAFMPYGGIKMAEEAAETYGYKVNEKFHKIFTEYHKTHNQAVFDAYT
FT                   PEMKAARHCHIVTGLPDTYGRGRIVGDYRRVALYGIDFLIEEKKKDLDLCGNGAMYDEI
FT                   IRQREEIAEQIRALKGMKEMAKIYGYDISGPATNAKEAIQWLYFGYLAAVKTQNGAAMS
FT                   VGRISTFIDIYVNRDLEEGTLTESQAQELIDHMTMKFRMVKFARIPSYNQLFSGDPVWA
FT                   TLEVAGLGQDGRHMVTKTDFRFLHTLENMGPSPEPNLTVLYSSRLPENFKKYAAKISVD
FT                   TSSIQYENDDVMRPVWGDDYSICCCVSATQTGKEMQFFGARANLAKCLLYAINGGKDEK
FT                   YKTKDGKPMQAGPEYAPITSEYLDYDEVMHKYDLMMDWLAGIYVNILNLIQYMHDKYYY
FT                   EAAEMALIDTDVRRTFATGIAGFSHVVDSLSAIKYAKVKVVRDENGMATSFVTEGDFPR
FT                   YGNDDDRADDIAVWLLKTFLKKVKKYHTYRNSEPTTSILTITSNVVYGKATGALPDGRA
FT                   AFTPFAPGATPSYGAEQNGLLASLNSVAKLPYEYALDGISNTETIAPGALGHSEDERKN
FT                   NLVHVLDGYFDQGAHHLNVNVFGLDKLKDAMEHPEKPEYANFTIRVSGYAVKFIDLTRE
FT                   QQLDVIARTCHEAM"
FT   CDS             310612..310869
FT                   /transl_table=11
FT                   /locus_tag="CK3_03050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40155"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQT0"
FT                   /protein_id="CBL40155.1"
FT                   /translation="MRIIIKICHMGNFLFREISAVTESQRGAECAIRQKGKKTAHGLRY
FT                   DCPDGRLSSIILHVVYPLIRQSYDRYKLYIPDVVGEVKWK"
FT   CDS             310984..312591
FT                   /transl_table=11
FT                   /locus_tag="CK3_03060"
FT                   /product="Response regulator containing CheY-like receiver
FT                   domain and AraC-type DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40156"
FT                   /db_xref="GOA:D7GQT1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQT1"
FT                   /protein_id="CBL40156.1"
FT                   /translation="MLRVLIADDESKVCQLIEKLVDWDVLGMEVVAVAENGIEALEKIK
FT                   EFYPDIVITDIRMPGYDGLDLIRLGKEEAPKAEFVIISGYRHFEYAQMAIRYGVNAYLL
FT                   KPIRKDELTETLKRLSAHFKEQTEQLSLEEKRQRAIRSDEKNLRQAFLQDLVGRRNKEV
FT                   LTQPLDRINREFHYHFEPGEFSIAILKLDGRVCDEEKNVRFMAEKVQAAAGKLLNGYVM
FT                   ETELTELNGFHFFLLNYDPDDRMQIRRQMKALLSEIRVQGDILKNLAVTMALGEGVRRL
FT                   SEIGISLKNARLLIEERLLGGTGKLMEGSIDSGESFADSESFAKFNDRISHTLESLDPF
FT                   ALREELIYLKTKMLASKEISGHEILQMTKEICNQYLFFMKKYRLPVEENFMENFSISAD
FT                   NCADATELFDYLTRRLTSSYEKASRLKRQDENRPIRLVKKYVEEHFGEPLTLEEVSQIA
FT                   DLSPTYLSTLFKKDTGITFLEYLSKVRMDMAKKLLKETNDTVADICGKVGYSDVRYFTK
FT                   SFTKYAGLKPKEYRKLYS"
FT   CDS             312591..313667
FT                   /transl_table=11
FT                   /locus_tag="CK3_03070"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase./Histidine kinase."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40157"
FT                   /db_xref="GOA:D7GQT2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQT2"
FT                   /protein_id="CBL40157.1"
FT                   /translation="MEKKHTDKKNYLSVRIKWCALLAAGLIGVVLAEMWLVHIREMRSL
FT                   AAPTLFTALFLMLAAAVHRLVLVPYRETRKIYEQFVMGYVMEDLFKVRYPFSPESEQAV
FT                   LRLNEIIDRSNLIAISKKQAEYLALQNQINPHFLYNTLEGIRSEALIAGLDSIAEMTEA
FT                   LATFFRYTISDLENLVTLEDELANIENYYYIQQFRFGSKLDLSIRYERDGDDDFSEMDF
FT                   LQCKLPKLTLQPIVENSIYHGIERKIGKGHLVIRISASEERLYIRISDDGQGMTDAKLK
FT                   ELNEKLRRLGDETDDPEKDGEKKQTRGGIAVVNVNRRIKLLFGEEYGIHVYSKEEVGTD
FT                   VVVELPLVREENRQGGWR"
FT   CDS             313658..315109
FT                   /transl_table=11
FT                   /locus_tag="CK3_03080"
FT                   /product="ABC-type sugar transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40158"
FT                   /db_xref="GOA:D7GQT3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQT3"
FT                   /protein_id="CBL40158.1"
FT                   /translation="MAVRKELLRISHVSLERDGEQLLDNLEFQMFAGEIFGLVARNRKG
FT                   QKEMVDLICRNDPITLGSVWYDGKIVNSYSYSSGESNKVALIEQKSHLVQGLSVVDNLF
FT                   ILREGFKKYFINEQVIFQQAVRFMGEQGLEVELNKRVENLSELERCFVELGKALLSGCH
FT                   LVIVDNPSNYLSEYELYKFQRMLKKIRKEGISVLYIGNHHQELFKIADRTALFSDGYIY
FT                   KVFERDEMTDENMAPYTSEWKILSTENEQENDDGILHFHTVGAGNLNGLRFILHRGECV
FT                   TLLDKENKIAGDMMDLMTGKMRCKSGWITVDHVTYTQKKAGNYLDEGIAVIPADGVNRL
FT                   LFLEMSYMENLTFLLDRKLKKSLIPGKIYKSIHSEYLPLVGPVIDAPCVRDIPQEDQFA
FT                   LLYHKMNLLRPRVMICIQPLAKGDMFCRMKILNALREIQKQGTAILMITSSVSDTMDIS
FT                   DRLLVVEQGKVAASYDRSEFKRIVR"
FT   CDS             315281..316147
FT                   /transl_table=11
FT                   /locus_tag="CK3_03090"
FT                   /product="Transcriptional regulator/sugar kinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40159"
FT                   /db_xref="GOA:D7GQT4"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQT4"
FT                   /protein_id="CBL40159.1"
FT                   /translation="MNEYIGIDIGGTKISVIRGDAAGNILEKKKFATKTKDETLKEIFE
FT                   GVSELMNEHVTSIGVSCGGPLNSKTGVILGPPNLPGWDEVPITDMLTETFGIPAYLKND
FT                   ADACAVAEWKFGAGKGTENMIFLTFGTGIGAGLILNGRLYEGSTGMAGETGHLRLFETG
FT                   HIGHGKAGSFEGYVSGGGIAQYGKGTAKELGKRAAEGDPEALALWNEIGENLGKLLAIL
FT                   IDLFNPEAIVIGSIYARAGEYMKAGMEAVIEKEALPGNVKACRILPAGLGEKIGDIAAL
FT                   SVAMHTK"
FT   CDS             316226..317734
FT                   /transl_table=11
FT                   /locus_tag="CK3_03100"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40160"
FT                   /db_xref="GOA:D7GQT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQT5"
FT                   /protein_id="CBL40160.1"
FT                   /translation="MGEVIVSMKDIVKTFPGVKALDHVNFELRSGEVMALLGENGAGKS
FT                   TLMKILSGVYTKDSGTMTIFGTEYENLTPKQAQAVGVAIIHQELNMCRHLSVAENMFLG
FT                   REKVNGIVLNDREMEAEAAKILGDLKIDIDPRQTVGDLPVSKQQMVEIAKALSIHAKIL
FT                   IMDEPTSSLTAKEIEELFRIIRQLKADGCGIVYISHRLEELKAIVDRVTIMRDGQYITD
FT                   GNFKDMTMDQIIANMVGREIKEQFPRVSCPKGKKIFEVKNLNAGHLVRDINFSLYEGEI
FT                   VGFAGLMGAGRTETTRAIFGVDPKTSGEIFLDGKEVKISCPMDAIKAGIVLAPEDRKKD
FT                   GLCTKLSIRHNLALPNLDLICSKLGVISRKQEDDLCEKAVKDLLIKTPTVEVNAGNLSG
FT                   GNQQKVVVGKWLARNSRVVIFDEPTRGIDVGAKVEIYNLMNQLKKQGIAVMFVSSEMPE
FT                   VLGIADRVIVMCDGRITGEVIAKETTQNEVLKFATEFEQKKAVG"
FT   CDS             317749..318765
FT                   /transl_table=11
FT                   /locus_tag="CK3_03110"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40161"
FT                   /db_xref="GOA:D7GQT6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQT6"
FT                   /protein_id="CBL40161.1"
FT                   /translation="MNEKKQSAVKRILGTRGMGAVITAFAGLIIIYVAFGLIDRKVFAG
FT                   QNVMNLLRSMSKYLLIGVGQSYLLITGNIDLSIGSMVGMSAMISATLMAMGVNPFVAIA
FT                   VAMICCLVTGVVNGMLVGKFKLPPFIATLGTMFVTRGVAYMVNNNRNTDAIATGIGKEA
FT                   GDKFQNFFYYGKTLGVYNTFWIALVIFLIFFFLLSKTRTGRHIYAIGSNVDAAKLSGVN
FT                   VVNTTIKAYLVSAVCACVVGYILCAQAGMGNMEAGNMYEMYGVAAGVIGGISPLGGTGL
FT                   LLGTFAGAAVWQTLENGLNMIGAQVGIQRLVIGIIVVFSVLLDVVVRSGNFGKKATK"
FT   CDS             318890..320728
FT                   /transl_table=11
FT                   /locus_tag="CK3_03120"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40162"
FT                   /db_xref="GOA:D7GQT7"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQT7"
FT                   /protein_id="CBL40162.1"
FT                   /translation="MKKRVLALLSCAALAAASITGCSSQKPAESAAASAEAESTTGAPS
FT                   KEVGDYKIALITMDSIDQHWVTLNEGAQEEAKELGVTVSFMSPNTKDDAQQIECVNNAV
FT                   AGGYQAIIVAANGPDAISSALKEAKDAGIKIVYVDSPANVEAEATFSTDNEAAGTTAGN
FT                   EMLKALKDAGVTSGKIGIVNVNAATDSTVKREAGFRKAFEGTDFELMETQYGEGDAAKS
FT                   QTIAENYITQGVVGIFGCNEGSTTGTGNAIKASGNTGIIGVGFDKSDAIMNLINDGYLL
FT                   CTMAQNPDLMGRDGVEAAVRALQGETFGGLVTDTGVSVIKAGNTEDAAGTTDVTATKDW
FT                   KIALITMDSIDQHWVTLNEGAQAEAKALGVTVSFMSPNTKDDAQQIECVNNAVAGGYEA
FT                   IIVAANGPDAISSALKEAASTGVKIVYVDSPANVEAEATFSTDNEAAGKTAGDEMIKAL
FT                   EAAGITSGKIGIVNVNAATDSTVKREAGFRSAFEGKGYELMETQYGEGDAAKSQTIAEN
FT                   YITQGVVGIFGCNEGSTTGTGNAIKASGKTDIVGVGFDKSDAIMNLINDGYLLCTMAQN
FT                   PDVMGKEGVKAAVRALEGEELGGAVSDTGVSVLKKN"
FT   CDS             320974..321660
FT                   /transl_table=11
FT                   /locus_tag="CK3_03130"
FT                   /product="ABC-type sugar transport system, auxiliary
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40163"
FT                   /db_xref="GOA:D7GQT8"
FT                   /db_xref="InterPro:IPR010864"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQT8"
FT                   /protein_id="CBL40163.1"
FT                   /translation="MKRSEINAALKEMEQMIREYQFAIPPFCNFTPEEWKEKGHDYDEI
FT                   RDNMLGWDITDYGLGDFDKVGFSLITIRNGNLKMKDKYTKSYAEKLLYIKEGQYSPMHF
FT                   HWSKMEDIINRGGGNVLIRVYNSTKDEDLDKVNDVHVHVDGREMVVPAGTQVRLTPGES
FT                   ISIYPYMYHDFEVEEGSGPVLLGEVSQCNDDNVDNRFYEKMGRFPEIEEDEAPYRLLCN
FT                   EYPEAK"
FT   CDS             321661..322707
FT                   /transl_table=11
FT                   /locus_tag="CK3_03140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40164"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQT9"
FT                   /protein_id="CBL40164.1"
FT                   /translation="MTDQKTLMAVCGHMDQIAGVRQMEFQDGRAAGLRCAMIHNGPLEL
FT                   PLMLDKCLDPAWIRYKGINLSLLTKPGLQGRNPYDTAGDEAVRSIMGGAMFTCGLGNVH
FT                   GNRVVDGVEYPVHGRMRTTPAEKISMDAFWENGEYKILVSGEMREAQIFGENLVLRRTI
FT                   ETTYGSREIVFTDEIENQGFEDQPLCFLYHCNAGYPFLVPGLRVVMPSIFCGPRDADAK
FT                   AGAAAWNVMEEPVEHAPEQVFQHELAADRNGNTFAAFVNDELQIGLCIRFEKSVIPYLT
FT                   QWKSTAAGDFAMALEPTNCGFDGRAGKTQSLKPFEKHENRIRFQILDGKDEIKQLEDEC
FT                   REVLECTM"
FT   CDS             322695..323096
FT                   /transl_table=11
FT                   /locus_tag="CK3_03150"
FT                   /product="Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40165"
FT                   /db_xref="GOA:D7GQU0"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQU0"
FT                   /protein_id="CBL40165.1"
FT                   /translation="MYDVIALGELLIDFAAKETDADGYPTMKANPGGAPGNFLAALNKY
FT                   GMKTAFLGKVGDDAFGKLLLKTFEKAGIETKGIVTDPSVFTTLAFVTFSPEGDRSFSFA
FT                   RKPGADTRLSFEEIDLAMIDEASVPFQAG"
FT   CDS             323093..323680
FT                   /transl_table=11
FT                   /locus_tag="CK3_03160"
FT                   /product="Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40166"
FT                   /db_xref="GOA:D7GQU1"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQU1"
FT                   /protein_id="CBL40166.1"
FT                   /translation="MIDEASVFHFGTLSLTDDPVRTATKKCVEYAKRQGKFITFDPNLR
FT                   LPLWETTDAAKEQILWGLAHADVVKISDEEVEFLWGITDEKEAAKKLLDEFGIRLAMIT
FT                   MGPKGAYLANQNGAAYAKCPEVKPIDTTGAGDIFGGSAVSRLLKTGKKPEELGVEELVF
FT                   IGKFACTAASLSTTQSGGIPSIPEEDVVLERI"
FT   CDS             323843..323965
FT                   /transl_table=11
FT                   /locus_tag="CK3_03170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40167"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQU2"
FT                   /protein_id="CBL40167.1"
FT                   /translation="MVRLGSSGNSRLFMILQEITYIFIGMRAPASGRNSFFLVY"
FT   CDS             324034..324996
FT                   /transl_table=11
FT                   /locus_tag="CK3_03180"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40168"
FT                   /db_xref="GOA:D7GQU3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQU3"
FT                   /protein_id="CBL40168.1"
FT                   /translation="MDRSIDYVIAVAECKSISQAAEMLYISQPSLSRYLSNLENELGVN
FT                   LFVRTLNGTELTAAGKIYLEYAKEIKLLKETMNSKLKELKREKKSRIRIGMPLNAASLA
FT                   AFDVVKEVEKKYPDCGVEIYNIFSKDMEKALKEWAYDFVIGPMADLSKNVDYDLMYRDF
FT                   YVLVVPKRYDLETYAEYGEQGSFPVIDMKKLPPMDYIFQDETTFVRKGINRILEKQKLS
FT                   IAPRLVVTSSTLALQAAENGFGCCIVSTGHLAYLNQSANLKVYLIKGEETSSCGVAYLH
FT                   NKIFSEEEKCCIALIRRALREGEKKIMQRFGTWEMKERE"
FT   gap             325156..326811
FT                   /estimated_length=1656
FT   CDS             326847..328130
FT                   /transl_table=11
FT                   /locus_tag="CK3_03190"
FT                   /product="Di-and tricarboxylate transporters"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40169"
FT                   /db_xref="GOA:D7GQU4"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQU4"
FT                   /protein_id="CBL40169.1"
FT                   /translation="MSTTLIWAFVCLIIFVAVLAHPKLPNWMTFICMAPVVLLAKVMEA
FT                   KDIYAVLNSSSLHLMIIICMFSGMIAATGLDIIIGDFVDHMTSSQTGKKKEMMIFAIVY
FT                   LVSGLISTVLQNSYVALAFLPVLKSIARKNRISLSKLVLFVIFATTLGGAITLIGTPTN
FT                   VYANTALEEAGLQLFGMLDFAWVGIPIFIVGGIYMIVMNRWCASYDDFGEETEEKALTS
FT                   GQRRKQMVVGITFLVFVAALVLKSLKVISIDPNFIGYAMIAVAVLTTVVTPKEALESLD
FT                   SQMILFCAGINLMIAVMNQSGLGQVFGDMIINIIGESKNLYLITAVLCIGASIATSFMN
FT                   NMACAGMLAPVGISIANALGANPQAIVLAIAIGAGCSYLTPIASGTNQTMMIFTKLKFQ
FT                   DFAKFGWPLLIISWILCIAILPQVFPFF"
FT   CDS             328164..329603
FT                   /transl_table=11
FT                   /locus_tag="CK3_03200"
FT                   /product="Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40170"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQU5"
FT                   /protein_id="CBL40170.1"
FT                   /translation="MKTELRYSWPSAEGVNPEYIVNFLNACEKADSEIHGIMIARHGNV
FT                   IFEAYNAPYAAEIPHIMHSFTKTLTNTAVALAYDDGLLDLDNPILKYFPEYEPEANEYL
FT                   KKCTIRNMITMRNGQERSVGGNEWRPLKTSWKDAYFKIPFDKEPGKTFMYSSGNSYILS
FT                   YIVQKLTGKTCRELVQERVGKEIGLTDFPWMLSPEGVCSGGNGVSLTTGDMLRIGLLYL
FT                   NKGKWNGKQLISEEWIDHALGYTDPLDPVDGLQYNFHWDHAGDIWAARGMFGQTCGLVP
FT                   ALDMVFAVTAADSGYQAMKLFQKEVIDPVKENDGRLITDGTMDDVLKQKALRMTLEGKN
FT                   CSVPGHKEILRKMTWTPENHVDGIRKIELCPAEGKNLIYRMEDDRGVHEIHAGLDHWIH
FT                   GTTTMTGAYLHHQYEQPVSKIAAIAYWTAPDVLMMEWRYPEMAFWDHVTLTWDHGDVRM
FT                   DRWVNMNSQDLKRPTVCMKEQ"
FT   CDS             329694..330644
FT                   /transl_table=11
FT                   /locus_tag="CK3_03210"
FT                   /product="Sugar kinases, ribokinase family"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40171"
FT                   /db_xref="GOA:D7GQU6"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQU6"
FT                   /protein_id="CBL40171.1"
FT                   /translation="MYDVIALGELLIDFAAKETDADGYPTMKANPGGAPGNFLAALNKY
FT                   GMKTAFLGKVGDDAFGKLLLKTFEKAGIETKGILTDPSVFTTLAFVTFSPEGDRSFSFA
FT                   RKPGADTRLSFEEIDLTMIDEASVFHFGTLSLTDDPVRTATKKCVEYAKEHGKLITFDP
FT                   NLRLPLWETTDAAKEQILWGLAHADVVKISDEEVEFLWGITDEKEAAKKLLDEFGIRLA
FT                   MITMGPKGAYLANQNGAAYAKCPEVKPIDTTGAGDIFGGSAVSRLLKAGKAPEEFSTEE
FT                   LGFIGQFACTAASISTTQSGGIPSIPEEAAVLDRM"
FT   CDS             330790..331683
FT                   /transl_table=11
FT                   /locus_tag="CK3_03220"
FT                   /product="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40172"
FT                   /db_xref="GOA:D7GQU7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQU7"
FT                   /protein_id="CBL40172.1"
FT                   /translation="MTDTKDKKREKLGILCCTAGATSWGLSGTCSEALFSQYPVDTTWV
FT                   TAVRMTSAGIILLFLAFAKHSLNLKELGKDKKGLIEIVLFAIAGLALCQYAYLSAIKWT
FT                   NSGTATVIQNLSIVFIAVYVCLTTRTAPDKRTVFCIILALFGVWLLATGGKPGNMELTP
FT                   RGLFWGLMAGIGAASYSLLSRAPVKHRGSIPVSGMGMFIGGLALSLIAQSWKIPAGLDG
FT                   RAILYMAVIVLLGTVGAFTLFLQGIALVGPVKAALLSCLEPLTAATLSVVWLHSSFSPT
FT                   DLIGFACILATVVLMR"
FT   CDS             331937..332026
FT                   /transl_table=11
FT                   /locus_tag="CK3_03230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40173"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQU8"
FT                   /protein_id="CBL40173.1"
FT                   /translation="MDSCDSTGRSTKCGVKNRQAQNAAIGAMM"
FT   CDS             332256..333653
FT                   /transl_table=11
FT                   /locus_tag="CK3_03240"
FT                   /product="Mg2+ transporter (mgtE)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40174"
FT                   /db_xref="GOA:D7GQU9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQU9"
FT                   /protein_id="CBL40174.1"
FT                   /translation="METEVLKEQHYVEELVDIIRSGLPKEELIDRLSDYHDNDIADALT
FT                   KLTPDERRELYPLIGVERVAEIFAYLDDAEPYLKELPIESAAKIVSEMDSDDAVDVLEE
FT                   MDATTKHKIVGMLDKEASEDVRLLFSYDEDEIGSRMTTNFIMIHNNLTIRQAMRELIEQ
FT                   AGENDNISTIYVIDDEDKFYGAIDLKDLIIAREYTDLEDLISHSYPYVKDHEKVADCIE
FT                   QIKDYAEDSIPVLQEDGTIAGIITSQDIVEAVDDEMGEDYAKLAGLTAEEDLNEKLTES
FT                   VKKRLPWLVILLFLGMVVSSVVGAFESVVAVIPIVMCFQSLILDMAGNVGTQSLAVTIR
FT                   VLMDEELTAKQKLMLVVKEMKIGFVNGLFLGVMAWLFLGIYICVIKGYPIHHALLVSGC
FT                   VGIALVTAMVISSMVGTLIPMFFKKINVDPAVASGPLITTVNDLVAIVVYYGLAMLFLV
FT                   DLLHVTG"
FT   CDS             334049..335344
FT                   /transl_table=11
FT                   /locus_tag="CK3_03250"
FT                   /product="phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40175"
FT                   /db_xref="GOA:D7GQV0"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQV0"
FT                   /protein_id="CBL40175.1"
FT                   /translation="MNYLEIEKVIGREILDSRGNPTVEAEVYLADGTIGRGTAPSGAST
FT                   GEFEALELRDGDQARYGGKGVTKAVENINTIINETLTGLDASDIYAVDRAMIKADGTKD
FT                   KSKLGANAILAVSIACARAAAISLDIPLYRFLGGIGGNRLPVPMMNIINGGCHALSSGL
FT                   DVQEFMIMPVGAPSFKECLRWCAEVFHALAAILKERGLATSVGDEGGFAPALKSDEEAI
FT                   ETILEAVKKAGYEPGRDFRIAMDAASSEWKTGKVGEYKLPKAGTVYTSEQLIEHWKKLV
FT                   EKYPIISIEDALDEEDWEGWKKLTAELGTKVQLVGDDLFVTNTERLSKGIKLGCANSIL
FT                   IKLNQIGSVSETLEAIKMAHRAGYTAISSHRSGETADTTIADLAVALNTCQIKTGAPSR
FT                   SERVAKYNQLLRIEEELGENGVYPGMDAFHVE"
FT   CDS             335506..337518
FT                   /transl_table=11
FT                   /locus_tag="CK3_03260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40176"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQV1"
FT                   /protein_id="CBL40176.1"
FT                   /translation="MMKVGRRIGLFLAAALILSGCSNSAAEIGSSAAQTEAETSQAETE
FT                   RAGETAVTSLPQIDSTKWQYNSDDKIYWQTGISYCENPADENYETLGIFIPAAYMNAKD
FT                   NGDGTFTCEINNQAAVQGYTADSAPIVIPVNTPGYSAMEAPTDYVTDSVSYTSAGFIYV
FT                   AAGCRGRDAGAPAGVTDLKAAIRYIRYNDGVIPGDVDRIFSFGMSGGGAQSALLGATGD
FT                   SEDYEPYLTAIGAVSGVSDAVTGSMCWCPITELDYADEAYEWNLGSTRTDLTEQEQTLS
FT                   NGMAEAFAQYINDLGLKDSSGNVLTLTESEEGIYQSGTYYEYLKGVVETSLNNFLEDTT
FT                   FPYKVETKKGPRGGGERPDGQKPDGAPQGENSGQKPDGAPQDGNGMPDDMQKDGQKDGR
FT                   LDGKQAQGTSDENKAGDDTTKTRTEKNRKASEEKAPADKNADGDTASDKGNGAPDFYAM
FT                   DGVDRNLSTGGVTLSGTYETAQDYIDALNADGTWVNYDSATNTATITSIADFTNACKRA
FT                   SKGIGAFDALDESQAENTLFGYGDGTTSHFDAILADLLKDDETYGAAFTEAMEKTDSQG
FT                   NTVTERGNMYNPLYYLSSYYDGYQKSTVADYWRIRTGIAQSDTSLTTEVNLALALKNYG
FT                   ADVDFATIWGEGHTMAESTGDSVTNFIEWVNKCLK"
FT   CDS             337593..337751
FT                   /transl_table=11
FT                   /locus_tag="CK3_03270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40177"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQV2"
FT                   /protein_id="CBL40177.1"
FT                   /translation="MFADVHQADAASGRLCRWLFKSNVRETWRVILVSKADIFHTESLR
FT                   ILAERFC"
FT   CDS             complement(337752..338531)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03280"
FT                   /product="Integral membrane protein (intg_mem_TP0381)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40178"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQV3"
FT                   /protein_id="CBL40178.1"
FT                   /translation="MYIFLQSILRMTAWPMTPPVPYSAFHILLTLFGAGFAVSFARVFG
FT                   KKIRSMASPEPYFRHILFSCGVLLALMELYKQAFLYVIEFHGHFDWWYFPFQLCSIPMY
FT                   ICLAAPLLHSEKTLRRAATFLQDFGLLGGIMALAVPPGLMHPYWTMTLHGFLWHFTLLF
FT                   LGLLSCMSGIAGHERRDYMDILPFFFLCCVIACVINIAAGPTADADMFYISPFHPSSQP
FT                   VFHEIACAVGIFWGNLLYVVSMIVGGLLMHKISSRLL"
FT   CDS             338885..340066
FT                   /transl_table=11
FT                   /locus_tag="CK3_03290"
FT                   /product="Acyltransferase family."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40179"
FT                   /db_xref="GOA:D7GQV4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQV4"
FT                   /protein_id="CBL40179.1"
FT                   /translation="MVTGSGERRFHDQISWLMFLFSIFVIWVHSYNVDLFSGGAQDGIW
FT                   SLADRIENFVSVGLGQIAVPGFFLLSSYLFFRNFSWDKLVGKWKSRVFSVLIPYVVWNL
FT                   IYYLGYMAASRFLAIRSVVGRDIIPFSVQEIWRAVSQYAYAPIFWYLYQLIFLIIVSPM
FT                   IYALVKNRAVGLFWIVGLVFAVHLHLDMRHPNTDALLYYSVAAYFAVHRRGLVERSMEE
FT                   EAAGWNADHGTKEKKATSEDKDGNTAGGIPDHVRRRCFAEGLAGVVISVFCYRRMMAPE
FT                   AAVLWTCFYRMAVPMTCWAFACGVRLPKIRPWMRQSMFLYAIHFIVVRFVNKGTAVVTR
FT                   SLAGTTTAAGISLVVYFLLPAIAVIASYILAKFLVRFLPGVWRVLSGGRKLEG"
FT   CDS             341588..341797
FT                   /transl_table=11
FT                   /locus_tag="CK3_03310"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40180"
FT                   /db_xref="GOA:D7GQV5"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQV5"
FT                   /protein_id="CBL40180.1"
FT                   /translation="MKQGIHPNYYQAKVVCNCGNEFVTGSTKKDIHVEICSKCHSFYTG
FT                   QQKAASARGRIEMFNRKYGMKTDK"
FT   CDS             343056..344219
FT                   /transl_table=11
FT                   /locus_tag="CK3_03330"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40181"
FT                   /db_xref="GOA:D7GQV6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQV6"
FT                   /protein_id="CBL40181.1"
FT                   /translation="MSEMKSAVWAGMDRSGDDLCVENSVREFKIWADVLNYGKKILKNA
FT                   GIVEADLDAWYLFGQIFGISRAQYFLCARENIAGSTAQKMAAQEQTGNSLESKNALDCV
FT                   ELWLKEKLSAYENTLEKRASRIPLQQILGQQEFMGLTFFVNEHVLIPRQDTETLVELVL
FT                   NEQKDKNISILDMCTGSGCIAVSLKKLGGYACVEGADISEEALKVAKRNSEEILENSDV
FT                   NNDAVSSRTEQIQNCTNLTNNQNKQDNSEERMVSEVRRGSQTGVTFRHSDMFSSFRETE
FT                   QFNVIVSNPPYVPSAVIEELEPEVRDHEPRGALDGTADGLYFYRILAEECAKHLTPGGH
FT                   VYFEIGYDQGMAVKELLDNHGFKDTRVIQDLTGKDRVVCGTWQTTGV"
FT   CDS             344233..345306
FT                   /transl_table=11
FT                   /locus_tag="CK3_03340"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40182"
FT                   /db_xref="GOA:D7GQV7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQV7"
FT                   /protein_id="CBL40182.1"
FT                   /translation="MFDRLDDMLRHYEELMLELNNPSVAEDQRKFRKLMKEQADLAPIV
FT                   DAYKQYKQAKQDVEDSLALLDEESDEEMKELAKEELADAKKRIEELEQELKILLLPKDP
FT                   NDEKNVIVEIRAGAGGDEAALFASELYRMYVHYAESQHWKTEMINVSESGIGGMKEVEF
FT                   MITGHGAYSKLKYESGVHRVQRVPETESGGRIHTSTATVAIMPEAEEFDVVIDDKDIRI
FT                   DVMRASGNGGQCVNTTDSAVRLTHIPTGIVIYSQTEKSQLQNKEKAFRLLRSKLYDMEL
FT                   ERRQNEEAAERRSQIGTGDRSEKIRTYNFPQGRVTDHRIKLTLYKIDAIMDGDIQELID
FT                   SLIAADQAAKLAKMNEN"
FT   CDS             complement(345586..346923)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03350"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40183"
FT                   /db_xref="GOA:D7GQV8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQV8"
FT                   /protein_id="CBL40183.1"
FT                   /translation="MNNRLFSRNDLVRLIIPLIVDQFLQVAVGLSDSIMVARVGEAAVS
FT                   GVSLVDTVMLLIINIFTALATGGAVIAGQYLGRKDPKTGCEATAQLFNFTFLFSIFIMI
FT                   LGYLGQNVILYHVFGKIEPEVMKDSRTYLLIVLSSIPMIAMYNAGAAIFRAMGNSNIAM
FT                   KTSLLMNSINVFGNALLIFGFHRGVEGVAIPTVVSRGVACVVILILLNNQKHELHILHP
FT                   YPFKIKWNVLKKILYIGIPNGLENSMFQLGKIAVLSLVSGLGTASLAANAVGNNIANFA
FT                   ILPGMSFGFALLTVCAQCVGAGDFEQVKYYTKHMMRVEYLCLIASNLIVILALPFILSV
FT                   YNLSDEAAQYANDIILYHAACVVTIWPLSFTLPNTLRAAADVKITMVLSIISMWVFRFG
FT                   FSYLLTMVFHMGIFGVWVAMTIDWLVRGIFFVCRYKSGRWQKIIFS"
FT   CDS             347355..348257
FT                   /transl_table=11
FT                   /locus_tag="CK3_03360"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40184"
FT                   /db_xref="GOA:D7GQV9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQV9"
FT                   /protein_id="CBL40184.1"
FT                   /translation="MKGIILAGGSGTRLYPLTKVTSKQLLPIYDKPMIYYPLSVLMNAG
FT                   IRDILIISTPDDTPRFEALLGDGKQFGVNLSYAVQPSPDGLAQAFIIGEKFINGDSVAM
FT                   ILGDNIFHGQGLKKRLRAAAEKEKGATVFGYYVDDPERFGIVEFDETGKAISIEEKPEK
FT                   PKSNYCVTGLYFYDNRVVEYAKNLKPSARGELEITDLNRIYLENGELDVTLLGQGFTWL
FT                   DTGTHESLVEATNFVKTIETHQHRKIACLEEIAYTNGWISKEEVMAAYEIYKKNQYGQY
FT                   LKDVIDGKYIDKLPGHADK"
FT   CDS             348344..348415
FT                   /transl_table=11
FT                   /locus_tag="CK3_03370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40185"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQW0"
FT                   /protein_id="CBL40185.1"
FT                   /translation="MEHELSVFLYENFAVRIMFMKEK"
FT   CDS             348420..349457
FT                   /transl_table=11
FT                   /locus_tag="CK3_03380"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40186"
FT                   /db_xref="GOA:D7GQW1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQW1"
FT                   /protein_id="CBL40186.1"
FT                   /translation="MKIIVTGGAGFIGGNFIHHMVNKYPEYQIVNLDLLTYAGNLETLK
FT                   PVENKPNYKFVKGDIADRKFVFDLFEKEKPDIVVNFAAESHVDRSVVDPESFVRTNVMG
FT                   TTTLLDACRTYGIKRYHQVSTDEVYGDLPLDRPDLFFTEETPLHTSSPYSSSKASADLF
FT                   VLAYHRTYGLPVTISRCSNNYGPYHFPEKLIPLMISRALADEALPVYGTGENVRDWLHV
FT                   SDHCEAIDLIIHNGRVGEVYNVGGHNERTNLEVVKTILKALNKPESLIKFVTDRPGHDR
FT                   RYAIDPTKLETELGWKPKYNFDTGIQQTIQWYLDNEDWWKHILSGEYSNYFDNMYGDRL
FT                   GKDLK"
FT   CDS             349489..350337
FT                   /transl_table=11
FT                   /locus_tag="CK3_03390"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40187"
FT                   /db_xref="GOA:D7GQW2"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQW2"
FT                   /protein_id="CBL40187.1"
FT                   /translation="MRVLVTGVKGQLGHDVVNEMEKRGLTPIGVDLAEMDITDKEACDR
FT                   VITEANVEAVIHCAAYTAVDAAEDNIEVCRKVNAGGTRNIAEVCKKLGIKMMYISTDYV
FT                   FDGQGTRPWEPDDERHPLNVYGQSKYEGELAVEELVEKFFTVRIAWVFGVNGKNFIKTM
FT                   LRIGKERGAASVVDDQIGSPTYTYDLARLLVDMIQTDKYGRYHATNEGLCSWYEFACEI
FT                   FRVAGMDVKVTPVHSDEYPAAKAKRPMNSRMSKEKLTENGFERLPEWKDAVARYLKEIT
FT                   W"
FT   CDS             350653..352011
FT                   /transl_table=11
FT                   /locus_tag="CK3_03400"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40188"
FT                   /db_xref="GOA:D7GQW3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQW3"
FT                   /protein_id="CBL40188.1"
FT                   /translation="MGKYFGTDGFRGEANIDLTVEHAYKVGRFLGWYYGKQAKGDRCRV
FT                   VIGKDTRRSSYMFEYSLAAGLTASGADTYLLHVTTTPSVSHVIRTEDFDCGIMISASHN
FT                   PYYDNGIKVMNGNGEKLEESVITEIEKYLDGEMEEIPLAKRENIGRTQDFAAGRNRYIG
FT                   YLISIATRSFKGKKVGLDCSNGSASSVAKSVFDALGADTYVINDKPDGLNINRGCGSTH
FT                   IGELQKFVKEKGLDVGFAYDGDADRCLAVDENGNVVDGDLILYICGKYMKEQGLLRNNK
FT                   IVTTVMSNLGLYKALDREGIGYEKTAVGDKYVYENMSRTGNCLGGEQSGHIIFSKYATT
FT                   GDGILTSLKIMEVMLEKKETLGKLASEVTILPQLLKNVRVADKAAALNDPDVQAAGKAV
FT                   DEALGNDGRLLLRQSGTEPLIRVMVEAETPEICEKYVDQVIDVLKKKGHVTEG"
FT   CDS             352600..354273
FT                   /transl_table=11
FT                   /locus_tag="CK3_03410"
FT                   /product="2-isopropylmalate synthase, yeast type"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40189"
FT                   /db_xref="GOA:D7GQW4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQW4"
FT                   /protein_id="CBL40189.1"
FT                   /translation="MMNYKRYQRVPVMNYPEREWPNKEIEKAPIWCSVDLRDGNQALVE
FT                   PMVVEEKIEMFNMLVQMGFKEIEIGFPAASQIEFDFLRQLVERRLIPDDVTVQVLTQCR
FT                   DHLLKRTFESIQGIPKAVVHIYNSTSTLQRDVVFHMDREEIKQIAIDGVDMVKKYMKDY
FT                   DGKVILEYSPESFTGTEMDYALDICNAVQRAWGPTPDNKMIINLPSTVEMTTPNVFADQ
FT                   IEWMSKHLENRESIVLSVHPHNDRGTGVAAAELAMLAGADRVEGTLFGNGERTGNVDIL
FT                   TIAYNMFSQGIDPELEIGDIKKIAEVYERCTKMHIDPRHPYAGKLVFTAFSGSHQDAIN
FT                   KGMHALMERKSEIWQVPYLPIDPSDIGREYEPVVRINSQSGKGGVAFVMDSFFGFKLPR
FT                   GMHKEFADVIQKIAEKQGEVAPDQIMEEFRIEYLDRKEPYHFRKCKITDFESGDQFTTV
FT                   AVVTYSDHGETKQFEGVGNGPIDAVKRGLEEELGISIKVLDYSEHALTSGSGAQAASYI
FT                   HLMDQKTGKVTYGVGISSNITRASLRGIFSAVNRLFGDAE"
FT   CDS             354611..355855
FT                   /transl_table=11
FT                   /locus_tag="CK3_03420"
FT                   /product="FOG: Glucan-binding domain (YG repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40190"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQW5"
FT                   /protein_id="CBL40190.1"
FT                   /translation="MKKRYFAGAAVAAMILTAGMATTSFADWSQQNGKWYYYNDNNGRL
FT                   VRNDWVCSKDAWYYMDYNGVMQTNSLIDDTYYVNENGVMITNTWKYINNSRWNESGWRY
FT                   FGANGKAYTNGWKQINDVWYHFTDSVLDIGWVEIDGKIYHLEDSGAMTTGWRKLADRED
FT                   DWGEYWYYFNSSGKLIYDGELKISGETYIFDHSGRMLTGWVNESDYTSTGRDDLSNSDV
FT                   NALRYFRSGGQQMNGWRYMASPDDAEENWYYFKDGRAYSTSYKTTEACGYGIAKIKGET
FT                   YCFDKKGRMKTGLVELSDGRKFYFDSDGKMKTGRIVINDDNHDNEVFYFTTSGSIGTRG
FT                   DGFTGVKDGSLYENGRLVSAEEGMKYEKVTVDGKTYVVNESGKVKTSGTVTDADGVKYK
FT                   ITKDQNGGYNVEVSW"
FT   CDS             355962..356453
FT                   /transl_table=11
FT                   /locus_tag="CK3_03430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40191"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQW6"
FT                   /protein_id="CBL40191.1"
FT                   /translation="MNSYEESKFFYLSSLTVILFNIFFIGFILKYGHKEYIPPAGVITY
FT                   EYWNELVKNPELVDEVLASNVANISSVSCIIFVLEILYALAVYDSLRSRDGRWILLIVP
FT                   IAFISYKICRQLFITYIPVYHMFMLLLPTEFVSIVLEVLNLYAYRRSRSREMLKNSTHR
FT                   "
FT   CDS             356733..359582
FT                   /transl_table=11
FT                   /locus_tag="CK3_03440"
FT                   /product="excinuclease ABC, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40192"
FT                   /db_xref="GOA:D7GQW7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQW7"
FT                   /protein_id="CBL40192.1"
FT                   /translation="MPKQYIKIRGANEHNLKNISLDIPRNELVVLTGLSGSGKSSLAFD
FT                   TIYAEGQRRYMESLSSYARQFLGQMEKPDVESIEGLSPAISIDQKSTNRNPRSTVGTVT
FT                   EIYDYMRLLYARIGIPHCPKCGREIRKQTVDQMVDQIMTLPERTKIQLLAPMVRGRKGR
FT                   HEKVLEQAKRSGYVRVMIDGNLHELSEEITLEKNIKHNIEIVVDRLVVKPGIEKRLTDS
FT                   IETVMKLSDGLMIVDVTGGEPINFSQSFSCPDCGISIEEVEPRSFSFNNPFGACPDCFG
FT                   LGYKMKFDEDLMIPDKSLSINEGAIVVLGWQSCAKPGSFSRAILDALAAEYHFDLDTPF
FT                   KDYPKEIHDILIYGTGGKEVKVHYTGQRGTGVYDVAFEGLIENVNRRYRETFSQASKAE
FT                   YESFMRITPCTTCHGQRLKQSSLAVTVGGLNIYEATNMSIVKFREFIDDLKLSEMQKMI
FT                   GEQILKEIRARISFLIDVGLDYLSLSRATGTLSGGEAQRIRLATQIGSGLVGVAYILDE
FT                   PSIGLHQRDNDKLLKTLEHLRDLGNSVIVVEHDEDTMRAADCIVDIGPGAGEHGGNVVA
FT                   VGTAAQIMKCKESITGAYLSGRIKIPVPKERRSPTGWIKIRGARENNLKNIDVDVPLGI
FT                   MTCVTGVSGSGKSSLINEILYKALAKKLNRARTIPGDHDGIDGVEQLDKIIAIDQSPIG
FT                   RTPRSNPATYTGVFDLIRDLFAATTDAKAKGYSKGRFSFNVKGGRCEACSGDGIIKIEM
FT                   HFLPDVYVPCEVCGGKRYNRETLEVKYKGKSIYDVLNMTVEEALKFFENVPSIARKIAT
FT                   LNDVGLSYIRLGQPSTELSGGEAQRIKLATELSRRGTGKTIYILDEPTTGLHFADVHKL
FT                   VEILRKLSEGGNTVVVIEHNLDVIKTADYIIDMGPEGGDRGGTVIAKGTPEEIVKVPES
FT                   YTGQYVKRYLENGDAGSDE"
FT   CDS             359920..361068
FT                   /transl_table=11
FT                   /locus_tag="CK3_03450"
FT                   /product="isoaspartyl dipeptidase. Metallo peptidase.
FT                   MEROPS family M38"
FT                   /EC_number="3.4.19.5"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40193"
FT                   /db_xref="GOA:D7GQW8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010229"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQW8"
FT                   /protein_id="CBL40193.1"
FT                   /translation="MLLVKNAKVYAPEYLGVKDILIAGGRIERIADHLPEYEGCEVIDG
FT                   TGKIVTPGIIDRHVHVTGGGGEGSFHTQTPQVQLSSLIKGGVTTVLGLLGTDGISRSVE
FT                   NLLAKVKALKEEGISAYAICGAYGYPSTTVTGSVSKDIMFIDEILGVKLAISDHRAPNI
FT                   TTEELIRLASDVRTAGMLSGKPGFICLHMGGDKRALKPVFEALERTSIPPKTFQPTHVG
FT                   RNANLLEDAFKFAKMGGTIDLTCGESESKFHSVADAVKKAKEEGVPMEKVTMSSDGQGS
FT                   WSNYDAEGKLVEIGVSDVDTIYRQIVYMVKEENMDFEELLALGTKNPAMALELYPKKGA
FT                   VKEESDADILIMNEDLSLDTVIAMGVPMMRDGKILKKGTYEK"
FT   CDS             361395..362939
FT                   /transl_table=11
FT                   /locus_tag="CK3_03460"
FT                   /product="GMP synthase (glutamine-hydrolyzing), C-terminal
FT                   domain or B subunit/GMP synthase (glutamine-hydrolyzing),
FT                   N-terminal domain or A subunit"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40194"
FT                   /db_xref="GOA:D7GQW9"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQW9"
FT                   /protein_id="CBL40194.1"
FT                   /translation="MNQEKIIVIDFGGQYNQLVARRVRECHVYCEIYSYRTPIEQIKAM
FT                   NPKGIILTGGPNSVYEEGAATCSKELFEMGVPVLGLCYGAQLMSYVLGGHVCKAPVREY
FT                   GKIEVTVDKTSKLFGNVSEKTICWMSHNDYIEKAAPGFKIVAHTPDCPVAAAECAEKKL
FT                   YAIQFHPEVLHTQEGTKMLHNFIYEVCGCAGTWKMDAFVENSIKAIREKVGNGKVLCAL
FT                   SGGVDSSVAAVMLAKAVGDQLTCVFVDHGLLRKNEGDEVEEVFGPNGPYDLHFIRVNAQ
FT                   QRFYDKLAGVEEPERKRKIIGEEFIRVFEEEAKKIGAVDFLVQGTIYPDVVESGLGGES
FT                   AVIKSHHNVGGLPDYVDFKEIIEPLRDLFKDEVRKAGLELGIPEKLVYRQPFPGPGLGI
FT                   RIIGAITPEKVKMVQEADAIYREEIAKAGIDRNIGQYFAALTNMRSVGVMGDERTYDYA
FT                   IALRAVNTIDFMTAEAAEIPWEVLGIVSSRIVNEVPHVNRVLYDCTGKPPATIEFE"
FT   CDS             complement(363020..364204)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03470"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40195"
FT                   /db_xref="GOA:D7GQX0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQX0"
FT                   /protein_id="CBL40195.1"
FT                   /translation="MAKDPIKKAENGTYYFRANLGFHPITGKQIQKYKSGFKTKKEARE
FT                   AYSKLMLTSTEELTEKKQQLSFQQFIEETYLPWYKTQVKESTYLNRRSTIQKHFSYFYK
FT                   MTVDEIEPINVQNWQLELAKEFSPNYIRIVQGMLSIAFDRAVVLGLAKKNPSRMIGNIK
FT                   SKKTKVDFWTLDEFQKVISLLYKGDYYEHYLFISYWLLFMTGMRIGEAAALQWSDINFE
FT                   TGLLSITKTLYYKTIDEYKFVEPKTQASIRTIYIDTDTIKELKAWQEVQQKVLKDCDLV
FT                   LSYNGIPTSKHTLPRALEKLAGLAGVHRIKIHALRHSHASLLISMGENPLLIKERLGHE
FT                   KIQTTLGTYGHLYPNTNVEVAKKLTGVLTYTPATTSVADYTSNQHTAIYHRAVE"
FT   CDS             complement(364241..364435)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03480"
FT                   /product="Protein of unknown function (DUF3173)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40196"
FT                   /db_xref="InterPro:IPR021512"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQX1"
FT                   /protein_id="CBL40196.1"
FT                   /translation="MITVTKKDLIELGYGTSFAADIIREAKKLMISKGHTYYQSRKLDR
FT                   VPREAVEELLGITFTDKSN"
FT   CDS             complement(365009..365248)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40197"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQX2"
FT                   /protein_id="CBL40197.1"
FT                   /translation="MTAKHPMIPFPVIVRAADGDIEAVNQIVRHYSGFIASRSMRPMKD
FT                   EYGNTLMVVDETLRRRMETRLIAKILSFEIREPK"
FT   CDS             complement(365245..365664)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03500"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40198"
FT                   /db_xref="GOA:D7GQX3"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQX3"
FT                   /protein_id="CBL40198.1"
FT                   /translation="MKPSEFQTTIENQFDYICKVAMEDERKDYLKALSRQCKRETLFCD
FT                   MDDYTVNLFSSEDTYPSHFHTFEMDGFTVRIENSLLAEALENLDGKKRDVILRYYFLGF
FT                   DDTEISKILEVNRSTIQRRRHAGLEFIKKFMEEEA"
FT   CDS             366265..366621
FT                   /transl_table=11
FT                   /locus_tag="CK3_03510"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40199"
FT                   /db_xref="GOA:D7GQX4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQX4"
FT                   /protein_id="CBL40199.1"
FT                   /translation="MRKKEDKYDFRALGLAIKEARKKQGLTREQVGAMIEIDPRYLTNI
FT                   ENKGQHPSLQVLYDLVSLLNVSVDEFFLPASSQVKSTKRRQLENKIDNFTDADLVIMES
FT                   VADGIVKSKEVGEM"
FT   CDS             complement(366654..367349)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40200"
FT                   /db_xref="GOA:D7GQX5"
FT                   /db_xref="InterPro:IPR003199"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQX5"
FT                   /protein_id="CBL40200.1"
FT                   /translation="MCTRFVYNGKETIVGFNFDIDLSEWEHTVIAEKDRFFIGIKMSDN
FT                   KYHSFHGINRNGNVGTLLYVHGNDNAQFCGNESCYTIADLTENFIKGNLSFDDSLEIVK
FT                   KKKITYAPDTTMQAMFSDRTGRVLIIEPGIGYRLEKEKYSLITNYSILKPELTNPYVLS
FT                   GDNRYEKAKDLLQGYGENFSISNAFDVLRSVRQEGLWATRVSFVYSVAKNKVYYVLNND
FT                   FKNIAEYQF"
FT   CDS             367529..368089
FT                   /transl_table=11
FT                   /locus_tag="CK3_03530"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40201"
FT                   /db_xref="GOA:D7GQX6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQX6"
FT                   /protein_id="CBL40201.1"
FT                   /translation="MRVTKAEVIKTASDMADRNGLHNVSLKAIAENLGIRTPSLYNHIG
FT                   SLDELLREIAHSGMRTMNEKMIRAVIGKTGDSALKLVAVEYLNYMIEHPGVYEIIQWAS
FT                   WNGTEETAIIFNDYLSLLKTLICSCGFNPDKTTEILNMVTGMLHGYTTLQLRYAFSNPD
FT                   KVRKELSEAIDTLLLGANQKYKD"
FT   CDS             complement(368165..369073)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40202"
FT                   /db_xref="InterPro:IPR024735"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQX7"
FT                   /protein_id="CBL40202.1"
FT                   /translation="MIQIRKEDNQKKQKEKKLKVYKVNTHKKTVIALWVLLAVSFLFAV
FT                   YKNFTAIDIHTVHETKVIEETILDTHKIENFVENFAEVYYSWEQSAASIDNRTNALKGY
FT                   LTGELQALNVDTVRKDIPVSSALTDFQIWEITEEKEQHYQVTYAVEQHITEGESVKTVR
FT                   SAYQVTVYVDGSGNLTIIQNPTITSVPVKSGYTPKAVQSDGTVDSITTEEINEFLTTFF
FT                   KLYPTATAKELTYYVNEGVLKPVGKEYIFSELVNPVYNRNGNQVTASLAVKYLDNQTMT
FT                   TQVSQFDLVLEKNGENWKIVK"
FT   CDS             complement(369090..370094)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03550"
FT                   /product="Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40203"
FT                   /db_xref="GOA:D7GQX8"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQX8"
FT                   /protein_id="CBL40203.1"
FT                   /translation="MKLRHLFFACSGVFVMMFSLLLLVVIVFSDEEDGGSGGNLIYGGV
FT                   SVSQEVLAHKPMLEKYAKEYGIEEYLNVLLAIIQVESGGTLEDVMQSSESLGLPPNSLS
FT                   TEESIKQGCKYFSELLAAAETKGCDLNSVIQSYNYGGGFLDYVAGHGKKYTFELAESFA
FT                   RDKSGGKKVTYTNPVAVEKNGGWRYSYGNMFYVLLVSQYLTVAQFDDETVQAIMEEALK
FT                   YEGWTYVYGGDSPSTSFDCSGLVQWCYGKAGIALPRTAQEQYNVTQHIPLSEAKAGDLV
FT                   FFHSTYNAGTYITHVGLYVGNNRMYHAGNPIGYADLTGSYWQQHFAGAGRIKQ"
FT   CDS             complement(372472..374922)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40204"
FT                   /db_xref="InterPro:IPR016628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQX9"
FT                   /protein_id="CBL40204.1"
FT                   /translation="MAYPIKYIENNLVFNHDGECFAYYELLPYNYSFLSPEQKYQVHDS
FT                   FRQLIAQNRDGKIHALQISTESSIRAAQERSKQEVTGKLKDIACAKIDAQTEALISMIG
FT                   ENQVDYRFFIGFKLLVNEQEVTMKQFRREAKTAVSDFLHEVNHKLMGDFVSMSNEEIWR
FT                   FQKMEKLLESKISRRFKVRRLNKDDFGYLIEHLYGQTGTAYEDYEYYLPKKRFQEETLV
FT                   KYYDLIKPTRCLIEENQRYLKIEQEDGTVYAAYFTINSIVGELDFPSSEIFYYQQQQFT
FT                   FPIDTSMNVEIVTNRKALSTVRNKKKELKDLDNHAWQNDSETSTNVVDALDSVNELEST
FT                   LDQSKESMYKLSYVVRVTAPDLEELKRRCNEVKDFYDDLNVKLVRPFGDMLGLHGEFLP
FT                   ASKRYLNDYIQYVTSDFLAGLGFGATQMLGEPEGIYIGYSLDTGRNVYLKPALASQGVK
FT                   GSVTNALAAAFVGSLGGGKSFSNNMIVYYSVLFGAQALIVDPKAERGRWKETLPEIAHE
FT                   INIVNLTSEEQNRGLLDPYVIMENPKDSESLAIDILTFLTGISSRDGEKFPVLRKAIRA
FT                   VTNSEERGLFKVIEELRAEGTTISTSIADHIESFTDYDFAHLLFSDGDVTQSISLEKQL
FT                   NIIQVADLVLPDKETSFEEYTTMELLSVAMLIVISTFALDFIHTDRSVFKIVDLDEAWS
FT                   FLQVAQGKTLSMKLVRAGRAMNAGVYFVTQNTDDLLDEKLKNNLGLKFAFRSTDINEIK
FT                   KTLAFFGVDSEDENNQKRLRDLENGQCLISDLYGRVGVIQFHPIFEDLFHAFDTRPPVR
FT                   KEVE"
FT   CDS             complement(374906..375298)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40205"
FT                   /db_xref="InterPro:IPR025608"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQY0"
FT                   /protein_id="CBL40205.1"
FT                   /translation="MKKIRSYTSIWSVEKVLYSINDFKLPFPITFTQMAWFVVSVFAVM
FT                   LLGNLPPLSFIDGAFLKYFGVPFALTWFMCQKTFDGKKPYGFLKSVLAYLVRPKLTYAG
FT                   KPVKLEKEYPAQPITAVRSDIYGISD"
FT   CDS             complement(375905..376399)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03600"
FT                   /product="Antirestriction protein (ArdA)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40206"
FT                   /db_xref="InterPro:IPR009899"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQY1"
FT                   /protein_id="CBL40206.1"
FT                   /translation="MRIYILNTTRFYHEDFEEYPGAWFSCPVDFEEVKERLGVQSEEEI
FT                   EIEDYELPFPLEGNTRLWEINALCRMVQEMQGTPLYYEMDVVQKRWFSSFTEFIDHKDQ
FT                   IRCYPVQDGESLARYLVQEVQIFGEVHPDLLNHIDYASIGRELETSENYLFTDNGIFYY
FT                   R"
FT   CDS             complement(376472..376978)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40207"
FT                   /db_xref="InterPro:IPR025982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQY2"
FT                   /protein_id="CBL40207.1"
FT                   /translation="MKDFIDFLKLPPNILGALSIASGTLLLLPQKLAQKFYIINFREKY
FT                   GFTIGIVFVISTALLIVLLLSKIFHFFYDKYASKRLGTAQIKYLKNMTPEQVTIIREFL
FT                   REPTHTLPLPMNNGLVIELQHLQILTPAGQTHLVSMLDPQINYFLQPWVIKKINSDEEL
FT                   KRIFY"
FT   CDS             complement(377166..377387)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40208"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQY3"
FT                   /protein_id="CBL40208.1"
FT                   /translation="MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLVV
FT                   SLVAVGLVFNADGVKDILLELFNKIIGA"
FT   CDS             complement(377439..378419)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03630"
FT                   /product="Putative phage replication protein RstA"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40209"
FT                   /db_xref="GOA:D7GQY4"
FT                   /db_xref="InterPro:IPR003491"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQY4"
FT                   /protein_id="CBL40209.1"
FT                   /translation="MLFDYVRIRFPTTDVKHIVEDVLRLKLPYFIHEDYGFYSYTEHYY
FT                   LGDIFVLVSPELEKGVLLELKGRGCRQFESYLLAQERSWYEFFMDVLMEDGVMKRLDLA
FT                   INDKTGILNIPHLTEKCRNEECISVFRSFKSYRSGELVRREEKECMGNTLYIGSLQSEV
FT                   YFCIYEKDYEQYKKHDIPIADAEVKNRFEIRLKNERAFYAIRDLLEHDNPERTAFQIIN
FT                   RYVRFVDKDDTKPRSDWRISEEWAWFIGEHRGSLKLTTKPEPYSFERTLHWLSHQVAPT
FT                   LKLALRLDKMNHTQIVHDIITHAKLTEKHEKILKQQAAAAKEVVL"
FT   CDS             complement(378814..380211)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03640"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40210"
FT                   /db_xref="GOA:D7GQY5"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQY5"
FT                   /protein_id="CBL40210.1"
FT                   /translation="MKQLFPRGKRIRPTDKDLVFHTALAALFPVFLLVVLLFHIRQIAG
FT                   TNWQEVSLSQIIQDVNIPYLLFSMGVAGLVCLAAVLLFWRYRRDEVKQLIHRQKLARMV
FT                   LENKWYESEQRKEDTFFKDLSSSRSKEAITYFPKIYYRMKQGLLHIRVEITLGKYQEQL
FT                   LNLEKKLESGLYCELTDKELKDSYVEYTLLYDTIANRISIEDVQAKDGRLRLMENVWWE
FT                   YDKLPHMLIAGGTGGGKTYFILTLIEALLRTNAILFVLDPKNADLADLQAVMPDVYYKK
FT                   EDMLSCIDRFYEEMMKRSEDMKLMENYRTGENYAYLGLPANFLIFDEYVAFMEMLGTKE
FT                   NAAVLNKLKQIVMLGRQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMM
FT                   FGETTKDFFLKQIKGRGYVDVGTSVISEFYTPLVQKGHDFLKEIKKLTDSRQGVQAACE
FT                   AKAAEAD"
FT   CDS             complement(380247..380624)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03650"
FT                   /product="Bacterial protein of unknown function (DUF961)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40211"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQY6"
FT                   /protein_id="CBL40211.1"
FT                   /translation="MRLANGIVIDKEATFGALKFSALRREVHLQNEDGSVSEEIKERTY
FT                   DLKSRGQGRMIQVSVPASVPLKEFDYNAEVELINPVADTVATATFQGAEVDWYIKAEDI
FT                   VLKKGAAMNPQPPKKDAPPVK"
FT   CDS             complement(380646..380960)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03660"
FT                   /product="Bacterial protein of unknown function (DUF961)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40212"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQY7"
FT                   /protein_id="CBL40212.1"
FT                   /translation="MELKFVIPNMEKTFGNLEFAGEDKTEQRRINGRIAVLSRSFNLYS
FT                   DVQRADDIVVILPAEAGEKHFDFEERVKLVNPRITAEGYKIGTRGFTNYILHADDMVKA
FT                   "
FT   gap             381637..381996
FT                   /estimated_length=360
FT   CDS             382853..383248
FT                   /transl_table=11
FT                   /locus_tag="CK3_03670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40213"
FT                   /db_xref="GOA:D7GQY8"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQY8"
FT                   /protein_id="CBL40213.1"
FT                   /translation="MEKAGTKRRDIHFRSDKNGIVVCVHSREAREYARYLEASADVASY
FT                   EAGTVLDSDKYPFINTIGIRKEYFDTQWTSDFVIHFTDGRTGIRELTNKDGLSKRAAIE
FT                   KLEFSRRYWSTTKVAEWKIVVMEKGEC"
FT   CDS             383250..385013
FT                   /transl_table=11
FT                   /locus_tag="CK3_03680"
FT                   /product="Integrase core domain."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40214"
FT                   /db_xref="GOA:D7GQY9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQY9"
FT                   /protein_id="CBL40214.1"
FT                   /translation="MFLESCGEVIRVLCGNEEGNWVISYDNPCTPKFVLRDDLRSMERI
FT                   EPPKDFQMRMTQEQTPGQKKRQELISELLEEESYVWDRTGRNTKIREIAAREKTSERRI
FT                   RELYFRALAGRALVEERKKAEKEETKEEKDFLWAIDTFYYTAKKFSLRSAYDMLLLSRY
FT                   TDPDGHLLDVYPSWNTFRHYFYDKNFHKKSRNLIARNGLTDYQRNKRPLFGSASAWKEQ
FT                   IGVFQMDATQADIYLVSRLDRSEVIGRPYIYLAVDTATQLIAGVYVGMDAGEQAVINCL
FT                   SNAAADKVSFCKRYGLDIKKEEWPNIGLPGEIITDKGREFIGTRMNELAMKYGIEFESL
FT                   PPFRPDGKGLVEKSFDLIQQRYKPALRGKGVIEADAQERWAVDYRSQAVLTLEEFTKVI
FT                   LSCILYLNSCRVIENHFCKDADPVAAAMWMKCEKEKRSLVIPINSEELYRFGLPRTSAT
FT                   LNRRGICYQGLWYVSENYKEFLESHNIGEIVRICYDSEDVSRLFLLNGMNYIPFELSRH
FT                   SKQYAGATESEYQMKRKAERDSRKESELRDTEGRVRLLKDIESVVKQAEYRDKNKISTK
FT                   RMEQAKEMERV"
FT   gap             385851..386775
FT                   /estimated_length=925
FT   CDS             386777..387454
FT                   /transl_table=11
FT                   /locus_tag="CK3_03700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40215"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQZ0"
FT                   /protein_id="CBL40215.1"
FT                   /translation="MSQEHLKRRTRGFRLLPLKYDVTYRKFITELWDSQVVLQKTELTE
FT                   KLMKQIYDLSAGIPSYIVKIFQEAQVQAILTGKEKLSYEVLKQAVMCLGIEVPKTYGWS
FT                   GTSISDFTVQEVTVNEEAVESVEIEVQTTEETSLEGDCQEEISLDSVDGRRDKLDAENI
FT                   RDEELPGSAEKTSSKRFYAVKRGRKKSERDDSDLLELWTENPSADALLLNLEQFYMLER
FT                   RCF"
FT   CDS             387454..388686
FT                   /transl_table=11
FT                   /locus_tag="CK3_03710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40216"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQZ1"
FT                   /protein_id="CBL40216.1"
FT                   /translation="MLQYFPTPYPDELWYSVLGRYHVRSGNPNSATTLRELFGAESVGG
FT                   MGNFLPNCGIRRVAEKLPEGVLDARKVALHHTLFPYTFRFQDLSTKEKLLEQALNEKVK
FT                   FPIKLPKPYTSTVLKYCPLCMREDRERYGEAYWHVTHQIPYVTTCTKHRCRLRMKDGMK
FT                   KWTLNDNLFLPMDEEEIEADLDITETEAELSGILVKYQELPIEKGPTETHNNLYEGLLN
FT                   SDYGIARKDKNFSIDYKSVETDLLERFGKDFIEEHFGTPVMRAAIFGNIRNWNYKLPER
FT                   YAILSTLIHQDPEITFSEERLENKTVSLFLRMSKEPMIRSKKYVARSLGMKEKHLDILA
FT                   HNLNVVPFWEQKPDAERAKEYRGYVCFTEDEWAYVQDSVSKYGFQSSSAFIRFCVGQYR
FT                   DRENMHFIIND"
FT   gap             388756..389882
FT                   /estimated_length=1127
FT   CDS             390469..391359
FT                   /transl_table=11
FT                   /locus_tag="CK3_03730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40217"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQZ2"
FT                   /protein_id="CBL40217.1"
FT                   /translation="MKKLAVGAVAGVLTAAMCMPGFAAIISTEQGGVTNYIKTDSYKGY
FT                   ENFPCWIWYQGYCYYYDQNGNYLTNTTTPDGYTVDELGRWTVNGNPIHNGAGNYKMNTE
FT                   DYNGKSDDEIWALMKEKLIPVYKEAIVGWDYDGPDANGKHIHIDQYTYGYGDNIIWTDK
FT                   DMSTYGGYGETGIEHNSQRLGTFVTAWLANDWSDLERRYNNAISKAVYSQKPDIKEKTI
FT                   KTVVGDKIGTELFNYIKQHADKIIPDAEWNPNSNPDGIKASKLDFSAWQNRKTDYGKIF
FT                   SVEVTGEVINIKVYK"
FT   CDS             complement(391459..391680)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40218"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQZ3"
FT                   /protein_id="CBL40218.1"
FT                   /translation="MLEKLLEFIRSKIFEKIAIAIVFVNVIVVYILIYHMYSIIDYATL
FT                   IRYIIKCLTLEFFVAAFAIIYNILTREK"
FT   CDS             392421..392606
FT                   /transl_table=11
FT                   /locus_tag="CK3_03760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40219"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQZ4"
FT                   /protein_id="CBL40219.1"
FT                   /translation="MELTDIMVKDSEGIVIYRANRDDGGSWNTIVKGYFDKDEDVKYIN
FT                   PLRTESQDVRHISTSK"
FT   CDS             392783..393079
FT                   /transl_table=11
FT                   /locus_tag="CK3_03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40220"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQZ5"
FT                   /protein_id="CBL40220.1"
FT                   /translation="MRDVTELVELRDRAYEGGVELKNAIVNKTGKTVHDYMYVRADKMI
FT                   QAMHYGRNNEFMDNVLKLSNMFELPIPRPLLEGMADEEKFNVVSRSYMIGLLS"
FT   CDS             393192..393983
FT                   /transl_table=11
FT                   /locus_tag="CK3_03780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40221"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQZ6"
FT                   /protein_id="CBL40221.1"
FT                   /translation="MDYTLLAQDNSFQSWSRLEPMDTDYTKYGEKDPSVIAAGHKCVDV
FT                   YNAFANARQSFMAAGYHNYGDLCSDNEMSRLYTKTHFLLHAIFEYAICLDLSWQVIWAY
FT                   VQPGSFEYLSKNEYKEMEGDCERDNLIRLLNCAIAQRNVKVERIKDIMLKFDNDEDVKR
FT                   LRTLYNSLKHRGTIHFVGLGENAKTMMMKVDGKSLSRLSREEYTVEAVEKILFDYHKKF
FT                   QTYFNELIKEIIPDDYLNKKVSFVDYANTMMKIDSVQNKCK"
FT   CDS             complement(394055..394360)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40222"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQZ7"
FT                   /protein_id="CBL40222.1"
FT                   /translation="MKKIINSIPYSTDSSCRLGYFQHRTILDPTYCREELYITRQGTYF
FT                   LYVEGRESSPYCFQGDPFPTAGCDLTVLSDIEARIWAEHRLTPDECEFIFPGPKAS"
FT   CDS             complement(394378..394728)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40223"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQZ8"
FT                   /protein_id="CBL40223.1"
FT                   /translation="MDTYTPHLTSLEYFGLETLFRHLITEYGSTYQGEGANLDFRRTHQ
FT                   GVSVCDPYYFGSFAARELIMIGDVCALVGSSAWSADRADPGPCDTMIDVTEYLKTPGLP
FT                   IDYLMDKIAMTC"
FT   CDS             395067..395327
FT                   /transl_table=11
FT                   /locus_tag="CK3_03810"
FT                   /product="prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40224"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:D7GQZ9"
FT                   /protein_id="CBL40224.1"
FT                   /translation="MPQIVPISHLKNTSEISEMCHSAREPIFITKNGYGDMVLMSMENY
FT                   ERMVRMAKIYEELEESERQVEAGQTMNAREHLASVREKYGL"
FT   CDS             395317..395634
FT                   /transl_table=11
FT                   /locus_tag="CK3_03820"
FT                   /product="Plasmid stabilisation system protein."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40225"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR00"
FT                   /protein_id="CBL40225.1"
FT                   /translation="MGYNLEVTRKASQHVDKLVAYLLDPLKNGQAASHFLSGVDEVYAR
FT                   LEEDPWQFPACTDYVLRKKEYRKAKIPGMSYVVIYQVDEEIRTVYVMGIFHELENYGIK
FT                   L"
FT   CDS             397083..398519
FT                   /transl_table=11
FT                   /locus_tag="CK3_03840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40226"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR01"
FT                   /protein_id="CBL40226.1"
FT                   /translation="MKTTNWDFYLTGDRPESGYLRFKIGNVRLGKEKSRWFDYDEATLY
FT                   YDYVVDPEVITQKPKGFILSLDDLAFIFFQHEDMYADEKSIIIESTDRENTIDITDANS
FT                   VVDIVEQMNGKSYKLVLKYESTLSMENIMAHMTYWMQFKNKEKLPRNFFIEYPGDDGKL
FT                   CWMEYNVKEKRLEFCINDGKFAGFDGSRLTLAMTCDKHKWYEFERFDLIRAISRWLTIE
FT                   TLYDYALQKPVTIEYEDGVTEVKTFKNSSSFRKCIENMIDGKKRIENAYVENISQDTIR
FT                   QMVDENYYDTHRLFVIPVENDVFRSQYRMIPSMANRKYKYIFLDELADMDEGKKKISNA
FT                   KKFAEPVLYHFTSKKILGMIQSCGFIMYPYIPIDPKEKIVWLTSVPSWKKAAVDSRVFM
FT                   KNRIRITVRKKDYMEWYFDWNTYAKESLEKDPSTYYDDSFYDFIHWYVAVEPIPMSDVL
FT                   RIEDLVTQEVLYEAEDAKYE"
FT   CDS             398604..399725
FT                   /transl_table=11
FT                   /locus_tag="CK3_03850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40227"
FT                   /db_xref="GOA:D7GR02"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR02"
FT                   /protein_id="CBL40227.1"
FT                   /translation="MLDFRYPLRKVKIRDGRKWLSLIKEKREMFMTKICPLCGKTAEAS
FT                   DSNVIEDKEIIWDFTYCKVCGRFELSEANDDPKRFNRDHLMSYLVYNGIHKSNDYRYYT
FT                   TRPKEWCDKWREEFDKGNKEHGRPIHLSPEIVENWYPKTISERVDLILKYIADHTSHMG
FT                   SFVQYGEDKRLYSVLFVDRYEMSNLGEKIIPEPQVESQFKFIIDYLTKKEYINISKIGS
FT                   RLSPHDCISLTVDGYSRVEELERSNSNGREVLIAMKFGDDTIALREAIRKGIMDAGYVP
FT                   ALIDEVPHNGFITPELLSHIRNSKFVVVDLTHQNNGAYFEEGYAMGYGKEVIQLCKDTT
FT                   KLHFDIAQKNTIIWQTEGDIPERLKKRILATID"
FT   gap             399797..399977
FT                   /estimated_length=181
FT   CDS             complement(400985..401761)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03870"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40228"
FT                   /db_xref="GOA:D7GR03"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR03"
FT                   /protein_id="CBL40228.1"
FT                   /translation="MTNQSTIDKLIEMHMTSMADAFRNQMQDISMKEIPFDDRFGMIVD
FT                   IEYTSRKNSRLKRLIKNAEFEQPDATIAAVDYGHNRKVNRHLIERLATCEYITEYRNIF
FT                   ITGATGSGKTYLACAFGMEACKRYYSVKYVRVPDLLLDLQEARDEGRFKDALKKYTNPT
FT                   LLILDEWLLMRVTEKDSANLLELIHKRRKHSSTIFCSQYLEEDWYQKLGGKDNPLTDAI
FT                   MDRISFDSYKIPIMSLDPEKDISMREVYGLDPSQAQ"
FT   CDS             complement(401758..403308)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03880"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40229"
FT                   /db_xref="GOA:D7GR04"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR04"
FT                   /protein_id="CBL40229.1"
FT                   /translation="MTKYREILRLTALGLSLRDIEKSLKVSRKTVVKVQKRADELSLSW
FT                   PLDESLTDAELEQRMFPKDLSPKSTKRMPDFDYIRKELLKNGVNKKLLWTEYLEECSQN
FT                   GDDALMYSQFCYYIQQNEQKSRATMHIPRKAGQQIEVDWAGDPAKIIDPDTGEITEAWI
FT                   FVGVMTYSQYAFVEAFINEQQKSWITAHVHMYEFFGGVTPILVSDNAPTATNRKQSDKY
FT                   ESVLIKSYEELAQHYNTAIIPARVPAPKDKPSVEGNVGHVSTWITAALRNEQFFSLEEL
FT                   NQEIRKKLKKYNAASFQKKEGSRQKLFLEDEKPLLMPLPATRFELAEHRTATVQFNYHI
FT                   AVDKMYYSVPYQYIKDKVDVRVTDTTIEIFKDFRRIASHKRLYGRPGQYSTVLEHMPPD
FT                   HQKYLEWNGDRFRKWAETIGINTYKVVNSILTSGRVEQQSYRACMGLLKLAERKSSQQL
FT                   ENACAKALQYSNSPSYKSIKNILTADRGAKSEAPQKQTNESSQSGITRGARYYGGKRS"
FT   CDS             complement(403460..403747)
FT                   /transl_table=11
FT                   /locus_tag="CK3_03890"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40230"
FT                   /db_xref="GOA:D7GR05"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR05"
FT                   /protein_id="CBL40230.1"
FT                   /translation="MTIGERIKKIRVFRKMTMDDLGGALGFEGKNMSVRISQYETGARI
FT                   PGEDMILKLADALHCNYKAISDYSLGAAEDIIETLFWLEESAASLPARGK"
FT   CDS             403807..404520
FT                   /transl_table=11
FT                   /locus_tag="CK3_03900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40231"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR06"
FT                   /protein_id="CBL40231.1"
FT                   /translation="MSDKVVVTIPEKVLCKAIQIKDCRAEAFCGWWSKVYRESSSRKRN
FT                   IENEEQYHEYQIWHVGVQEELDELKQEKRNIKKQIQLADGIVKEDLYTAYYAVSEKEEI
FT                   VADRDVEIPGMEDEAVSEKDVAVEPETNVVVINPDNNQNEIGRQKEQADSARKQQTDLG
FT                   GIGIPEILNLSDVNMTRMDESIINVTSKSELVNMKKKSLWTKLAGLSGEYQSLVVLRMS
FT                   VILLRQMYSDLILLM"
FT   CDS             404535..404687
FT                   /transl_table=11
FT                   /locus_tag="CK3_03910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40232"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR07"
FT                   /protein_id="CBL40232.1"
FT                   /translation="MFSDVMKRLGIKLDGDELYEEFQRIYDESVGRDVDKGKMEDKMRN
FT                   RDRGR"
FT   CDS             404872..404994
FT                   /transl_table=11
FT                   /locus_tag="CK3_03920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40233"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR08"
FT                   /protein_id="CBL40233.1"
FT                   /translation="MEQAKEQGVLQIALEATDMGRPLYERHGFVKMEDEMELIK"
FT   CDS             404991..405326
FT                   /transl_table=11
FT                   /locus_tag="CK3_03930"
FT                   /product="Fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40234"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR09"
FT                   /protein_id="CBL40234.1"
FT                   /translation="MTRVYFVRHAQLEHDWEEDRTRPLTEEGKKDSVVVLEFLSNKKKD
FT                   AFYCSPYKRSMDTIAEAADFFTKEIITDERLREREKGPDGNNYGMFQKRWADHDYHEDG
FT                   GESIAMV"
FT   CDS             405616..408327
FT                   /transl_table=11
FT                   /locus_tag="CK3_03950"
FT                   /product="Uncharacterized conserved protein
FT                   (DUF2075)./Protein of unknown function (DUF2726)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40235"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR10"
FT                   /protein_id="CBL40235.1"
FT                   /translation="MVIIKGEIKTSEIMSCGYNRNTQKWDVKFNNGKTYSYAYLNVEKL
FT                   TDPEVLNPNMYRISREGREFFAVNAIYVFRSGSESYWHICFGDGSERDYRRNDLHIIES
FT                   CLAHSQSSNVFEYIKQIAGLSNLKNEETGEKLLSKKFAKISFVGSDVALAKYLNPSSLQ
FT                   GKRTGREYIPIFPFGCNNSQYKAVKNAMENQISVIQGPPGTGKTQTILNIIANILMQGK
FT                   TVQIVSNNNSATENVYEKLSSPKYNLGFIAATLGSSKNKKLFVEHQDAAYPDFSSWKTG
FT                   EDQSVLQKEIEEQSSQLKSVFDKQEKLACLRQELSQLVTEQEYFNQYVKESDVHTDSIK
FT                   FKKKLSSKQWMVLWQECQLISEEKTAIGFWFKIKALFKYRVTDWSIYKQDISKIITTFQ
FT                   AMYYRAKRAELSGKIADIEKYLNSVNKNLLEDLCDQSMVVLKDKLARKYEGNSSRKTFS
FT                   EDNLWKEPYDVLAEYPVILSTTFSSRNSLNSDVVYDYLIMDEASQVDIATGALALSCAR
FT                   NVVIVGDTKQLPNVVTGDIKAKAKVIFDSFNVSEGYQYTNSFLQSILDVMPNVTQTLLR
FT                   EHYRCHPKIINFCNQKFYRGELIIMTTDKGEQDVLSVVKTVVGNHERNHYSQRQIDVIK
FT                   NEIIPKYVSNPEETGIIAPYKNQVEALSKEITDIDAATVHKFQGKEKENIIISTVDDEI
FT                   SDFADDPYLINVAVSRAKKKLMLVVTGNEQSKERNITDLIDYIQYNNFEVTESKIYSIF
FT                   DYLYKQYTEERRAYLQKHKKVSEYDSENLMYSLIEDIISANKYSSLDVVCHFPLNMLIK
FT                   NPELLNEQECQYAMNPATHLDFLVYNRIGKKPVLAIEVDGYEYHKEDTVQASRDLLKNH
FT                   IMELYEIPLLRFMTNGSGEKEKIIEMLDKSVG"
FT   CDS             408345..409439
FT                   /transl_table=11
FT                   /locus_tag="CK3_03960"
FT                   /product="Restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40236"
FT                   /db_xref="GOA:D7GR11"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR11"
FT                   /protein_id="CBL40236.1"
FT                   /translation="MEIIRRDELQELLDVVRMKPYGKILITGAAGSGKTFLLNIIGKIL
FT                   EEQGRKIWYETMVFSQMGNKIWKHSSDFTDVVCLVDGLDEIYRYKQQMVENIKNARGCY
FT                   ICTARENKFDINFDYEIRLKPLTDKQILLFISDYLGARISSDSIVEGIFKELDKQNLTP
FT                   RTIAEKLHTKLKGEGLNEYFLDFEKDIHQIYTYKGGVSLQHPEIVVPERKIIRVPDEIK
FT                   NDIKVVTHSLVDKVALRPEILQEITPRQFEELVCELFERKGYNVQLTKQTRDGGKDLIV
FT                   LNNSVLGDLVIYAECKKKAPRHPVNVGLVRQLYGTVEADRVTAGIMVTNSYFSKDARRF
FT                   QQTIKSRMNLIDYSELMKQIMDCR"
FT   CDS             409478..410188
FT                   /transl_table=11
FT                   /locus_tag="CK3_03970"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40237"
FT                   /db_xref="GOA:D7GR12"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR12"
FT                   /protein_id="CBL40237.1"
FT                   /translation="MAVSYNKLWKLLIDKKMSKSDLRKKAEIAPNTMTKLRRDEEVSLT
FT                   ILSKICKTLHADFGDIVEYVPDAEIWDLYNENRELLGKDHIRGEQLPIDGYHLVVHVWI
FT                   RNSKGEYLISQRSANRPTHPLMWECVDGSVVKGEDSLQGALREAKEEVGIDLLPEKGQV
FT                   VLSDIKKIEFGKVANKIVDVWLFDYDGEVDLGNATTDEVAQVAWMNREQIKELFEHNMF
FT                   VDTLEYFFTEVDKQ"
FT   CDS             410209..411579
FT                   /transl_table=11
FT                   /locus_tag="CK3_03980"
FT                   /product="Predicted transcriptional regulator containing an
FT                   HTH domain and an uncharacterized domain shared with the
FT                   mammalian protein Schlafen"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40238"
FT                   /db_xref="GOA:D7GR13"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR13"
FT                   /protein_id="CBL40238.1"
FT                   /translation="MKEKEHQSIEWKESWQDEYLKWICGYANAYGGTIYIGTDDNGNVV
FT                   GIDNARDLLERIPNKITDTMGIIADVNLLYKGELEYLQIIVDKYPSLISFRGKYYYRSG
FT                   STMREITGKELERALLKTQGRTWDGVPLPKLTVSDLKQDAIQLFKDKAVKRGRLTNEEV
FT                   SVEDTILMDNLHLIDEDGYLIRAAMLAFYKDPEKWVTGSYIKIGYFGKSDSDLVYQDEV
FT                   HGSLIEQVDKTVDLVYTKYMKALIDYEGVQRIEQFMFHKDAFREILLNAIVHKDYSGCN
FT                   PIQISVYEDKIYIWNDGEMPPNLDSTDKLFMKHSSKPYNPKLANIFFKSGMIEAWGRGF
FT                   EKIREACALYDGPLPEYEINEAGIMVLCKACDRYLRLLRDDGQHPDHHPNQNGQDVNKL
FT                   IIDFCKDPKSVQEIMDEFDFDSRTSFRRKYLTPMLKNSVLKMTIPEKPSSKNQKYFS"
FT   gap             411676..413707
FT                   /estimated_length=2032
FT   CDS             414891..415658
FT                   /transl_table=11
FT                   /locus_tag="CK3_04000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40239"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR14"
FT                   /protein_id="CBL40239.1"
FT                   /translation="MNKAEKSQIIVLIACFACVFLSAALIWNYYKKPADENEALIVTIK
FT                   YPEYENAVITPVSTMECAIDNEFLHELQQISSSSDGNTDEHSYNYQYDTVPDRIYIKAP
FT                   DIYVFEQGKSKSSMTPCSVGSIAYYDDAPWFSITAVTIDKLYTGVFDITISIKAFKDIV
FT                   PVMTTLKIGDVVLDEVRSAPEKETVFENDSYISETFQFRYNRGALSDISDLVNEATFCT
FT                   EDVFHRISGAQITAECNIPSVKVIIEDSELSSK"
FT   CDS             complement(416508..417827)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04020"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40240"
FT                   /db_xref="GOA:D7GR15"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR15"
FT                   /protein_id="CBL40240.1"
FT                   /translation="MKKVVKFGGSSLASARQFKKVKAIIEADKTRCYVVPSAPGKRDSK
FT                   DTKVTDMLYQCYDAVCAGESYKRILDQIKKRYTDIIDGLDLNLNLDFEFAKIEENFLKK
FT                   AGRDYAASRGEYLNGIIAANYLGFTFVDAADVIRFDAEGNFLSEETNEEMREHLASLKQ
FT                   AVIPGFYGAKPDGTIHTFSRGGSDITGSIVARAVQADLYENWTDVSGFLVADPRIVENP
FT                   APIETITYTELRELSYMGASVLHEDAIFPVRKAGIPINIRNTNRPEDPGTMIVENTSKR
FT                   PHYTITGVAGKKGFCAMNIDKAMMNSEVGFGRKVLEVFEKNGISFEHMPSGIDTMSVLV
FT                   HQDEFQEKEQSVLSGIQRSVHPDVVTLESDLAVIAVVGRGMKAMRGTAARIFAALAHAK
FT                   INVKMIDQGSSELNIIIGVTNDDFEPAIRAIYDIFVKTEL"
FT   CDS             complement(417874..418521)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04030"
FT                   /product="signal peptidase I . Serine peptidase. MEROPS
FT                   family S26A"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40241"
FT                   /db_xref="GOA:D7GR16"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR16"
FT                   /protein_id="CBL40241.1"
FT                   /translation="MIIYMENNEKEKKEKTGWVAELISWVQVLVSAAVIAFVLTTFVIA
FT                   NSEIPTGSMENTIMAGSRVIGSRLHYKFSEPERGDVAIFVFGWQCPQCGAIIEGDKQDT
FT                   CPACGSEVGKHGHTIYYVKRVIGMPGDVIDIVDDQVYLNGSDTPLDEPYIAEPMNQHET
FT                   YHFEVPENCYFMMGDNRNYSLDARYWQNHYISRDKMVAKVFFEYFPTPKVIH"
FT   CDS             418977..421373
FT                   /transl_table=11
FT                   /locus_tag="CK3_04040"
FT                   /product="glycogen branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40242"
FT                   /db_xref="GOA:D7GR17"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR17"
FT                   /protein_id="CBL40242.1"
FT                   /translation="MEKILYDLMDWAGIEELVYSEASDPGRLLGEHVIKEGLLIQAFLP
FT                   NAEKVSVKIGGELFPMEMADENGFFAVLLEDRKELVPYHFCITYTDGDSEEIVDPYSYQ
FT                   FHTAFTEEEVRKFGAGIYYDSYEKFGAHPAVEAGIEGVHFAVWAPDAMRVSVVGDFNFW
FT                   DGRRHQMKKRGPSGIYEIFIPNLKPGAIYKYEIKTKAGLPMLKADPYGNYAELRPNTAS
FT                   VVWDMSGYKWNDDEWIKERAAAKDRLKDSPMSIYEVHLGSWMQKTVAQNENGEDINGSQ
FT                   FYNYREIAEKLAAYVKEMGYTHVELLPVMEHPLDESWGYQVTGYYAPTSRFGTPDDFKA
FT                   FMDHMHKEGIGVILDWVPAHFPRDAHGLAAFDGTCLYEHQDPRQGSHPHWGTLIYNYGR
FT                   PQVSNFLISNALYWAKEFHADGIRMDAVASMLYLDYGKNAGEWVANIYGGNENLEAVEF
FT                   LKHLNSIYARDTKGSVLIAEESTAWPKVSGDENDGGLGFDFKWNMGWMNDFLDYMQCDP
FT                   YFRHDHYGELTFSMLYAYSEKFVLVFSHDEVVHGKGSLAGKMPGDTQEKKFANLRTAYG
FT                   FMMGHPGKKLLFMGQDFGQMDEWNEKASLEWGLLKYDIHSQMKDYVKALNHLYRTQPAL
FT                   YRMDYEPEGFEWINCTYNDENIVIFERKTEKPEETLLFVCNFAPVEHEKFRLGVPFAGK
FT                   YKEILNSDAKQFGGSGMTNPRVKMSKKEEWDTRKNSIAINLAPMSVAVFSCTPYEEEAE
FT                   PEKKKTAEKRKRPARQPSVKLPASPLDVISEKVGQIIKTARESRH"
FT   CDS             421457..422269
FT                   /transl_table=11
FT                   /locus_tag="CK3_04050"
FT                   /product="Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40243"
FT                   /db_xref="GOA:D7GR18"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR18"
FT                   /protein_id="CBL40243.1"
FT                   /translation="MKEHTLDILTAALVKYGTRVFWAAVIVFVGLRIIRIARRAAGQIM
FT                   DRAGVEITLKKFLDMLLHAVLFGVMVFMAADQLGIKTTSFVAVIGTVTLAFSLAMQNTL
FT                   SNFAGGTLILLLKPFKVGDYISTSSGEGTVESIGLVYTTLLTTDNRVITIPNSSVSSAP
FT                   LTNLTRTGKRRLIINVGIGYSSDLLKAKNVLKKIFEENPGIMKDQPVQVVVDALGDSSV
FT                   VLSARGWTTCEDYWTAKWSITEAIKLTFDKEGIEIPYQYMNVMMTKES"
FT   CDS             422547..423383
FT                   /transl_table=11
FT                   /locus_tag="CK3_04060"
FT                   /product="Protein of unknown function (DUF3100)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40244"
FT                   /db_xref="InterPro:IPR021450"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR19"
FT                   /protein_id="CBL40244.1"
FT                   /translation="MKEHMADWRIHALAFVLTVIAEFIGTKKFSFGPLSFSLFPMLYVL
FT                   ILGAILGIVKLIPQKMMTEASPYIGISVMMLTAKIASTIGPNLGAVVKAGPALILQEFG
FT                   NLGTAVLALPIAVFVFHMGRAAIGTSFSISRESSLAVVADKYGLDSDEGIGVMGGYITG
FT                   TVFGTMFNGIFVSLLCSLNIFHPYALGMACGTGSASMLSASLAAVVEAYPDMEAEITAY
FT                   AATSNMLSSVDGLYMSLFIALPMCEFMYKLFTKNNRHYKDGLPIGAKVKVKAAGEE"
FT   CDS             423395..423880
FT                   /transl_table=11
FT                   /locus_tag="CK3_04070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40245"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR20"
FT                   /protein_id="CBL40245.1"
FT                   /translation="MDAAVWFKRIKCLVLVCIFASIGNFISTSKAGNPVTPLEAVPGLV
FT                   LLLLCTLVGCIIYELINKVSPKNLPAIAYISFIAILITIPGVSPIADYAIEQIGKIGLL
FT                   PLCTPILAYAGISIGKDVDTFKKQGFAIVVVAIFTFAGTFLGSTIIAQIILKMTGVI"
FT   CDS             424118..425434
FT                   /transl_table=11
FT                   /locus_tag="CK3_04080"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40246"
FT                   /db_xref="GOA:D7GR21"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR21"
FT                   /protein_id="CBL40246.1"
FT                   /translation="MYHDLTKGSISRSLLLFALPMMAGNILQQFYNIADTLIVGRVLGK
FT                   NALAAVGSSYTLMTFLTSIFLGLSMGSGALFSIYRGKGDERALKSSIAHACGLILAVTL
FT                   VLNVVVYIFIDPILNFLRVPEEVWGGMREYLLIIFAGLLATSLYNFFSCLLRALGNSTV
FT                   PLVFLAVSAILNIAWDLLFVAVFHWGIAGAAYATIFAQYVSGIGILLYVLFRCRSLLPE
FT                   RKDLRFDGGILKEIAGLSSLTCLQQSVMNFGILMVQGLVNSFGATTMAAFAAAVKIDTF
FT                   AYLPVQDFGNAYSTFIAQNYGAGNKERIRRGTKESFAISTAFSLVISALVFAFAAPLMQ
FT                   IFVSSAETAVIASGVRYLRIEGAFYFGIGCLFLLYGYYRAIKRAEMSVVLTVISLGIRV
FT                   LLAYVLSATFLGETGIWMAIPIGWILADLTGLLYMRKTW"
FT   gap             425445..425750
FT                   /estimated_length=306
FT   CDS             complement(425919..427376)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04090"
FT                   /product="Coproporphyrinogen III oxidase and related Fe-S
FT                   oxidoreductases"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40247"
FT                   /db_xref="GOA:D7GR22"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023995"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR22"
FT                   /protein_id="CBL40247.1"
FT                   /translation="MIGILLNDTAYEQDIRELLMAFYPGETFVHEKQDDVDFYVEGTCT
FT                   QNADETKFGLKITDPADTVADETVFPIDYDVRLNAKTTIKKELYGMLKKRTGKELPWGT
FT                   LTGIRPTKIAMTRLDQGEDEESIRSFMRDMYLTSKEKIDLSVEVAKRERELLSHIDYET
FT                   GYSLYVGIPFCPTTCLYCSFTSYPIGAWERKVHLYHEALFKELDYVAEKMKGRTLDTVY
FT                   FGGGTPTSLKAEELDALLTKIENTFDLSKVQEFTVEAGRPDSITEDKFKVLRAHNISRI
FT                   SINPQTMKQATLDLIGRHHTVDMVKEKFRMARDLGFDNINMDLIIGLPEEDIDDVRSTM
FT                   EQVRELAPDSVTVHSLAIKRAARLNIFKERYANLKIQNTQEMIDLTAKYARKMGLEPYY
FT                   LYRQKNMAGNFENVGYAAPGKACIYNILIMEEKQTIVACGAGTTTKVTFPAENRLERAE
FT                   NVKDVASYIERIDEMIDRKEKLLSKLV"
FT   CDS             complement(427373..428017)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04100"
FT                   /product="Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40248"
FT                   /db_xref="GOA:D7GR23"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR23"
FT                   /protein_id="CBL40248.1"
FT                   /translation="MSEIRIKTLVVGMVGTNCYLVYDHETKRAAVIDPGDGAGQIANMA
FT                   VSLGLKPEAILLTHGHFDHIMAAKELKETWNVPIYACEKEIDVLTDGRKSLVAGYFREP
FT                   YTITPDVTVKEGDELSIAGFTWKVFETPGHTIGSCCYYIEKEEVLFSGDTLFAGSYGRT
FT                   DFPTGSGRQIAESVRRLLSTLPDDTMVYPGHMDTTTIGFEKKYNPLSGAMG"
FT   CDS             complement(428209..430494)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04110"
FT                   /product="(p)ppGpp synthetase, RelA/SpoT family"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40249"
FT                   /db_xref="GOA:D7GR24"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR24"
FT                   /protein_id="CBL40249.1"
FT                   /translation="MEENKLKTIEGDLEAPADFTSPDVLYRDLVASIRKYHPSDDLSMI
FT                   EKAYQLADNAHKDQKRKSGEPYIIHPLCVAIILADLEMDKETIAAGLLHDVVEDTVYTE
FT                   EQLAELFGKEVALLVDGVTKLTQLSWSADKVEMQAENLRKMFLAMAKDIRVIIIKLADR
FT                   LHNMRTLQYMRPEKQKEKARETIEIYSPLADRLGISKIKIELDDLALRYLEPNVYKELE
FT                   EKIALTSEARQKFIDDIISEIKTHMENAEIRCEVNGRVKHFFSIYKKMLNQHKTLDQIY
FT                   DIFAVRIIVDSVKDCYAALGVIHEMYKPIPGRFKDYIAMPKPNMYQSLHTTLIGTNGQP
FT                   FEIQIRTFEMHRTAEYGIAAHWKYKESGSGQVAAGDEAKKLSWLRQILEWQQDMSDNKE
FT                   FLNAIKSDLDMFSDSVYCFTPTGDVKALPSGSTPIDFAYSIHTAVGNKMVGARVNGKLV
FT                   NIDYVIQNGDRIEVMTSQNSKGPSRDWLNIIKSSQARNKINAWFKQERKADNILKGREM
FT                   IDRYCKAKGINFSDINKPEFVDKVLKRYAFQDWDSVLASVGHGGLKEGQVINKMIEERT
FT                   KKLKREVTDATILDAIGENNKPAVVPIRGSKSKSGIIVKGIHDLAVRFSKCCSPVPGDE
FT                   IVGFVTRGRGITIHRTDCINVLNLPEIERSRLIDAEWQGVEEDNSAATYSTEISIFANN
FT                   RIGMFVDISKIFTEREIDIKAMSSRVNKQGKATITMSFDIHGIEELNNLMAKLRQIDGV
FT                   LDIERTTG"
FT   CDS             430852..432027
FT                   /transl_table=11
FT                   /locus_tag="CK3_04120"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40250"
FT                   /db_xref="GOA:D7GR25"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR25"
FT                   /protein_id="CBL40250.1"
FT                   /translation="MDTMELTAKYEDEMIAIRRHIHRHPELSNKEYKTTEFIREKLTEY
FT                   GVEIAEIGMKTGVVAVIRGGKPGKTVAIREDIDALPMKELTGLPFASENDGACHSCGHD
FT                   IHTTVLLYCAKVLSEIREELAGTVMLIFQPAEEHMGAGELVDCNFTQVAKPDAFIGLHV
FT                   SPEIDAGSIGLKKGPANASNDFFNIKIKGKGGHGAHPENCIDPVVISGYVITQLQTVIS
FT                   RENYPVYPGVLTIGSIHGGTVNNIIPDYVEMHGTLRSLDPDCRKKMMAAIDRVVKGCAE
FT                   SMRGTAEVEWEIGVPPLVNDDSIIEAVAEAAAKTIGADHVSYVKNPSMGSEDFSVLFPK
FT                   FGPGAQFRLGSGNNEDPNSRHGLHNSKNVFDEKCIRTGASVIIQYARDFLR"
FT   CDS             432040..433452
FT                   /transl_table=11
FT                   /locus_tag="CK3_04130"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40251"
FT                   /db_xref="GOA:D7GR26"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR26"
FT                   /protein_id="CBL40251.1"
FT                   /translation="MENNKKKLQIPSTCALLFMLMIVCAILTWIVPAGEFDTEKVDNLN
FT                   KVIAGTYHTVEASPVGPWATIMAVVQGFYKAAKLMVMIMFVGGAVEILEKTGAIHAAFG
FT                   KLASKQNLNVNVLVFLVMAFMSIGGAAGVFANPVVALIPIGIILATNLGYDSFTGFLLV
FT                   YMGAYSGFNVGWANASTIGTAQPIAELPMFSGFGVRVVLNIINFAICYFFTIRYMKTIK
FT                   ADPKKSLNYEAGMSASDSMGAGKDGAKAIEAHLTTKHLISLIGLVVAVAAILVGSVKYK
FT                   WSYDQIAATFFTLAVVVGLLNGMGINGTTKVFIGGCSKMVNAAFIVGFANGISVILASG
FT                   NILNTIVYWLSIPMSGMGSILGANFMFVANLFINLFIPSGSGQAAAVMPLMVPVADLAG
FT                   ITRQVAVQAFQFGDGFSNCLFPTAGTLMGSLAIAKTDWTKYAKWLMPLLGCQVILSFAS
FT                   LTILQSIGWTGL"
FT   CDS             433797..435062
FT                   /transl_table=11
FT                   /locus_tag="CK3_04140"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40252"
FT                   /db_xref="GOA:D7GR27"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR27"
FT                   /protein_id="CBL40252.1"
FT                   /translation="MALKKKPVTGMKDILPAEMQIRDYVLNQIKETYRGFGFSAIETPC
FT                   VEHIENLLSKQGGDNEKLIFKILKRGEKLNIETAETENDLADGGLRYDLTLPLSRYYSN
FT                   NSANLPSPFKALQVGSVWRADRPQKGRFRQFVQCDIDILGDATNQAEIELILATTTALK
FT                   KICPDNSFEVRVNDRKLLRAMAVYSGFPEEDIDKVFITVDKMDKIGTDGVKAELMENGY
FT                   SEETADKYLELMGQATNDASGVRRMGEILAGVLEDGAAENLAQIMETVGDVSDGSFKLA
FT                   FDPTLVRGMGYYTGTIFEVSMEGFGGSVAGGGRYDKMIGKFTGMDTPACGFSIGFERIV
FT                   TILLDNGFTVPGGNEKEAWLFEKGMSSEKLASIMKEAMTARKEGKIVLVAQMNKNKKFQ
FT                   KEQLGKEGYSEFKEFYKEDLKH"
FT   CDS             435209..437005
FT                   /transl_table=11
FT                   /locus_tag="CK3_04150"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40253"
FT                   /db_xref="GOA:D7GR28"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR28"
FT                   /protein_id="CBL40253.1"
FT                   /translation="MAESMAGLKRSCRCAEVTEANVGQKMTLMGWVQKSRNKGGIIFTD
FT                   LRDRSGIIQIIFEESDCGAESFAKAEKLRSEFTVAVVGTIEKRSGAANPNLKTGTIEMR
FT                   AKSLRILSESEVPPFPIEENSKTKEDLRLKYRYLDLRRPDLQRNIMIRSRVATMVRQFL
FT                   ADEGFLEIETPTLIKSTPEGARDYLVPSRVHPGEFYALPQSPQLLKQLLMCSGMDRYFQ
FT                   LARCYRDEDLRADRQPEFTQIDMELSFVDVEDVLEVNERLLKKLFKEICNFDVQTPILR
FT                   MTWREAMDRFGSDKPDMRFGMELKNVSDVVKDCEFVVFKSALENGGSVRGINADGQAGM
FT                   PRKKIDALVEYAKGFGAKGLAYLAIHEDGSYKCSFGKFMKQEELDALVKAMNGKPGDLL
FT                   FFAADKNKVVFDVLGNLRLEIARQLDLLKKDDFKFLWVTEFPLLEYSEEEGRYVAMHHP
FT                   FTMPMEEDLPLIDTDPGAVRAKAYDIVLNGTELGGGSVRIHQDDIQEKMFEVLGFTKER
FT                   AREQFGFLLDAFKYGVPPHAGLAYGLDRVVMLMVGADSIRDVIAFPKVKDASCLMMEAP
FT                   APVDPKQLEDLDIAIVEKKDEE"
FT   CDS             437099..438514
FT                   /transl_table=11
FT                   /locus_tag="CK3_04160"
FT                   /product="Transglutaminase-like superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40254"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR29"
FT                   /protein_id="CBL40254.1"
FT                   /translation="MKKVLKITAVTTLLSLGLAFSSYAGQWKQGTGANAGKWWYDEDNG
FT                   TYATNGWRWIDGDGDGIAENYCFDQSGWLYVSTETPDKKTVDANGARTQDGKVVTMNVN
FT                   SGDTTYTVDGTGTLEPKTYNGIEFSLDNLGYSNMAIGSIMYPKANSVTAEHILEYKRYY
FT                   ETGTDNYWLGAKQKERVNAFISEWKSKNINNSMTEDQKARKIYDWLVDNVMYDAQETYN
FT                   QSSYGAFIDRRCVCGGFANAFMSLGKACGLDVKYVFEIEHAFNIVKLDGKWYAVDATKK
FT                   YYKNKDTSSAYYYKDIPEGDRSIEEKVQKRENKESKRIEEIKTSNEKNMERAKKNFESG
FT                   AVFQADDEKLIPSLLQYINEQVNTNVKSSQPITAVIYTGGRNFQEFNKQRFSYNGFTGK
FT                   LDEVIEHEIIGKTINGYYIGNYSNCVIDYQKNKGTDGTSIFVTTWKDKDGKDYIIFRVA
FT                   LNPRDRVTASKGE"
FT   CDS             438738..439418
FT                   /transl_table=11
FT                   /locus_tag="CK3_04170"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40255"
FT                   /db_xref="GOA:D7GR30"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR30"
FT                   /protein_id="CBL40255.1"
FT                   /translation="MDAVKILMVDDEERMRKLVKDFLTIKGYRVLEAGDGEQAIDIFFK
FT                   EKDISLVILDVMMPKMDGWETCKTIRRYSQVPIIMLTARSEERDELLGFELGVDEYITK
FT                   PFSPKILVARIEAILRRGSGTSTGEILEADGIRVDKDAHEVTVDGRPVDLSNKEFELLT
FT                   YFMENKGIALSREKILNNVWNYDYFGDARTIDTHVKKLRSKLGPKGDNIKTVWGMGYKL
FT                   EVDG"
FT   CDS             439418..440959
FT                   /transl_table=11
FT                   /locus_tag="CK3_04180"
FT                   /product="His Kinase A (phosphoacceptor) domain./Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase./HAMP
FT                   domain."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40256"
FT                   /db_xref="GOA:D7GR31"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR31"
FT                   /protein_id="CBL40256.1"
FT                   /translation="MKSIRSRLTVTFIGLIAVILAVIWGVNKWYLEDFYVTKKVQALNG
FT                   AYEAIDSRIEENKENGISIEDAMRREKDADGNITEGNLQRLIRNFSDSANVSVLIIDNS
FT                   TEDATVYSTSRDTKFLKDRIDRYIFGWAKAKYTILEENDQYKIQKTYDPQRESMYLESW
FT                   GFFSDNSTAFIMSAPLSSIGESVRLANQFLLYVGMIAVLIGALVVYLVAKQITMPIYKL
FT                   SNLSERMSDLDFNAKYESGKHDMEEIQVLGNSMNTLSERLEETISELKSANNQLTKDIE
FT                   EKTKIDEMRKDFIANVSHELKTPIALIQGYAEGLQEGMGEEKESRDYYCDVIVDEANKM
FT                   NKMVKQLLTLSSLESGNDKPVMDRFNLTELVRGVVNASKILLEQNEIQVDFDAQTSVYV
FT                   WADEFKIEQVVTNYLSNAIHHIDGEKKIIIKMLPENGIVRISVFNTGTPIPEDAIPNLW
FT                   TKFYKVDKARTRAYGGTGIGLSIVKAIMDAHNQQYGVKNWENGVEFWFTLDGSNS"
FT   CDS             complement(441343..441597)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40257"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR32"
FT                   /protein_id="CBL40257.1"
FT                   /translation="MAEKIRKFMRSERGRAFVNAMFILATMVRGSGMMFMADIFWVLWL
FT                   IFCIRESKTKAERVIYGCFVVVGVVLFGMNLYGWRTIRR"
FT   CDS             complement(441598..443154)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40258"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR33"
FT                   /protein_id="CBL40258.1"
FT                   /translation="MDTRIWMQESFWESAEKQSVKESPQENAEHLSKDQNENGGNKLVD
FT                   QKTSLWKQTYENILVGMGFCGIKLNFLLLYYILPFIGILMIFAGLRKLKQEDKWFKAGY
FT                   TAAAINVVITMISIVSGTFINREQIYDTWIWKFMLLWAYALPLIIAFCFFHGMQTGLKK
FT                   CEKEADNKILIHLVIWYAVVILLMNMNYSGWIIGIAVIAAYIGILMELKHTAEDLEKAG
FT                   YVLEEPPMRVSNGKCAAGAVVLTAAGLVIGTIFFGSYHMKWNEVKGPQDPAYEEIKTHL
FT                   VLLGFPEDILDDLKEDDLLACRNARQVRLQQTDYPINDGEQIVERSEGYTQYSRQYPHK
FT                   ELRLSGIAVELEQEGHWKIIHHFLWNEDPGFRGTEALQLYPACRERNGGWLEEGGLTGQ
FT                   VLYDKKEISYAADYASLENETYDMGQSWPFYESRETSSIFAEFSMPWRGERCRGYVSYG
FT                   IREKEKDWWIDSWLNYTHQKSILQYPVMTAAQNRKNGSWTDDPVFITMQDALQVLPEGE
FT                   V"
FT   CDS             complement(445527..447005)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04220"
FT                   /product="D-altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40259"
FT                   /db_xref="GOA:D7GR34"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR34"
FT                   /protein_id="CBL40259.1"
FT                   /translation="MKVIQISRLDNVAVALHPIKKGEEVTAGGITVTALEDIPQGHKIA
FT                   LKPIKNGENIVKYGFAIGHATADAEAGAWMHTHNVKTNLEGEMEYTYTPSLDFPEKVEP
FT                   ETFMGFRRKDGRAAIRNEIWIIPTVGCVNDIAKKMVRDNQDLVKGTIDGLYTFPHPFGC
FT                   SQTGADHAQTRKLLAALVRHPNAAAVLVLGLGCENLTHEQFLEELGDYDHDRVKFLTCQ
FT                   EVDDEFEAGRKLLEECSTYAAQFEREPIPVSELVVGMKCGGSDGLSGITANPTVGRFSD
FT                   MMAARGGSTVLTEVPEMFGAEGFLMNRCVNKEVFDKAVNMINGFKNYFISHHEVVYDNP
FT                   SPGNKQGGITTLEDKSCGCVQKGGTAPIMDVIGYGDPVVTKGLNMLYGPGNDLVSATAM
FT                   TAAGAHMILFTTGRGTPFGAPAPTLKLATNSQLAERKKGWIDFDAGPIADGETIDDAAK
FT                   RLLQLVIEVAGGKQTKAEEKGFREISIFKDGVVL"
FT   CDS             complement(447013..448512)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04230"
FT                   /product="tagaturonate reductase"
FT                   /EC_number="1.1.1.58"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40260"
FT                   /db_xref="GOA:D7GR35"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR35"
FT                   /protein_id="CBL40260.1"
FT                   /translation="MERLNYDVLKKSGYDGYVLKDAPEKVLQFGEGNFLRAFVDYWFDL
FT                   ANEKAGWNGKCCLVQPIAPGLAKMINEQEGLYTLYLRGSENGQKVDAKRVISSVNRCLN
FT                   PYEKEDYEKMMEVAASDDLEIIVSNTTEAGIQYDPSCKQDDCPPSSFPAKLTQVLYHRY
FT                   KAGKKGIIMLACELIDNNGKELLKCVNQYIEQWGLEDGFKKYVNEDCTFCGSLVDRIVP
FT                   GRIKDANEVAELEQKNGYADPLTDVGEVFGVWVIEGDEKLNDILPFKKAGLLDKVFVTP
FT                   DMSPYKKRKVRILNGAHTGFVLGAYLAGENIVRDCMHDEVIKGFMNKMLYDEVIPTLPL
FT                   DKNDLMQFASAVQDRFNNPFVDHELMSISLNSTSKWKARNMPSFLEYIKETGKLPECLT
FT                   MSLAAYIAFYSNDIQALTDAGLVCKRPAGNEYTVSDDRWALEFYYAHKDDSAEALVNAV
FT                   LTNEKMWDQDLTKIAGLEEKVVADLKKIRTEGAKAAFASCL"
FT   CDS             complement(448627..449910)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04240"
FT                   /product="Uncharacterized conserved protein (DUF2088)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40261"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR36"
FT                   /protein_id="CBL40261.1"
FT                   /translation="MRERQFVADMVKDTYVPKMFRVKQTFPRPKIEPEEIPEIIENLLN
FT                   QEKFASRVKPGMRIAITAGSRGIANNALTTKCIADFVKSRGAHPFVVPAMGSHGGATAE
FT                   GQKAILTGYGITEEYIGCPIISSMEVKKIGVNDEGGDVYIDKNAAEADGIILGCRIKPH
FT                   TAFRGPYQSGMMKMMAIGLGKQYGAEVCHEAGFKNMGKNVPLFGKCIIKNAPILFAVPT
FT                   IENAYDETCKIVAVAAEDIEALEPGLLQESADLMPRILVDSCDVLIVDQIGKNFSGDGM
FT                   DPNITGTFCTPYATGGIDAQRVAVLDLSPETHGNGIGLGYSSATTKRVFDQLDLASMYP
FT                   NAITCTVLGGVRIPIVMESDKECIQVCIRSCNEIDKKNPRVVRIHNSLHIDHIWLSESY
FT                   WEEAHHIPGMTIESEPEEMPFDEDGNMW"
FT   CDS             complement(449991..451277)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04250"
FT                   /product="TRAP transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40262"
FT                   /db_xref="GOA:D7GR37"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR37"
FT                   /protein_id="CBL40262.1"
FT                   /translation="MNHVIVIAAIALLVLLFLKVPVYISVLAASVIYFIGSPNVNSMVF
FT                   AQQVLAGSQGLSLLAIPFFVMAGVFMNYTGVTRRIMECCNVLTSRWYGGLAQVNVLLST
FT                   LMGGLSGSSLADAAMECKMLVPSMEAEGYSKPFSTVITAASGMIVPLIPPGTGLIIYAC
FT                   ICNISVGKLFVAGIGPGIVLSVTLMIFTRFVSKKRGYMPHRTTKIPVSEKWAAIKPAIL
FT                   PLLLPIIIIGGVRIGVFTATEAGTVAIVYALILGILYHEMKVSDFVKGCKETVTTTSSI
FT                   MLIVAAASCFSWILTKEQIPQTLASWMTSAISNKFIFLLICNVFLIVVGMFIEGNASMI
FT                   VLAPLLHPVAVAFGIDPVHFAMVYIFNCTIGAFTPPMGTLMFVTCGVTGCRTKDFIKEA
FT                   KPFYLLFLIDMLVLTYFPPLTTFLVDLIY"
FT   CDS             complement(451277..451807)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04260"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   small permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40263"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR38"
FT                   /protein_id="CBL40263.1"
FT                   /translation="MENKKNWKVMLLNIDVVIASAAMVLLVALTFSGVIARYVVGRPFG
FT                   WIEEVQAALIVWVIFGAAGAAYRTANHAAIEIFYEMFPKMVQKILNVFILLVSIGTLLF
FT                   LAKTSIDYINMFAATGRKTAVLHLSYQLIYCLTPISCIWQLYNFIIVNFFGYSEKEVIE
FT                   SISEEEFEEAKKK"
FT   CDS             complement(451893..452996)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04270"
FT                   /product="tripartite ATP-independent periplasmic
FT                   transporter solute receptor, DctP family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40264"
FT                   /db_xref="GOA:D7GR39"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR39"
FT                   /protein_id="CBL40264.1"
FT                   /translation="MKLRKVMALTMAGAMVATTLTACGSSSSKTETTAAAETTAAAADA
FT                   TTAAADAAAPEGTVVINVGYENATTEPAAKAVEKWKELVEEKSNGSIELKLFPNSALGK
FT                   KTDLIDQMVMGENTITVADGAFLADYGVPDFGIFYAPFMFDNWDEEWAVIDSDWYKDLC
FT                   DQLASKGGIRVLSSNWIYGSRDIMSTKQITTPEDLKGLKLRVSSNDLSITSFNDLGAAS
FT                   VGMDMGDVYQALQAGTIDAVENPVVSLANRSFQEVAKYVVRDGHILATSMWICGESFYN
FT                   TLTDEQKQILSECADEAGLYNNELQDDATEDALKKLEEAGVTVTELTDEQKAAWIEAGQ
FT                   YFYQNDTAKLGWSDGLYDTVKAAAKAN"
FT   gap             453010..454134
FT                   /estimated_length=1125
FT   CDS             complement(454534..455820)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04280"
FT                   /product="TRAP transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40265"
FT                   /db_xref="GOA:D7GR40"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR40"
FT                   /protein_id="CBL40265.1"
FT                   /translation="MSNVLMLSAIVMLVLLFFKVPVFIAVLGGSMVYFVMNPGINTVIF
FT                   AQQAIIGTEKISLMAIPFFVCAGIFMNYTGVTKRIMDFCEVVTGRLPGGLAQVNVLLST
FT                   VMGGLSGSNIADAAMESKMMVPEMTKKGFSLEFSSVVTAASSMITPLIPPGIAMILYGC
FT                   IANVSIGKLFISGFGVGGLLCVSMMILVGVISKKRGYGLLTTEKLTWSKFWTALKPAIL
FT                   PLLLPIIIIGGIRIGIFTATEAGAVAILYAAFLGFIYHEMHIKDMIQGLKETVCTTASI
FT                   MLIVSAASVFSWILTKERIPQALTAWMLANIHSKYVFLIVVNIFLLIVGMFIEGNASMI
FT                   ILVPLLAPIAAQYGINEIQFAMIYIFNNAIGALSPPMGTLMFVTCSITKCKTAAFIKEA
FT                   VPFYILLIVNLMLLTWVEPFTTFLVNLFY"
FT   CDS             complement(455813..456322)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04290"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   small permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40266"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR41"
FT                   /protein_id="CBL40266.1"
FT                   /translation="MEKKENKASAILMNIDIVVASIILAILIVLTFLGVVWRYIFNAPF
FT                   TWLEEVQTSCMVWIVFAGAGAAFRSGNHVAIEMIVDLMPKSMQKIMEILISIVVVVVIG
FT                   YLFMQSIGFIQVFVKSGRSTSMLKIPYSWVYGIAIISYFDMIISYFYALFHGVKSEAKE
FT                   AASSNE"
FT   gap             457160..457354
FT                   /estimated_length=195
FT   CDS             complement(457862..458896)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04320"
FT                   /product="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40267"
FT                   /db_xref="GOA:D7GR42"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR42"
FT                   /protein_id="CBL40267.1"
FT                   /translation="MKAMYIDAPGQVSIKDVEMPVRKEGEVLLKILYGGICGSDLGSYR
FT                   GTFAYFDYPRIPGHEFSAEVIEADENNAYGIKPGMIVTCNPYFNCGHCYSCEHGIVNAC
FT                   MDNQTMGCQRDGAFQEYITMPIERVYDGKGMDAKTLAAIEPFCISYHGVSRANVKEGDK
FT                   VLVVGAGTIGVLAAIAAKAKGATVYISDVSAGKLEMAKDFGVDGTLLNDSPENFEKGVA
FT                   EITNGNGFDVTIEAVGLPSTFQNCIDACCFGGRMVLIGVGKKNLDFNFTLIQKKELNVF
FT                   GSRNALKKDFLELIDIVNAGKAPLHKIITNTYAFDDAAKAFDDFAHNPGNMLKVVFDFS
FT                   KISK"
FT   CDS             complement(458950..459159)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40268"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR43"
FT                   /protein_id="CBL40268.1"
FT                   /translation="MQCIHIIIKQGTFQERKIKIPEIVNWQFAQVWNLDFVEMDKSHIT
FT                   FLTIIDSDVKSIIICCIQQRIQQL"
FT   CDS             459231..459914
FT                   /transl_table=11
FT                   /locus_tag="CK3_04340"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40269"
FT                   /db_xref="GOA:D7GR44"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR44"
FT                   /protein_id="CBL40269.1"
FT                   /translation="MPKINLKTLAYNTIRNKIVTCQYAPGTFLNEEQLTTELSLSRTPV
FT                   RDALGRLEQEGLLEIRPKCGILVRPLTLNDIDMTFEVRMLYEPYILTHYGVNLSVSKLK
FT                   EFYEIFQKWDPEKELYRDKDFFYDLDYRFHAFLMSACPNEFINRSYDTIQTQNERFRYM
FT                   TGNVSNFRLEATFKEHTAIVEPCLEGDWEKAADRLIYHLERSKASAFRLVADSDVNSLA
FT                   HRMTL"
FT   gap             459941..460183
FT                   /estimated_length=243
FT   CDS             460424..461821
FT                   /transl_table=11
FT                   /locus_tag="CK3_04350"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40270"
FT                   /db_xref="GOA:D7GR45"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR45"
FT                   /protein_id="CBL40270.1"
FT                   /translation="MFIGRERELSSLEKLYRSDKFEFAVVYGRRRVGKTALLSHFIKDK
FT                   NSIYFMGIESNAKQNLENFSRSILESDSRNPAESVFLTFQSALEYVFRRSEQERIILVI
FT                   DEYPYVARSSKSFSSVLQLLIDQYKDRSKLMLILCGSSMSYMEDHVLAYKAPLYGRRTA
FT                   QFKILPFNFFETCHYFRNFSPSDCALIYGIAGGTPQYLLQMDDSMSVDENIKNTFLNSS
FT                   SALFEEPENLLKQEVREPSLYNAIISAIATGASKLSEISTKVGENSSTCTAYLKNLISL
FT                   GLVRRETPYGEKNSKKTIYTVEGNMFRFWYRFIPDNASLIVRGASDLAYQRIRPQLSDY
FT                   MGKIFEDICTQYLWQLLLNGKSPVFFKELGRWWGTDPATHAQTEIDIMGEQDKNTALFC
FT                   ECKWTNDLVDSGVLELLVHRSQLFHYNSTHLFLFSKNGFTSGCTEMAEKLGNVTLVSYS
FT                   DIYGSCQ"
FT   CDS             complement(461942..462901)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04360"
FT                   /product="tRNA-U20-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40271"
FT                   /db_xref="GOA:D7GR46"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR46"
FT                   /protein_id="CBL40271.1"
FT                   /translation="MTLKIGNVELENNVILAPMAGVTDMPYRILCREQGAGLVCMEMVS
FT                   AKAILYKNKNTQELLKVDERERPVSLQLFGSDPDIVADIAASLEDGPYDIFDINMGCPV
FT                   PKIVKNGEGSALMRNPKLVEEILTKLVKAVKKPVTVKFRKGFDDTCINAVEIAKIAESA
FT                   GVAAVAVHGRTREQYYSGKADWNIIREVKKAVKIPVIGNGDVFTPQDAKRLVEETGCDG
FT                   IMVARGAKGNPWIFKQITHYLETGELLPRPSVEELKAMILRHGQMMMEFKGELAGMREM
FT                   RKHVAWYTAGYPNSAALRNEINSVATLEELTELIGTRL"
FT   CDS             complement(462898..463680)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04370"
FT                   /product="Putative cell wall binding repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40272"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR47"
FT                   /protein_id="CBL40272.1"
FT                   /translation="MRRTGWKSIQNKMRNCGGYEDKRKARKTMMAAAAGIAGAVLLSLT
FT                   DSGTAGMTAYAFNIGPGMEDHDIIYYQEQPENNPAYNNGWTSNVGPGASGSNPGGGLDS
FT                   EKDYVYSKGPGNEAAQQYAKTENSTIYIHNIYRGGSWRQRADGKWALYKPDGNPVSSQW
FT                   GYVDGKTYLLDMYGIMQTGWQNVNGNWYYLNSKGAMQTGWLLKEGKYYFLNTDGTMAYG
FT                   WVNSQGSWYYFQKPDGDMLTNAYAPDGRYVNAEGVLIQ"
FT   CDS             complement(463703..464074)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40273"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR48"
FT                   /protein_id="CBL40273.1"
FT                   /translation="MAENNNKQENIILCGANSYQQKYYFNEKFKLLPENIKKELQIMCV
FT                   LFTEDVGGILFLEFTPEGNLEFRVEAEDQDYLFDEIGSGLKIRQYQREKKELLESLELF
FT                   YRVVFRGDKLEDELGKEGE"
FT   CDS             complement(464315..464965)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04390"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED/haloacid
FT                   dehalogenase superfamily, subfamily IA, variant 1 with
FT                   third motif having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40274"
FT                   /db_xref="GOA:D7GR49"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR49"
FT                   /protein_id="CBL40274.1"
FT                   /translation="MKITRPIRAVLFDMDGVMVDSEFVYMKYLLEFAREKNPAVTMEDI
FT                   NPMVGRSRQDSWMVMERAVDNGESWETLIKEWADRDIYSRIDYRKIFRPEMKTTVQELK
FT                   RRGYTVALVSSTGPKLISRIVEEVGMRPEFDLIVSGKQFKQSKPNPEIYHYTADTLGIR
FT                   EDECFVVEDSTVGIEAAYRAGMSIAGLKDDRFGFDQSKADYHIDSISDILRYL"
FT   CDS             complement(465153..465791)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04400"
FT                   /product="Cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40275"
FT                   /db_xref="GOA:D7GR50"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR50"
FT                   /protein_id="CBL40275.1"
FT                   /translation="MAENKKFVITVGRQYGSGGAEMAKRLGERLGLHVYDKEILKMTSE
FT                   ESGIRESYFHLADEKAGNKLLYRIIHSLIPENGTPSLGSDLISSDNLFRFQSSVIRKLA
FT                   QEESCIIIGRCADYVLDGTENLVRLFVYAEIEERINKVREKGYFPEEDILKNIKRIDRE
FT                   RRDYYRYYTGKSWENLENYDLMINTTKLSYDDMVECVVDYLKMRGILAK"
FT   CDS             466951..467064
FT                   /transl_table=11
FT                   /locus_tag="CK3_04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40276"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR51"
FT                   /protein_id="CBL40276.1"
FT                   /translation="MLIVFNQMVSLFLLMLTGYLANRSGVIDKIFESKVSR"
FT   CDS             complement(467424..467861)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04440"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40277"
FT                   /db_xref="GOA:D7GR52"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR52"
FT                   /protein_id="CBL40277.1"
FT                   /translation="MDHIDREILQILQHNARASLKMIAEKTFLSSPAVSARIEKLEKDG
FT                   IITSYQAQIDPMKLGYHILAFINLNVLPEDKQKFYNYAEGIPNILECSSVTGEYSVIMK
FT                   VAFESTMQLDSFLGQLQKFGKTSTQVVFATHVGPRGVQVQE"
FT   CDS             complement(468092..468886)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04450"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40278"
FT                   /db_xref="GOA:D7GR53"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR53"
FT                   /protein_id="CBL40278.1"
FT                   /translation="MKFTKMQGIGNDYVYVNCFEETVEDPCGTAKMVSDRHFGIGSDGL
FT                   ILIKPSRVADCQMDMYNLDGSRGAMCGNGIRCVGKYSYDHGIVDKTEIDVETASGIKHL
FT                   SMKLKDGKVGLVTVDMGRPEQTSEIGEPITVAGKEYRFTGVSMGNPHAVVFMDGIKDME
FT                   IEKIGPSFEVHEKFPDRTNTEFVEIVDRGHVNMRVWERGSGETLACGTGACATAVACIL
FT                   NGLTDDEVRVTLLGGDLLIRWDREKDTVFMTGPAAEVFHGEI"
FT   CDS             complement(468883..469260)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04460"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40279"
FT                   /db_xref="GOA:D7GR54"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR54"
FT                   /protein_id="CBL40279.1"
FT                   /translation="MGIREDEKIAPHCEFIHVHDKVVKRVMDVMPEGEELQNLAEFFRV
FT                   FGDSTRIRILYALSQSELCVCDIASLLGMGQSAISHQLRILKQMRLVKFRREGKSVLYS
FT                   LADGHIQTILAQGMEHIGEKI"
FT   CDS             complement(469321..470298)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04470"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40280"
FT                   /db_xref="GOA:D7GR55"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR55"
FT                   /protein_id="CBL40280.1"
FT                   /translation="MSKKEVRTIGVLTSGGDAPGMNAAIRAVVRTAINKGLKVKGIMRG
FT                   YAGLLQEEIVDMDSVSVADTINRGGTILYTARCEEFTTEEGQKRGAEVCKKHGIDGIVV
FT                   IGGDGSFRGAGKLSALGINTIGLPGTIDLDIACTDYTIGFDTAVNTAMEAIDKVRDTST
FT                   SHERCSIIEVMGRNAGYIALWCGIANGAEDILLPERYDGNEQYLINRIIENRKRGKKHH
FT                   IIINAEGIGHSTSMARRIEAATGIETRATIIGHIQRGGTPTCKDRVYASIMGARAAELL
FT                   AEGKSNRIVAYKDGKFVDFDIQEALNMKKDIPEEQYEVSKLLVR"
FT   CDS             complement(470495..473974)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04480"
FT                   /product="DNA polymerase III catalytic subunit, DnaE type"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40281"
FT                   /db_xref="GOA:D7GR56"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR56"
FT                   /protein_id="CBL40281.1"
FT                   /translation="MAFTHLHVHTEYSLLDGSSKIGELAARAKELGMDSMAITDHGVMY
FT                   GVIDFYRAARAAGVKPIIGCEVYVSPGSRFDRETVHGEDRYYHLVLLAENNTGYQNLMK
FT                   IVSKGFVDGFYYKPRIDEEVMREYHEGIIALSACLAGEVPRYLEKGLYEDAKAAAKRHL
FT                   EIFGEGNYFLELQDHGIPMQRQVNQGIMRLSKELNIPLVATNDCHYINAEDWEAHDILL
FT                   CIQTGKKVSDENRMRYEGGQYYVKSEEEMRRLFPYAPEAIENTHKIAERCNVEIEFGVT
FT                   KLPRFDVPEGYDSWGYLNHLCDEGFAMRYPNDDGTLRARLDYELGTIKSMGYVDYFLIV
FT                   WDFINFAKSHGIAVGPGRGSAAGSIVAYCLKITDIDPIRYQLLFERFLNPERVSMPDID
FT                   VDFCYERRQEVIDYVVEKYGKDQVAQIVTFGTLAARGVIRDVGRVMDLPYSLCDQVSKM
FT                   VPAELNITLDLALRKNPELKALYDSDEQVRKLIDMSKRLEGLPRHTSMHAAGVVISRTS
FT                   IDEYVPLSRGADGTIVTQFTMTTLEELGLLKMDFLGLRTLTVIQDAVKMIKKDHGVDLD
FT                   LEHIDYDDKKVMDSLGTGKNEGVFQLESGGFKTFMKELKPTTLEDIIAGISLYRPGPMD
FT                   FIPKYLKGKNDPESITYTCPQLEPILKPTYGCIVYQEQVMQIVRDLAGYTLGRSDLVRR
FT                   AMSKKKAAVMAKERQNFVYGNEEEGVKGCIANGIDEKTANQIYDDMTDFAKYAFNKSHA
FT                   AAYAVVAYQTAFLKYYYPKEFMAALMTSVMDNTTKVSEYILACRNMGIPILPPDINEGY
FT                   SGFSVSGNGIRYGLSAIKSVGRAVVDVIIAERESGGLFKNLDDFVSRMSNKEVNKRTLE
FT                   SFIKSGALDTLPGTRKQKLIVSGDLLESKSKEKKTVMEGQMSFFDIAPEEEKDNFHITF
FT                   PDVGEYDKQTLLAFEKETIGIYVSGHPMEEYRELWEKNVTARTSDFVVDEVGKTIVEDN
FT                   SNVVIGGMITSKKVKTTKTNQLMAFITVEDLVGTVEVLVFPKIYEKNRQAFTEENKVFI
FT                   RGRASIGDDPVGKLICEEVIPFTDIPNELWLQFENQAFYASHIDDVMAALRDSDGKDRV
FT                   IMYLKEERKMRRLSENWAVLAGPDLLNRLYKILGEKNVKVVQKVIEKKGKVY"
FT   CDS             complement(474068..474322)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04490"
FT                   /product="Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40282"
FT                   /db_xref="GOA:D7GR57"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR57"
FT                   /protein_id="CBL40282.1"
FT                   /translation="MTKRTVTIELASGLEARPIAMLVQLASSYESTIYVQSDNKKINAK
FT                   SIMGMMTLDLPVGEQVVVTADGVDEEKAVNDIEKYLSNN"
FT   CDS             complement(474370..475329)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40283"
FT                   /db_xref="GOA:D7GR58"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR58"
FT                   /protein_id="CBL40283.1"
FT                   /translation="MSFSSRIKEELSRHMSPARHCQIAEIAAILSLCGRIQISGDDHYS
FT                   IKIHTENVTVARKCFTLLIKTFNIETDISIRRNAHLGKNRIYSVCVKQHEDALRVLKAT
FT                   KLLTEDGEVGENLSVVGNVVVQNPCCRRAFLRGAFLASGSISDPEKFYHFEIVCATDAK
FT                   ARQIQSIMATFDIDAKIVIRKRYYVVYIKEGSQIVDILNVMEAHLSLMELENIRILKEM
FT                   RGNVNRQVNCETANINKTVSAAVKQIEDIEFIRDTVGFESLPDGLAQIAKARLLKPEAT
FT                   LKELGEDLEPPVGKSGVNHRLRKLGEMAEKLREQGTET"
FT   CDS             complement(476230..477099)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04520"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.1.1.158"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40284"
FT                   /db_xref="GOA:D7GR59"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR59"
FT                   /protein_id="CBL40284.1"
FT                   /translation="METRTNEPMARHTSFRVGGPADRFVIPESETELREAVLDCKKSGQ
FT                   PWYMIGNGSNLLVGDKGFRGTIISTERLAELEVQKNENIIIAGAGVMLSKLANTAAREE
FT                   LTGLEFAAGIPGTVGGAVMMNAGAYGSEMKNVLLWADVMDQDGNVKLMKNEELELGYRT
FT                   SCLERLGLFTVRAAFKLTPGDPEVIRSQMEELARKRKEKQPLEYPSAGSTFKRPEGYFA
FT                   GKLIEDAGLKGFSVGGAAVSEKHAGFVINKDHGTAADILGLCNEVKRRVKASSGVDLEL
FT                   EVKLLGEF"
FT   CDS             complement(477115..478044)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04530"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.4.-"
FT                   /EC_number="2.7.11.-"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40285"
FT                   /db_xref="GOA:D7GR60"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR60"
FT                   /protein_id="CBL40285.1"
FT                   /translation="MYGVTIAELIEKMDFKNLTPELDCEKIVVSHPDVNRPALQLTGFY
FT                   AHFDNERVQMIGNVEIAYLSGLTRERRIAMYDKLISSKIPCLVFCRNQTPEPEVAELCS
FT                   HYGVPCLLSAKPTSDTMAEVIRWLKAKLAPCISIHGVLVDVFGEGVLITGESGIGKSEA
FT                   ALELIKRGHRLVSDDVVEIRKVSDETLVGSAPDITRYLIEVRGIGIIDVKTLFGVESVK
FT                   DTQSIDMVIKLEEWDKNKEYDRLGLEDQYTEFLGNKVVCHNIPVRPGRNLAVIVESAAV
FT                   NYRQKKMGYNAAQELYNRVQANIAKRGE"
FT   CDS             complement(478363..478407)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40286"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR61"
FT                   /protein_id="CBL40286.1"
FT                   /translation="MHGMKQENLVTFGL"
FT   CDS             complement(480327..480941)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04560"
FT                   /product="Protein of unknown function (DUF1653)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40287"
FT                   /db_xref="InterPro:IPR023387"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR62"
FT                   /protein_id="CBL40287.1"
FT                   /translation="MNQIRKTPVPGEFYRHFKNKLYQIIAVATHSETGEEMVVYQALYG
FT                   DFKIWVRPLDMFLEEVDREKYPDAVQKYRFERVRLVKPQNAENSAQNAAQPVRQAPAEQ
FT                   KPSADSDSSAKNITAQAPDEDQPVNQELLDFFDAMDEKNYDLMLECLTKLQTHATQKEL
FT                   DDICMVLDIHPPVSCDDVGSQIMFIKRHLAMIRKFDGERLR"
FT   CDS             complement(480956..482299)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04570"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40288"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025275"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR63"
FT                   /protein_id="CBL40288.1"
FT                   /translation="MKKMLFAFSMAGLFLLSACSRPAAEETETAEMTAAAESTQETSGV
FT                   LVIEDAGEDKNKTISVRIVDSSNPALPGREAKKVRGIYITGPVAGNEEVLNGVLDGALT
FT                   AGINAVVIDFKEDQGRITCPVDAATVNEIGASIPYVRDMKSLIESLKKKDLYVIARVAA
FT                   FRDSYLAEKKPEWSLKLPDGSLYQDRQGMYWVDPYRQEVWDYLLEVGTEAKDLGFDEVQ
FT                   LDYLRFPNEASAGQVVYDEAVIRGRSKTDTILECTNYLYENLASQGLFVSADVFGTIIG
FT                   SGVDSTAVGQNYTEMAKILDYICPMIYPSHYSSGNFGLEHPDTEPYKTIFGALQKSGKV
FT                   LLDASRADNHESRQAIVRPWLQDFTATYLGEGNYITYGDAEVAEEVRAVQDAGYEEWML
FT                   WSAANKYHLEELSGDGSSAAAAEVLGEGEASSDGGETSAETEPETAQQ"
FT   CDS             482706..484184
FT                   /transl_table=11
FT                   /locus_tag="CK3_04580"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40289"
FT                   /db_xref="InterPro:IPR014999"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR64"
FT                   /protein_id="CBL40289.1"
FT                   /translation="MIKQGFDNDKYLAMQSDHIRERISKFGDKLYLEFGGKLYDDYHAS
FT                   RVLPGFEPDSKLRMLMQLADQAEIVIAINAADITKNKVRYDLGITYDLDVLRLIHVFTD
FT                   RGLYVSSVVITRYVDTPAIQQFKHKLEKLGLKVYRHYEIDGYPSNIPLIVSDEGYGKND
FT                   YIETTRPLVVVTAPGPGSGKMATCLSQLYHENKRGVKAGYAKFETFPIWNLPLKHPVNL
FT                   AYEAATADLNDVNMIDPFHLEAYGKTTVNYNRDVEIYPVLSAIFEGIFGECPYKSPTDM
FT                   GVNMAGLCIFDDEACREASCQEIIRRYYQALEKVVKDDSCQNEAYKIELIMKQAKISPK
FT                   DRVVVPAAVNLAKETDAPAAALELPDGKIVLGKTKELLGASAAVLLNAVKELGGIDHSI
FT                   DLISPESIAPIQELKVRYLGSGNPRLHTDEVLIALSTCAATDENARIALEQLPKLRGCQ
FT                   VHTTVMLSNVDKNVFKKLGIGLTCEPVQEDKKIG"
FT   CDS             484355..485386
FT                   /transl_table=11
FT                   /locus_tag="CK3_04590"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40290"
FT                   /db_xref="GOA:D7GR65"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR65"
FT                   /protein_id="CBL40290.1"
FT                   /translation="MNQKSRNALYAGLGTAFAVMLANPAIAYAGTWSNEGGPNQWKYYN
FT                   DDNRCAADGWYWIDGDQDGLEECYYFDKNGFMLADTRTPDGFQVNSDGFWTVSGQVQKR
FT                   ETPVQDLPTGLHEQEGGLIYRDEGGELAANAWRSSDGSWYYFDAAGHAVKGWQYIDGYK
FT                   FYFDENACTLVQNLEGILSAQSFQIVVDRARCQVTVYAPDDGNGYIIPYRTFICSPGKE
FT                   NSQTPTGTFKTTRKYRWHALVESTYGQYCTRLSNTSILFHSVPGKTTSIHNITAEEYNK
FT                   LGAPASHGCIRMTVADCKWIYDHCPSGTVVTVGDNLPAPFDRPEAEKIPEGQDWDPTDP
FT                   EIG"
FT   CDS             complement(485509..486768)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04600"
FT                   /product="Pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dihydrolipoamide dehydrogenase (E3) component, and related
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40291"
FT                   /db_xref="GOA:D7GR66"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR66"
FT                   /protein_id="CBL40291.1"
FT                   /translation="MERSYQYDIVVVGGGTAGVAAAVGAAKAGARTLLVERNAYLGGEA
FT                   TNSGVNCFCGFYTCGSDPVRVVKGIGQLVLDEMRALGPTIAEEISASGNRDIIFQPEYL
FT                   KCALDNLLEKEHVDYFLHTVLIGAETVENTIRTIQCADDEGLFTVSAKAFVDATGDANL
FT                   SRLAGAKLIWGNDGGHPQAATLTFRLSGVAADVDLSPAAVERAVVRAKAEGIRNLTREK
FT                   GFILRMENSGIVHVLLPSIIPEGLSAEEMTRMERETRKQVLGYIQALRTYMPGMEHSEL
FT                   AVIGPSIGFRETRKLVGKETITADDVISGRKRPDGVARGGWKPEIHRDVNKMATYMEVK
FT                   SGSYFDIPLGALQSENVKNLFGAGRMISADEAAFAAVRVMGTCFATGHAAGVGAACLAA
FT                   DERAEIEHVREILKEQNALV"
FT   gap             488585..488936
FT                   /estimated_length=352
FT   CDS             complement(488966..489457)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04620"
FT                   /product="Protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40292"
FT                   /db_xref="GOA:D7GR67"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR67"
FT                   /protein_id="CBL40292.1"
FT                   /translation="MIKILFICLGNICRSPLAEFYFKDLVAKHNLSAEFYIESAATSYE
FT                   ETGNPVHPGTRKKLAAAGISCAGKTARCMEREDYRKFDYLIGMDQANIRNITQIAGGDP
FT                   EKKIYKMLEFAGDGWKELKAGKRNPDKVPDVADPWYTGNFDDTWRDVTAGCQGLLKFLL
FT                   "
FT   CDS             complement(489643..490842)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04630"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40293"
FT                   /db_xref="GOA:D7GR68"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004191"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR68"
FT                   /protein_id="CBL40293.1"
FT                   /translation="MSEKRRDNRNRILREGEYQRKDGRYRFRYIDEDGKEKNVYSWRLD
FT                   KNDPMPKGKKREPSLREKEKQIEADLFDRIVTNGGNYTVLELVEKYVSLKTGVRHNTVA
FT                   GYKTVINMLKKESFGNLRIDKVRLSDAKAWLIKLQQIDGRGYSSIHSIRGVLRPAFQMA
FT                   VDDDLLRKNPFEFELASVIVNDSVTREAITRKQQRDLLKFIQEDKHFSRYYDAIYILFH
FT                   TGLRISEFCGLTVSEIEYGEMRIKVDHQLQRTAQMQYVIEEPKTDKGIRYVPMTEAVAA
FT                   CFRRIIANRKTPKVEPMVEGYAGFLFLDKNDMPMVALHWEKYLEHIIQKYNKIYRIQMP
FT                   KVTPHVCRHTFCSNMAKSGMNPKTLQYIMGHADISVTLNTYTHVNFDDAKEEVYRIANS
FT                   "
FT   gap             491182..491876
FT                   /estimated_length=695
FT   gap             492682..494493
FT                   /estimated_length=1812
FT   CDS             complement(495191..495595)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40294"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR69"
FT                   /protein_id="CBL40294.1"
FT                   /translation="MKHKKFLLIALICLIGIGISFLLFSAHRPFKDLEAADITSASVRL
FT                   SPPDTTIQIVETEELVSYLNEVVIYNKDNSYTEYAGQAVIFTLSLADGSQVEIIAYNPF
FT                   IIIDGIGYKCKYEPCEALNHYANELMTREP"
FT   gap             495941..498373
FT                   /estimated_length=2433
FT   CDS             complement(498937..499935)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04700"
FT                   /product="Bacterial SH3 domain."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40295"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR70"
FT                   /protein_id="CBL40295.1"
FT                   /translation="MSLIDTIISKALEFEGVSESPPGSNNVIFNTDYYGEEVEGEAYPW
FT                   CVTFLWDVFRMCNASSVFCDGQKTASTEFVYSHYNDGRLFSQGQAGDIVLIKTSSAASN
FT                   RNVNHAGLVIKRNNDGSYDTVEGNTGGNIADGGAVMRRTRSMNGSGYKIVAFARPTYGA
FT                   IEPMEEIAISAKLTVQGTNVNVRTSPNTNASIVKKLNTGAEIQASSRVLINGDPWFHFS
FT                   DGWISGNYVQGWVKDYNDNNRWWYVEKGYIYPKSEWKTIAGKDYCFGPDGYLFVECYIK
FT                   SEVNSNYYWVDDDGVYMSQYDTTTPDRKYRVVENYKTENAYQGYSGYVFSH"
FT   gap             500276..500735
FT                   /estimated_length=460
FT   CDS             501538..502542
FT                   /transl_table=11
FT                   /locus_tag="CK3_04730"
FT                   /product="Bacterial SH3 domain."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40296"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR71"
FT                   /protein_id="CBL40296.1"
FT                   /translation="MATWYKINASAKLTVRADSLNVRSGPQLYDFVKSVKAGEVVQATE
FT                   RALISGDPWFHISDGWISGKYVEGWVKDNNNNNSWWYVEKNYGYPSATWRTIGGKDYCF
FT                   GKDAYLFVYCYIKAADGVNYYWVDDDGVYMPEYTTKTPDRNKYRVVENYATENAYSGAA
FT                   PSADKVYARNDYQTESQMKVNAQYILNYLRAKGWTKNAVCGMLGNMQSESTISPGRWQD
FT                   GDAGNMNLGVGLTQWTKATKLYDWAAKNNLYPLDMDTQLKRILFEVTTTDPNEIQYTPK
FT                   SPQYPLTFQQFTKSTQTPYDLACAFLHCYEKPKNSQQDATRGAQATEWFNALS"
FT   CDS             complement(502597..503568)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40297"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR72"
FT                   /protein_id="CBL40297.1"
FT                   /translation="MKKLIIVALGVCILGTACSRDNNLAEKNTLQQPLEQSVMLQTEEI
FT                   EIQSTKESSSEQEIILLSEEPAETVSLSEPEHMEGSAAASVEERDRTKTDALHKNDTAN
FT                   NSSEVTSENTYEMRLYTKAPNQNSTIKIQYPAFYGSKAEEINSLILAKVQDMASLDPSL
FT                   FPENPRIDVNYQSAVTLQNSKIISVVFWGNTDIEVSQFPTTDLYALNIDLTSLELITLK
FT                   DLYTVNAEFEKVFFEKAFFPSDPITSYSEEKFSEMLKLQTSEYTLPSPFTNADSMRCFL
FT                   KPEGIVLSMPAIHASGSDHFEAELLYSDIQDYYLPEQIYWNE"
FT   CDS             complement(504461..504895)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40298"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR73"
FT                   /protein_id="CBL40298.1"
FT                   /translation="MNKIFKCLIRFLIEVIVMTVLIVGINIFTNGMYLWRLPRINNIQS
FT                   VNITYPSVTDDVKEISSREDIELALKLTGFLKYDLFEKVNSEEEPTITITYFLKDGTSK
FT                   TISANNTTVWWNNKIHVIKDKDMFINLTEGIFFLEDLQTK"
FT   CDS             complement(504967..505371)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40299"
FT                   /db_xref="InterPro:IPR026989"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR74"
FT                   /protein_id="CBL40299.1"
FT                   /translation="MGQNEEIKNMSELKPRITENGIDYILVGDYYIPDLKLPEEHRPIG
FT                   KYGRMHREYLREVHPARLNTLILTGELWTYLADLNEQAQERLDTIMEQMKAAEGVTEEL
FT                   KRTSQMEWVQRCNNIHNRAEEIILHERIYS"
FT   gap             506891..507283
FT                   /estimated_length=393
FT   CDS             507871..508527
FT                   /transl_table=11
FT                   /locus_tag="CK3_04800"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40300"
FT                   /db_xref="GOA:D7GR75"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR75"
FT                   /protein_id="CBL40300.1"
FT                   /translation="MSLQLKMRGHQVGRRKTRRYMIEMGIDPIYPKMNLSKRMQQAKVC
FT                   PYLLRNAVIDRPNQAWSIDITYIPIKHGFLYLTAIIDWYSRCIVGWEIDDTLDTRMVIN
FT                   ALKKAFKVAKPLILNSDQGCQFTSTEYIAFLKENHIRQSMDGKSRWADNIMIERWFRSF
FT                   KYEEAYLTQYANIREARAAIKSYVHTYNFERCHSAINDQTPASYYYPALLIDHAA"
FT   gap             508575..509802
FT                   /estimated_length=1228
FT   CDS             complement(509977..511428)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40301"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR76"
FT                   /protein_id="CBL40301.1"
FT                   /translation="MIIEKLLLREGMIENLDTFSEKRNLIYSKTNTKGKSTFVRLLFYA
FT                   LGYPIPNMRGIKYEDIITEITFSEKGQKYTATRENNLLTLFSENSRIEFTLPSQHMSFL
FT                   SFVFKYENIKVLKNLLGFMYVDQDKGWTLLNRGTVIGKIKFSIEELLAGLNGIDIDDLI
FT                   EKKTTLELNRDKYLAMLNIQELSEQVYEQNGEIFISDIEKELNEKIAYCNIKLENEKNA
FT                   LKEINSVLLKEKQFFDYIDSMNLSVKQDDVIIPVNRTTLLNSTANYEYLRAHRSIIVTN
FT                   IEKLKRERSSYDVKLCEYHAKNAQISMFSAESKDTLVNKQLANFNIDQTVVEQLLDETK
FT                   SDLKHVKAEIKRTIKNQNSYISKIYKYVLEYATQLNVDDKMVAKEDFIFTSDLKSLSGA
FT                   VLQKMVFAFKVAFLKVIEESMDTKLFIVLDSPKGKELDDDNMKLIENLVSAELCDNQIF
FT                   FASIYDLEHEKLIEIKNRAIEGRNN"
FT   CDS             complement(511425..512561)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40302"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR77"
FT                   /protein_id="CBL40302.1"
FT                   /translation="MSEYLNEDICQFSNDASASSFGWNFQANAGIFLFLKYMPDAADIK
FT                   IESISQDIEITLIDERKVFAQAKSAQDSTTIKDQKEKFKDAIISLARNPYKDNQLVYIS
FT                   NIPDTFKSAPNFFNNSIIPYNDCLAGIQKEIDDTILSISKNIAKKIKKEKDPLKIRKLE
FT                   QIKEKVENFHKENLYISTIYPYYGNEKNRYTIIGDSVLSFLTDTIGLTRDDAISIKQKL
FT                   LEHWQLNFEHNSTIKDENKNKKILKEDFTWPIVAFLVDGNFPDIDDCLSFLPDQSIKKE
FT                   VERVMNDPKSFYHARYEFTNKVLQRYAQFKNQSIGKAIKKPELEFIKEHGDEFRDEFVM
FT                   LSNGDNELTEYLTKVFLYRILTSNRVVQKVCSAVGVKA"
FT   CDS             complement(512691..513032)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40303"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR78"
FT                   /protein_id="CBL40303.1"
FT                   /translation="MENRKRNVHLHVMVTPDELAAIHERMVEAGISNAGAYVRKMALNG
FT                   YILHIDLAPVKELISLQRRCSNNLNQVAIHAHTYGVYPEEIDGLKRDYEKLWGEVSKVL
FT                   RELSELVAK"
FT   gap             513124..515167
FT                   /estimated_length=2044
FT   CDS             515210..515494
FT                   /transl_table=11
FT                   /locus_tag="CK3_04850"
FT                   /product="DNA ligase N terminus."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40304"
FT                   /db_xref="GOA:D7GR79"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR79"
FT                   /protein_id="CBL40304.1"
FT                   /translation="MVLDDLNLIIRDIREAHKKDSESAPQTTVADELKENLEEVENFKG
FT                   SRDEKLVVLYCKQLGINYKNLSDEEFRWLIRILKKSKKMGTPISQRKKR"
FT   CDS             complement(515583..516044)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40305"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR80"
FT                   /protein_id="CBL40305.1"
FT                   /translation="MKKISIDETKLPAVMEIIEKAALLMDEKDCDSDKEAKKELGELQK
FT                   NLREITGNKKIKINIFQAYWSYTDLETTARRALMPPPMKSNLSNEQLKEIVLHILKFGE
FT                   GERDWWLEYLEINTGLDNLTDYIFYPDLIGLDFDATLEQIADKIIADRK"
FT   CDS             complement(516102..516434)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40306"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR81"
FT                   /protein_id="CBL40306.1"
FT                   /translation="MQTIIVLLNPGMLENADLDLRYRIPDRIEEVSNSLIQSNGYDYID
FT                   TEDGDPGPLMGIWLETENAHRNWHIVRDLFQREKFIGNDLSLSAQIYISEKDTDDLENC
FT                   VLVFPE"
FT   CDS             complement(516483..516860)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40307"
FT                   /db_xref="InterPro:IPR026989"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR82"
FT                   /protein_id="CBL40307.1"
FT                   /translation="MSKLKRRITENGIDYILVGDYYIPDLKLPEEHRPIGKYGRMHREY
FT                   LREVHPARLNTLILTGELWTYLADLNEQAQERLDTIMEQMKTAEGVTEELKRTHQMEWV
FT                   QRCNNIHNRAEEIVLHEMIYS"
FT   CDS             complement(517537..518916)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40308"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR83"
FT                   /protein_id="CBL40308.1"
FT                   /translation="MIEAFLDFFQLYTVDADYLPDFWLTMILLYLNAGLYLNDLYNLVK
FT                   RKSKAETFSLMAIPGVFAVIFVLMLSIFAHVPNLQSIASQAKRLSLLITAIQPQTNLAL
FT                   LLIVFLYPILWGIGLLRQKRHEHGSRKRWVLSCIPDYIAWIILILGIGYHLFFGENILN
FT                   SVLENAKEGDLLALYGSHGTWLYIWMYGIYILACKEAVLLVGLLSELLLMRIPLRYHSG
FT                   QNAVTFVSFYYLFCQNAIFRGISLLEAALVIPLCGVMLREAASPFSDYSSTMIYAAILL
FT                   LTGAVFVVLITIGPVMRTLFCFDAWGQRKQIRELFCTEYFLMQPVSSNRSFTVTHHFII
FT                   DEQDAAGVYYLPLLTDISGWASPRKKAGKLKMLSFADGRTLELSEHEAEAAKEMLSYAS
FT                   NRLYAQKITGENWSNKNNMPGTEETWNPLISPATTMYQKLVKIFLGLMVILFMMSYQIL
FT                   K"
FT   gap             519018..520024
FT                   /estimated_length=1007
FT   CDS             complement(520761..521912)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04910"
FT                   /product="Putative transposase."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40309"
FT                   /db_xref="GOA:D7GR84"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR84"
FT                   /protein_id="CBL40309.1"
FT                   /translation="MDKPTVQDIFHRFYPAYLDQYSPSPVQAKVAHNIMNCKTGAYGAN
FT                   VCVCEDCGFVQIHYNSFRNRCCPMCQAVPKEMWMDARREDVLDAPYFHLVFTVPDILNP
FT                   VIYSNQRLLYDALYHAASSTISELTADPKRLGAKVGYICILHTWGSEMNFHPHIHTILL
FT                   GGGLASNNQWKDNGENFFLPIRVISKVFRGKYLEELKRLWKEDKLVFHGTAEKFRNHYT
FT                   FKELLDSCYGMDWIPHCKKTFNGAQTVMKYLGKYTHRIAVSNHRTVRMDDDTVTFLVKD
FT                   YRNEGQWKELTISGVEFVRRFLMHVPPRRFVRIRHYGLLCSRTKNQKLTLCRNLLGCKK
FT                   YLSKLRDMEMPEILEHLYGIKVCVCKACGGHLGKPQMRMPLRC"
FT   CDS             complement(521905..522033)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40310"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR85"
FT                   /protein_id="CBL40310.1"
FT                   /translation="MASQLGLPLVPDTSYYYPRFYLGLLEGEYSGPFDRKDGTANG"
FT   CDS             complement(522622..523518)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40311"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR86"
FT                   /protein_id="CBL40311.1"
FT                   /translation="MNSDMTKYCYQHFENAYNIGWNTNFDSTVESKETFNSIFIEKLTS
FT                   YCENPLNSDLNGVCRETEIDGKKYVKGFGEIRIIDLKKKIRYAAPNVIIDDILSGKYIP
FT                   PIEFIDAVLTGPTFDSEEYQEFYLNYSEKNFWGENEENFEKIAKVLELAGDLEGFKDYI
FT                   LNNDLINIVVPEGSLLNYAITEGKEKEALWLIENGIDINAFDGLELMTAIKKNNNIIAK
FT                   KLIDEGIVINSREMNDNPLVSAIRFSNAFLVEELMKNYRDLIVAYSNEYVRNCSVLDIA
FT                   ERTKNEKIINIVKKYLV"
FT   CDS             complement(523912..524097)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40312"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR87"
FT                   /protein_id="CBL40312.1"
FT                   /translation="MIELNSKIKNALIKIGFIERYEELSNKFNDKRTPSSNRLAYIDSE
FT                   EVMETIQDLGILRCLM"
FT   CDS             complement(524630..525676)
FT                   /transl_table=11
FT                   /locus_tag="CK3_04980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40313"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR88"
FT                   /protein_id="CBL40313.1"
FT                   /translation="MEKLIFSLVLLLTTKIIYLITGRNRRQIARIPKGMAILCQPPGRR
FT                   YVAYAVGVFQLLFVAFFLVLYIKDGAPAEARLMWGLLVITSILICMLLIFCGNVAGRDC
FT                   VYFNSREVRIEKPFRKSRTFQWEEIRKVDGNFDNAVNLYLLDGTKVLTARLGMVNYDVF
FT                   CDMIKKTCPEKIASYYRSHMYEESQKCILRYGSEYYLLAAMGIGILLIYMATLVPAAAE
FT                   NSIMQQFLQGDFSQRFALWFAPVCGVISIVFLVVMLNTNIRYSQEKMTIKYPLHRKHEL
FT                   YWRNIQRIEMAAVEKTEKAEWMKLRLYTREGTYKISFKFLTHGKDEFLSMLFKMIQKYG
FT                   ISCMQTDK"
FT   CDS             525993..526412
FT                   /transl_table=11
FT                   /locus_tag="CK3_04990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_04990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40314"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR89"
FT                   /protein_id="CBL40314.1"
FT                   /translation="MLRMTLRVDGKPDYTLVLPADEKYLDAVKNHLDIDVFADAMLCDI
FT                   RFKVPYIGELIRDTDCPAVEDYNDFAEALEDIWQQDGALLTYAAVLEAERPDTLRGACE
FT                   LLQDLDNYQRITEDANGYGQQRLQETLGLDDEGHL"
FT   CDS             526396..526551
FT                   /transl_table=11
FT                   /locus_tag="CK3_05000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40315"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR90"
FT                   /protein_id="CBL40315.1"
FT                   /translation="MKAIYELDGYMDFERYGQDCMGNDCVTKTEFGLLRRLEPPFPEQR
FT                   QGQRMM"
FT   CDS             complement(526619..527251)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40316"
FT                   /db_xref="InterPro:IPR024540"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR91"
FT                   /protein_id="CBL40316.1"
FT                   /translation="MSMNISGLGNAYSGVNTNSKQYKALKEKGWLEGVIQNEAMMSPEE
FT                   KMIYEIFGGRDTIVNNLMKQFDSDGDLLNANGVAGMDVTGKGTSWQKLTNVSEEYRQKM
FT                   FDNVKKEFIQENGVSNGDTTKRSDIFKDYQLSVNKDKRLSGTWTLEQYEGQYRSAMYAA
FT                   VKAANPNWKPGQKFDTSILDNVTRESVEATLVKNGNRLVRNSIDVSV"
FT   gap             527349..529238
FT                   /estimated_length=1890
FT   gap             530173..530574
FT                   /estimated_length=402
FT   CDS             complement(530638..531276)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05030"
FT                   /product="Protein involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40317"
FT                   /db_xref="GOA:D7GR92"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR92"
FT                   /protein_id="CBL40317.1"
FT                   /translation="MKNVRETMLENKLGITDSTELARMEERISKQKALEMFESGFFETL
FT                   EPGTYKSLAMIHQCLFDEIYDFAGKLRKVNISKGNFRFAPLMYLETALQNIDKMPQSTF
FT                   DEIVEKYVEMNVAHPFREGNGRSTRIWLDLMLKKEIGYVVDWSKVDKEDYLLAMERSPI
FT                   KDIEIKFLLKNALTDHVNDREIYMKGIDHSYYYEGYYVFKMENLTDTRD"
FT   CDS             complement(532759..533079)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05050"
FT                   /product="Predicted pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40318"
FT                   /db_xref="InterPro:IPR011394"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR93"
FT                   /protein_id="CBL40318.1"
FT                   /translation="MKQETIDRIRKFTDDRDWEQFHSAANLAKSIVIEAAELLECFQWN
FT                   DEEYDLQHVKEELADVIVYSQNLLDKLGLDADEIVNMKMGMNERKYPVEKAKGKSAKYD
FT                   CL"
FT   CDS             complement(533560..538119)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40319"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR94"
FT                   /protein_id="CBL40319.1"
FT                   /translation="MSKISRIRILNLNYNNNTIKIDDETFDLGGQNTLISLRNGGGKSV
FT                   LVQMIVSLFVNRTYRDFGDRPFKSYFTTNRPTFLITEWILDNGIDRFLAGMMVRKNQKE
FT                   DNDTEELEMYTFTGSYSNGCKYDLDNLPIIRQDGNKKILKGFGECKNLLEEISRNEPGD
FT                   FRLYDMASQYGRRQYFSTLRQYQINNKEWESIIRKVNQKESGLSELFQNAKDEKDLVEN
FT                   WFLRPIEDKLNQEKNKIDEFRKLAFQFIEQYRSNQSKILRKGIIEQYFEDTKPLKDMID
FT                   DYAQKDRDAVNLRTEMILYAKSLRKELDRLQTEIAAGQEKFEQIEREQRQIVYEQLSYQ
FT                   IYLSEDQKTEILSQRAQQEIEITRLTSLKNHLLRKIDTYDLHKIYLELKDFERQKAEVD
FT                   AKLQVLLQKTEESKDEIEKIGCRLYALYSENAKKLKDQRQSEEETLAETERARENAQRE
FT                   RDEKEREIRKLSGDIGAKESRVRSYDEVEDSFNREFNAELRRNLLGLYEDGALEIFRKE
FT                   IDAGLQEKKNKSVKYARKLMEQEQTRKKLSQEASDGTVTLNDIAHKFDHVSEKLADLER
FT                   QKKERLRIMKYVNVDEEHLDRRDLILDQLDGKIRELDVARSRLIQKKGDQEKHFRQLKE
FT                   GKTTELPENIRTYMEQNGIDLVYGMEWLSKNGRTAAENAELVKKNPFIPYSILMERSIL
FT                   ERFQKNGEELYTSFPIPIIVKEELEQEQEHVDSRFAAYGNVHFYVMFNTHLLDREELEK
FT                   ILGKIRREIEDLKKAVEDKDADLETYRSYRSVVENQTFSTALCQQTEKEINRLKDERTA
FT                   VKGRLEEIYREQSRLEEEKKEIETLADTVKEQIDGLKRMDVQFEILLKKYDQYETDRTS
FT                   LERLKKENRELTEKQTALSVRLGELREQEMGLRALVKEFAEKIDREEKKQAEFEEIART
FT                   AENRDLSSLTQMTSEELEARYYALTKVISDSVEELRKSQTDWIGRISGKRTELKKKNED
FT                   SQIPEKEYQSLVCTEEQYDAWKRQKKQTERELNKANEENTALGRKEGALTTTITLYMKN
FT                   LKKETGYEQPAERKTITDTEFEKRLNLKEYELTAHQKELSQLRERNIQIASQAAGVEEY
FT                   VDEPIPAELISGDGLSSVDERMSVERSIASGGLIPENGADAYSETGENKILLAIQERIP
FT                   DVRNEEMDVIKGYQKEIRRKITESSKALDRCRGDVSEMIRGIASGKTYADDYFKKTFES
FT                   LLSQTASPRNLFRQFEMNRQAYENQLEKLKIDLAHIDDEQKNLEMMFLEYVEQINANIG
FT                   MIDKNSTISVRGRSLKMLRIQVPDWETEKEHFRLKLHDYFENIVKLGIETIEKNGNLTE
FT                   FLGRVITTRKLYDDVAGIQNVKIRLYKIEAEREVPISWSEVSANSGGEGFLSAFVILTC
FT                   LLSYMRRDETDLFTSGEEGKTLIMDNPFAQTNAEHLLKPLIEMAKKTNTQLICLSGLGG
FT                   DSIYNRFDNIYVLKLVESSIRNGVQRVDVTHMKGEETKRMVLSEFKMEQMSLFEMMEE"
FT   CDS             complement(538112..538858)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40320"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR95"
FT                   /protein_id="CBL40320.1"
FT                   /translation="MAYEAEMITYSQKIFYYLLCHGALSDLDAGVNDLYRAYVEHEEVM
FT                   NLVKNQAEIADCKIERYGTTIYLMPDIDNKYLGFTKADLKKELCKPNATDRDYYLAQFV
FT                   ILTLLAEFYDGQGSTSKSREFLKLGELQNIVSERLKAGLALEQEREQDGTNLYTEMYET
FT                   VLDYKSMSEAYESLKSVEAGSRSKYTKEGYVSIICNFLDRQGLIIFIPEDEMIKTTAKL
FT                   DNIMEYKILNKENYARIMETLGETHE"
FT   CDS             complement(538862..540472)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40321"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR96"
FT                   /protein_id="CBL40321.1"
FT                   /translation="MIDKDFLKNFDQRMKCVGRYSVLCSNSFDKKLWKEYGIETRDEQM
FT                   NMLFTLLLFIMEYSLREENCTMDEIASFVEDISYGYYGRKLNFEKSQEFARFMVEDILG
FT                   NSGSSMYFKTFDYEKRTYQDINIRYIDNKVVYLENGVRRTSYYLTDEGYNMIFATMEME
FT                   NNLKLSVHEMLFKLHMEKADYNRAVDDIKNIFGQLRKQSQKIEEAILAVRRNALSYSVE
FT                   EYGKLVEDNISTVVETREKFRLHRDFIEEKIEEFEEKQMNAEEFTEKEKANLGNLRTIG
FT                   RYLTQTLDEHQRILGQHFDLKKLYDEELENYSNMTLVQRFPFRSDVYDKILKDASLLKN
FT                   ADKIFAPLFRSRINKIFNPEKMMEYQKKLKKSDVEDESMELDFDEEKYNREKEQSRQER
FT                   MKKYEGCVNVILEQLVIHKEMTLETLNISCKEEERERLLPTAEIFREAIIEFLTAGTID
FT                   IGTIQKEQTDYLMDASEGFVLNEMLLAILEDRRYRKIGKIHIFPMEDGKHVHFKNVMDE
FT                   AGNRRNFKCSNVGFCYEER"
FT   CDS             complement(540479..541471)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05100"
FT                   /product="Uncharacterized protein conserved in bacteria
FT                   C-term(DUF2220)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40322"
FT                   /db_xref="InterPro:IPR024534"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR97"
FT                   /protein_id="CBL40322.1"
FT                   /translation="MKKHKVYLQELSAEFSEADYSKFYEVVMRRIENGELVPMKSAKNN
FT                   GRKPALPLCFWEYEKEADYTELYEELKYRYHPRINTFYYREHPECYERDREKLQLLSDY
FT                   LKDHSELLLVQETMNERSFEIFHREKYFQREGGLELCKRVAITPETLAFYETSEPLSYY
FT                   SCSKQTPQNILIIENKDTFFDIRRYMNSGNDRIMGREFGTVIYGAGKGIWKTFEDYVNG
FT                   AERYFLGKNALFYFGDLDFEGILIFEHLIEQKQYRESGIHIFKEAYEKMLDKAWQLGFS
FT                   RLPDMKEKQNANIGTGFLSAFDAERRHQIRELLDMGKYIPQEILNEHDW"
FT   CDS             complement(541662..543164)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05110"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40323"
FT                   /db_xref="GOA:D7GR98"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017145"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR98"
FT                   /protein_id="CBL40323.1"
FT                   /translation="MRHRRNFLINLRKEDPEIRTNNMDKKEFVLKAVADKKALIVDVSD
FT                   KIFDYAEVGFHEFKTAKLYEEVLKKEGFQVEMGVGGMPTAFKAVYGSGKPVIGFLAEYD
FT                   ALPELSQEGGCTMRKEAAGDNPDGHGCGHNLLGAGAMAAALAVKAYIEEHPEAGTVILF
FT                   GCPSEEKGDGKAIMAREGVFDGVDAAFTWHPGDKNAIWSESTLANVSVFFNFKGVTSHA
FT                   AAAPELGRSALDAAELMSVGVNYLREHIISDARVHYAYRDVGGIAPNVVQGHSRVHYFI
FT                   RAPKSWQVKEIYKRVVDVAEGAAKMTGTEMTYELYAGLSDYIPNHVLSEVLHESMEEIG
FT                   APKYDEADFALASKFFHETATPDEMEAKRASLRKLFGADHMEEIEAHPLHTSIAPLVWN
FT                   GKVQAGSTDVGDASYVIPTAMCTTATATLGTAAHTWQMTAHGNTEIAHKAMLNVGEAMA
FT                   LAALKTMESPEILKKAHDEWMAETNGIYECPIPKEVGPRLED"
FT   CDS             complement(543205..543879)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40324"
FT                   /db_xref="UniProtKB/TrEMBL:D7GR99"
FT                   /protein_id="CBL40324.1"
FT                   /translation="MKDNSFYNKIHRLGRITVVCALISFMAVPFGLAAVNGISMNIPEI
FT                   LKNAIPLLLTFSISGICENLSFMPIIGSGALYMSCVTGNVSNMKVPAAVNAMEVAGYTA
FT                   GSDRADVVAIIAVAASTFVTTAIVFLGMLFLAPLFEPIYNNAFLQPAFQNMVPALMGAL
FT                   LFPFILKAPKQAIVPIALPIIAILVIGRKVFSSNQSYIMVGVIILSVIYSLALYKKGKI
FT                   SA"
FT   CDS             complement(543893..544606)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40325"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRA0"
FT                   /protein_id="CBL40325.1"
FT                   /translation="MSTHLQLANSTTMAILCGITILIVLLQPVIFMIVAFKRGKELNMT
FT                   DQEMKEAARSSAIFSIIPSLPIIVSYLLLVPSLGRYFPWLRLSVVGSAAYETMVANMAA
FT                   EALGLESITVPDIPADTFVFILFVVTIGILGGNIFNVFFLKAYDKKVESIKNSNAKLVP
FT                   IITTAMFLGLYGTMAAPHFTNIANIPAVAAILVAGITSIFVNKFAANHKKLKEFAFPLS
FT                   MIVGMLGACVANLLI"
FT   CDS             544883..545872
FT                   /transl_table=11
FT                   /locus_tag="CK3_05140"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40326"
FT                   /db_xref="GOA:D7GRA1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRA1"
FT                   /protein_id="CBL40326.1"
FT                   /translation="MNLQNMEYLIEISNCGSISAAAKHLFVTQPYLSKVLRETEKEYGL
FT                   TIFTRGKNGIIPTESGRLFLDMSRDLIEHAKHFKTTFKEHSEAYRLRVSSSSCSHASDA
FT                   FIRMVNSLADTPFRFFYREMTGNEVIEDVYTNRADIGFIMYPAHKADKIQEILTFRHLE
FT                   ARPLFQSPTQFFCRVGHPILKELDNLTPEKLYQYNFVLYPSESTKTRAAESVYNDKTLQ
FT                   LINWNRISQVIYVNSRALLHNVIQRSDYLGIGLIPMREQVENYNIVSFPLPDWMQPEAD
FT                   RYGDYISAYIFQKGIQLPKAARAYITFLEQFYGPDSGYEEECSENKNL"
FT   gap             545912..546206
FT                   /estimated_length=295
FT   CDS             complement(546412..548148)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05150"
FT                   /product="alpha-phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40327"
FT                   /db_xref="GOA:D7GRA2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRA2"
FT                   /protein_id="CBL40327.1"
FT                   /translation="MKDYMKIYQEWLANPYFDDKTKEELRAIANDENEIKERFYMDLEF
FT                   GTAGLRGIIGAGINRMNIYTVRRATQGLANYIIKQGGADKGVAIAFDSRHMSPEFAMEA
FT                   AMTLAANGIKAYKFESLRPTPELSFAVRELGCIAGINITASHNPPEYNGYKVYWEDGAQ
FT                   FTPPHDKGVTAEVLAIEDLSTVKTTTEEEALKSGKFQVIGKEIDDRYIAQVKAQVVNQE
FT                   AINRMQKDITIVYTPLHGTGNIPARRVMKEIGFENVYVVPEQELPNGDFPTVSYPNPEA
FT                   AEAFELGLKLAKEKNADLVLATDPDADRLGVYVKDTKSGEYIPLTGNMSGSLLCDYVLS
FT                   QKQAAGKIPADGEVVKSIVTTNLVDAVAKHYGCKLVEVLTGFKYIGQQILKEETTGKGT
FT                   YMFGMEESYGCLIGTYARDKDAISATAALCEAAAYYKEKGMTLWDAMVAMYEKYGYYKD
FT                   TVKSIGLKGIEGLAKIQEIMENFRKNPPKALGGYEVTSVRDYKKNTITEVATGEVKETG
FT                   LPESNVLYYDMNDGAWLCIRPSGTEPKIKFYYGVKGTSLDDAEAKSKAVGDELMGMVDK
FT                   MM"
FT   CDS             548369..549691
FT                   /transl_table=11
FT                   /locus_tag="CK3_05160"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40328"
FT                   /db_xref="GOA:D7GRA3"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRA3"
FT                   /protein_id="CBL40328.1"
FT                   /translation="MENYKSKIVTAEAAVAAAVKDGDWVDYGFGGGFPELLDKALAARK
FT                   GHLRDVKIRGGLVIRPRIEVVEADPEQESFSYYSWHIGDYERKLQTRGLVKFMPVVLRL
FT                   LPTLYRQHYIRTDVAFVPVSAPDENGYCGLGISNFAWRTMFESARTVIFEINEHYPKLQ
FT                   GVDGSHRVHLSEADYIVEGAHEPLPVRTYKAPSETDIQIAKLVVNEIPDGAVLSLGVGG
FT                   VPFTVANMLAESDLKDLGCHTGTISDAYLKLWKAGKLTNAKKEFDTGLSTWNLAMGSQE
FT                   FYDWVAENPKLFHPADLDYVHDPQRIGTMKNVISINGGVQLDLMGQENAESAGTRQLSG
FT                   IGGQMDFLEGAYRSVGGKGYICINSARKAKDGTLKSNIVPFIPGGSTVSAPRTMIQSVA
FT                   TEYGIANLSGKTLRERAEAMIAIAHPDFRDELEQYAKEAFH"
FT   CDS             complement(549702..549965)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05170"
FT                   /product="Threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40329"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRA4"
FT                   /protein_id="CBL40329.1"
FT                   /translation="MINLLPQITANYFLAKPRATGIYVKMEVREHIFVPLGNGTLFLGV
FT                   VFGLEHILASGVIEKMLKVIAIQSEHCAPFAEAVKQGLKSDH"
FT   CDS             complement(550098..551057)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40330"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRA5"
FT                   /protein_id="CBL40330.1"
FT                   /translation="MKGKYKVIVQNNRLHYELEIRRNITIIQGNSATGKTTLVNMLRQA
FT                   ENLGNSSGIDVQCDVPCRILEGTSWKLILENSQKTIFFIDEENVFMNTEEFASAVRKSD
FT                   NYVVLITRENLYNLPYSVEEIYGLHSSGKYQNTRKVYQQMYQIYSNMENVPVKPEILIT
FT                   EDSNSGYDFFYAVAKEKHMECMSAEGKSNIYFKLNGLEQKEVCVIADGAAIGPEMNRLY
FT                   EIVRKKKRIHLYLPESFEWLVLISGLVEGKDIENMLEEPEKYIDSKEYFSWERYFTKVL
FT                   VDRTQDSYLQYRKAKLNAAYLHERNKRTILKSIRGIEF"
FT   CDS             complement(551067..551507)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40331"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRA6"
FT                   /protein_id="CBL40331.1"
FT                   /translation="MLKIFLGNMGGVIYHPPTYFDNQYEDEWITDPLTKEMVKDVDQSE
FT                   VISSRLIDSPVLGPVSVKELSGGVKTLILLAFDKNQKIFNISVCGNNCAKWILEIGKKK
FT                   DLTVNLRHVMNFGDGKFEIEILNTGEIVYDMEKFAEIAGKYV"
FT   CDS             complement(551837..553015)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05200"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40332"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRA7"
FT                   /protein_id="CBL40332.1"
FT                   /translation="MTQKNKAGSMILGVAFVWFTTHFGGGFASGAQIYSYYVRYGIWCL
FT                   IMPAAAMLYNTVFFAYCLRFARKHEVYDYRSYNNAFYGKFSPVFSNLFEILYLCVMCVA
FT                   PAVAFATGGATLSALTGLPYLLCTFVIGVFIFIVAIFGTDLVRKVASVLSVCIIAGLLI
FT                   VYIPNIAAGFGAIKETAAAMQAEPVPFGKALYSAFLYGTFQLANVAVFVQHAKSFEKPD
FT                   DAVKSMGIGFVVNTLMMTMVVLGIMTVCQNPEMKNQSVPTLFMVQNGVGKAFMTPLISV
FT                   LIILGAVSTAVNMVAAMVRRICSGIEAGCADRKKTVLAGESVKNAGETPKRKISRHEIF
FT                   AALICCIVDFAIAQFGLLTLIQRAYSVLAYLAIPVILIPYLVHMAVTRFDTK"
FT   CDS             complement(552999..554114)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05210"
FT                   /product="Glycerol dehydrogenase and related enzymes"
FT                   /EC_number="1.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40333"
FT                   /db_xref="GOA:D7GRA8"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRA8"
FT                   /protein_id="CBL40333.1"
FT                   /translation="MKLENYEVHLPSYSIGNAIYDKIGPVCESYGKTVLVIGGKLALEA
FT                   AYDKIKAAVDKTNLTIIGKELFGEDCTYKTVEALRALPVYHEADMVFGVGGGKALDTVK
FT                   CLCITDDKPVFTFPTIASNCAATTSVSIMYNDDGTFLKPHFFIRPAMHAFIDTEIIAKA
FT                   PARYMWAGIGDTYAKYYEAKISSRDERLEHFTAVGVAVSEMCLQPLLEYGVKAYADHQK
FT                   GLCTYDVEQVVLAIVVTTGIASIFLTKDCTPDYNSGLAHAVFYALTSYPVIEKLHLHGE
FT                   VVGFGVLLALLVDRQEEEFEKIYKLNREIGLPVSLKEIEITEDEWEESMNRIPEMSDVA
FT                   HYPYRVTKEMLRDAMDRLKERAGKDAYDTEK"
FT   CDS             554410..555744
FT                   /transl_table=11
FT                   /locus_tag="CK3_05220"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40334"
FT                   /db_xref="GOA:D7GRA9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRA9"
FT                   /protein_id="CBL40334.1"
FT                   /translation="MNIPFWSLVMRYFLEFFSMVPCAVLCFLPVQDRLRIKPLNIFLTG
FT                   IPLSILWAFAGGLVCADFGIARDFWILPSFILFAVFFLRVCDLAPWKPFSILIAVCAVF
FT                   SCITNLTLVADALIDRTNTSGLFTLPGAGIHLLLSVLIVAIVWYPATHAAKWLVDDIEM
FT                   AKTWYIFWIFPAAFFLLNRLIRPRYYETLYTNRVMKFYPILILALLTFLLLFYFMFYLM
FT                   AAEMNQNTRLLRENELLQLQSAQYRNLQRSIDETRIARHDLRQHLTVLSGYAANKDLDA
FT                   ISDYLASFRKHMMPEWLPAYCENQSVNAILGYYAQIAENAGTALEIQAQMEKEIPVPEP
FT                   EFCVLLGNLLENAVDACRENNESGAIKVHIRQTGTSLIAITVDNPCRNPPVLEGKRFLS
FT                   TKHSGPGIGTQSIRLIAERHRGDARFEWKNGMFYASVILIPSAES"
FT   gap             557223..557495
FT                   /estimated_length=273
FT   CDS             558297..559073
FT                   /transl_table=11
FT                   /locus_tag="CK3_05250"
FT                   /product="RNA polymerase, sigma subunit, RpsG/SigG"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40335"
FT                   /db_xref="GOA:D7GRB0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRB0"
FT                   /protein_id="CBL40335.1"
FT                   /translation="MAGYKVEICGVNTSKLPLLTNEEKTDLFRRIQNGDTDARETYIKG
FT                   NLRLVLSVIQRFSGSSENLDDLFQIGCIGLIKAIDNFDLSQNVKFSTYAVPMILGEVRR
FT                   YLRDNNSIRVSRSLRDTAYKALSARELLTKRNLREPTIMEIADEVGISKEEITYAMDAI
FT                   QSPVSLYEPVYTDGGDPLCVMDQISDKKNREENWVEQLSLSEAMKRLPARERRIIDMRF
FT                   FEGKTQTEVAGEVGISQAQVSRLEKNALKAMKSYLD"
FT   CDS             complement(559151..560503)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05260"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /EC_number="3.4.17.4"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40336"
FT                   /db_xref="GOA:D7GRB1"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRB1"
FT                   /protein_id="CBL40336.1"
FT                   /translation="MGKHTIDPQISAEHLAGAVRFATVSNADNSLTDYTKFDAFHEYLK
FT                   ETYPLVHKHLTLEHTGQAGLLYHWKGTGKSGAAPLLLMAHQDVVPEGDLEKWIYPPYSG
FT                   TIADGKIWGRGSSDCKSNLIGQLEAVEALLEKGYEPDYDLYLSYGYMEEVAGGKIPAET
FT                   LRGTGIRFGAVLDEGGGVRPGSDYGIDDKGLCTIGLCEKGYVDFELSYTAKGGHSSRPG
FT                   ENFAMTMIAKALIAIQENPMPYRVTDTIRRRFEVLAPYMAKENPELAKLLEKPDENLEK
FT                   LVPYFKKDPALDAMFHTTVVPTMLSGSAQANILPAKVTAVVNSRILTGDTVESVKKHLE
FT                   DIVPDEVEVRVLKGSNASPTSLYDGAIKDLLVEISGKIYGDVIPCPEMMLGGTDARFVY
FT                   DLSDRVYRFSTIYAREDHHVHAANEFTGVEELADSIDFYMELLTRYGETAK"
FT   CDS             complement(560529..561251)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05270"
FT                   /product="Predicted thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40337"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRB2"
FT                   /protein_id="CBL40337.1"
FT                   /translation="MSKTEAMIEKVKALINAPSCCAEAKEAANKWLEAVNTEKQDEAAK
FT                   ALIEEIAADIIPIDGLIAFAGSEDGKKIFGEEKAAGIEAHAKKIKAEGARFCDCPACTA
FT                   VAAILADKADLYAPTYSLTWTVTDDMTAKRIGSAGSKILSTPNMVALMEDAALELAKSY
FT                   LEEGQTTVGAEIHCRHLAPTPVGMKVTATAKLRSIERRKLWFDIEVNDEKGKCGEGSHL
FT                   RIIVNSKAMSEKAEKKAE"
FT   CDS             complement(561477..561758)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05290"
FT                   /product="sporulation transcriptional regulator SpoIIID"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40338"
FT                   /db_xref="GOA:D7GRB3"
FT                   /db_xref="InterPro:IPR014208"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRB3"
FT                   /protein_id="CBL40338.1"
FT                   /translation="MKEYIEERAIQIANYIIDENATVRQTAKRFGISKSTVHKDVTDRL
FT                   IHIDPSLAAQARVVLDINKAERHIRGGLATKEKYEHEHQLQACSRVEM"
FT   CDS             complement(561832..561975)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40339"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRB4"
FT                   /protein_id="CBL40339.1"
FT                   /translation="MEGTYICTFLYIGKFEECTAIPEDDNVSGIRICAKIQTAAARECV
FT                   EI"
FT   CDS             complement(562026..562556)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05310"
FT                   /product="Amidases related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40340"
FT                   /db_xref="GOA:D7GRB5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRB5"
FT                   /protein_id="CBL40340.1"
FT                   /translation="MAEKILIVVDMQKDFVNGSLGSKDAEAIVPAVVKKAKEFDGDLIF
FT                   TKDTHFENYMDTQEGHFLPVPHCMKGTDGWNLIPELEKIFVERDAAMYEKITFGCPELA
FT                   EDLLERNKKTPIESIELVGLCTDICVVSNALLIKAFLPETPVFVDSACAAGVTRERHEA
FT                   ALETMRSCQIVVK"
FT   CDS             complement(562538..562711)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40341"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRB6"
FT                   /protein_id="CBL40341.1"
FT                   /translation="MRAVQGREKKNAFWVETQGHFSADPEKRLTGQVAWGILDLRQIRI
FT                   RRKEDELWQRRF"
FT   CDS             complement(562747..563586)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05330"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40342"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRB7"
FT                   /protein_id="CBL40342.1"
FT                   /translation="MAEGKKKQKKSPWWYKLGIMVFGAVFCVSAFMAGRDYLAAKKEAD
FT                   AFDSLSKLAADYAEEKAPADLPESSGETTDQEKAAEWAELLKEAAGYAALKNENPDYVG
FT                   WIRIPDTRIDYPVVDRESDPEYYLHRAFDGSKSFGGTPFLGEASGVDTKCLIIYGHNMK
FT                   NGSIFGTLDSYKKDDYWKEHPIVRFYVDGEPRTYEVFAAVETQVLYEDEDGFRYYRYDG
FT                   DIPEEEYDELVTWLRGHSDYDTEIVPEYEDQILMLSTCSYHTKNGRFVVAARRVAEP"
FT   CDS             complement(563709..565064)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05340"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40343"
FT                   /db_xref="GOA:D7GRB8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRB8"
FT                   /protein_id="CBL40343.1"
FT                   /translation="MQLDMTKGKPLPVILQFTIPLVIGNIFQQLYNMADTIIVGRCVGA
FT                   GALAAVGSTGTIMFLATGFAQGITAGFSILTAQRYGAGDKKGVKRSVANGIILAVIAAA
FT                   ILTLVCVAIMNPLLHLMNTPSDIFQDAYTYIMGISVGLTANIFYNLFSSYLRAVGNSQI
FT                   PLFFLIFSACLNVGLDLLFIIRGGMGVAGAAWATNLSQAISAVLCAGYIWVKVPSLKPE
FT                   REHWKIHGSDTRNQLAAGIPMAFQFAITASGTMIMQSAINLFGSVAVAAYTAAAKLQSL
FT                   VIQGMIAMGQTMATYGGQNYGCGDVKRIKAGVKAALLAEFVYSVTVALLMCALLRPCLG
FT                   LFFTGDVDISAMMPWAETYCYMTAMFFLPLCTIFIFRNIMQGCGYGFLPMMGGVSELIA
FT                   RLIVSMAAMKLLSYPLACFADPAAWIAAAVFTGVSYLFVIKKIGRELKEKTT"
FT   CDS             complement(565176..566219)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40344"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRB9"
FT                   /protein_id="CBL40344.1"
FT                   /translation="MAATKEEIKELAEHIYDLDAEVYVHLGSSLGRVFNRDRERCVNEL
FT                   TELLTTRPQGHLVRSELGLIANMARTIEDKEERAMCMTEYNRILNEVMSLPTSFASGDV
FT                   IDPILAKLNSFNVANRFSNDDHLIICISWTYGSGGIDVGFKLADKLHINYYDADIFAAV
FT                   LKRLDAEKDKTIRDAAGYAHVSEELQQSPASEFEAVTHMSLKDHIKYFSRYHGLNRQDA
FT                   VFFNQSDLICDMAKKEDFIIMGRCADAILTNNGIPHISIYITAPIEQRIQRAIEVNSGL
FT                   DRKKARHFLKKLDKKHAHYYNFYTGRSWGNANNYDLCINSASYGIDGTVDFILRMIGRD
FT                   RDKKKSE"
FT   CDS             complement(566235..567680)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05360"
FT                   /product="transporter, UIT6 family (TC 9.B.53)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40345"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRC0"
FT                   /protein_id="CBL40345.1"
FT                   /translation="MKKLFAFCAGLLAVLNQTAVTALAAEPEAAGAAAQTPLWLCIPFA
FT                   GLLLCIAVLPLVKAEWWEAHQPHAVVFWSLLFLIPFAVKYGVPKAAETTLECIINDYLT
FT                   FIVLLFGLFCVSGNITLSGDLAGSPRINVGLLALGTLLSSWIGTTGASMLMIRPIIKMN
FT                   AWRKRRRHIVIFFIFMVSNMGGCLTPIGDPPLLMGFMRGVPFFWSLKLLPILIFNMIIL
FT                   LFIFYHFDMKAYRKDIAAGLKPDISKPGTEVKIRGGHNLIFIIMIVIAVILSGTLPSMP
FT                   MFQDAAGNVLGIHVFGEVTLSYPAIIECVIILVSAFLSFKTTDGSIRRENHFTWGAIHE
FT                   VAVLFVGIFITMQPALMILKANGAELGITEPFEMFWATGLLSSFLDNTPTYLVFLTTAG
FT                   ALGLSQGMVTALGTVPVKMLEAISCGAVFMGANTYIGNAPNFMVKSIADENGIRMPSFF
FT                   GYLIWSFGILVPVFIVDTLVFFL"
FT   CDS             complement(568101..568409)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05370"
FT                   /product="Branched-chain amino acid transport protein
FT                   (AzlD)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40346"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRC1"
FT                   /protein_id="CBL40346.1"
FT                   /translation="MEKNIYLYIAVMAGVSYLIRVLPLTLIRKPIKNQFIQSFLYYVPY
FT                   VTLAVMTFPAILSATNSTVSAALALVIGIIAAWCGRSLLSVAVICCAMVFITEFFLV"
FT   CDS             complement(568502..569311)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05380"
FT                   /product="Predicted branched-chain amino acid permease
FT                   (azaleucine resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40347"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRC2"
FT                   /protein_id="CBL40347.1"
FT                   /translation="MGNNKFSIASVGNRRAFRDGARDGVPIALGYFAVSFSLGIVARNV
FT                   GMTPIQGMITSALCNASAGEYAGFTMIAAGAAYIEMAIVTLIANARYLLMSCAMSQRMD
FT                   PDMPFFHRLLMAFDITDELFGITIARPGCLNPWYMYGAIALALPGWAVGTALGALAGNL
FT                   MPWRLVSAFSVALYGMFLAIIIPPARKSRILAGLIAISFAASYLAEHLPGISSISSGTR
FT                   TIILTVVLSSAAAILFPHPAEDSEIEVQEENQEGKNNSSAGAAKQGA"
FT   gap             569653..569861
FT                   /estimated_length=209
FT   CDS             570045..571154
FT                   /transl_table=11
FT                   /locus_tag="CK3_05390"
FT                   /product="transporter, YbiR family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40348"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRC3"
FT                   /protein_id="CBL40348.1"
FT                   /translation="MSFIKKEPVLSAAAVLAVLSMFFVAPSPEYLSYIDFRTLALLFSL
FT                   MTVVAGLKEIGLFRYLGSSLLAGMHSTRQLAFTLTALCFFSSMLITNDVSLITFVPFSI
FT                   LILNMAGLPELMIPVIVLQTIAANLGSMATPIGNPQNLYLYSSFGLSAGELMGYMLPLT
FT                   VLSALLLTAAVFLLKNRAITLSRASLKQDDCPTKTSLIFYLALFLVCLGCVVRIYSWPI
FT                   MFFIILTAVLIKDRSLFVRVDYFLLLTFVCFFIFIGNMERIPAISGLLTKLISGHEFPA
FT                   GVLLSQCISNVPAAILLSGFTGAVRPLLFGVNVGGLGTLIASMASVISYRAYAELPEAK
FT                   SGTYMMVFTLYNLIFLIIMCAAGWMLLSL"
FT   CDS             571396..572202
FT                   /transl_table=11
FT                   /locus_tag="CK3_05400"
FT                   /product="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40349"
FT                   /db_xref="GOA:D7GRC4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRC4"
FT                   /protein_id="CBL40349.1"
FT                   /translation="MADLIYEVHNHLARITLNRPKQLNCFSEEMIRLWTEALEDVRDND
FT                   DVYALLLSGNGKAFCAGGDVKAMAAGDGFFESHEDISSTALARKNSLWKGIQRIPLLLE
FT                   EIDKPVVAKIHGAAVGAGLDMALMCDVRIAGESASMSESYFNAGIVPGDGGAYFLPRLV
FT                   GRDKALDLFWTARTLKGKEAADMGLVTHCVPDAELDTFVEQYMEKLLAAPQQAMRLTKR
FT                   AVVQGEQSSLRASLDLISSFMGIVTELDDYRQRTSALVAKMQRKAQ"
FT   CDS             573076..573312
FT                   /transl_table=11
FT                   /locus_tag="CK3_05410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40350"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRC5"
FT                   /protein_id="CBL40350.1"
FT                   /translation="MACEIPDNPMSSCPEQHEVVAIDFSGADTVAVGEQLPDRTTVSAP
FT                   AIRLVFSGFSVEIQNSAACETIRNTIAALQQLC"
FT   gap             573902..575234
FT                   /estimated_length=1333
FT   CDS             complement(575770..575928)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40351"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRC6"
FT                   /protein_id="CBL40351.1"
FT                   /translation="MKIKQYMVTVYAVLVKSGKHNIEELPEAYIIPVAEYLAEQEEGST
FT                   SADSPAE"
FT   CDS             complement(575925..576122)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40352"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRC7"
FT                   /protein_id="CBL40352.1"
FT                   /translation="MDNVKYLTPKKPLSEIARERAEAAEQQNIDIYEAIAGLFEDMAAL
FT                   TEENAALAERVTKLEGGQSK"
FT   CDS             complement(576122..577849)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40353"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRC8"
FT                   /protein_id="CBL40353.1"
FT                   /translation="MSGGMANYTIGNTPADEAKRLQWVKIKDGDKTLLICDRVILVSVS
FT                   WDDLNGQGYVSGKTINIDGARYKCRLLTGGNNYRHTSNAHAGGSPTNNEWDRFIAREEV
FT                   ISGLPAPVSSDLDSNMDTTDHNSTHNQFWHWTGVSSWCQETYSGNASGRAFRGYSSARC
FT                   WNYLSSSFRHVSRGFRPVLEVLNTDPLISDTDRDLGDKNNNFTIQYTVNDADPGDVLTA
FT                   TESIDGVTKKTFSPVRGQQNTITVPVNDLGLGAHTVKVVVTDGQGGTAARTWTFRRTNS
FT                   APTISGSDTNLGDKNLGFTYEYTVDDADGDSLTVTEKLGDEVLRTVNNAPKNTPLTLTI
FT                   TAEKLYTLGLNSVNTITISVTDGKGGTAYRSLTFKRTNSAPVISGQDTDIGAQTGAFAE
FT                   NYTVTDAEGDNVVINEYLDDQKIRTYQATLGQQATIEVSRENWLKLSNGAHRLRVEAVD
FT                   GNFATSVRVWNFSKSETVIAFQFSKPEATDARASKILITPTWRIEGAVAKVEVCNNAFD
FT                   AVPTWEDMTAQVAINRVFNFTNETKTADSWGVSVRFTITKNEGYTGEVSISGFGGAYE"
FT   CDS             complement(577908..578360)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05460"
FT                   /product="Reverse transcriptase (RNA-dependent DNA
FT                   polymerase)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40354"
FT                   /db_xref="GOA:D7GRC9"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRC9"
FT                   /protein_id="CBL40354.1"
FT                   /translation="MDDVVIIAPDRETAREWLAKIKAYLDERLHLETNSKTKIFSVRQG
FT                   VNAYGFKIKATHLMLRTETKRAMKRRIKKMVEKMKDGLLARKEVLQAVNSWLGFARWAS
FT                   AYNLAKKIFAPYRFIKVEGEMYFGYLSRNRQIRRFLQQRSRPRPAH"
FT   CDS             complement(578403..578684)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05470"
FT                   /product="Reverse transcriptase (RNA-dependent DNA
FT                   polymerase)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40355"
FT                   /db_xref="GOA:D7GRD0"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRD0"
FT                   /protein_id="CBL40355.1"
FT                   /translation="MRAALKKWGEEATVIKLDIKKFFYSIDRTILKQILVKRFKKLKKK
FT                   YPEKYPDFLKFFRLLCKVIDSSPEGERGIPLGNVSSQDFANIYLNELD"
FT   CDS             complement(578691..579089)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40356"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRD1"
FT                   /protein_id="CBL40356.1"
FT                   /translation="MTKFPIKPLPVLREPGTFEEVVGYDRIEANYKEALRGTRKFKKEA
FT                   VNYDLYRELNNVGLWRDLRKERYTPGAYYHTVITEPKRRELSIPKLRDKIVQLVIHEEL
FT                   QNIYRPVFVERSFACQYGKGPIRAAFNV"
FT   CDS             complement(579935..580090)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40357"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRD2"
FT                   /protein_id="CBL40357.1"
FT                   /translation="MYKIACTRKEASCILGSFFGELDLVCERCKGAPDGELLLSTTEGL
FT                   VFIGDG"
FT   CDS             complement(580083..580394)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40358"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRD3"
FT                   /protein_id="CBL40358.1"
FT                   /translation="MQAYEKVGWLDHVVDVATNEVIQEGTPLSQTNLGHMDDGIEKVTA
FT                   ETIIHAALIADTQKEIKVLKDATLNNMTQNVFLKNFDTVDSVAITSGIYDPVARKIYV"
FT   CDS             complement(580381..580716)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40359"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRD4"
FT                   /protein_id="CBL40359.1"
FT                   /translation="MRTLTETGVNKIGKRLVDSVAHAAYTLDGQPKTIEIFRRSAEAGS
FT                   TKVYVYFDDTISGKVANVQLVDTDGDVIATTPPEREFVKPTSKGLYVAFKYNIKEMETE
FT                   VEINASI"
FT   CDS             complement(580716..581558)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40360"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRD5"
FT                   /protein_id="CBL40360.1"
FT                   /translation="MKRFETFGEYMFDLLFAPLKRGKRSKNQFFIFFRVVGRIFDGMKD
FT                   DVFRVRAEANVTTASPPMLTVHGRDRGMQRLLGEDDEAYRTRLSMKGIIAEEAGTKKGI
FT                   LRALTALGYDKSYIEPLAYQDPERWAEFIVYLNGSRRTGVNDLNVIDAEVRKVKEGSSK
FT                   PSYGSEVSGGILIASRLQAGLSCYPRCGEIVCGVFPDMASIGNLFGSHIAAQGGEASGD
FT                   VTFPRVGTLVTSEAFYQFADCVTYEGFSSDVRLAMGHGSGSRDYPLCSNETKTKGERQ"
FT   CDS             complement(581563..582696)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05550"
FT                   /product="Uncharacterized homolog of phage Mu protein gp47"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40361"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRD6"
FT                   /protein_id="CBL40361.1"
FT                   /translation="MIDKEILDSVLPVPELEELKESTIKELEEEGFVITNFHSGGVFYT
FT                   LLMIVLRIKIEFTELLRKVLSNMSVTHASGAWLDLKVADYGKKRKKAQKTRGLVTLSRA
FT                   SLQGEAVKIPKGHVFKTLKDINGEELRFFVLEAAVLQKGAQSVDVLVEAEKEGARYNVP
FT                   TGQIVHSLTYLNGVEMVNNGADWIVREGSDTEDDEGVRARTLRSWSELAKRPIEDTFIN
FT                   AAESVPGVLFAQADCDHPRGQGTVDVIITGTAGTATEGLIAEVKEAVDSIAGPYDNVSV
FT                   RGSTTIEQDITLTVTVADTATDEEVTSRVKAVLGELLAVRKGRKLYELRLSDINHAVRT
FT                   GCSGSTNVTISVPAADVKLEKDKVITLGAMSVTVGRE"
FT   CDS             complement(583481..584236)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40362"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRD7"
FT                   /protein_id="CBL40362.1"
FT                   /translation="METQELFYPQIAAQAGPYTFEEGVEIELYSSQDSYFDWAKIRFTE
FT                   EYQPEISVERKAPAFIRLGYDGNLEDVFEGYVAKGYDSGGFANEINLKDEMLLLEETEI
FT                   NNTFLNTTPQEMISYFLGQAGVTKSKLSPEIFPERRQVPIKKMSVIQAINAVHAAWGIK
FT                   KKFFFSGGVFYWGEKPEQKKVTVFEYGVNVLTLTRSGGVWELETVSVPWVKHSHKISIE
FT                   HPKISGEFEVKKVITKTDDSGFIRTSIYF"
FT   CDS             complement(584249..584842)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40363"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRD8"
FT                   /protein_id="CBL40363.1"
FT                   /translation="MIFVEDRLVKVGGVVLPGLLKSIEVTETAKVDEQEVEGSAVKPKQ
FT                   ATGYEDARVNIELILDDTTAATKYQRLEAIRTAFRKPGQKVPQPIPIVCEDTAAHGIEK
FT                   VIFKNMRHKRENKKDQLSVTLEFWEFIPQTIKTKKGGGGSKSSSASNKQASKQASEELS
FT                   ADYKNYLSKGRGKSPAVDDASTSEALNRVQQMPY"
FT   CDS             complement(587281..587472)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40364"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRD9"
FT                   /protein_id="CBL40364.1"
FT                   /translation="MRESFVEAGLLEIYRYVPPPLLERFDPEAIDLDEFLEYLAKARYI
FT                   QELEQGIVARAVSEVFSE"
FT   CDS             complement(587490..587909)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05620"
FT                   /product="Protein of unknown function (DUF2765)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40365"
FT                   /db_xref="InterPro:IPR024406"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRE0"
FT                   /protein_id="CBL40365.1"
FT                   /translation="MEDIKKTNGAISDAYGNGGAVEATLSTEAQKKKRAEELKAKYGMI
FT                   YSVAMSVPVDDTQEIELSYYFKRPSVPSYDRYIKDAAKSGITKASKVFMLDCVVEEDRE
FT                   RLIVDMEENPGVAITIGNKLTEIMGLTGTANLKKL"
FT   CDS             complement(587948..588385)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40366"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRE1"
FT                   /protein_id="CBL40366.1"
FT                   /translation="MSLKVNGKAYDWGDVDVKLPGLVLEVQEISYDDELEQEEVYGKGN
FT                   KPRGYGTGNYKASGKISLLRDDYDQLLAWCKAKGVPFFKLDIPSIVVSYANEGDRTRID
FT                   ELKKVKFSKRSTKAAQGDKKLTVDLDLAIYGGVINDGLEPV"
FT   CDS             complement(588403..589881)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40367"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRE2"
FT                   /protein_id="CBL40367.1"
FT                   /translation="MLRDVVHNVSDGLLGFATKTGDGRSVKIGVSPVVSDAPIVITGDM
FT                   DAAKIKSRLGLSPLADAAMDSVQGGAGRTYCFPVAATTAGNIGEVKKTGDGGGTLTTDG
FT                   SPTNAFSIIVKITAQGGLNTAAFTVSIDGGKIFAEETTVPLNGSHEIAGTGVKVKFAEA
FT                   TEESQKPSSFLVNDTYTFETTAPSMTVGDISAAIDKLKTFNEEYEFCHIVGSTGLAVWQ
FT                   MVSTTQVELAKTYHKPMFFLLEAAYPDAAAVRGSGIGESKPGDLTDWALQMEADRKKIK
FT                   NTDIQVCAAWGRLVKLDGTTQIVNLAGLCSGMYAKAKVHESIGKTRTEAGFGVPRTQLL
FT                   DLLPEGVDNSIIELLDLAGYLTFREYDGLDDFYVYHTKMMCPDGSDYRYAEDVRVKNKI
FT                   IRETRKEGLLILNDDIDLEDVQGELETRAKFMFTPLQRMIDEKEISSAVITVPEGQAAT
FT                   IIEDETMRVKIRYLSRGYIREVEVDLGRSRPNNE"
FT   CDS             complement(589875..590129)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40368"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRE3"
FT                   /protein_id="CBL40368.1"
FT                   /translation="MATKKTNAAEAEGRASTVDTPKTPELLEINELKKKYNVGAAVFAG
FT                   LCAANNWKPGRQIADSDFKGALDALLAAPADGKGDKRQC"
FT   CDS             complement(590146..590640)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40369"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRE4"
FT                   /protein_id="CBL40369.1"
FT                   /translation="MLYAEAKKYLLDRLKEAGVKSKPHTTRKSLERSQDSHVGAVLFES
FT                   EDIARNGSKTRYSDQTGAQKKRRKVFDRRIAFTVIIGDYTEDAVESMFERFLSGIGSGI
FT                   TVDGNFVPIEVEAADWVDSDDSILKAKVAVQIKIRFDGGVYRDTDFAKVSELVVESIDK
FT                   N"
FT   CDS             complement(590644..591132)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05670"
FT                   /product="phage virion morphogenesis (putative tail
FT                   completion) protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40370"
FT                   /db_xref="InterPro:IPR006522"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRE5"
FT                   /protein_id="CBL40370.1"
FT                   /translation="MYSIRLEGDTQAALRKIRSFAELDKKRINAAISEGVRESTIERFH
FT                   TSKGPDGRRWETSIRAATEGGKTLVQTAQLRNSIRSKSDASGFAVGTNVKHAATHQFGD
FT                   ERTIRARKAKALRFRVGGKWVSKKQVRVSIPARPFLGLSDDDLEEIKGTVEDFVSREV"
FT   CDS             complement(591134..591589)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05680"
FT                   /product="Mu-like prophage protein gp36"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40371"
FT                   /db_xref="InterPro:IPR009752"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRE6"
FT                   /protein_id="CBL40371.1"
FT                   /translation="MNYCTRQEVREMLKDDAMNIVIGDQYIEDPAKREELIGPIIDAAV
FT                   EDAEGEIDGYIVKRYNVPLIPVPKVINKFTKDIALYNLYSRIGIDENGEEKNYLNRYNS
FT                   AIKFLVLVTEGKVSLGVPSDDLQTAASTGFSVKSNPRLFGRNSLRGM"
FT   CDS             complement(591624..592517)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05690"
FT                   /product="Mu-like prophage major head subunit gpT"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40372"
FT                   /db_xref="InterPro:IPR018774"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRE7"
FT                   /protein_id="CBL40372.1"
FT                   /translation="MIISSQNLRAIFIGFNTTFNKALEEQKPLYDRVATVVPSTTDAET
FT                   YAWLGDMPGMREWLGEREIKNLSGSDYTIKNKDFELTVGVPRNAIEDDKIGLYTPSVQM
FT                   LGQSAAMHPDELIFGLLKKGFTEKCFDGKPFFSADHEIKEGEKVSNKGTAKLTLDSYIA
FT                   ARAAMMSLTNADDRALGIVPNLLVVPPALEGVARSITTADFINGSTNTMKGTAEALAVP
FT                   QLAGKDAAWYLLCTTRPIRPLIYQQRRKAKFVGKTAENDDNVFFNKEYIYGVDSRGNAG
FT                   FGFWQMAYGSDGSTDA"
FT   CDS             complement(592543..592983)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40373"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRE8"
FT                   /protein_id="CBL40373.1"
FT                   /translation="MAALQKERNTVEIANGAKTLSLPVKGATTIYQGSLVALDANGYAI
FT                   PAKKAANITAAGRAEETVQNTGSDGELVIRVSRGVFVFDNTATAANKLKASHVLTPCYI
FT                   EDDHTVTALATGSSVAGLVVRVDDTGVAVEINPALSYPAATA"
FT   CDS             complement(592990..594021)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05710"
FT                   /product="Mu-like prophage I protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40374"
FT                   /db_xref="InterPro:IPR012106"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRE9"
FT                   /protein_id="CBL40374.1"
FT                   /translation="MKGFYILKGGEVDVGEAPEVISILPLGHVKSSKGEFEVDAESLEA
FT                   MKQGIAQRGVDLVVDYEHQTLKGVQAPAAGWVKALRMGDGCIEALVEWTETAAKYLKNK
FT                   EYRYLSPVITVRKSDGKATGLHSLALTNTPAIEGMTPIVNSDNYNEGGQHNMNEFLKKL
FT                   AELLGLGEDATEADVEAALKACTEENKSLKDKAAQLPEVDKIVANKAVCELLGLKAGAP
FT                   ADDVSAKIMELKSGNIDGVNVLAELKELKRKNAERDATDAVELALKGGKITPAQKGWAK
FT                   EYALDNPEGFKSFVEKAPQIVPLSEVAGDSVALKSDKIDDATLLVCKQLGLSAEDVEKY
FT                   GKE"
FT   gap             594118..594425
FT                   /estimated_length=308
FT   CDS             complement(594491..595222)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05720"
FT                   /product="phage putative head morphogenesis protein, SPP1
FT                   gp7 family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40375"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRF0"
FT                   /protein_id="CBL40375.1"
FT                   /translation="MIDVEALLARKDITFEEAVDYFKERVPVTASQFYKIAEEYRSLAF
FT                   TVSGYASVQILKRFYEEILAALEEGNTLQEFRANMNDFLETEGYEGITPLQADNIFRTN
FT                   IQTAYNVGHYEQMSDPAVKELRPYWEYDAVQDTHTRRSHLAMDGRVFPADSPVWDTWFP
FT                   PNGFRCRCTVRSLSKRQVEQRGLKVETEVPRSATLADGRFVSIMPDPMFNTNPAKVRFK
FT                   PNLEGYPEPLRRAYEKRQKAK"
FT   CDS             complement(595219..596796)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05730"
FT                   /product="Mu-like prophage protein gp29"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40376"
FT                   /db_xref="InterPro:IPR009279"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRF1"
FT                   /protein_id="CBL40376.1"
FT                   /translation="MSRKKKKQYQTQQTTPLCRPKVEEIAVAQVTDKYSEYPSNGLTPV
FT                   KLAEIFREADSGDVLRQMELFEELEEKDPHLFSQLQTRKNAVTGLDFEIIPFDSDDSRD
FT                   KEIAEFVESQLGGLENIEDIMIDLLDAIGKGFAVSEIMWGYDEGHVVVEDIRSRHQKRF
FT                   FWDSLDDSFKVRTEAAPEGILLPDSKFIVHRYKARSGHPSRAGVLRVVAWMYLFKNYDL
FT                   KDWVAFAEVYGMPLRLGKYQPGASEDDKLALMQALIQIGADAAGIIPDGTTIDFITTEK
FT                   ASSTDLYERLARYCDEQISKAILGQTLTSDSGGGSYAQSKTHNEVRHDLTVADCKALAS
FT                   TLRRDLIRPLVIFNFGEDKRIPYLRFDCEESGDLEQTANILGTLIKEVGLKVPTSYIYK
FT                   KFSIPKPEGDEEIAAPAAPPMGLPFKADTPAQLVLKGEQQADHGTQERIDRMADAAVKQ
FT                   GAGVFKKAFAPVLKLVEKAESLEQLREMMEDDKAVAELYASMDVSEAEELLQKVMLYAD
FT                   LEGRVNGQ"
FT   CDS             complement(597463..599238)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05750"
FT                   /product="phage uncharacterized protein (putative large
FT                   terminase), C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40377"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRF2"
FT                   /protein_id="CBL40377.1"
FT                   /translation="MAKIDLEDYLEKLDEPEDREAVANREYQRQIFEQYVTSGDNFPER
FT                   RAQLLRDYKTGKELTGPKGLRRKLGAIDLEYFGRAYLAHYFVRKSPAFHGELDRIWREG
FT                   VMKGLDPTESAKEINRADGCRRAIEAPRGHAKSTTFTFKDDLHAAVYAYKHYILILSDS
FT                   SEQAEGFLADLKTELEENAALKEDFGELEGKVWKASVILLSNGVKIEAIGSGKKIRGRR
FT                   HKQWRPDLIVCDDLENDENVNTPDQRKKLRNWYYKAVSKCGDTYTDIVYIGTLLHFDAL
FT                   LANVAKNPSYKTSVYRGVISFAENVGLWDAWERIFTDLANDARQEDAEEFFKANREEML
FT                   EGTAVLWEEKLSYYDLMVIRISEGEASFNSEIQNDPIDPESCTFQEEWFDFYDDDGKTI
FT                   PDFSDPRFMFFGANDPSLGKNKKSDTSSIFAVAKDTKTGFLYVLIADVEKRKPDKIIED
FT                   ALEASRRLKRDYKRPYYQFGVETVQFQYYFAEIMRQRSAEAGEYLPIVEINSTQNKDAR
FT                   IQSLQPFVKNGYIKFSKKHKTLYKQMTEYPMGKNDDAPDGLQMAVKLALDCKIGRKTEY
FT                   RSVIARALDFKRGAF"
FT   CDS             complement(599225..599797)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05760"
FT                   /product="Protein of unknown function (DUF3486)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40378"
FT                   /db_xref="InterPro:IPR021874"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRF3"
FT                   /protein_id="CBL40378.1"
FT                   /translation="MSKGERRRTRVSSTVDKLPDDIKAQLDLKLTDTANTYEELALWLK
FT                   EEGHTISKSAIGRYAIRSNQAAQRVAETLQRTQAIAQAVESHPDLDYTKAASMVLMDGL
FT                   MQRVSTAEDDFAEMPLDKAGRLIASLARNATYEKRVRQDMKKKAELAFDQMEVELMAAI
FT                   KQHPELTEELRDVLARAREKVVTDGED"
FT   CDS             complement(599790..600113)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40379"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRF4"
FT                   /protein_id="CBL40379.1"
FT                   /translation="MAFMDEAQEQEVGKNKAIRGYIIRALAKGNQNALLVRQITNALVG
FT                   DGLILSPDISKHLEYLEEAGYIAFTGRTANAYNAYRRDAVIKLTRKGVDLVEGTIDDPG
FT                   VDV"
FT   CDS             complement(600120..600407)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40380"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRF5"
FT                   /protein_id="CBL40380.1"
FT                   /translation="MDVTQITTIIGASASLLCTLVVGALTFFIKKTLTTLEEADKKNAT
FT                   QIEKVEEKLNDLKADLPLLYVTREDYIRIMNRVEDKLDQLLYGAGKGKEE"
FT   CDS             complement(600420..600905)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40381"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRF6"
FT                   /protein_id="CBL40381.1"
FT                   /translation="MESIQTMASELLVNLALGVLTLLGAYAMYYIRIGVSMAKMKTAAI
FT                   KDEAARKLLNDALDDVESLATVSVSAMEQTTAKALRDAVKAGTVDREELLKLGKEVFED
FT                   VKKSVTPEAQRVITENLGSFDDYLIKCIEDAVRKVKQEDPYITLDRELLESGSVVTE"
FT   CDS             complement(601021..601341)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05800"
FT                   /product="Mor transcription activator family."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40382"
FT                   /db_xref="GOA:D7GRF7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRF7"
FT                   /protein_id="CBL40382.1"
FT                   /translation="MDNLVKGLKIEMLPENYRAIAEAIGTENFVKLAEVVGGATLYIPK
FT                   PESLVRPVRDAQIKEEFNGYNHMELSKKYGVTERWVRQLCGAGRLEGQLELFDLFDQEE
FT                   DN"
FT   CDS             complement(601360..602691)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05810"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40383"
FT                   /db_xref="GOA:D7GRF8"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRF8"
FT                   /protein_id="CBL40383.1"
FT                   /translation="MSKVKICIDAGHVGSNYNQSPVVKTYFESEAMWKLHLLLKAELKK
FT                   KGFEVITTRAKQEKDLGVYQRGTAAKGCDVFLSLHSNACGTESVDYPVVYRAYDNLNKV
FT                   NDLALAIAKKIGQLIGTEQTGKTAIRKNDSGGEYYGVMRGARAVGVPLYMLIEHSFHTN
FT                   KKATLWLSKEENLKRLAVAEAELLAAHFKMEAKPESKEEGKVEIMGTAEATAAQMALYC
FT                   RSKNAAPKLTSCTLEELAQMFLEEGKAEGIRGDIAFAQSLKETGFFKYGGIVLPSQNNY
FT                   AGIGALNGNGKGEAATFPTPRIGVRAQIQHLKAYASKKALVNPCVDPRFHLVTRGSAPY
FT                   VEWLGAADNPDGKGWAVPGKGYGKSLLELLDAIKGTKPPQKPQELPEEKPEDNIPKWQK
FT                   EGFNALVEAGIINTPEYWEKKLTQPITVGEALGIIGRVYGMLDK"
FT   CDS             complement(602684..602815)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40384"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRF9"
FT                   /protein_id="CBL40384.1"
FT                   /translation="MDNKNEKTITQEVNTAPVQEPELNEVDGDPIFHADEEEGDDNE"
FT   CDS             complement(602829..603050)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40385"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRG0"
FT                   /protein_id="CBL40385.1"
FT                   /translation="MDAYSADLYLRQAIGCMVSPDMNRVTEEEVGVLKLLKIAVESERF
FT                   SKALEAEGRSQYTIGEYAEKVILPILKL"
FT   CDS             complement(603073..603654)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05840"
FT                   /product="Protein of unknown function (DUF1018)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40386"
FT                   /db_xref="InterPro:IPR009363"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRG1"
FT                   /protein_id="CBL40386.1"
FT                   /translation="MAARNTGGRKPASIRTLWAIAKSPELGLTDEDLHAVVYRETGKES
FT                   MKKLSQGEINTVARVLQNMKDGVERDTKAKRIDEGGNAQTEKQRRKIYALCDELGWNND
FT                   PRRLAGFVKRVTQVDRVEWLTIAQCNKVIEGLKGILARQRKKEVVSNGSEEKAAHAAGK
FT                   GRESTDQEEAPRRRRSSAGQAEAQPQEVRP"
FT   CDS             complement(604239..604763)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05860"
FT                   /product="Bacteriophage Mu Gam like protein."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40387"
FT                   /db_xref="GOA:D7GRG2"
FT                   /db_xref="InterPro:IPR009951"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRG2"
FT                   /protein_id="CBL40387.1"
FT                   /translation="MARKRITETPAIKNWEEVDAALREIAEAELALGDNEAELNRQIIG
FT                   AKKVAEQESKPYADRISKLERDVKEFVTDHRDELGKAKSRSLNFGEVGFRLSTTISVPK
FT                   AKEKVAEIVRRLKARQMTDCIIVKEKISKDALRKYGEDAVNAVGATWKQKDTFGYEVFK
FT                   DKVERTSSPGL"
FT   CDS             complement(605009..605983)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05870"
FT                   /product="Uncharacterized ATPase, putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40388"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRG3"
FT                   /protein_id="CBL40388.1"
FT                   /translation="MEGTAERTVNIYTNPGKTLAEKINDHLALTKQSIAGLAKDVNYSR
FT                   TAVSRYLSGKYDSNATGLEEKLAEWYAQSTGDAVKMPEGAKGRTPRRPQFLESRDATAV
FT                   LGVCQSCQEYIGLGIVVGRSGYGKTHTLKQYAKLSKVAYIECDDTMSSRDLVEAIERSL
FT                   GLPSGYGTIWKRVNGIREFCNTNKGYLIIIDEADKLVSKYTQKKMEILRAIYDQSDVGI
FT                   VIAGEPKLEAQIKSYLVRMANRVDFYASLRGLSQNEVEEYLSGYEVEPEAMAEIKARAC
FT                   NLQTGCFRLLDRTLSNVFRILEESGSYRITLKTIEQASSMMML"
FT   CDS             complement(608087..608311)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05890"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40389"
FT                   /db_xref="GOA:D7GRG4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRG4"
FT                   /protein_id="CBL40389.1"
FT                   /translation="MKSSKGKLTKFGKLVVKALTDQDMTKTQLAAEIGTSPQYLSYILY
FT                   GVRSGEKYLPLIVATLNLDPNKVEKAIAA"
FT   CDS             complement(608345..608770)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40390"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRG5"
FT                   /protein_id="CBL40390.1"
FT                   /translation="MNKPNPLFEYLKLRRETVAYVEELKKEAQRTKCAVGQTKNPFKAV
FT                   PGLETEFEKAVKTIRYCDNILNEIEKNRERKLRLRRAAYFLEETVVALVALVMCVGLIG
FT                   AVCFGLSFIFAVIGIPLWAVLLALAAGSLLAVGWSWK"
FT   CDS             complement(608989..609321)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40391"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRG6"
FT                   /protein_id="CBL40391.1"
FT                   /translation="MTGIEFLKAPDTTAGELADIISAPCPPVISSECDRLSCRECWLAW
FT                   LNTGEPPQKKKPSDKRTASDEDGLHPNLVELYTRHFRKEHMVAERLRELLPQDSFSRKR
FT                   ELDNAD"
FT   CDS             complement(609318..610091)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40392"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRG7"
FT                   /protein_id="CBL40392.1"
FT                   /translation="MRKIKKINGYLVVKFDAREIREWEGTALGEYGVIDAELYTGHLEI
FT                   DRSAMEYDGAETLEEAVELARGLESEEDTPTFTVTKETDSSFTEDEVEPQLMLSGWEAQ
FT                   LKAQVVSSHYPDIDPRTAAHELYGFKVAFEQLGLIEQAECFVSPTHFEEPPKDNFRHQP
FT                   DGVPTTGLFTLGMKLLEDCPKNDCIIYRNIFKTCLELDEQIDRVTGRAREVLNSELRRE
FT                   VYELWEMLSENYAVGEYRKERRRRKAEEEGKGARA"
FT   CDS             complement(610140..610322)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40393"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRG8"
FT                   /protein_id="CBL40393.1"
FT                   /translation="MKHGKKPTRAQKIRLGQAGLNPENWLVIRQKPDGEMVVIHKRSER
FT                   VRVVPMGTATSKKLG"
FT   CDS             610482..610955
FT                   /transl_table=11
FT                   /locus_tag="CK3_05950"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40394"
FT                   /db_xref="GOA:D7GRG9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRG9"
FT                   /protein_id="CBL40394.1"
FT                   /translation="MFSKTLRTLRAEKGFSQGQLAKAINVSPGNVSDWETDKSKPGYNA
FT                   LAALARIFEVSADYLLELDVSPEKKGVDLSDYKNEQGLSCDGSPLNAMEADVVAMFRLL
FT                   PERHQEEIFDLIYFKYQRHVEEKKGSIFSTYKSENEQQKSGSDDEQKARHETS"
FT   CDS             611745..612920
FT                   /transl_table=11
FT                   /locus_tag="CK3_05960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40395"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRH0"
FT                   /protein_id="CBL40395.1"
FT                   /translation="MIKNKCFKSSIAALSIISLSVMSTFVAMATSQNDSDSSVLMKNVV
FT                   ESDTNILSIDGSVDLEEKITLCDMKGTLYAYFIPVVDNAQNKISGYSVVSAVGTPKTLV
FT                   TAIGDNAASLSVAIMSAFESTGEMIYEFPSAFITKNGDNYYKICMDGSLNEILNPSDYE
FT                   SSTVEFLKSEIPQTNSTKATTVYGQLDDWDTGAFLPIKDDGGGIYYGGYQGWLTNVGVS
FT                   EFYANRSCGVTAASNMFCYMSSHVSGMKGLYTKSGITKSEFNAFQKEVYDTISPAVWGI
FT                   PTVDSLISRAEEFASTHKVDLKATRSSSAWSEVNVRKYIATGLNKESPVLLLTWNSPIP
FT                   DLEQHWVTVTRIYDAGSGTKMVTSNWAGKEIYDFPTWVNGGSLYKGVIYFE"
FT   CDS             complement(613326..613955)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40396"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRH1"
FT                   /protein_id="CBL40396.1"
FT                   /translation="MAIKYTEEQLNSVDKSMLIQMFLNQQEQLEKVSADSFLIIKQIQA
FT                   IYREEGKLKELSSKERLVQRQVVVKPLVDALFVYLKQHENEVGTEKLREAFIYVLNQEK
FT                   YLRVFLTDGDVPMDNNASERAIRGFCVGKKNWQMIDTINGAKSSDIIYSIAETAKANNL
FT                   KPYEYFEYLLTEIPKHMDDTDRSFLDDLIPWSKNLPESIRKPKKIN"
FT   CDS             complement(614354..615223)
FT                   /transl_table=11
FT                   /locus_tag="CK3_05980"
FT                   /product="PEP phosphonomutase and related enzymes"
FT                   /EC_number="4.1.3.30"
FT                   /EC_number="2.7.8.23"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40397"
FT                   /db_xref="GOA:D7GRH2"
FT                   /db_xref="InterPro:IPR004172"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRH2"
FT                   /protein_id="CBL40397.1"
FT                   /translation="MQNEHAKELRKILSETSFLTLPGVYDCLSAKIAEEAGFQALFLSG
FT                   GALAYSVLGRPDFGFLSLAEFGTAIQHIVSSVHAPLIADADNGFGNAIQAANTGAMYEQ
FT                   FGAAGLQIDDKVLPANHPAKNEIIDWELMGPKIKAVRTAVSDDFVIIYRTCAELYDFGV
FT                   DEAIRRINLAKECSADYAYVDGIKSVENLEKISREAKIPLMVNLNEKGFVGGLPTEQVK
FT                   ALNYCIGLFPISAMLAAAQGMIDVLGALAEQGTTLAVRDKMTNPPTKIHRMMGQFSLVE
FT                   KYTPYYNE"
FT   CDS             615801..616751
FT                   /transl_table=11
FT                   /locus_tag="CK3_05990"
FT                   /product="Lactate dehydrogenase and related dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40398"
FT                   /db_xref="GOA:D7GRH3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRH3"
FT                   /protein_id="CBL40398.1"
FT                   /translation="MSDKTVVLNAKKMNFDGNLDFSVLSSDVTVYDDTTPEQLLERIEG
FT                   ADIIVTKEMPVNGDLIRKFPASVKLICEAGTGYNNLDLDAAREKGITVCNIPAYSSERV
FT                   AHTAVMMILNLSSTMQVQMKMLANGNHDNFTKNLQVPHVEVNGKTLGIIGAGHIGKTVM
FT                   KIAKALDMNILVYTRTPRADEDGIRYVDLETVLKNSDYVSLHCPLTPQTKHMINKETLA
FT                   LMKPTAFLINTSRGALIDEPALIEALEKHQIAGAGLDVQETEPPKADNPLYTLDNVILT
FT                   PHMGWKGLETRQRLVSILAGNVKGFLEGTPVNVVS"
FT   CDS             616926..618065
FT                   /transl_table=11
FT                   /locus_tag="CK3_06000"
FT                   /product="Imidazolonepropionase and related
FT                   amidohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40399"
FT                   /db_xref="GOA:D7GRH4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRH4"
FT                   /protein_id="CBL40399.1"
FT                   /translation="MICIKNGTLHTAVSKETFIADILIDGGKIVKIGKGLSADGAEVID
FT                   ATGLQVYPGFVEAHCHIGLDGYGIGYEGHDYNELNDPVTPQVQAIDGINPFDPCMKMAA
FT                   KAGVTCFATGPGSSNSIGGTFAAIKPVGTRVDNMIVKFPIAMKCAFGENPKRCYQKQGI
FT                   SSRMTNAAKIREALNKAKVYKAKIEAAGDDASKLPAYDQKSEALIPVLNHEIPLKAHAH
FT                   QANDIFTAIRIAKEFGVGLTLEHVTEGHMIVDELAKENLPLAVGPTFGHASKFELQNKT
FT                   WETPGILAKAGCHVSIITDAPVTPLHYLPLCAGLAIKAGMDEYDALRAVTINPAEHIGI
FT                   ADRVGSLEEGKDADVVIVDGCPFDVTGVIKHVLINGEEV"
FT   CDS             complement(619835..619924)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40400"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRH5"
FT                   /protein_id="CBL40400.1"
FT                   /translation="MRDVGGNMGNMNGKCVFLWRECGRTVVGT"
FT   CDS             620046..620906
FT                   /transl_table=11
FT                   /locus_tag="CK3_06030"
FT                   /product="Predicted SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40401"
FT                   /db_xref="GOA:D7GRH6"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRH6"
FT                   /protein_id="CBL40401.1"
FT                   /translation="MWIADGWKDYEVIDCSGGEKLERWGKYILVRPDPQVIWDTDKKAP
FT                   QWRKMNGHYHRSSKGGGEWEFFSLPEQWSINYKGLTFQLKPFSFKHTGLFPEQAANWDW
FT                   FGEKIKNAGRPVKVLNLFAYTGGATLAAAKAGASVTHVDASKGMVAWAKENAKSSGLED
FT                   APIRWIVDDCVKFVEREIRRGNHYDAIIMDPPSYGRGPKGEIWKIEDAIYPLVKLCAKL
FT                   LSDKPLFYLINSYTTGLAPAVLTYMLGTAVVPQFGGTVSSEEIGLPVTSSKLVLPCGAS
FT                   GRWEA"
FT   CDS             620931..621284
FT                   /transl_table=11
FT                   /locus_tag="CK3_06040"
FT                   /product="K+ transport systems, NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40402"
FT                   /db_xref="GOA:D7GRH7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRH7"
FT                   /protein_id="CBL40402.1"
FT                   /translation="MKIIIVGCGKVGVSLAERLSAEGHDLVMVDMNPQKVEHLSNQFDA
FT                   LGIVGNGASFNIQQEAGVESADLFIAVTGEDELNLLCCLMAKKTGHCDTIARVRNPLYN
FT                   KEIRFIQENSDSP"
FT   CDS             621281..622288
FT                   /transl_table=11
FT                   /locus_tag="CK3_06050"
FT                   /product="K+ transport systems, NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40403"
FT                   /db_xref="GOA:D7GRH8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRH8"
FT                   /protein_id="CBL40403.1"
FT                   /translation="MIINPELTAAREILKLLKFPSAIKIDTFAKGRVELLRFRLKPEIG
FT                   FGGKTVMDIMRQLKCDVLICAVERGSEVVIPNGSFVLQDTDILSIVGSLENTAQFFEKI
FT                   GLRSKSVKNSLIIGGGTIAHYLAQDLLKIGFRVRIIEQRKERCDYLSEVIPGADIINGD
FT                   GSDRDLLLEEGLTYADSLVALTGLDEENIFLTLYGKLHSNAKLIAKVNKIAFDDVIDSF
FT                   GIDSIIYPKYLTADYILQYVRARQNTIGCNVETLYKILDGRAEALEFSIKEDSAVTNVP
FT                   LMDLNLKDNLLICCINRNGQILTPRGQNIIKVGDTVILVTTNRGLGDIRDILKS"
FT   CDS             622301..623743
FT                   /transl_table=11
FT                   /locus_tag="CK3_06060"
FT                   /product="Trk-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40404"
FT                   /db_xref="GOA:D7GRH9"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRH9"
FT                   /protein_id="CBL40404.1"
FT                   /translation="MNYSMIFYIIGWILDVEAALLVPSLAVSLIYHESCALAFFITIVL
FT                   CLIPGVILVRKQPKNKVFYAREGSVTVALSWIVMSIMGSIPFLLSGSITNPVDALFETV
FT                   SGFTTTGASILPAVEPLQHGILFWRSFTHWIGGMGVLVFLLCLLPLTGSGYHMNLMKAE
FT                   SPGPSVTKLVPKVQSTAKILYGLYLFLTVMEFVLLLVGQMPVFDSLCTVFGTAGTGGFG
FT                   IKNDSFGSYSTYLQGVVTVFMILFGINFNVYFLFYMKKPKEALRCEEARWYLGIIAASI
FT                   LVITFFVRDFFDSLFLAFHHVAFQVASIITTTGFATVDFNLWPTIPKTILVLLMFIGAC
FT                   AGSTGGGIKVSRVVLLFRSLTKELSQSLHPNQVRKIHFEGRAVDHVVLRSVNVFMAAYI
FT                   LIFAISVLLIGIDNFDLVTNFTAVAATLNNIGPGLELVGPAQNFGLFSNFSKLVLTFDM
FT                   LAGRLELFPLLLLFYRGTWKRF"
FT   CDS             complement(624060..624848)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06070"
FT                   /product="Predicted divalent heavy-metal cations
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40405"
FT                   /db_xref="GOA:D7GRI0"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRI0"
FT                   /protein_id="CBL40405.1"
FT                   /translation="MENIGNIILGIMIPFAGTTLGAACVYFMKKGIRQNVEKGLLGFAS
FT                   GVMVAASVWSLLIPSMNLSADLGRLAFLPAVTGFFCGILFLLFLDGHVPHLHIGCDEPE
FT                   GPSCTLKKNTMLVLAVTLHNIPEGMAVGVMFAGLLTANSGITLAGAFALSVGIAIQNFP
FT                   EGAIISLPLKGEGMSSNRAFLYGTLSGVVEPVAALLTVLLYRVLAPVLPYLLAFAAGAM
FT                   MYVVVEELIPETAEGEHSNIGTIGFAIGFALMMMLDVALG"
FT   CDS             complement(625026..627209)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06080"
FT                   /product="ferrous iron transporter FeoB"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40406"
FT                   /db_xref="GOA:D7GRI1"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011619"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRI1"
FT                   /protein_id="CBL40406.1"
FT                   /translation="MAIKIALAGNPNCGKTTMFNALTGANQYVGNWPGVTVEKKEGKLK
FT                   SAKSGEEIIITDLPGVYSLSPYTLEEVVSRDYLVHEKPQAIINLVDATNIERNLYLTTQ
FT                   ILEIGIPVVIALNMADLLAKSGDKIDVKKLSEIFGCEVVETSALKGTGLKEVVEKAIEA
FT                   AKKNEWKNPAGIFSGNVENAIAKVEEAVGDAVDADQKRWFAIKLLEKDSKVIEQLHLPA
FT                   SAMAAVNTEVTRLEKEQDDDTESIITDERYTYIGSVIDKAVKKSGKKLSTSDKIDKIVT
FT                   NRILGIPIFAAVMWFVYYICVSTLGTMGTDWANDTFGGGIQEWAGAALAAAGASDFIQS
FT                   LVVDGILGGLFAVFGFLPQMALLFLMLSILEDCGYMVRIAFVMDRVFRHFGLSGKSFIP
FT                   LLIASGCGIPGIMASKTIENDNDRRLTIMTATFIPCGAKLPVIALLGGIMVGWTSGDYS
FT                   DAGNTAFLMYALGIVCVLVAAIMLKKTKPFSGEAAPFVMELPAYHIPSAKTVLMHTWER
FT                   LWGFIKKAGTILFLACVIMWILSTFGFENGSFGMVEDTENCLMAILGSALAWIFTPLGW
FT                   GKWQCVAAAISGFSAKEGIVSTMGVLANVSEDLSEETDVVAAAIRDWFPTMAAAFSFLV
FT                   FNLLNSPCLAAISTMAQQMQSRKWFWFAIIFQNVFAYCVALMFYQFGLLMEGGSFGIGT
FT                   AAAVVVLLGFLYMLFRPDPYKNQKKASRRSVAA"
FT   CDS             complement(627325..627549)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06090"
FT                   /product="Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40407"
FT                   /db_xref="GOA:D7GRI2"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRI2"
FT                   /protein_id="CBL40407.1"
FT                   /translation="MTLREVPVHTTVKVVKINGEGAFRRRIMDMGITKNSEIYVRKVAP
FT                   LGDPVEITVRGYELSLRRDDAESVEVVTV"
FT   CDS             complement(627795..628001)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06100"
FT                   /product="Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40408"
FT                   /db_xref="GOA:D7GRI3"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRI3"
FT                   /protein_id="CBL40408.1"
FT                   /translation="MTFLRAGETGMIQRVGGAEDTKRFLANLGFVDGAAVTVISELNGN
FT                   LIVNIKDSRVAINKEMAKHVMVQ"
FT   CDS             complement(628038..628214)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40409"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRI4"
FT                   /protein_id="CBL40409.1"
FT                   /translation="MLTDVIVLLLVAMAVIGVIKSIRKQKKSGSCGGCCGSCSGCSGCG
FT                   SVHYDTAPKAHKA"
FT   gap             629235..629437
FT                   /estimated_length=203
FT   CDS             629451..630035
FT                   /transl_table=11
FT                   /locus_tag="CK3_06130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40410"
FT                   /db_xref="GOA:D7GRI5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRI5"
FT                   /protein_id="CBL40410.1"
FT                   /translation="MSVQGLLKKAAGLEIRMICPLHSVIWREDLPWLIDKYLKWSSYTP
FT                   EEKSVTIAYGSVYGHTEKAADILAGKLADRGIRHISVFDVSKTHPSYIIADAFRTSAMV
FT                   FASITYNGGIFCNMDTLLHQLAAHGLTNRTAALIQNGTWAATTSKQMGEILGTMKNIHV
FT                   LEADVTIKSALKNDQEAELDALADAIAASLQ"
FT   CDS             630051..630557
FT                   /transl_table=11
FT                   /locus_tag="CK3_06140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40411"
FT                   /db_xref="GOA:D7GRI6"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRI6"
FT                   /protein_id="CBL40411.1"
FT                   /translation="MKYAIVYSSKTGNTAALADRLHDILPHEHCVYFGDTSHYSPELGA
FT                   DLIFAGFWTDKGSCDDRTRIFLKNLQNTNIALFGTAGYAAPDYIHSILKQAEANIPVNN
FT                   TVLTGFVCQGKMQPAVADKFAAMLEKDPEDAKGKLLRDTYQEGLSHPNEEDFANFKKWA
FT                   EGFIH"
FT   CDS             complement(630744..632159)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06150"
FT                   /product="Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40412"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRI7"
FT                   /protein_id="CBL40412.1"
FT                   /translation="MNKITNASRFLFEELVSRIQERSNAVGIAVAIVDRNGNTQYEKFF
FT                   GYRDQERKLPIDEDTIFGLASVTKSFVALSIMQLVEAGKVDLDDPVSKYIPEFTNRNQK
FT                   PIKLWHFLCHTAGFYPMHRTIINEIAQKAGLDENETGDFAFCEKIALEGTKAVAELLDA
FT                   QTKENGGLIGDPGNYMSYCNDGFGLLSEIVRRVGGENSFAEYVKKHILEPLHMERSSGE
FT                   YVRPAADANAAVLYKMQKGVMTSGRDYHDNAFSLGGAGSLKSTLADMKKYICMYLNYGK
FT                   GIDGTRILSQEGVRTMCRPRIDYRPESHYCFGLSQKKLDDLTVMEHGGSLPGVSSNLSW
FT                   SYDAGVGVMVLCNTSGVPVSTIADAAMRMYHGRNPIEDRFVYQETEWNAEKRKAMCGTF
FT                   RSDEDNNITIFEKDGNLAVKEGETLLRFVPVQEFLGIVRNPDKDGYVRFFENENGEIFA
FT                   IGYGGRMLPRVKD"
FT   CDS             complement(632253..632315)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40413"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRI8"
FT                   /protein_id="CBL40413.1"
FT                   /translation="MEERKSKILSEIDRDREELE"
FT   CDS             complement(632338..633633)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06170"
FT                   /product="Bacterial capsule synthesis protein PGA_cap."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40414"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRI9"
FT                   /protein_id="CBL40414.1"
FT                   /translation="MKKMTLIATGDAFITRRFPEGGYEGFEQVRDVISQYDVKFSNLEM
FT                   TFHNEEGYPAAFSGGTWAMADPRTLDDMRSFGFNLFNTANNHSCDYSHGGVLATIRNLE
FT                   ERDMIFAGTGKNLSEASKPCYLETKNGRVAMIAVSSSFHESGMAGGQSAELIGRPGLNP
FT                   LRYETIYHVTEENYKKAEELAALTKINATMERSVKNGYKNPPASGTLPFGTYKFVLDEK
FT                   DWIESVPFPADMERVEKEIIEAKKQADIVLVSFHGHETDGEDTTVPSMFLETFSRRCVD
FT                   AGADAVIGHGPHELRGIEIYHGAPIFYSLGNFLFETETVEKQPYDAYINKKMPLDTKVG
FT                   AYMDARSKNGTAGYGVLPEIWLSVMAGWTMEDGHLTEIKLYPISLGMTEKRPQKGVPVL
FT                   TGDENVLSYLAELSKPYGTEMEIKDSVGTIRL"
FT   CDS             complement(633637..634902)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06180"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40415"
FT                   /db_xref="GOA:D7GRJ0"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRJ0"
FT                   /protein_id="CBL40415.1"
FT                   /translation="MYQVSERVKKQFEYTMSIPCVKEAMKFIQEDERNTIEEQKELVLI
FT                   EAPTGEEEKRAAVMMEKFKALGLENVHIDRGGNVVGLRRGSGKGPKVLIEGHLDTVFPF
FT                   GTVHGVEERDGFLYAPGIGDDTRALAMLLGLLRALNQNEIKTFGDIVFVATTREEGMGG
FT                   LGGMKDFLNDNDDIDISLTIDNNDMSVLIFEATSGETYEVNFYGIGGHAFGAFGEMAQP
FT                   IHAAARAVAKIADFTVPSDPKTSFCVSNFHGGTAAGVHAIASQATIKFNFRSNSPEELA
FT                   KLRTKIFDAIEEACREETEKWGKDEITWDKNLISQVPGGTQDSHTPLVESAWLGLKSLD
FT                   IEPVFHKGGCTNANVAVSKGIPSICLGRAFAPDENRKNIMNHSVHEKFPITDSYKAVQQ
FT                   AFMVLMMAAGIDGETNSVVEGK"
FT   CDS             complement(635138..636013)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06190"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40416"
FT                   /db_xref="GOA:D7GRJ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRJ1"
FT                   /protein_id="CBL40416.1"
FT                   /translation="MEIYQLRYFVYAAKYENITMAAQELNVSQPSISKAIQSLERELKT
FT                   ELLRKNGRSCVLTRDGYLLQERVVPLLEEIERLPLEFHNRQKKKLIRLNVLTGGLLVPE
FT                   LIREFREENPDVFFQVLDRREATKWDVCIRSTLPQYVFSNAVKLMEEPLCLAFHKDSWL
FT                   RNVEKVRLSDIRNEKFVMLRSGGSIRTISDAIFEKEGIIPDIAFECDTVNILRRMVQEG
FT                   LGIAIWPRYSWRDHLRSETDFENVCYRPIDNNEFKRSLYLILQKDLKMTEELTKFCKYT
FT                   EAYFNSIKKE"
FT   CDS             complement(636111..637373)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06200"
FT                   /product="Na+/citrate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40417"
FT                   /db_xref="GOA:D7GRJ2"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRJ2"
FT                   /protein_id="CBL40417.1"
FT                   /translation="MKDFKVAGFPLPLYVLILALTAACMFTGCVPKSLVPAFLVLMVFG
FT                   EGLNAIGNNVPVVKTYLGGSVICILGSAILTAGGLIPEQTIETLDYFVNDSGFLIFYIA
FT                   ALICGSLFNIDRNLLLRATVKLLPVAVISLSMGILLSGIMGIILGEGFWGGILYIGVPM
FT                   TSGGMTAGTVPLSAMYSQALGVEAADVLTKMAPATVLGNCVAIIFGGLLNNFGKKHPET
FT                   TGNGVLVNDGKTVKKTPPLKPTFASLCTGMIIAFAFYQLGAILHRFVPVIPTYAWMIIA
FT                   VVLVKGTGIMSEELEDAAREWGQFAIKSWTAAALAGIGFTLIDLNTILKTLTPLYLITV
FT                   VLIVGIITFTASVLGKLVGFFPLESAIAAGMCTTNMGGSGNVAVLSSAHRMELLPFAQI
FT                   VTRSCGALMLTLGGILVQMVG"
FT   CDS             complement(637409..637912)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06210"
FT                   /product="Transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40418"
FT                   /db_xref="GOA:D7GRJ3"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRJ3"
FT                   /protein_id="CBL40418.1"
FT                   /translation="MYDELTKNDIKKMEEEIEYRKLVVRKEAIEAVKEARAQGDLSENF
FT                   EYYAAKKDKNKNESRIRYLERMIRTAKVVSDESKDDEVGLYNTVDVYFEDDDETETYKI
FT                   VTTIRGNSLKGLISSESPLGRALLGHKVGDRVHVQVNDRAGYDVIIKRLEKTVDDGSDA
FT                   IRSF"
FT   CDS             complement(639422..640312)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06240"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40419"
FT                   /db_xref="GOA:D7GRJ4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRJ4"
FT                   /protein_id="CBL40419.1"
FT                   /translation="MNDEALETYLNIIKTHSLTKTAENMFISQSAVSNRLISLEKELNV
FT                   KLIDRSPGQKGVVLTQKGEEFVEFAKRHQELNRQIQDWSRGDVTEVLRVASVISLTDYV
FT                   KGFYRELLGKGKLSITLATHWTDRIISMLENRETDIGITPRVFYSKAVEAVPIFREPLF
FT                   LLSSKSVSDYPEVVQAQQLKRSNEIYFDWGTGFVEWHEKQMNPLDLPLMVTDTTELIPE
FT                   LLRIPNSFSIIPACIFKNYHDTELRLSRIVPEPPPRICYLLKLRELHSQKKELIEQFEK
FT                   EFKEYIRTVEDVISI"
FT   CDS             640490..641710
FT                   /transl_table=11
FT                   /locus_tag="CK3_06250"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40420"
FT                   /db_xref="GOA:D7GRJ5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRJ5"
FT                   /protein_id="CBL40420.1"
FT                   /translation="MDYLAEKFARLGTDNAPGQEGLQKAEDLPMIGDKLEGPAVDFSHG
FT                   DVNAHQPIPGSLETFVKHYCVDGTYQAYTEYRGKGAIREYLAEKLAEYSGAPVDPKTEI
FT                   ILTPGTQGALFLAMGSLVGRGDKVAIVEPDYFDNRKLVEFFEGEMVPIHMNWKDAAPHT
FT                   SGIDLKELEEAFKNGVKLFLYSNPNNPTGAVFSKEEVSEIARLAKKYDVAILADELYSR
FT                   QILEKDFTYTHMRALPEKPDKLITIMGPSKTESLSGFRLGVGYGTPEIITRMEKLQAVV
FT                   SLRCAGYNQAAFYRWFSEPDGWMEKRIADHRQIRDDILAVINSCPGCWARPTEGGSYIF
FT                   MQLPKLKVDIFQFTKLCRAQASVTVTPGTEFGKQYGDFIRMNFSQDHDKAVDAVKRICK
FT                   MVDIYRA"
FT   CDS             complement(641898..642671)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06260"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40421"
FT                   /db_xref="GOA:D7GRJ6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRJ6"
FT                   /protein_id="CBL40421.1"
FT                   /translation="MQEKEPQYINSIIRATAILELYEKLNVQYLGIAEISKELGIQKTT
FT                   VFNIVKTLVHQGWLIQDNPNGKYRLGTRILRVSTMITRSITTEELIEKEMRRLRDEYNE
FT                   DVVLTAMVDGVPICVEKVKSANYLQIQSKVGRVGSYVKGSTGKTVFAWQPENFIQEILR
FT                   KIYPETEAGLREKEQVEEQLKKIREQGYCISISEQDKGVASVAVPILNDKGYAVYSLAV
FT                   VGEENRMRQKGLDVIRQELVRVARSLGREQHYMKG"
FT   CDS             complement(642798..644072)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06270"
FT                   /product="Uncharacterized conserved protein (DUF2088)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40422"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRJ7"
FT                   /protein_id="CBL40422.1"
FT                   /translation="MPLFPESAYQLELPKMHKVLQKFDTTQLKSVEETVRAEMHKKEIS
FT                   SLVKPEMRIAMAVGSRGIQNLALIVKTIADELQNMGAMPFIVPAMGSHGGGTAKGQTAV
FT                   LEGYGITEEAIGIPVKSSLEVDEIGTVECESGMVQVVVDHYAAHADLIIPIGRVKPHTD
FT                   FRGPIESGLCKMLTIGLGKFEGCTRLHHMGAIHFPTLLPVAAKLVIDKTPVGFGVAIIE
FT                   NSYDQTYHIEMVPADKIHDREPELLKIARSKMPKILVKEIDALIVQEMGKDISGAGMDP
FT                   NIIGRAARGRLKDFDGTEIQRILVKSLTKDTHGNASGIGLADYVLKSCAETIDLGATYT
FT                   NSVSCGNPEGGRIPIQVMDVKEGVLACLRSGVGVDLNAPKIVYIKNTLQLGEIWVSDAL
FT                   IEEVRRNPQLILCDEEQSIEKLQMS"
FT   CDS             complement(644205..644633)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06280"
FT                   /product="Putative translation initiation inhibitor, yjgF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40423"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRJ8"
FT                   /protein_id="CBL40423.1"
FT                   /translation="MTREANPIPQGKYVPATRFGNMIFTAGMTPRNNGVLLKTGKIKAT
FT                   DEIADYKEAVVQAAKNALTAAKNKLENGEKIAQIMQITVYVNSETDFTKQPKIADFASE
FT                   YFCEELGESGVGSRAAVGVAVLPGDAPVEISIIAGVEN"
FT   CDS             complement(644803..646239)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06290"
FT                   /product="Dihydroorotase and related cyclic
FT                   amidohydrolases"
FT                   /EC_number="3.5.2.5"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40424"
FT                   /db_xref="GOA:D7GRJ9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRJ9"
FT                   /protein_id="CBL40424.1"
FT                   /translation="MMDLAVINGLVFIEGGFRKADVGIKDGKFALIAEPGCLPEAERTI
FT                   DAGGKYVLPGGIDTHVHYRDPGHWERETFEVGTRAAAAGGCTTFFEHPISMPPQWNGEI
FT                   LKNRISICKGEESAANDRHEKGSCVDFCFFGAAGGEHPEAIEPLSHEGIIAYKTFLHEA
FT                   PEGRDAEFEGLTSANNDQLYRVLEEVKKTGLAVAAHAEDNELVTGFIKRLREQGRQTEN
FT                   IAHCESRPPIVEIEAISKMLKFGKDVGCPIELVHVSTWQAMELAKKAKAEGQPVMVETC
FT                   PHYLLLDESYVEKYGAYAKCNPALRKKEDVERLWDYVKDGTIDFIGSDHSPFLVSEKEK
FT                   KDKDGNKDIFLSPSGFPGIDLRLPLMITEGLKRGVSLEKIVELLSVNPAKLFHIFPQKG
FT                   TISAGADGDLVIVDMNKKVTCHAEDSYSQAKGIMKAYEGWQLDCAVDSTIVRGRVVYEN
FT                   GKVDESASGWGEFVKPVLKK"
FT   CDS             complement(646276..647469)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06300"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40425"
FT                   /db_xref="GOA:D7GRK0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRK0"
FT                   /protein_id="CBL40425.1"
FT                   /translation="MSRLNELLQQAGGIGRNEDGSITRLGFSEGYFQALELLKARMKEI
FT                   GMQVETDPVGNLHGVLPGSDPEAKAIVIGSHLDTVIKGGVYDGMLGVTGAMEVAARLKD
FT                   EGRTLRHPLEIWGFNMEESSILGGTFGSRCVTGMIDPDLPGYPEKLAKFDCSPEKVKAA
FT                   KRDISKYECYLEYHIEQGDKLDNADLDVGVVSGIVSVIRYEVTAKGMSNHAGTTMMVNR
FT                   KDALVGMAKLIVAAEERARELSDTLVFTVGKIAVSPGQENVIPGQAVATFEMRHMDRAV
FT                   TDQFYTDIQALAKEIPNCEFEFVNTIAKYSTPCDPRLIKLIDGVCAEKGISHVIMPSGA
FT                   GHDANPMAHEGVPIGMIFVPSVKGVSHQGDEYTKPEHVDIGADVLYQTVLKLDENGL"
FT   CDS             complement(647562..649004)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06310"
FT                   /product="Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40426"
FT                   /db_xref="GOA:D7GRK1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRK1"
FT                   /protein_id="CBL40426.1"
FT                   /translation="MSNNALYMIVTVIFMVGLAVIGILISRGIKDTEDWMVASKSLGKL
FT                   PMAGTYFATIISATSIMSYMGYYYLNGWSGWWNAAGTLLTSFLACMFFARRMRQSECNT
FT                   LPELIEKRYSGKYSIVMSLLIVVSCTALLGAQVTGATIILQTFSNWSTLTCCVILLAVF
FT                   VVFTCIGGMKAVAWTDTICSFVIIIGIWLIAIQFLLKVGGFTAMNESIAALNPEFVKGF
FT                   SVKIPPITALSWVVTWGICNFGAPQFVARFMSAESPEVASKSQGITGIGLLLFYVPLAI
FT                   TGLCGMLIHPGIEKQDMVFTTLVFSEVNPIIGAIMLASVVAAIISTADSLLLLIATTFA
FT                   HDFYSKVKSNVSDKEELFVSRVSTIVFGIGAVALTFVMSDTIQIIQAKAVTLMGAAMAV
FT                   PIMVGVAWKRANKISAMIAAAAGFVTALVWYGLGQPAGIMAALPACLVCFIVIMVGSVM
FT                   TPESANESADKETMDHLFGETK"
FT   CDS             complement(649492..649920)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06320"
FT                   /product="Putative translation initiation inhibitor, yjgF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40427"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRK2"
FT                   /protein_id="CBL40427.1"
FT                   /translation="MAKEANPIPQGKYVPATRFGNLIFTAGMTPRNNGVLIRTGKVKAS
FT                   DDIADYKEAVVQAAKNALTAAKNKLEEGEKIVQIMQITVYVNSEPDFTKQPKIADFASE
FT                   YFCEELGESGVGSRAAVGVAVLPGEAPVEIAIIAGVGK"
FT   CDS             complement(649986..651179)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06330"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40428"
FT                   /db_xref="GOA:D7GRK3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRK3"
FT                   /protein_id="CBL40428.1"
FT                   /translation="MSRLNELLQQAGNIGRNEDGSITRLGFSEKYFQALEFLKGRMQEL
FT                   GMQVETDPVGNLHGVLQGSDPEAKSIVIGSHMDTVMQGGIYDGMLGVTGALEVAARLKD
FT                   EGRTLRHPLEIWGFNMEESSILGGTFGSRCVTGMLDPDIPGYAEKLAKFGCSPEKAKAA
FT                   KRDISKYECYLEYHIEQGDKLDHTGIDVGVVSGIVSIIDYKVTAKGMSNHAGTTMMANR
FT                   KDALVGMAKLIVAAEERARELNDTLVFTVGKISVSPGQENVIPGQAVANFEMRHMDKAV
FT                   TDQFYADIQALAKEIPNCEFEIVNIGAKYSTPCDPRLIKLIDGVCTEKGISHIIMPSGA
FT                   GHDANSMAHEGVPIGMIFVPSVKGISHQGDEYTKPEHIDMGADVLYQTVLKLDENGV"
FT   CDS             complement(651257..652114)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06340"
FT                   /product="Na+-dependent transporters of the SNF family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40429"
FT                   /db_xref="GOA:D7GRK4"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRK4"
FT                   /protein_id="CBL40429.1"
FT                   /translation="MLVTAVIMAYGISGGIEKANKIMMPMLFILFVGLGIYIFTLPGSE
FT                   HGYRYIFTLDPKGLFDPRLWIYAFGQAFFSLSIAGNGTVIYGSYLSEEEDVVSSARNVA
FT                   FFDTLAALLAALVIIPGMAVGGAELSSGGPGLMFIYLLNVFNGMPGGWCVEMVFYVCVL
FT                   LAGLSSLVNLYEAPVEMMQERFGFRRKIAVAVIAMLGGIISLMIQGIVSEWMDAVSIYI
FT                   CPLGAMLAAIMFFWVAGKDFALTAVNKGTKKPIGSWFMPLGKYVLVPAALLALVAGALL
FT                   GGIG"
FT   CDS             complement(652134..652490)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06350"
FT                   /product="Na+-dependent transporters of the SNF family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40430"
FT                   /db_xref="GOA:D7GRK5"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRK5"
FT                   /protein_id="CBL40430.1"
FT                   /translation="MVSEWGGMTFLLPYVLFVILIASTGVIEEMALGRAAKSGPIKAFG
FT                   KCTEIRTGNKRTGEVIGVIPVIGSLALAIGYSVVVGWIFKYTFFALSGGLFHLGQDVAA
FT                   IEGLFGGYSRRIWK"
FT   CDS             complement(653168..653521)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40431"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRK6"
FT                   /protein_id="CBL40431.1"
FT                   /translation="MRHVIIYSWEEVKKVLENELEDDKYRVQVKPCLLKKGYGVVEIEE
FT                   MDIMEGMIEDMQEQLRILKGFINQRLDKEVRDIKPTEDHIREAKQEADEAKERDFEAEK
FT                   ERIRRMIKDKERD"
FT   CDS             complement(653532..653765)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40432"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRK7"
FT                   /protein_id="CBL40432.1"
FT                   /translation="MKKLSDRSKNQIRKFLEAEGVAIGNQFRWEFYWRKCDLEKENPDA
FT                   DEDKVRDEALEYANQEVLKMLDGFFNDYETWK"
FT   CDS             complement(653899..654702)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06380"
FT                   /product="Plasmid recombination enzyme."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40433"
FT                   /db_xref="GOA:D7GRK8"
FT                   /db_xref="InterPro:IPR001668"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRK8"
FT                   /protein_id="CBL40433.1"
FT                   /translation="MCNKIDERLVKTMASIHYGKIKGAGQAKAWMRHCATEERKKREHR
FT                   NEDVDKTRTSENVDFLKLTYAESCKKYDDRIKELDESTNTNKRRDRVTLYGLIISMPSG
FT                   LSRDQEKRLMEVSISLFGEKYGWENIMGAYGHWDEIHEYARDEQFKSSRAHLHLFVVPE
FT                   ISGRLCGKEFSSKKAMKEMNRAIDRECYERFGKHFLTGEKPERKTVEELKTRSSKEAEI
FT                   LWNINKAIRSEQLEQLSLLLESRKGRSLVSQALSHEIYVNRERTR"
FT   CDS             655135..656496
FT                   /transl_table=11
FT                   /locus_tag="CK3_06390"
FT                   /product="RNA helicase./Plasmid replication protein."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40434"
FT                   /db_xref="GOA:D7GRK9"
FT                   /db_xref="InterPro:IPR000605"
FT                   /db_xref="InterPro:IPR002631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRK9"
FT                   /protein_id="CBL40434.1"
FT                   /translation="MTNENMTTATTGTTEPKKTYRTFEIMQYEYNPKTGEDLHFNRAVI
FT                   MKALAHKTIKQWIYVRHDRDKNDDGTPKAPHWHVYIYCNPAKSLDDISKWFGGVPTNMI
FT                   ELKVGKHSFLDCAEYFTHEKQPTKALYDDTKLYSNMPWRQMLNERDEKRAKYGDEDIQF
FT                   RDLQRVDVLNFGKTLKQCKIDDPVLYVKEMQILKKCRLEYLYTQPVPKSRMNIYVTGQG
FT                   GVGKGHTCKALARALYPELDDDEDIFFTIGAKNATFEGYDGQPVIIWDDRRDYSLLEEL
FT                   GGRENVFNVFDTIPQNLRQNIKYGSVKLLNAINIVNSVQPYTEFLDGLSGEYKAKDGTV
FT                   YKSEDDQKQQSYRRFPFCIEVKNFSYVFYENQGFVNHDKKDYLHITSSVRRGNADEVHA
FT                   YFTDRKKIREMEAKLFAYPIQTIKENMTYNRAKDFDENWFEHFGDDLTGIYYEL"
FT   gap             657103..658992
FT                   /estimated_length=1890
FT   CDS             complement(659014..659514)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40435"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRL0"
FT                   /protein_id="CBL40435.1"
FT                   /translation="MKRALLFIFITVCVLGMSACSSKDAMPETSDSASNPVHNTDISNL
FT                   NGEKIWSEQDIVSMFSLVQETDWEYTDCVLIPDHASDRVGAVLFRNDKEQTSNVAFFDA
FT                   DGYFQQYGTYARMSDEPDFQYLGGGAVTFKLETEDGIIYNCTITISIDGSNVNFKAEDD
FT                   LPK"
FT   tRNA            complement(661297..661384)
FT                   /locus_tag="CK3_T_36010"
FT   CDS             complement(661599..662147)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06430"
FT                   /product="hydro-lyases, Fe-S type, tartrate/fumarate
FT                   subfamily, beta region"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40436"
FT                   /db_xref="GOA:D7GRL1"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRL1"
FT                   /protein_id="CBL40436.1"
FT                   /translation="MDRQISVPIKKEDAVSLRAGDYVTLTGTIYTARDAAHKRMQETLD
FT                   AGEALPIEMQGNVIYYMGPSPAREGRPIGSAGPTTASRMDKYAPKLLDLGLGAMIGKGK
FT                   RSQAVIDAIVRNGSVYFAAIGGAGALLSQRIKKSEVVAYDDLGTEAIRKLEVEDFPVVV
FT                   VIDSQGNNLYETAIKEYQK"
FT   CDS             complement(662171..663013)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06440"
FT                   /product="hydro-lyases, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha region"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40437"
FT                   /db_xref="GOA:D7GRL2"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRL2"
FT                   /protein_id="CBL40437.1"
FT                   /translation="MRTVQTSEITKNIREMCIEANHFLSDDMKKVFNESVEKEESPLGK
FT                   QILNQLKENLEIAGRDMIPICQDTGMAVVFIKVGQEVHIEGGNLTDAINEGVRQGYVDG
FT                   YLRKSVVRDPIDRVNTKDNTPAIIHYEIVDGDQVDITVAPKGFGSENMSRVFMLKPADG
FT                   IEGVKEKILEAVRDAGPNACPPMVVGVGIGGTFEKCALMAKHALTRNLEEESPVPYVRD
FT                   LEKEMLEKINRLGIGPGGLGGRVTAMAVNIETYPTHIAGLPMAVNICCHVNRHAHRVI"
FT   CDS             complement(663212..665734)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06450"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40438"
FT                   /db_xref="GOA:D7GRL3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRL3"
FT                   /protein_id="CBL40438.1"
FT                   /translation="MEPNIFDKIHEIDLKKTMEKSYIDYAMSVIASRALPDVRDGLKPV
FT                   QRRVLYSMAELNNGPDKPHRKSARIVGDTMGKYHPHGDSSIYGALVNMAQRWSMRYMLV
FT                   DGHGNFGSIDGDGAAAMRYTEARLSKISVEMLADIYKDTVDFIPNFDETEKEPTVLPSR
FT                   FPNLLVNGGTGIAVGMATNIPPHNLREVIAAVVKIIDNQVEEGRQTSMEEVLQIIKGPD
FT                   FPTGAEILGTRGIEEAYRTGRGKIRVRAVTNIETAPNGKSHIIVTELPYLVNKARLIEK
FT                   IAELVKTKKIDGITGITDESNREGIRINIELRRDVNANVLLNQLLKHTQLQDSFGVIML
FT                   ALVNNEPKVLNILQMLEYYLDHQKDVVTRRTKYDLNKAEERAHILEGLLKALDHIDEVI
FT                   RIIRGSANVAEAKRVLMERFELTDPQAQAIVDMRLRALTGLEREKLENEYKELEAKIAE
FT                   LRAILADENKLLGVIKKEILVISEKYGDDRRTKIGFEDDMSVEDLISDDDTVIAMTNLG
FT                   YIKRMSVDNFKSQNRGGKGIKGMQTIDEDFIEDLLMTTNHHYIMFFTNTGRCYRIKAYE
FT                   IPEAGRTARGTAIVNLLQLQPGEKVTAAIPMREIDDDKYLFMATKGGMVKKTRMCEYSN
FT                   MRKTGLQAILLREGDELIEVKVTDNTEDIFLATKFGMSIRFKETDARITGRVSYGVIGM
FT                   KLDEGDEVIGMQMASQGEYMLVASEKGYGKRTRISEFKLQLRGGKGLLCYNVTEKTGNL
FT                   VGMKLLDDGRDIMLITNEGILIRMGVDDISIIGRNTSGVKLMSIDADSDVRVASIAKVR
FT                   ESSRQDEEDENVADPESMENEDGETTEE"
FT   CDS             complement(665837..667747)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06460"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40439"
FT                   /db_xref="GOA:D7GRL4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRL4"
FT                   /protein_id="CBL40439.1"
FT                   /translation="MSAEYNADQIQILEGLEAVRKRPGMYIGSTSSRGLHHLVYEIVDN
FT                   AVDEALAGYCDTIDVQINSDNSITVVDDGRGIPVDIQKKAGLPAVEVVFTILHAGGKFG
FT                   GGGYKVSGGLHGVGASVVNALSEWLEVEVYHGGKVYKQRYERGKTMYPLKIVGDCPSDK
FT                   HGTKVTFLPDKTIFEETVYDYDTLKIRLRETAFLTKNLKIILRDDREDKKEKVFHYEGG
FT                   IKEFVTYLNRSNVPLYDNVIYCEGKKDNVLVEVAMQHNDSYTENIYSFVNNINTPEGGT
FT                   HLTGFRNALTKTFNDYGRKNKLLKDNEPALTGEDIREGLTAIISVKIEEPQFEGQTKQK
FT                   LGNSEARGAVDSVVSEQLTYFLEQNPSVAKTIIEKSVLAQRARAAARKARDLTRRKTVL
FT                   DGLSLPGKLADCSSKHPEECEIYIVEGDSAGGSAKDARNKSTQAILPLRGKILNVEKAR
FT                   LDRIYGNAEIKSMITAFGTGIHEDFDISKLRYHKIIIMTDADVDGAHISTLLLTFIYRF
FT                   MPELIKQGYVYLAQPPLYKIEKNKRVWYAYSDEELNNILKEIGRDQNNKIQRYKGLGEM
FT                   DAEQLWETTMDPEHRVLLRVTMNEEMTSEIDLTFTTLMGDQVEPRREFIEQNAKYGTLD
FT                   I"
FT   CDS             complement(667760..668845)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06470"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40440"
FT                   /db_xref="GOA:D7GRL5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRL5"
FT                   /protein_id="CBL40440.1"
FT                   /translation="MFIESIELSDYRNYSHLHIDFHKGTNVLYGDNAQGKTNILEAVYV
FT                   CSTTKSHRGSKDKEIIRFGADESHIKMMVRRDGIPYRIDMHLKKNKAKGVAVNGVPIKK
FT                   ASELFGIVNVIFFSPEDLNIIKNGPAERRRFVDLELCQLNRLYVYNLAQYNKTVIQRNK
FT                   LLKDIDYNTSLKETLPMWNEQLLKYGTELIIMRSEFIKELNPLIAEIHAGLSGGKETLS
FT                   IAYEPNVSPENFREQLAKNQFQEIRQRQTLTGPHRDDLNFIVNGTDIRRFGSQGQQRTA
FT                   ALSLKLAEIELVKKIVKDYPVLLLDDVLSELDSKRQEHLLSEITHIQTLITCTGLDEFV
FT                   NSKFRMDKIFKIVEGTVESED"
FT   CDS             complement(668857..669066)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06480"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40441"
FT                   /db_xref="GOA:D7GRL6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRL6"
FT                   /protein_id="CBL40441.1"
FT                   /translation="MESIHLKDEFIKLGQALKLAGLVGSGVDAKFVIQDGLVKVNGEVE
FT                   TQRGKKLYPGDTVSYDGKTFKVEN"
FT   CDS             complement(669153..670271)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06490"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40442"
FT                   /db_xref="GOA:D7GRL7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRL7"
FT                   /protein_id="CBL40442.1"
FT                   /translation="MKLTFQKTALLNGINIVLKAVPSKTTMPILECILIDASTDEIKLT
FT                   ANDMELGIETKVEGDILEKGKIALDAKLFSEIARKLSDSDSLVTIESDEKFNTVITCEN
FT                   SVFKIQGKDGEEFSYLPYIERNKNITLSQFSLKEVIRQTIFSISVNDSNKMMTGELFEV
FT                   NGDTLRVVSLDGHRMAIRKIVLKDEYESTKVIVPGKTLNEISKILTGDNEKEVQIFFGA
FT                   NHILFEFDDTIVVSRLIEGEYFKVDQMLSSDYATKVSLNKKDFLDSIERASILIRENDK
FT                   KPIILNIEDSKMGLKLNSSFGTMNAEILIHKTGQDLMIGFNPKFLSDALRIIDDEEVTL
FT                   YMMNAKSPCFIKDEDESYIYLILPVNFNAAAI"
FT   CDS             complement(670542..671906)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06500"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40443"
FT                   /db_xref="GOA:D7GRL8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRL8"
FT                   /protein_id="CBL40443.1"
FT                   /translation="MLEEIKEKWDEILLNIKEEHDISEVSYRTWLLPLIPDSVDKDILT
FT                   ILVPDSAFISYVKKKYEFLLKITIEEITGFQCELDFKLKSDVKEPEKENRLINVTNNTV
FT                   SQLALQNANLNPRYTFDTFVVGKNNNLAHAASLAVAESPGEIYNPLFIYGGVGLGKTHL
FT                   MHSVAHFILKNNPSAKILYVTSEKFTNELIDAIRNKNNVSTTEFREKYRNNDVLLIDDI
FT                   QFIIGKESTQEEFFHTFNALYEAKKQIIISSDRPPREIETLEDRLRSRFEWGLTVDIQP
FT                   PDYETRMAILRKKEELEGYNIDNEIIKYIATNVKSNIRELEGALTKIVASSKLNNKEIN
FT                   LELAEEALKDLISPNAAREVTPQLIINVVSEHFGITPLDLIGQKRSKELVFPRQIVMYL
FT                   CGDMTSESLQNIGKALGGRDHTTIIHGTKKIASELKTDENLKNTIDILKKKINPQ"
FT   CDS             672140..672364
FT                   /transl_table=11
FT                   /locus_tag="CK3_06510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40444"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRL9"
FT                   /protein_id="CBL40444.1"
FT                   /translation="MCARSGQKKYNKLCPWKKDTEIRRERKNDFRGLDVGEGIYEGKMK
FT                   NRKKIKAAGEKKRVRSGERRRQQELYCRK"
FT   CDS             672497..673135
FT                   /transl_table=11
FT                   /locus_tag="CK3_06520"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40445"
FT                   /db_xref="GOA:D7GRM0"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRM0"
FT                   /protein_id="CBL40445.1"
FT                   /translation="MKIEKKVLDMSLAGIFTAIIIAMSVVPFLGYIPLGFMNATIIHVP
FT                   VIIGAIILGPKYGAYLGLVFGVTSLVKATIAPGVTSFVFSPFVTIGGYSGNMWSAVIAI
FT                   VPRVCIGIVAYFVYKLIMKAAHGIKGSQTVALWVAGIAGAMTNTLLVMNGIYIFFGQSY
FT                   AAASNKAVEHIYDVILGIILGFGIPEAIVAGILTTAITKVLFKIMKDNG"
FT   CDS             673512..673646
FT                   /transl_table=11
FT                   /locus_tag="CK3_06530"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40446"
FT                   /db_xref="GOA:D7GRM1"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRM1"
FT                   /protein_id="CBL40446.1"
FT                   /translation="MKMTFQPKNTQRKRVHGFRARMATAGGRKVLAARRAKGRARLSA"
FT   CDS             673687..673749
FT                   /transl_table=11
FT                   /locus_tag="CK3_06540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40447"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRM2"
FT                   /protein_id="CBL40447.1"
FT                   /translation="MLFFVMRDFYGFIDLVLQRY"
FT   CDS             673750..674094
FT                   /transl_table=11
FT                   /locus_tag="CK3_06550"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40448"
FT                   /db_xref="GOA:D7GRM3"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRM3"
FT                   /protein_id="CBL40448.1"
FT                   /translation="MKRFNSLKKNQDFQTVYRRGKSYANKYLVMYVMDSGREDTRIGIS
FT                   ASKKVGNSVVRHRFARLVRESFRLNKDILEEGKDIIVVARAAAKDKNFDKIESAFLHLC
FT                   GLHNILKESK"
FT   CDS             674331..675581
FT                   /transl_table=11
FT                   /locus_tag="CK3_06560"
FT                   /product="membrane protein insertase, YidC/Oxa1 family,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40449"
FT                   /db_xref="GOA:D7GRM4"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRM4"
FT                   /protein_id="CBL40449.1"
FT                   /translation="MVLTKAGSILGPIATVLGYVMDILFRFTSSFGVFNVGLCIILFTI
FT                   VMKTLMIPLTIKQQKTTKLMSVMNPEIQAIQKKYKGKSDQESMQRQNVEIQAVYEKYGT
FT                   SMTGGCLPLLIQMPILLALYRVIYNIPAYVPSVRVYFDNVVTPLMGQADYAQKLQEITN
FT                   IATACGGKLDKFDFTNANRLVDMLYKFSTSQWGELQSLFPAISDVIGQNAAVVERMNTF
FT                   LGLNMAEAPGWVPSFAWIIPVLAAVSQWFSTKLMSGNQPSTSADAENPMAQSMKTMTTT
FT                   MPLFSAFICITMPAGLGIYWIATSVVTIIQQLIVNAYMDKVNIDDMIAKNLEKVNKKRA
FT                   KQGLPPAKVTQNATASLKAIKAEEEKEKAAEEVKKEKIAKQIEESSKYYNTNAKPGSLA
FT                   SKAAMVQKYNEAHDKRK"
FT   CDS             675597..676313
FT                   /transl_table=11
FT                   /locus_tag="CK3_06570"
FT                   /product="Predicted RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40450"
FT                   /db_xref="GOA:D7GRM5"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRM5"
FT                   /protein_id="CBL40450.1"
FT                   /translation="MEMITVTAKTVEDAITQASLQLGVSSDRIQYEVVEKGSAGVLGGL
FT                   FGSKPAVIRAKKIETVDDKAVDFLNSVFDAMGLAVDVEVKMNEEEKEMDVNLIGEEMGL
FT                   LIGKRGQTLDSLQYLVSLVVNKESEDYLRVKLDTENYRERRKETLETLAKNIAYKVKRT
FT                   RRPVSLEPMNPYERRIIHSALQNDKYVFTKSEGEEPFRHVVIALKKEERRERRPRYERR
FT                   ERPAGSENSRYRSSQE"
FT   CDS             676533..677948
FT                   /transl_table=11
FT                   /locus_tag="CK3_06580"
FT                   /product="tRNA modification GTPase trmE"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40451"
FT                   /db_xref="GOA:D7GRM6"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRM6"
FT                   /protein_id="CBL40451.1"
FT                   /translation="MFKAAGVSDRMEIMEYTDTIAAIATAMGNSGIGIVRISGENAVEV
FT                   AEKIFREPGKKKLSEAESHTIHYGYVYDGDETVDEVLLMLMRGPRSYTAEDTVEIDCHG
FT                   GMLVTRRILETVLKAGARLAEPGEFTKRAFLNGRIDLSQAEAVIDVINAKNEYALQSSV
FT                   SQLRGSVSKEIHEIRDQIIYEIAFIESALDDPEHISMDGYGEKLLKVVLSVKKKLEKLI
FT                   RSSSNGRVVSEGVKTVILGKPNAGKSSLMNVLVGEDRAIVTDVAGTTRDILEEHIYLQG
FT                   ISLNVVDTAGIRDTEDVVEKIGVSRAMEEAKKADLIIYVVDGSRELDENDYQIMDFIKE
FT                   RKSVVLLNKSDLEPVVSADEVEKRSGHKVIGISAKEETGIDLLEEEIKSLFYEGEIDFN
FT                   DQVMITNVRHVKALKDAFESMSMVENSIENGMPEDFYSIDLMDAYEKLGLIVGESVEDD
FT                   LVNEIFSKFCMGK"
FT   CDS             678053..680002
FT                   /transl_table=11
FT                   /locus_tag="CK3_06590"
FT                   /product="glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40452"
FT                   /db_xref="GOA:D7GRM7"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRM7"
FT                   /protein_id="CBL40452.1"
FT                   /translation="MPVVEETYDIVVVGAGHAGCEAALAAARLGFETIMFTVSVDSIAL
FT                   MPCNPNVGGSSKGHLVRELDALGGEMGKNIDKTFIQSKMLNESKGPAVHSLRAQADKQE
FT                   YTRSMRRVLENTDHLTIRQAEVAEILTEEIPGEYGTFQEEHEGHQESGYPVKKRIVGVK
FT                   TYSGAVYKCRAVVLATGVYLRARCIYGNVSNPTGPNGLQAANHLTDSLKANGIEMYRFK
FT                   TGTPARADKRSIDFSKMEEQFGDKRVVPFSFSTDPESVQKEQISCWLTYTNEKTHEIIR
FT                   NNLDRSPLFSGAIEGTGPRYCPSIEDKVVKFPDKGRHQVFVEPEGLYTNEMYLGGMSSS
FT                   LPEDVQYAMYRTVPGLENVKIVRNAYAIEYDCINPRQLKASLEFKNIDGLFSGGQFNGS
FT                   SGYEEAAVQGFMAGVNAARKLQEKSAVVLDRSQAYIGVLIDDLVTKENHEPYRMMTSRA
FT                   EYRLLLRQDNADLRLRGIGHEIGLVSEEQYEYVLWKEKAIEEEIKRLEKATVGANEKVQ
FT                   EFLEKHGSTSLKSGSTLAELIKRPELNYEMLAELDEKRPELPADVREQVDINLKYDGYI
FT                   RRQKQQVAQFKKLEGRKIPVDLDYTTVGSLRREAVQKLNLYKPENIGQASRISGVSPAD
FT                   ISVLMVHLEQMGRK"
FT   CDS             680007..680753
FT                   /transl_table=11
FT                   /locus_tag="CK3_06600"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.-.-"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40453"
FT                   /db_xref="GOA:D7GRM8"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRM8"
FT                   /protein_id="CBL40453.1"
FT                   /translation="MTDEFVKLLDQGCADLEIELSKQQKEQFFKYYEMLIEKNKVMNLT
FT                   AITELSDVIKKHFVDSLLLVLAAPELGLKLDTSAKYRCIDVGTGAGFPGIPLKIAFPGL
FT                   KITLLDSLNKRVGFLNEVIETLGLTDINAVHGRAEDYGRDPKYREQYDLCVSRAVANMS
FT                   TLSEYCIPFVKKGGYFIPYKSGKADEEIAQARSAVKKLGGAMQDIIVKFLPETDVERTF
FT                   VPVKKLAATAKQYPRKAGLPGKEPLK"
FT   gap             680804..682797
FT                   /estimated_length=1994
FT   CDS             complement(682853..683443)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40454"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRM9"
FT                   /protein_id="CBL40454.1"
FT                   /translation="METIYEKYMALPIDKGLLCLEYGDIAEPYFCYPVNAKPIGFEGCI
FT                   LYCFLPEYGEMVFACNPESCVDQNVYPLAANFEDFIRLILACGTANPLEQIVWMDKNKF
FT                   EEHMANEEKILTDGQRTAAQQLQRALSLLPIENPFEYVKSIQKDFDGSKIQYSDEYYEV
FT                   TGIENPKGTNTQDKHLVEFEPVVFEFNRKQDSD"
FT   gap             683453..684957
FT                   /estimated_length=1505
FT   CDS             complement(685208..686248)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06620"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40455"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRN0"
FT                   /protein_id="CBL40455.1"
FT                   /translation="MRAFDYIKEPEKLLTPEIVQMTGKIHEHKGKQELFLEANIDELKT
FT                   LLEVALIQSTGASNRIEGIYTTDKRLEELVSQKAEPRNRSEQEISGYREVLSTIHESYE
FT                   YIVPRPNIILQLHRDLYSYAGSGGEYKNADNVIAETDAEGHQKARFIPVPAFQTVEAMD
FT                   ELCRQFLEAWNTDKIDRLLLIPMFILDFLCIHPFNDGNGRMSRLLSLLLYYKAGYIVGK
FT                   YVSMEMLIEKTKETYYEALQASSTGWHENENSYEPFVKYYLGIMLKAYNEFESRVEHLK
FT                   NRTLSKPERIKAMIDQKVGKITKKEIMDAHPDISKTTVERTLADLVKSEYIAKVGSGPA
FT                   TGYVKI"
FT   gap             686827..687173
FT                   /estimated_length=347
FT   CDS             complement(687500..688564)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40456"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRN1"
FT                   /protein_id="CBL40456.1"
FT                   /translation="MTFYQELQLNQAGSKNLLKKSETVKEKSYHILVYLVKIAVTMAFC
FT                   FLFVTIFSILFGNENSIVGVVVLLCLMVFRNADLGIHTGQSTMLLALFFVIMTVCPHLA
FT                   NQLSPVLGMLLNIAAMAVLILFGCHNPFMFNQSTLVLGYLLLYGYDVTGKSYQMRLTGM
FT                   ALGAALTCFVFYRNHKNRTYKRNLNDLVQEFDISSSRTKWQLCQIICVPAVLCIAELCN
FT                   MPRAMWAGIAAMSAILPFMEDMQYRVRKRIVGNIAGVICFTVLYFLLPSSIYTYIGILG
FT                   GIGVGLSAKYGWQAVFNTFGALAIATESYGLKGAVGLRVIQNVFGVVFALIFCSMFYWL
FT                   MSKKKETVVTVAAK"
FT   CDS             complement(688596..689639)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06660"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40457"
FT                   /db_xref="GOA:D7GRN2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRN2"
FT                   /protein_id="CBL40457.1"
FT                   /translation="MEQKKEKGLRIRSCLTGAIWLALVFSTVISALLFAFLNHFFNLPG
FT                   SIPVLGWLLIFNTLIAGLITSFINARLLEPITRLSKAMKEVSQGDFEQHLETNSRIAEV
FT                   GESYQSFNVMTKELRATEVLQMDFVSNVSHEFKTPINAIEGYTMLLQGEELSQDQEEYV
FT                   KKILFNTQRLSGLVGNILLLSKLENQNIPMKKTEYRLDEQIRQAFLSLETKWTEKEIGF
FT                   QVELEEVKYTGNEGLFMHIWINLLDNAIKFSPAKGTIMMFLKQEKDSVMFILEDEGPGI
FT                   EDDVKTRIFDKFYQTDGSHKAEGNGLGLALVKRIVDSAGGTIKAENREYGGCRFVVELP
FT                   IQKDEAI"
FT   CDS             complement(690328..691761)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06680"
FT                   /product="Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin
FT                   synthases and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40458"
FT                   /db_xref="GOA:D7GRN3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRN3"
FT                   /protein_id="CBL40458.1"
FT                   /translation="MGKRKICKIVFVILSIFLCVAFYELFGICIAYKKQPEVSNTIKKE
FT                   TQNDSWNERSENMERAVIIEKNPEALLQRVRLIRNAKEDIILSTFAFQSDESGKLILGA
FT                   LHDAADRGVHVRLLVDGMESWVDMEGNPYFYGLSSHKNVEIKLYNKANPLKPWKMMGRM
FT                   HDKYLIADGKAYILGGRNTYNYFLGDFLGHKNYDRDVLVVCDEPEKENSVNQLLEYFET
FT                   IWEQEDSGYFHDNKKLANRKSVKNAVLELQNGYQKYFEENKERICDTDYTDETFETEKI
FT                   ALVSNPIHTGPKEPVVWYQLGELMKNAKERVKIHTPYIICNDMMYNTWKEIAERVPDFS
FT                   IMTNSVANNGNPFGSADYARNRNRILNTGIDIWEYEGGYSYHGKSILIDDDLSVIGSFN
FT                   MDMRSTYLDTELMLVIRSKEINKQLEEGMMEYERVSRQVLEDGTYRDPYHVEPIELTKK
FT                   RQRKIFLVQHLLEWARYLF"
FT   CDS             complement(691934..693493)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06690"
FT                   /product="Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin
FT                   synthases and related enzymes"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40459"
FT                   /db_xref="GOA:D7GRN4"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRN4"
FT                   /protein_id="CBL40459.1"
FT                   /translation="MKQDTLEGKAKTKNGIKRLCFSIICILLEVIFIITIVTRLNEYAE
FT                   IINLFTRILSGILVLRLYASDKTSSMKMPWVILILIFPIMGVGLYLLIGLNGGTHKMRE
FT                   RYAEIDSKLLPMLPDNQECLSRIKEKIPKAGNIASYIQRNSRYPIYQNTDIKYFDEAVK
FT                   GLEAQLEELAKAQKFIFMEYHAIEDAEAWHKIQDVLEERVKAGVEVRVFYDDMGSIGFI
FT                   NTDFVKKMESIGIHCRVFNPFVPGLNLFLNNRDHRKITVIDGKVGFTGGYNLANEYFNY
FT                   THPYGQWKDTGIRLEGDAVQSLTVTFLEMWNAVSEKATNDTDFSKYIIHYDYKAQQTGF
FT                   VQPYADSPMDNEQVGEEVYISMINKAENYCWFMTPYLIITDEMTHALCLAAKRGVDVRI
FT                   ITPGIPDKKFIYNITRSFYHGLVKHGVRVYEWTPGFCHAKMSIVDDCMATCGTINLDYR
FT                   SLYHHFENGCFMADCQAVVEIKNDLIRTMGECRDVTDQYCTGRSAYLRLGQLFMRLFAG
FT                   LL"
FT   CDS             complement(693806..693991)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40460"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRN5"
FT                   /protein_id="CBL40460.1"
FT                   /translation="MEDAFYNRENLNPQMKGADAGQTANTVAVPEGVDADLLMKVLGNP
FT                   EMAALLTSLAKSLKAE"
FT   CDS             complement(694016..694411)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06710"
FT                   /product="Phage integrase family."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40461"
FT                   /db_xref="GOA:D7GRN6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRN6"
FT                   /protein_id="CBL40461.1"
FT                   /translation="MDNRSLSHTRWKCQYHIVFIPKYRKRFVAQILVDIKKEQDELKDI
FT                   LGSEYQDYNLVMATTFGLPIEDSYLRDQMQKVIDEQGLPDVVFHSLRHTSVTYKLKLSG
FT                   GDIKVVQGDSGHAQADMVTEVYGHIID"
FT   CDS             694674..695954
FT                   /transl_table=11
FT                   /locus_tag="CK3_06720"
FT                   /product="Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA
FT                   dehydratase subunit, BcrC/BadD/HgdB"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40462"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRN7"
FT                   /protein_id="CBL40462.1"
FT                   /translation="MDVIEKFGNRVSSQALKDPEKARRMLLAGYRLQEKKLQFLPDREL
FT                   PSSGQYVARVVMKNIIQSLSEPENAAMVSIFVPGELVMAAGLTPYSVEAMSCFMAGTKC
FT                   EQTFLRKTEEEGFPETMCSYHRVFLGAALTGILPKPNCMIYTNLACDGNMMTFPYLKDK
FT                   FECPGFYIDVPYEKNRESVLYVADQLRKLKRFLEETTDRRISEETVRSAVDNSRKAAAN
FT                   YKKQLALRCAHDPVTSLTNELYALFMCHLMAGSETAVTYTEKLLRDVRMSPRGDGLSVI
FT                   WMHIMPFLQEPVKDIFNYSKKMHIRACDFIADGFQEMHAEDPYEAMAEKMVYCIYNGSV
FT                   KQRIEEAERLARITESDGAVLFAHWGCKGTIGASSLIKQSLEKTGLPTMILDGDGCNPA
FT                   NTSDGQVSTRLQAFVEMLEKGKEEKHA"
FT   CDS             695951..697660
FT                   /transl_table=11
FT                   /locus_tag="CK3_06730"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40463"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRN8"
FT                   /protein_id="CBL40463.1"
FT                   /translation="MIYYVCKYTPIELFRGFGEECSVLEEMPENFEQSDQIAHANLCGF
FT                   GKSVIQAVLEGKVEQLVLVNCCDSMRRVYDIVESTGKCKFLYMLDLPHDDNECEKVKFA
FT                   GTIRRLKKAYEAYSGKVFDKRAFIKSFITPEMNTEPYIGVLGVRVSGILEDMIRDNIQM
FT                   DVENLTCTGGRKLSVVQDEMWNMEEEELFLSYADVLLGQMPCFRMNRSIRRNRLYLDPN
FT                   LKGIIYHTIKFCDYYGFEYASIKRDIKVPLLKIETDFTSQSAGQLLTRIQAFEETIEGS
FT                   EDMDPGKGISEEARKKMESGIFYVAGIDSGSTSTDVVILDQDGKIKSTMIIPTGGGAMM
FT                   SAEKSLDLAIEKAGIKKEEIVRIDTTGYGRSYIDSGDDSITEITCHAKGANYLNPNVRT
FT                   IIDIGGQDIKAISIDGQGAVKNFLMNDKCAAGTGRFLEMMAKTLGLSLEEMSVKGLEWK
FT                   HNIVISSMCTVFAESEVVSLVAQNKDVADIIHGLNVSVASKVGALAARLGKDHPGEYMM
FT                   TGGVAKNRGIIQALEEKLGAKLYICDEAQLCGALGAALFAYEKCKGSAEETR"
FT   CDS             complement(697671..697943)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40464"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRN9"
FT                   /protein_id="CBL40464.1"
FT                   /translation="MAVWRLQVNTGGANVADCLQNHVAALWAGKVLAYLMGNYYDSKAT
FT                   YEKLFDWTDEHKFKTGKYSHKEAVIDELATASPSEYLTKISIQVF"
FT   CDS             complement(697968..698258)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40465"
FT                   /db_xref="InterPro:IPR027890"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRP0"
FT                   /protein_id="CBL40465.1"
FT                   /translation="MMNFSGILIGVLTFFLIGLFHPIVIYAEYYFGSRCWPVFLLVGIL
FT                   CMILSVRMQEILWSVSLGVLGVSCFWSIKELKEQEKRVAKGWFPKRKVDKH"
FT   CDS             complement(698431..698889)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40466"
FT                   /db_xref="GOA:D7GRP1"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRP1"
FT                   /protein_id="CBL40466.1"
FT                   /translation="MLPFENMAADYVKETGNHVLYRVTPVFEGSSLVAPGVLMEAESVE
FT                   DKGEGILCCVYVYNVQPGININYATGDSSASGTNKTAVTEQATQAVTQAASQQTSTESY
FT                   ILNTNTKKFHRPSCSSVKQMKESNKKSSSESRDALIAAGYDPCKKCNP"
FT   CDS             complement(698922..699338)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40467"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRP2"
FT                   /protein_id="CBL40467.1"
FT                   /translation="MSACGQAAKQEPIVSASTELHQVDLVSAGTLVFDLASVPAYSGQP
FT                   YAIVNDNKYFTDADLTAVSFETYSDLDSLGRCGVAYASVGKDLMPTEERGSIGQVKPSG
FT                   WHTIKYDNVDGKYLYNRCHLIGFSSLQKMRMRRT"
FT   gap             699638..701775
FT                   /estimated_length=2138
FT   gap             702570..703243
FT                   /estimated_length=674
FT   gap             704759..706128
FT                   /estimated_length=1370
FT   CDS             706236..706562
FT                   /transl_table=11
FT                   /locus_tag="CK3_06830"
FT                   /product="Bacterial protein of unknown function (DUF961)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40468"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRP3"
FT                   /protein_id="CBL40468.1"
FT                   /translation="MEMKYVVPDMAQSFGTLEFAGESEPVFERDKNNRRVLAKRSYNLY
FT                   SDVQKGENVVVEIPVQAGEKKFKYEQKVKLVNPKLYGRGYAIGDMGHTDYVLLADDIVA
FT                   VEEK"
FT   CDS             706578..706961
FT                   /transl_table=11
FT                   /locus_tag="CK3_06840"
FT                   /product="Bacterial protein of unknown function (DUF961)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40469"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRP4"
FT                   /protein_id="CBL40469.1"
FT                   /translation="MRLSNGFVIDKEKTFGELKFTAVRDVFLQNEDGTPSTQLKKRIYD
FT                   LKCSLHGGIIPVSVPPEVPLREFPYNAVVELVNPVADTVSRKTYTGADVDWYVKAENIV
FT                   LKNKGNQNAGSPQNHTPQGQPKK"
FT   CDS             707059..707241
FT                   /transl_table=11
FT                   /locus_tag="CK3_06850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40470"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRP5"
FT                   /protein_id="CBL40470.1"
FT                   /translation="MKDKNILICVGIIIYIAMSGIDRFVYHIPNIIYIPVAILGIALIL
FT                   IGFFKDKFKQENFDL"
FT   CDS             707277..707540
FT                   /transl_table=11
FT                   /locus_tag="CK3_06860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40471"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRP6"
FT                   /protein_id="CBL40471.1"
FT                   /translation="MIGLILGNIMVVLGVFSIIKGKLPLIKRYNGVKNIKLHSRIEGTA
FT                   ILLVGIMLIFQCFISLGNVEIVIIILSICIFSLILEIALKVI"
FT   gap             708050..708662
FT                   /estimated_length=613
FT   CDS             708745..709299
FT                   /transl_table=11
FT                   /locus_tag="CK3_06880"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40472"
FT                   /db_xref="GOA:D7GRP7"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRP7"
FT                   /protein_id="CBL40472.1"
FT                   /translation="MGNVYHTKEEMIDCVNAFYEGMVQRSEEMKRHPNYKTGENYAYLG
FT                   LPPCFLIFDEYVAFFEMLGTKESVSLLSQLKKIVMLGRQAGYFLIVACQRPDAKYFSDG
FT                   IRDNFNFRVGLGRISELGYGMLFGSDVKKQFFQKRIKGRGYCDVGTSVISEFYTPLVPK
FT                   GHDFLQEIGRLEEKRTASNES"
FT   CDS             complement(709305..709505)
FT                   /transl_table=11
FT                   /locus_tag="CK3_06890"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40473"
FT                   /db_xref="GOA:D7GRP8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRP8"
FT                   /protein_id="CBL40473.1"
FT                   /translation="MQVYIDLENLLKEKNISKNKVCEACKLQRTQLNNYCKNKVSRIDL
FT                   TILAKLCDFLECSPNDILKLK"
FT   CDS             709617..710027
FT                   /transl_table=11
FT                   /locus_tag="CK3_06900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40474"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRP9"
FT                   /protein_id="CBL40474.1"
FT                   /translation="MCKKRKIITITVLFVLGVAVSYLQWGREIDVVGSMGTSSENFHEE
FT                   HVTFTLNRLIITDKEKCAEEIIKKCRENDFTSILFSYDVAKPNALYGTVYRSRFSMKGQ
FT                   KPLFHFRYTQTADTLGSYNIVDDPEAFTLVIE"
FT   gap             710583..711394
FT                   /estimated_length=812
FT   CDS             711673..711807
FT                   /transl_table=11
FT                   /locus_tag="CK3_06930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40475"
FT                   /db_xref="InterPro:IPR024522"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRQ0"
FT                   /protein_id="CBL40475.1"
FT                   /translation="MWELVKDFLLVSMGMGIGIVLMCILNVGKEADCEMKQLNESEDN"
FT   CDS             711808..712029
FT                   /transl_table=11
FT                   /locus_tag="CK3_06940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40476"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRQ1"
FT                   /protein_id="CBL40476.1"
FT                   /translation="MNFGQNLYQWFLSNAQSLVLMAIVVIGIYLGFKREFSKLIGFLVV
FT                   ALIAVGLVFNAGGVKDVLLELFNKIIGA"
FT   CDS             712114..712236
FT                   /transl_table=11
FT                   /locus_tag="CK3_06950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40477"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRQ2"
FT                   /protein_id="CBL40477.1"
FT                   /translation="MKWYNDMTEQEKRSFQKVIVVFVVGAILILIVPMVFHAIF"
FT   CDS             712314..712733
FT                   /transl_table=11
FT                   /locus_tag="CK3_06960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40478"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRQ3"
FT                   /protein_id="CBL40478.1"
FT                   /translation="MSEREKIIRLWFDMWLKQQDLGMDKIFTEDVVYTESWCPKYENLK
FT                   TVKHWFNEWNTRGKVIIWDIKQFFHKENQTVVEWYFKNEMNTGNVEEFDGISLIEWTED
FT                   NKIKSLKEYGCNLNNYNPYQHSDNPQFRDEKISWF"
FT   CDS             713040..713543
FT                   /transl_table=11
FT                   /locus_tag="CK3_06970"
FT                   /product="Antirestriction protein (ArdA)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_06970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40479"
FT                   /db_xref="InterPro:IPR009899"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRQ4"
FT                   /protein_id="CBL40479.1"
FT                   /translation="MQETRVLVETSGTTGEETTSYWFDLPIDVAEFEEKLGVCAESGDY
FT                   RIIEKVLPFADEVHEHTSVYQLNELDFMYRQLSSDMQEEYVSLLTVFENLEALYICRNV
FT                   ITVYHDCKSMIDVTRQKLMNDPTFKHLSEDCQEYYFDFEAYASHLQEHGKFLVTEHGIF
FT                   ELPE"
FT   gap             713862..715110
FT                   /estimated_length=1249
FT   CDS             716213..718399
FT                   /transl_table=11
FT                   /locus_tag="CK3_07000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40480"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRQ5"
FT                   /protein_id="CBL40480.1"
FT                   /translation="MKERIKGAFTKRKILHFLKMALFVVALSLILLSLLGTVAHATGLV
FT                   DDTINAENLYSKYPLSNYQLDFYVDNSWSWLPWNWLDGIGKSVQYGLYCITNFVWTISL
FT                   YLSNATGYVVQEAYKLDFINDMADSIGQSIQTLAGVTENGFSSTGFYVGFLLLIILVVG
FT                   IYVAYTGLIKRETSKALHAVINFVVVFVLSASFIAYAPDYIKKINEFSSDISTASLDLG
FT                   TKIMLPNSDSEGKDSVDLIRDSLFSIQVEQPWLLLQFGNSNAEEIGTDRVEALVSTSPE
FT                   DEDGKTREEVVKTEIEDNDNNNLTIPQVVNRLGMVFFLLFFNLGITIFVFLLTGMMLFS
FT                   QILFIIFAMFLPISFLLSMIPSYESMAKQAIVRVFNTIMTRAGITLIVTVAFSISSMFY
FT                   NISTDYPFFMVAFLQIVCFAGIYMKLGDLMSMFSLNANDSQSMGRRIFRRPYLYLAHRA
FT                   RRMERRLAGAVTAGGVAGAVAGSTISNRKPTRNTATKDSRGNTSSSMGQRAGSKVGAVL
FT                   DTKNKVKDKANAVKENIKDMPTQTAYAVYSAKKKAKSSVSDFKRGMVQEQQSRQTGRLE
FT                   KQEQHRQNIADKRMELQKAQEARQAQRKADGSATTGATRPHERPATASKPSAEKMQEVK
FT                   RPATAPTPKASEPVKTNVIKERPLSSGASDKKATQSVQPAHRQNVEKVVSQETRQNYTK
FT                   DRRTKVQQTQTVQKNQQTTEKTRNLVTKKGQKKK"
FT   gap             718597..719401
FT                   /estimated_length=805
FT   CDS             720013..720333
FT                   /transl_table=11
FT                   /locus_tag="CK3_07030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40481"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRQ6"
FT                   /protein_id="CBL40481.1"
FT                   /translation="MNREEVLKKVQNRKPNQMDEMELDILQKSSTIGMTVGLIMCVVLM
FT                   IINIYCNQPYQDVYSVFCSILCGQYMYKWIRQKDKFTLFCGICWGFVAVLLFILYLTKI
FT                   FV"
FT   CDS             720353..720559
FT                   /transl_table=11
FT                   /locus_tag="CK3_07040"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40482"
FT                   /db_xref="GOA:D7GRQ7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRQ7"
FT                   /protein_id="CBL40482.1"
FT                   /translation="MNDELILKNNLKQVRTEKKLSQSALAEMVGVSRNTISSIETGQFN
FT                   PTAKLALILCIALDKKFEELFYF"
FT   CDS             720570..720794
FT                   /transl_table=11
FT                   /locus_tag="CK3_07050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40483"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRQ8"
FT                   /protein_id="CBL40483.1"
FT                   /translation="MLGLKKRDIKKALKAGAKAGGVSLADVRADIEVTIDEAMNSNDPE
FT                   VQANFKKYFGNKRPTPEEYIYKITKKTKV"
FT   CDS             721074..721493
FT                   /transl_table=11
FT                   /locus_tag="CK3_07060"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40484"
FT                   /db_xref="GOA:D7GRQ9"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRQ9"
FT                   /protein_id="CBL40484.1"
FT                   /translation="MKPSDFQKTVQCRFESCLKKVVRHVVKDYQKKLKRRQKEETLFCE
FT                   LPEIVVENLAVWDDYDTDYTIFNVCGNDIRVYDDELAEALKQLSERNRETLLMYYFLEM
FT                   NNEEIAKKQNISRSGVFQNRHNSLALMKKLLKEKQ"
FT   CDS             721496..721744
FT                   /transl_table=11
FT                   /locus_tag="CK3_07070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40485"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRR0"
FT                   /protein_id="CBL40485.1"
FT                   /translation="MKQTFKKPSYYLLSQAMDGDEKAIEKILAFYDPYISKCCLRPLYD
FT                   EYGNVYIVVDMELKGLIREALIKMILGFDIALEIEEE"
FT   CDS             722031..722396
FT                   /transl_table=11
FT                   /locus_tag="CK3_07080"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40486"
FT                   /db_xref="GOA:D7GRR1"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRR1"
FT                   /protein_id="CBL40486.1"
FT                   /translation="MGIVEILTELSKAVCLLIIDSFSNKIYLLFLFRCVIMTLLDECVL
FT                   LLSQMKGVLIVISDTQNAQSPTKEKKTYTVEEIAEQLDISKKVAYSLVKSGQFSYVRAG
FT                   KAIRVSKVSFDKWLNGI"
FT   CDS             722415..723860
FT                   /transl_table=11
FT                   /locus_tag="CK3_07090"
FT                   /product="Phage integrase family."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40487"
FT                   /db_xref="GOA:D7GRR2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRR2"
FT                   /protein_id="CBL40487.1"
FT                   /translation="MASIKQRKSSFSVIYWYLDSAGERKQKWDTLETRKEAKQRKAFIE
FT                   YYQEKFGYVIVPLEEQFAHQIENSKKELDVVDKDITLRDFLEIFVNLYGTSKWSPSTFS
FT                   GKVGSIENYINPIIGDWKLNEITTKSLSKYYNDLLSVPEVPRANRKATGRCVQPANIKK
FT                   IHDIIRCALNQAIRWEYIDTNKRNPASLATLPKIPKTRRKVWSVQTFREAVKATEDDLL
FT                   SICMHLAFSCSMRIGEITGLTWEDVIIDEESIATNNAKVIINKELSRVNAEAMQKLKEK
FT                   DILKIFPTQKPHCTTRLVLKTPKTETSNRVVWLPKTVAELLVQYKKDQQELKEFLGSAY
FT                   NDYNLVIALDNGNPVESRIVRDRFQKLCEENDYEVVVFHSLRHLSTGYKLKMTNGDVKS
FT                   VQGDTGHAEAEMVTDVYSEIIDEDRRFNAQKMDKEFYSTLNDDTDNPKQDTDLTDSDMA
FT                   LLELIKSLSPEMKEQFLKQALQR"
FT   tRNA            complement(724068..724144)
FT                   /locus_tag="CK3_T_36000"
FT   CDS             complement(724935..725840)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40488"
FT                   /db_xref="InterPro:IPR024541"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRR3"
FT                   /protein_id="CBL40488.1"
FT                   /translation="MHKFLRAAGFSMYTKKKDIEKLLDLLERQPSMTRCVQVDEESNVC
FT                   EMRTEVAPGLGISIIGELNEEGNFEREFYFPYQESHIIGSTEECSVQRHTEKETYSGMV
FT                   DENKVGITLIFYIQNFMEFRERMLDKEHHSKISSVCFSGMSIGGKVLLPIKKSQKQIQK
FT                   AKVAAKNRNSLIEAAKNGDEDAMESLTIEDIDLYSQISRRAMKEDLYSIIDSCFMPCGV
FT                   ECDQYSVIGEIEEVEKIRNIYTKEEIYRMKIESHDLEFVVCINSKDLLGEPQPGRRFKG
FT                   QIWMQGTLKLEDIIRKQGIK"
FT   CDS             complement(725846..726652)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40489"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRR4"
FT                   /protein_id="CBL40489.1"
FT                   /translation="MENSMLYSIPIDPMVLIVGFSILSLVLLIVVIICIVKLNKLYRRY
FT                   DIFMRGKDAETLEDTIMDIMDEMEELQEKDRSSKDAMKQLSRQIKSSFQKFGYVKYNAF
FT                   KGMGGNLSFVIAMLDNNNSGFILDVVHSREGCYIYLKEVEEGATEVLLGGEEQEALEQA
FT                   LGYVKRPTMDERLAMKEKAANSKKKELKSGSGEQDIEVPSSERKKSERMKELRKRQAER
FT                   RENEEERVKKYADAYDVEEVEIETDTIENFDALSYDPDGEDNKGDY"
FT   CDS             complement(726702..727829)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07120"
FT                   /product="ParB-like partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40490"
FT                   /db_xref="GOA:D7GRR5"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRR5"
FT                   /protein_id="CBL40490.1"
FT                   /translation="MAKRGLGKGLGAFFGEEVTTTKENAAEKVSRSERKGHLMVNQGTT
FT                   KNTEKDGTGKKTDSSQPAKTGTNAETIVVEKIVEKPVEKIVEKIVEKPVEKIVEKIVEK
FT                   PVEKIVEKPIEQTLKLNLIEPNSEQPRKNFDEESLQELADSIKQYGILQPLIVQKKGNH
FT                   YEIIAGERRWRAAKLAGVTDVPVLIREYDKQQTMEIALIENVQRADLNPIEEAQAFQQL
FT                   IQEFHLTQEEIANRVSKNRATITNSMRLLKLDIRVQDMLAEGKISSGHARALLGLEEGE
FT                   RQYQVAAKIIEEKLSVRDVEKLVKMMNRPPKEKKPEKGPDIDLIYRQVEDKLKSIMGTK
FT                   VVINQKDKNKGRIEIEYYSQEELDRLIELMESLRV"
FT   CDS             complement(727829..728599)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07130"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40491"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRR6"
FT                   /protein_id="CBL40491.1"
FT                   /translation="MGRIIAITNQKGGVGKTTTAINLSACLAEAGQRVLTVDFDPQGNT
FT                   TSGLGLEKGNIDNTVYELLMGECTVDECINPSVQERLDVMPSDVDLAGAEIELLDMEEK
FT                   ESILKKNMELLDGKYDFIIIDCPPSLNLLTINALTAANTVLVPIQCEYYALEGLSQVLK
FT                   TVNLVQKKLNPSLEVEGVVFTMYDSRTNLSLEVVENVKEHLNENIYKTIIPRNVRLAEA
FT                   PSYGMPINLYDSRSSGAESYRLLAAEVISRGEEI"
FT   CDS             complement(728884..728961)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40492"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRR7"
FT                   /protein_id="CBL40492.1"
FT                   /translation="MTIFLFDNSLLYYNIIGNEIQQAKM"
FT   CDS             729037..729987
FT                   /transl_table=11
FT                   /locus_tag="CK3_07150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40493"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRR8"
FT                   /protein_id="CBL40493.1"
FT                   /translation="MKAKNKIITAILLSAGAAVGTALINKYIKMSAISRNLLAQPEPRC
FT                   YRWRLGNIYYTKTGTGKPLLLVHDLTHASSSCEWDSLIPLLKEHYTVYTIDLLGCGRSE
FT                   KPNLTYTNFLYVQLLNDFVKSEIGRRTNILATGASAPIVTMACGYNPDLFEQMMFINPD
FT                   SLLSCSHIPGKSARYYKFILDLPIIGTLLYNFASARSIISRTFSESYFYNPYDVNPHYI
FT                   DKYHESAHLGDSPKSVYASVQCNYTKCNITKTLEKIDNSIYILGGEAEQDIDLIIKEYT
FT                   KCNPAIESSTIPNTKHLPQIENPEEVSSTVQMFFN"
FT   gap             730785..732778
FT                   /estimated_length=1994
FT   CDS             732882..733166
FT                   /transl_table=11
FT                   /locus_tag="CK3_07160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40494"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRR9"
FT                   /protein_id="CBL40494.1"
FT                   /translation="MKLVLKILALPVLFVVKLICILGNLLTNIVSYVIGLLLLVIGGSA
FT                   IYCVVKALWQSLAILVVLGIATIAAVFLLVWVVMKVENIRDSLGAFIRS"
FT   CDS             733229..734641
FT                   /transl_table=11
FT                   /locus_tag="CK3_07170"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40495"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRS0"
FT                   /protein_id="CBL40495.1"
FT                   /translation="MAATRLIALHINKGKTVAQCLADRTNYSQNAAKTNDGEFISSYEC
FT                   DPKTADEEFLLSKRQYQHITGRQQKNNIIAYQIRQSFKLGEITPEEANQVGYETAMRWT
FT                   KGKHAFIVATHIDKSHIHNHIIYNSTSLDSTQKFKNFFLSGLAVQKLSDMVCLEHGLSI
FT                   ITPKPYRERQKRTVYPKKRTQRDELCDAIDAVLKQKPKSFDGFVQALADMGFEFKDGKQ
FT                   PAFKGKNQKRFIRLRSLGEGYSKEEIQAVISGKNLDKSKGSSAKAPAPKQFQMLIDIQA
FT                   KMAEGKTAGYEKWAKKFNRKEAARTVILLKEKGLGNYDDLTDHIENLSARFDALSDSIK
FT                   TAEKRMVEVQTLQQHIKNYRSTRQIYIEYRKSGYSKKFFEEHRQEITIHKAAKQAFDEL
FT                   QITKLPSMQSLYEEFHQLAVQKKKDYAEYRQIRKEKEELLIAKRTVETILNIDRQKEQE
FT                   KEQEKEEKKNFR"
FT   CDS             complement(734891..735106)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40496"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRS1"
FT                   /protein_id="CBL40496.1"
FT                   /translation="MKENIKKWLKPILFTAGGALVGLAYYYFVGCSTGACPLTSNPFIT
FT                   MAYMGFIGWLLSGVFGKGCSGSCNMQ"
FT   CDS             complement(735108..736373)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07190"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40497"
FT                   /db_xref="GOA:D7GRS2"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRS2"
FT                   /protein_id="CBL40497.1"
FT                   /translation="MAVININRNQFEEMVHSGKTVLVEFSAPWCVYCRRLAPALESVAE
FT                   EYKDTLVFTAVNIDDEPELAEAEAIEVVPTLLIYHSGQALGSIVAPESRAQLVAFIEET
FT                   LQHQTQEATTVQHIYDMIVVGGGPGGYTAALYAARAGMNTVVLEKLSAGGQMALTEQID
FT                   NYPGFEDGIDGFSLGEKMKRGTERFGVETKLTEVLSLELSGSIKKAVTSEGPMYAKTIV
FT                   LATGAGPRELGVDGEQELIGKGVHYCAACDGMFYRNKTVVIAGGGNTAAADALILSRIC
FT                   KKVIVVHRRDTLKATKIYHEPLMKTENIEFLWDSEIVTLLHNEKLTGIRTRNVKTGEES
FT                   TLACDGVFVSVGRKPSTELVKDQITIDPAGYIIADESTCTNIPGVFAVGDVRTKALRQV
FT                   VTAVADGATAVHYAEEYLAGGI"
FT   CDS             complement(736471..736776)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40498"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRS3"
FT                   /protein_id="CBL40498.1"
FT                   /translation="MIIIIFSLILLLLASFLYVQKKKVISLQQQISDLQSKISILEKQD
FT                   LAAEQYNDSLRQEANTVHLYASLSLEETRKTSIKDKQSQIIRSSEHILELLNNEKV"
FT   CDS             complement(736779..737729)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40499"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRS4"
FT                   /protein_id="CBL40499.1"
FT                   /translation="MSQDNASFTFLHRIEEVELNIEDGRWQSALALALTLPDICGGIAF
FT                   PEIVKRYRDGRAVLDRNQRPTRDVGNQYIRWFDTYAAPFFKVSAQDISPYICGERCWQL
FT                   RCEYLHQNKGFANTEDNTSIRFHLGVNCGTSVCQLDRISSANSLTDIRIDIEQFCRRMC
FT                   RAVRAYYEAVHTEKDFNLYNTPVLDFIKASQDEKSNATIAIMCSDSAYGNGLRLVLQNL
FT                   SKHILVFETPEAARKELSKKKPMLWIVTEPLTKQPDQPWRADKRTPVILLSNQPESEIA
FT                   IEKNAGKLTVLPLPVLLETLRNAVKAYLLTKEDKN"
FT   CDS             complement(737888..738190)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07220"
FT                   /product="Predicted DNA-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40500"
FT                   /db_xref="GOA:D7GRS5"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRS5"
FT                   /protein_id="CBL40500.1"
FT                   /translation="MPRPRKCRKVCCLPDNDGFVPVRGGEELTPIFLNVDEYEAIRLID
FT                   REGFSQEQCGEYMRIARTTVQQIYAATRKKSIRCFRNTSSSGSMSRPKTVDSARL"
FT   CDS             738326..738985
FT                   /transl_table=11
FT                   /locus_tag="CK3_07230"
FT                   /product="cAMP-binding proteins-catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40501"
FT                   /db_xref="GOA:D7GRS6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001808"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRS6"
FT                   /protein_id="CBL40501.1"
FT                   /translation="MDFSSYFPIWNKLTPTQQQILERNAVLRKVDKGTVIHNGTMECTG
FT                   LLLVRNGQLRAYILSDEGREISLYRLFDRDICLFSASCMMNSIQFEITIEAQKDTTMWV
FT                   ISADIYGRLMKESAVVANFTNEIMATRFSEVMWLMEQIMWKSFDKRLAGFLLEECSLEG
FT                   TNILKITHETIAGHMGTAREVVTRMLRYFQNEGMVKLTRGTVEVTDEAALEELQNA"
FT   CDS             738978..739043
FT                   /transl_table=11
FT                   /locus_tag="CK3_07240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40502"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRS7"
FT                   /protein_id="CBL40502.1"
FT                   /translation="MPKQQLTLLIIALAVLGIIIY"
FT   CDS             complement(739091..740782)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07250"
FT                   /product="Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40503"
FT                   /db_xref="GOA:D7GRS8"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRS8"
FT                   /protein_id="CBL40503.1"
FT                   /translation="MKVVIVGGVAGGATAAARIRRLNEQAEIVVFERSGYISYANCGLP
FT                   YYIGDVITDRSDLTLQTPESFFSRFRVNMKVRHEVTAIHPDKKTVSVKNLQTGEELEES
FT                   YDKLILSPGAKPTQPRLPGLGLDKLFTLRTVEDTFRIKDYININHPKSAVLAGGGFIGL
FT                   ELAENLRELGMEVTIVQRPKQLMNPFDSDIAAFIHNEMRKHGVKLALGHTVEGVAEVSG
FT                   GVDVLLKDEQPLHADMVILAIGVSPETTLAKDAGLELGIKGSIVVNDRMETSISDIYAV
FT                   GDAVQVKHFVTGQDALISLAGPANKQGRIAADNICGGDSHYTGSQGSSVIKVFGMTAAT
FT                   TGVNETNARKAGLDVDTVILSPMSHAGYYPDGKVMTMKVVFEKETYRLLGAQLVGYEGV
FT                   DKRIDVLATAIRAGMKAPELKDLDLAYAPPYSSAKDPVNMAGFMIENIAKGILKQWYLE
FT                   DTDKLPRDGSVTLLDTRTVEEFTHGHIDGFLNIPVDELRERLDELDKRTPVYVICQSGL
FT                   RSYIACRILTGNGFDCYNFSGGFRFYDAVFNDRCLIESATACGMDK"
FT   CDS             complement(740784..741104)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07260"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40504"
FT                   /db_xref="GOA:D7GRS9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRS9"
FT                   /protein_id="CBL40504.1"
FT                   /translation="MGFFDFLKGPDINQGVKEYSTTDGAVLLDVRTPDEYRQGHIPGSK
FT                   NVPLQSINKVTGVIDNKATPIFVHCLSGARSRQASAILQQMGYTNVKNIGGISTYAGKV
FT                   ER"
FT   CDS             complement(741117..741422)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07270"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40505"
FT                   /db_xref="GOA:D7GRT0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRT0"
FT                   /protein_id="CBL40505.1"
FT                   /translation="MSAINVNKNNFNQEVLNSDKPVLMDFWAPWCGPCRMVVPLVEEIA
FT                   EERSDIKVVKINVDEEQELAMQFGVMSIPTLVVMKNGKVVNQATGARPKAQILAML"
FT   CDS             complement(741494..741772)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07280"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40506"
FT                   /db_xref="GOA:D7GRT1"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRT1"
FT                   /protein_id="CBL40506.1"
FT                   /translation="MEEETEYIILDVRTAEEYSEKHIPGAINIANESIGTEDIPELPDK
FT                   DQLILVYCRSGNRSKQASEKLVKLGYTNIVEIGGINSWPGETVAGDK"
FT   CDS             complement(741944..742690)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07290"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.100"
FT                   /EC_number="1.1.1.159"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40507"
FT                   /db_xref="GOA:D7GRT2"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRT2"
FT                   /protein_id="CBL40507.1"
FT                   /translation="MRLKDKVAIITGGSRGIGYATVEKFLKEGATVILTASSQGSADKA
FT                   VAQLKEKYPDATVAGISPNLSNLESVRNAFREAASKYGCIDILVNNAGISESTPFTEYT
FT                   EETFDKVMDLNVKGVFNATKAASECMIAKGHGVILSTSSMVSIYGQPSGFAYPTSKFAV
FT                   NGLTVSLARELGPKGIRVNAVAPGITLTDMMKAVPKEVIDPLVNQIPLRRLGQPEDIAN
FT                   AFVFLASDEASYITGVVLSVDGMART"
FT   CDS             743214..743420
FT                   /transl_table=11
FT                   /locus_tag="CK3_07300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40508"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRT3"
FT                   /protein_id="CBL40508.1"
FT                   /translation="MIQAFSSSVISAFLPRPGEFQEKKKEQEAAKPDPDADYVDDDEDY
FT                   GHSEEYEDDDVGFIADDEDNEPV"
FT   CDS             745006..745302
FT                   /transl_table=11
FT                   /locus_tag="CK3_07320"
FT                   /product="N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40509"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRT4"
FT                   /protein_id="CBL40509.1"
FT                   /translation="MRDPLFLAQKSTDATEADQQVIIDLLDTLRANLDHCVGMAANMIG
FT                   VKKNIIVVAAGPFQFAMVNPVITKKTGAFIIKVSTTGMLVPLKADLRFPISGQ"
FT   CDS             745508..746281
FT                   /transl_table=11
FT                   /locus_tag="CK3_07330"
FT                   /product="Predicted DNA-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40510"
FT                   /db_xref="GOA:D7GRT5"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRT5"
FT                   /protein_id="CBL40510.1"
FT                   /translation="MPRPVKCRKVCHFPNVLEFFPADDTEKKVPIVLTVDEYETIRLLD
FT                   KKGYSQEQCAESMQIARTTVQRIYEIARKKIADALIDGHPLRIEGGDFRICDGQSSNCN
FT                   LGGCYKQEIYQKYAVEKGEGIMRIAVTYEDGQIFQHFGHTETFKIYDVEEGKVVHSEVV
FT                   DTNGSGHGALAGVLNALNADVLICGGIGGGAQTALAAAGIKLFGGVSGDADKAVEAFIN
FT                   DTLDYNPDVKCSHHEHSHGEGHTCGEHGCGSHSCH"
FT   CDS             746547..746756
FT                   /transl_table=11
FT                   /locus_tag="CK3_07340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40511"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRT6"
FT                   /protein_id="CBL40511.1"
FT                   /translation="MKAHKYWSFGALITMIGTFYTGYKGSKSSHRYFACSTLICMIMSI
FT                   YTGHKMISGNKRTRKQVENTEAEE"
FT   CDS             746760..747215
FT                   /transl_table=11
FT                   /locus_tag="CK3_07350"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40512"
FT                   /db_xref="GOA:D7GRT7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRT7"
FT                   /protein_id="CBL40512.1"
FT                   /translation="MLEIGTKAPDFELPDQNGEMHKLSDYAGKKVILYFYPKDNTAGCT
FT                   KQACGFSERYPQFTEKGAVVLGVSKDSVASHKKFEEKYGLAFTLLADPERKVIEVYDVW
FT                   KEKKNYGKVSMGVVRTTYLIDEQGIIIKANDKVKAADDPENMLKELN"
FT   CDS             747215..747964
FT                   /transl_table=11
FT                   /locus_tag="CK3_07360"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40513"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRT8"
FT                   /protein_id="CBL40513.1"
FT                   /translation="MKIILSPAKKMIADTDNIAPVELPAFIDKTAEILGWMKSKSKEEL
FT                   KAIWKCNDKIAEQNFNRLETMDLYNRLTPAVLAYEGIAFQYMAPAVFEIQQFEYLQNHL
FT                   RILSAFYGILKPMDGVTPYRLEMQAKVGIGDAKNLYEYWGELLYRSVIDDSRIIINLAS
FT                   KEYSKCIEKYLTSQDRYITIVFCELSGDKLVTKGTYAKMARGETVRFIAENNIENPVEI
FT                   QKFDRLGYSFRSDLSSDSEYVFERKMK"
FT   CDS             748305..748433
FT                   /transl_table=11
FT                   /locus_tag="CK3_07370"
FT                   /product="lactate/malate dehydrogenase, alpha/beta
FT                   C-terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40514"
FT                   /db_xref="GOA:D7GRT9"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRT9"
FT                   /protein_id="CBL40514.1"
FT                   /translation="MPVIVGVDGIESNIPINLSGEEALKLKKSADSLKKIIETIEL"
FT   CDS             748461..748835
FT                   /transl_table=11
FT                   /locus_tag="CK3_07380"
FT                   /product="desulfoferrodoxin ferrous iron-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40515"
FT                   /db_xref="GOA:D7GRU0"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR004462"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRU0"
FT                   /protein_id="CBL40515.1"
FT                   /translation="MEVKYYICKHCGNIVEKVKDKGVPVICCGEPMQELKAGVTDAAVE
FT                   KHVPVYTVEGNYVHVVVGETKHPMLEEHFIEWITLNTNQGIYRKQLSPGQEPIADFCLC
FT                   DGEQVEEVYAYCNLHGLWKC"
FT   CDS             748926..749084
FT                   /transl_table=11
FT                   /locus_tag="CK3_07390"
FT                   /product="Rubredoxin"
FT                   /EC_number="1.18.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40516"
FT                   /db_xref="GOA:D7GRU1"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRU1"
FT                   /protein_id="CBL40516.1"
FT                   /translation="MKYVCDVCGWEYDEEKGYPEGGIAPGTKWEDVPEDFECPLCSVGK
FT                   DQFSKAE"
FT   CDS             749219..749377
FT                   /transl_table=11
FT                   /locus_tag="CK3_07400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40517"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRU2"
FT                   /protein_id="CBL40517.1"
FT                   /translation="MESINYKKLFTQKVQHLKFIHKLDEFIEHHNDEIEDQDEQIMVIC
FT                   VESAERL"
FT   gap             749551..749913
FT                   /estimated_length=363
FT   CDS             750752..751342
FT                   /transl_table=11
FT                   /locus_tag="CK3_07420"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40518"
FT                   /db_xref="GOA:D7GRU3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRU3"
FT                   /protein_id="CBL40518.1"
FT                   /translation="MIREIENRRSIRKYRSDEIDRKLIEEIIYSATLAPSAKNRQPWKF
FT                   IVYQGEAKDKLVEVMRHGINSEKITHELMPEWAFAIPDAENTVRIMQEAPCLIAVLNTN
FT                   QYTPFASIEREKRIVEICDSLSIGAAVENMILTATGYGLGTLWIANTCFAYNELIEFIG
FT                   TDNQLTGIVAVGAANEAPPKRPRKALRDVVEYR"
FT   CDS             complement(751964..752887)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07440"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40519"
FT                   /db_xref="GOA:D7GRU4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRU4"
FT                   /protein_id="CBL40519.1"
FT                   /translation="MELKEARYILAIARHQSIGKAAESLYISQPSLSKYLKNLEERLGA
FT                   PLFSRHENRYYPTYMGERYLHYAEQIVACGDEWMQEYDDIAHRQRGRLNIAVPIMMGST
FT                   LIEPMLAPFHKRYPYVTLNIMEAVNFIAENSLETSSIDLTLYNIHEFPETMDYQILRSE
FT                   EIVLVLHENHPLAAKAITRPGFRYPWLDLSLLKEENFILLYPDQNTGGIALDLFKEYNI
FT                   NPPVSLHTRNSSMSIHLAMDGVGAAFAPESYFHHENQYTGNRALCFSVGHRPALTTTIA
FT                   AYRKNRYLPQHARDFLEMIREYCREK"
FT   CDS             753062..753895
FT                   /transl_table=11
FT                   /locus_tag="CK3_07450"
FT                   /product="ABC-type spermidine/putrescine transport system,
FT                   permease component I"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40520"
FT                   /db_xref="GOA:D7GRU5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRU5"
FT                   /protein_id="CBL40520.1"
FT                   /translation="MKKSSAWCMLVPGLVILFLFLMIPLLRVLVPSVFTGDYPFSAYVD
FT                   FFKDEYYRKIFLRTVKIAVITTFVCMVGGIPTAYFISRCDKKWRGLLLSASIFPMMTNS
FT                   VIRSFAWINILGSNGIINKAMIAMGLIEKPMKLLYTDFSIIIGSVYLFLPLMIVTVAGV
FT                   MENIDDDMMEAAQSLGASRTEAFMKVIFPMSLPGIIVGGILVFTGTLTAYTTPQLLGGN
FT                   SNMVMATLIYQRAMSVSDWTGASVIALIMIVVTLVVIKGFNALAARLDRRGEDYA"
FT   CDS             753888..754670
FT                   /transl_table=11
FT                   /locus_tag="CK3_07460"
FT                   /product="ABC-type spermidine/putrescine transport system,
FT                   permease component II"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40521"
FT                   /db_xref="GOA:D7GRU6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRU6"
FT                   /protein_id="CBL40521.1"
FT                   /translation="MRKNKVLTIWAAIVFAFLMIPLLIITVTAFGGGSAITFPIESFST
FT                   KWFANVFALKSFRRSFLTSLEVALLATCISLLVGIPAAYALARSGLKGKQLLKSIFLSP
FT                   TIVPGIVIGFIMYQCLILTLRIPVFAGLLAGHFMVTLPYVIRVVGSAMEQFDFSIEEAA
FT                   WSLGCPKGAAFFKVVLPNVTSGISSAFMLAFINSFNNIPVSMFLSGPGVSTFPSTLMNY
FT                   IEYNYDPTVSAVSVLLMAATVIIMVIVDRTLGIAALAK"
FT   CDS             754684..755724
FT                   /transl_table=11
FT                   /locus_tag="CK3_07470"
FT                   /product="ABC-type spermidine/putrescine transport systems,
FT                   ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40522"
FT                   /db_xref="GOA:D7GRU7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRU7"
FT                   /protein_id="CBL40522.1"
FT                   /translation="MAFMSLNGIDVSYDKKKQILKGLNLEVEEGELVSLLGPSGCGKST
FT                   TLRVVAGFIDPQGGTFTLDGEDMTKVPVHKRQFGLVFQSYALFPHLSVYDNVAFGLRTR
FT                   KMDKDVIDKKVKEILEVCGLTELADRFPKQMSGGQRQRVALARALVIEPKLLLLDEPLS
FT                   NLDAKLRLSMRVEIKRLQKRLGITTLFVTHDQEECFSISDKVAVMNGGVIEQFDTPENI
FT                   YKRPATEFVARFIGFENFLELAKKQDGVYTAPDGSEFLTSMDLDCENFAGTIRPDDICL
FT                   ADEIQTENVLSGTIGVRTFLGKSYQYEVETSAGVLKVNMGTDHVYKEGEKIRLYLPKDK
FT                   LILVRK"
FT   CDS             755816..756928
FT                   /transl_table=11
FT                   /locus_tag="CK3_07480"
FT                   /product="Spermidine/putrescine-binding periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40523"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRU8"
FT                   /protein_id="CBL40523.1"
FT                   /translation="MKKTAAVVLCAAMMLTACGGASTTETTAAGSQAAGSETTASAEET
FT                   KAASGDAQKLVLSTYGLSEDISEEEVYTPFENEFNCEIVTETGGTNDRYTKLAADPNST
FT                   IDVIELSQAMTAKGADEGLFDTIDLSKIPNAEKLIPAAKELAEAGQGVPYTINSIGIIY
FT                   NPELTGFELTSFDDLWDERLAGMVSIPEITTTFGPAMVYVASDHAGVDVTTDNGEAAFK
FT                   ALADLKPNLVKTYTKSSDLINMFTSGEVAAAVVGDFGVPTIVAANPTLVYVTPDGAYAN
FT                   FNTINVTKNCANKELAYEYINYRISEELQTKTGKALNEAPTNMDVTFTEEESQNMTYGD
FT                   AAEKVKVVDYAFVNPILNNWIDQWNRTINN"
FT   CDS             756945..758786
FT                   /transl_table=11
FT                   /locus_tag="CK3_07490"
FT                   /product="Adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40524"
FT                   /db_xref="GOA:D7GRU9"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRU9"
FT                   /protein_id="CBL40524.1"
FT                   /translation="MRPDFILKNVMVYQTFRQCFEKRDVAVAGETFYCISPAISYPGVE
FT                   ERDGKGRYMLPGLVDIHMHIESSMTYPGEFSRITLPYGVTTVVADAHEMANVFGMDGIR
FT                   AFMAQKTKQDIFWAIPSSVPATNEKLETAGAALGVKEISEMASLDGVLCLGEIMNYKDL
FT                   SAEGESRTRALIDVCRKAGKNLRIEGHCPGLTGTDLNRFIYEGVDADHTQQTPQSVMEK
FT                   TELGMFLELQFKSLTPEVVKTVCDHELYENVALVTDDTMADKLLTGHLNKIIETAVKAG
FT                   MPMEKAIYCATWTPSRRMHLDDRGMIAPGKIADFMLLDSLDGIEPVVVYKKGECVYCRA
FT                   DEACGAAKGRKAQEACAVAAGCGAEAAKMQAAGISEVRADKSGQAAAPVAAACSFPDSF
FT                   YRTINCRPAEISDFVLKAEDPDAKWAEVNVMKIGTFGTATTPVKRRVEVKDGVLDWKSA
FT                   GLSLAVVFERYGKNGNVGYGLVEGALTKPGAVATTWSHDSHNLFVLGTDENDMKLAQRR
FT                   VLELQGAYVVFAGGKSLAEARLTIGGIVSDQPIEVLGQELKEVRAAMEGLGYVNNNVIM
FT                   SMSTLCLPVSPKLKLTDHGLLTVPGQEHVPLVEKYGK"
FT   CDS             758869..760224
FT                   /transl_table=11
FT                   /locus_tag="CK3_07500"
FT                   /product="Cytosine deaminase and related metal-dependent
FT                   hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40525"
FT                   /db_xref="GOA:D7GRV0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRV0"
FT                   /protein_id="CBL40525.1"
FT                   /translation="MKKIIKNGIVVTMNAAGDVWDHGYVMFEDTKILAAGPEDELEKTL
FT                   QELTAQGILKAGETFEEIDAKRAIVIPGLVNTHCHLGMIPFRGLGDDCKDRLRVFLLPM
FT                   ENQAMDAEMAKLSTRYAIGELLLSGVTTVLDMYYFEEVVAKVMDEMGIRGIAGETVMEK
FT                   DSCDSKNADEAIERGIALIEAYKDHPRVSGAITPHGTTTCSPETLKRAYEEDVKAGTVF
FT                   TLHVAEMDYEMTQLREQHGMTPIEFMEHIGVLGPNTLAAHSIRTTEHDVEILAKHGASV
FT                   AHCIASNTKAAKGVAPVSLMHKHGMSVGFGTDGPASGNTLDLFIQMRMCENFHKNELRD
FT                   RSAFPAKEVVSMATIEGARALGLGDITGSIEPGKQADLVLVETDSPNMFPVYDPYSALV
FT                   YSAIASNVRDVYVAGECLVKEKKLVREDFAKIRNDLREKMERTAFKDMKNLV"
FT   CDS             760377..761921
FT                   /transl_table=11
FT                   /locus_tag="CK3_07520"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40526"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRV1"
FT                   /protein_id="CBL40526.1"
FT                   /translation="MRMFRIKMTAARTNPQQIREVRIDSEKTVGELLELVRIVYEYGDV
FT                   RGSLLNEAGASQSPETKLKDRIHVRDLLTVNYANKSITPIYLEVLEEFDGSGETAPILE
FT                   RYRTIPRRTRKTAFGYPAFAPEEAEHFQKYLNKEISKVFAPELVVPDFAWEIATPWQSL
FT                   LDSGTAADLKILIKENKLPVNVYLRKAELEKGIIKEAGKSDFWENIMQTMGITEYFQVK
FT                   ELCIQGSKFVNGDAVDTTFPVLSRNRLVDENYWYRTILAKEFMEFFENWLGSGKEREYI
FT                   KDHAEQTCFLAACRLYGFADRELVTEFYKIMCPEQNAAERVGNFWKQAMQCALQYNIKK
FT                   IVGMEVYYDSQSVSSNSVKLLYRSFLTSDRFHYVPTKAEIEDIAISGIGFSEKDREALI
FT                   DMMERKYRCERTNGRFIVGELEKAIHTGIPVGELTGYLQKVLLSGRRSSYLGDIMEILE
FT                   RAQRTVRKISLGGYTETEINRAVTKKKAVRVEKKIYPNDPCPCGSGKKYKNCCGRR"
FT   CDS             complement(765601..766590)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07540"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40527"
FT                   /db_xref="GOA:D7GRV2"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRV2"
FT                   /protein_id="CBL40527.1"
FT                   /translation="MVTLNDYLYSGDTMFKILKNYSQDLKKEAKCTGNEIDLMHANFLL
FT                   QIRELLEHNDFLTAQSQKIREFYIHMAKEYPLLAFNFKGRIKSLIRAEAKFNGYIVEYI
FT                   YDYYMENKAYPSISELKQRLSCFRDLIAYRIVTSLPKCYLKPDESQEEADLRYLYQIAN
FT                   ELPGFLEERGFTAEPAYGVKKSTSPLLNDDVKPYYRDYICGNTSEDYQSLHITFYDNSS
FT                   RSYMEVQLRTKHMDDIAEIGVANHLSYEKRQEGERARRDEIPVGECVYFDEAYERCRRL
FT                   VTLILADLDVNMFSAINNDLVNDGCGLYRGRLILPYEHLSRHQNELVD"
FT   gap             767127..767366
FT                   /estimated_length=240
FT   CDS             768319..769953
FT                   /transl_table=11
FT                   /locus_tag="CK3_07570"
FT                   /product="nickel ABC transporter, periplasmic
FT                   nickel-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40528"
FT                   /db_xref="GOA:D7GRV3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR011980"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRV3"
FT                   /protein_id="CBL40528.1"
FT                   /translation="MKKRVLSLCLAGLMAASLTGCGGAGNAAETTAAAGAENSAAASEA
FT                   GASEGKEELVFVNYRDIRDLNPHLYAGEMYAQEMLYETLVNITADGYEGCLAESWDISD
FT                   DGKTYTFHIRDGVKFSDGEVCDANAIKANFDAIIENKDRHTWLEMMNLLVGVSAPDDKT
FT                   FVIELSEPYYPLLTELGVTRPFAMISPKAMKDGSTKDGVNAYIGTGPYVLTDFVTDEYA
FT                   IFEANENYWGEQPKIKKITVKVIPDNQTRILALEKGEIDMIFGKNMIDADAINQYTGND
FT                   KFTVSLSDPTSTRQIVLNTTRDVLADKEVRQALQHATNKQAISDGIFYGLEQPADTLFA
FT                   KTVPYCDIDLEPYAYDVELAQSMLDEAGWVVGADKIRERDGQKLNIDLLYNSDSVTEKA
FT                   IAEYLQSEYQKIGISLNIHGEEEQSYRDNMKAGNFDMVFNICWGTPYDPQSSLAAMRAP
FT                   VYGDYAAQLGLEDKADIDQAITDILVSTDETKRQELYTFVLTRLHEDAVYIPLTYECNK
FT                   AIYRSDLQGFHFTQTQYEVPFADFYFE"
FT   CDS             770144..771085
FT                   /transl_table=11
FT                   /locus_tag="CK3_07580"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40529"
FT                   /db_xref="GOA:D7GRV4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRV4"
FT                   /protein_id="CBL40529.1"
FT                   /translation="MKQYVIKRILSAIPLLIVISFVCFVFINLIPSDPAEVALRVRQVP
FT                   IITEEAIAEVRAELGLDKPYLVRYFSWLADCLRGDFGISYVNPKRTVAGELARCMPATL
FT                   QLAGVSFVMVILLSLPIGFLCAVYKDGWFDKIMRAIVFMTTAMPAYWVGLLLMWLVSIR
FT                   LDLLPTSGNGTWKHLILPAFTVSLSYISTYIRLIRNNMLENMKQDYVLYANVRGLPQKL
FT                   ILVKHILKNSMHTCIVAVGMSIPQLISGTIVVENVFAWPGLGTLCISSIFNRDYPVIQT
FT                   YVLLIGVLFVVFNLLFDILQTVSDPRMRREEH"
FT   CDS             771085..771909
FT                   /transl_table=11
FT                   /locus_tag="CK3_07590"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40530"
FT                   /db_xref="GOA:D7GRV5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRV5"
FT                   /protein_id="CBL40530.1"
FT                   /translation="MLQRFLHNRTAMFTVAIVLLTALVGIFAPFIAPNDPYKTDILNKF
FT                   AGFSAEYPLGTDNLGRCILSRMIYGIRPTLGLAVLTMLGTIGLGALMGLLAGYFRGIPE
FT                   EIIMRTVDVMLSFPSQIMVFAVVALLGINVQNVILANVFIKWAWYARMIRTGVMQHRDR
FT                   NFVQFSRCVGTPERFILFRHLVPSIAADLAVLASLDVGWAIINISTLSFLGLGVQAPTP
FT                   EWGAMLNEAKNVLTSNPTQMIVPGVAIVILVSAFNLMGDALRDVLDPKEVNV"
FT   CDS             771906..772739
FT                   /transl_table=11
FT                   /locus_tag="CK3_07600"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40531"
FT                   /db_xref="GOA:D7GRV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRV6"
FT                   /protein_id="CBL40531.1"
FT                   /translation="MSTVMRAEDLCVTLKIPRRPEKELVRHVNFEVQRGECLGILGESG
FT                   SGKSMSIKAMLGLLDKNFSVSGHAWFGEKDLLKESGESMRKIRGSEIAVVLQNPMTCFD
FT                   PLYRIGSQIGETFATHTDWNANEIREKSLETLERMRIRNPEEALQKYPHQLSGGMLQRI
FT                   MIGIAMALKPALLIADEPTTAIDSITQYEILEEFVRIKKEYDTAMIFITHDLGAISKVA
FT                   DDLVVMNSGTIADRGSFSHILHHASDPYTRLLVEKRSAVMKKYRESIGHENGGAA"
FT   CDS             772736..773563
FT                   /transl_table=11
FT                   /locus_tag="CK3_07610"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40532"
FT                   /db_xref="GOA:D7GRV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRV7"
FT                   /protein_id="CBL40532.1"
FT                   /translation="MIRMRDICVSFRRERQEKIFGVSRTQVLFDVSLSIPKGSCLGILG
FT                   ESGSGKSTLGRVICGLLKPDSGEYLLEGKNVYASRDGKKNLQNMLSVVFQDYTTSANPR
FT                   FRIRDILAEGIRVKERKNGKKTDRSAEYCRLLELVGLDETFLDRFPHELSGGQLQRVCI
FT                   ARAVACEPEFILFDEAISSLDAHTQVQVMDLLKELKEKLGLTYVFITHDLTSVTYLCDE
FT                   VMFLYKGRITEHIPVSRIAQTTDVYARKLLDSIIEFDEEYDDEMDVKESEESA"
FT   CDS             773629..774579
FT                   /transl_table=11
FT                   /locus_tag="CK3_07620"
FT                   /product="Predicted deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40533"
FT                   /db_xref="GOA:D7GRV8"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRV8"
FT                   /protein_id="CBL40533.1"
FT                   /translation="MLEIGMICAEAGEKKTGWLEIKGGGQKLPLTLICGAKEGPTMMIS
FT                   AGVHGAEYIGVQALSELSRELDPKDTAGNVICLHVANPSAFRDYVRFFVPEDGKNLNRV
FT                   FPGKKDGTLSERIAWTITEKLQSKADYYIDLHAGDTSEEVMPFVYYNVAAGEKIARVSA
FT                   NMAMAADMEVRASSTATTGAYSSACQRGLPAILMERGGGGRFTDSEVQAYKRDVKNIMI
FT                   RMGLLSGEEVHTVQQKNVTRAEYLEAETDGLWYPVFSAGDTFAGGAVLGTVRDIWGNLL
FT                   REYRADYPGIVLYQTVGLGVKAGDPLIAYGEYVDR"
FT   CDS             774657..774740
FT                   /transl_table=11
FT                   /locus_tag="CK3_07630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40534"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRV9"
FT                   /protein_id="CBL40534.1"
FT                   /translation="MAFYAAMHTKEAAGGRFRMRALEQTGY"
FT   CDS             complement(774737..775384)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07640"
FT                   /product="K+ transport systems, NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40535"
FT                   /db_xref="GOA:D7GRW0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRW0"
FT                   /protein_id="CBL40535.1"
FT                   /translation="MKSILLIGLGRFGKHVAMHLHNLGHQVMAVDSTEERVNAVLPYVT
FT                   EAQIGDSTNESFLSSLGIRNFDACIVAIGDNFQSSLETTSLLKELGAKLVVSRASSDVH
FT                   QKFLLRNGADQVVYPEQQLAKWTAIRFSSNHILDFVNLEGDYDIYEVDLPERWVGMSVG
FT                   EIDIRKKYGINIIAVRRNGTLDFSVKPETVFEDGDTILVLGQYRDLQKCFKI"
FT   CDS             complement(775404..776741)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07650"
FT                   /product="Trk-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40536"
FT                   /db_xref="GOA:D7GRW1"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRW1"
FT                   /protein_id="CBL40536.1"
FT                   /translation="MFRILSAFRRLNSFQIIVLGFAFVILLGAGILMLPVSSADGSWTP
FT                   FVNALFTSVTSVCVTGLVVCDTGTYWSSFGHAVILLLIQTGGLGVVTISASFTILSGKK
FT                   IGLSQRSIMAESVAAPQLSGVVRLTGFIVRVTLGIELIGALLMAPVFCRDFGLFRGLWM
FT                   SLFHSVSAFCNAGIDLLGVRGAYSSLTSYAYDPLINLVIILLIVIGGIGFLTWDDIYRN
FT                   RHHISRYRMQSKVILSYSLALIFIPAILFFFLEFQDIPAGKRILVSLFQSVTTRTAGFN
FT                   TADLSSMRESGQFLMILLMLVGGSPGSTAGGIKTTTLAVLISCATAVFARKDSPEMFKR
FT                   RIIPDIVATAIAILFMYTSLGILCAMTLSILESLPLMPCLFEAFSALATVGLSFGITPT
FT                   LSVPSKLILIAFMFIGRVGGLTIIYATMSGYKIQCGKFPQEKISVG"
FT   CDS             777169..778806
FT                   /transl_table=11
FT                   /locus_tag="CK3_07660"
FT                   /product="hydroxylamine reductase"
FT                   /EC_number="1.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40537"
FT                   /db_xref="GOA:D7GRW2"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRW2"
FT                   /protein_id="CBL40537.1"
FT                   /translation="MDQKMFCYQCEQTAGCAGCTGSTGVCGKTAETARLQDQLVGAMIG
FT                   LARAAEGVECPGDRVYRTVIEGLFTTLTNVSFDDDAIRAQIEKTHREKERLLAAPVKKS
FT                   AGPREKAAGESGAAASVQDTDDYNLGLLWDMDPDIRSLKSLILFGLKGMAAYAYHALML
FT                   GASDETVNQFFLTGLREIAKDGTVESLLPTVLKVGEVNLTCMAMLDAANTGTYGTPIPV
FT                   SVPLVVERGPFIVVTGHDLKDLELLLKQTEGKGVNIYTHGEMLPVHAYPELRKYPQLKG
FT                   NFGTAWQNQQKEFADIPAPILFTTNCLMPPKKSYADRVFTTEVVAYPGMVHIDDEKDFT
FT                   PVIEKALELGGYQEDRQFTGINGGTQVMTGFGHGTILSMADQVIDAVKSGAIRHFFLVA
FT                   GCDGAKPGRNYYTDFVKQTPADSLVLTLACGKFRFNDLDLGNIGGLPRIMDMGQCNDAY
FT                   GAIKVAMALAEAFGCGVNELPLSFVLSWYEQKAVCILLTLLHLGIRNIRLGPSLPAFLS
FT                   PNILNFLVENYGIGPVTTPEEDLKALLG"
FT   CDS             779591..780565
FT                   /transl_table=11
FT                   /locus_tag="CK3_07680"
FT                   /product="Inhibitor of the KinA pathway to sporulation,
FT                   predicted exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40538"
FT                   /db_xref="GOA:D7GRW3"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRW3"
FT                   /protein_id="CBL40538.1"
FT                   /translation="MKNFIVFDLEWNQNPGGKEASVERLPFEIFEIGAVKLNEEREKVA
FT                   EFHRIIRPCVYRQMHRIISEVTHVSIEELERDGEPFAAVMEDFLKWCGEDCIFCTWGSM
FT                   DLTELQRNMVYHGMTIPFPKPFLFYDVQKLYSLCYQDGKARISLDEAVESFALDVDAPF
FT                   HRALGDAEYTGRVLQAMDFDSVKDYVSVDYYLPPESEDEEFTLRFPEYTKFVSQMFETK
FT                   EEAMEEKRVTDIICTKCRRMLRKKIRWFSSGQRYYLCLATCPEHGMMKGKIRMKKSEDG
FT                   RVFAVKTVKPVDEEGAEAVFLKKEEARIRRAEKSRQKKLHGVE"
FT   CDS             780552..780698
FT                   /transl_table=11
FT                   /locus_tag="CK3_07690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40539"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRW4"
FT                   /protein_id="CBL40539.1"
FT                   /translation="MEWNRGGSPEDTAAIEHFAPEQNGCETIEKEQRYCFKKHTSALLV
FT                   YIK"
FT   CDS             complement(780702..782246)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07700"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40540"
FT                   /db_xref="GOA:D7GRW5"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRW5"
FT                   /protein_id="CBL40540.1"
FT                   /translation="MKRILSIFLCLTLILGFCPGQTAYAAAEWPSEISISSDGGILMDI
FT                   NSGAVLFEKNSHEPYYPASITKILTALIVIENCGLDETVTFSNTAVNSLEPNSSILGAR
FT                   AGDTLSVRDCLYALLLQSANEVANALAEHCAGSIDAFAEKMNEKTAELGCTDSHFANPS
FT                   GLNDPNHYVSAYDMALIAKAAFNNPTFVEVDSTTYYDVPAGKLKQYPDGWRYYAHHRML
FT                   RRNDSLYYDGAIGGKTGYTLLAGNTLVTCAERDGMKLIAVVLNGHQTHYSDTKALFDYG
FT                   FKNFKSVPVADQDSTYSKVADDLTISGIFSGSATRLTVNKNSAVTLPADGNFSDVTSTL
FT                   DYNLADDAPDGAIARIDYRYGDKLVGQAYLEATVTQGYVPGAVKQSTDTAETETVAETV
FT                   PSKAPDKKTEPSSKKTGSNKTSWTSSPAFGIVKKVLIAAAVIGTIGGAVFGIMIYQENK
FT                   TQNERFLRHQRREKRLKEWGYSSTEFDMLMEEHLRSKSGIKQPGFRERLRDRFRRR"
FT   CDS             complement(782450..783169)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07710"
FT                   /product="integral membrane protein TIGR01906"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40541"
FT                   /db_xref="InterPro:IPR010178"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRW6"
FT                   /protein_id="CBL40541.1"
FT                   /translation="MTKTAKTITYAAGIFTAFWLIIAFLITSVEAVTYWTPGYYEKEYT
FT                   KYQVLNDLPEMTMDDLLDVTDEMMAFLRGKRENLHVYTTMGGEYREFFNDREIAHMEDV
FT                   RGLFIGGLWLRRIGILITLCFAALAYFWGRKSAERTEALKRLIPKSLCIGTGAVFAVAL
FT                   ALIGIISTDFSKYFIVFHKIFFNNDLWVLDPRTDMLINIVPEGFFFDTAARIALVFAGI
FT                   VMVFFVGNLVLYKRAGR"
FT   CDS             complement(783166..783786)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07720"
FT                   /product="H(+)-transporting ATP synthase, vacuolar type,
FT                   subunit D"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40542"
FT                   /db_xref="GOA:D7GRW7"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRW7"
FT                   /protein_id="CBL40542.1"
FT                   /translation="MNPNTFPTKGNLILAKNSLALATQGYGLMDKKRNILLRELMGLID
FT                   QAKAIQSEIDSTFTAAYRALQKANIEMGIHYVEEIAGSLPVTDDIRIKARSIMGTEIPL
FT                   VEYTPSKDEKPPYSFYSTSDSLDEARIAFERVKELTADLATVETSAYRLAESIKKTQKR
FT                   ANALKNITIPSYQALVKDITNALEEKDREEFTRLKVIKRSTTK"
FT   CDS             complement(783799..785196)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07730"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit B"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40543"
FT                   /db_xref="GOA:D7GRW8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRW8"
FT                   /protein_id="CBL40543.1"
FT                   /translation="MAVEYLGLSSLNGPLAVLEGVSGASYDEIVEMTVDGKEKKLGRII
FT                   EAYEDKAVIQVFESTGNMALKNTHTRLTGHPMEIGVSADMLGRTFDGLGNPIDGLGPIL
FT                   ADKKLDVNGKPLNPVAREYPRNYIRTGISAIDGLMTLIRGQKLPIFSGNGLPHDQLAAQ
FT                   IVMQSSLGDNSDEKFAVVFAAMGVKYDVAEYFERTFRESGVLDHVAMFINLANDPVVER
FT                   LITPKVALTVAEYLAFEKGMHILVILTDMTSYAEALREVSSSKGEIPSRKGYPGYLYSD
FT                   LASLYERAGIVAGVNGSVTQIPILTMPNDDITHPIPDLTGYITEGQIVLDRSLNGQSIY
FT                   PPISVLPSLSRLMKDGIGEGFTREDHQDVANQLFSCYAKVGDARALASVIGEDELSPID
FT                   KKYLEFGREFEKRFIGQDIHDNRTIIDTLNIGWELLGLLPREELDRIDTKILDKYYKPA
FT                   DAASDAS"
FT   CDS             complement(785211..786014)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07740"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40544"
FT                   /db_xref="GOA:D7GRW9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRW9"
FT                   /protein_id="CBL40544.1"
FT                   /translation="MGYNVAIMADSTSRWAEALRELSGRLEEMPAEEGFPAYLASRLSQ
FT                   FYERAGMVQNLNGTEGSVSIIGAVSPQGGDFSEPVTQNTKRFVRCFWGLDKNLAYARHF
FT                   PAIQWLTSYSEYLTDLSSWYSEHVDKNFVNYRNQLVTILNQESSLMEIVKLIGSDVLPD
FT                   DQKLVLEIAKVIRLGFLQQNAFHKEDTCVPLKKQFKMMEIILYLYKKSRALVAMGMPVS
FT                   VLKEEKIFEKIIAIKYDVPNDRLDMFDDYKKQIDDFYNSVIERNA"
FT   CDS             complement(786038..786976)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07750"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40545"
FT                   /db_xref="GOA:D7GRX0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRX0"
FT                   /protein_id="CBL40545.1"
FT                   /translation="MAAKGTIYGINGPIVYIAGDSGFQMNEMVYVGEANLVGEVIGLTS
FT                   ERTTIEVYEETTGLKPGEPVTGTGAPVSVTLAPGIITNIFDGIERPLAAIKKSSGYYID
FT                   RGVHVTSLDTEKKWQTHMTVKRGDHVYGGTIIAEVPETRAITHKVMIPPDLEGDVLSVV
FT                   SDGEYTINDTLLTIMTKDGTEKAITMTQKWPIRIPRPTVKRYPASKPLITGQRILDTLF
FT                   PLAKGGTAAIPGGFGTGKTMTQHQIAKWSDADIIIYIGCGERGNEMTQVLEEFSELIDP
FT                   KSGNPLMERTTLIANTSNMPVAAREASFTPA"
FT   CDS             complement(787064..787717)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07760"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40546"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRX1"
FT                   /protein_id="CBL40546.1"
FT                   /translation="MHTAVPSAGNSDPEPLQIDIGIKEVAALTTEEKLQHFEDICTGDA
FT                   LKKYEQAVSDYTAYEEKILNEHKENARKQAALQIAAEKERIARETNKNLSLGQIEIRRS
FT                   YSRKDEELRGKVFSELRDRLARFMETPKYDALLEAQIKKEKAFAGSSEIHIYIDPSDRE
FT                   KQNLLSLRTDCDIRVSQYPFLGGTRAVIASKNILIDNSFETKLKEAEQDFQFSL"
FT   CDS             complement(787719..788027)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07770"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit F"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40547"
FT                   /db_xref="GOA:D7GRX2"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRX2"
FT                   /protein_id="CBL40547.1"
FT                   /translation="MRMYLISDNTDTLTGMRLAGVDGVIANEKETLEKALNEVLKDKNI
FT                   GIILLTEALGKKYPELVKTVRTEHKKPLLIEIPDRHGTGRRPDFITAYVNDAIGLKL"
FT   CDS             complement(788073..788504)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07780"
FT                   /product="ATP synthase subunit C."
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40548"
FT                   /db_xref="GOA:D7GRX3"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRX3"
FT                   /protein_id="CBL40548.1"
FT                   /translation="MTIAVKLLLTVALIFSIAVPFGAFAAGEKTKGRYKTALAANTVMF
FT                   FGTMLFAVCVLFGGTAFAAESTAAAGGISTGMGYIAAALSTGLSCIGGGVAVSAAASAA
FT                   LGAISEDSSILGKSLIFVGLAEGVCLYGLIISFMIIGKL"
FT   CDS             complement(790490..791545)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07800"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit C"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40549"
FT                   /db_xref="GOA:D7GRX4"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRX4"
FT                   /protein_id="CBL40549.1"
FT                   /translation="MGSLITYSAIAAKLAAMRGHFLTDDEFSVLAGMENVPAAVEYLKS
FT                   SPAYRDVFSGVENEELHRSKIEELLWHSLYGDFSRLFRFANGTQRKFLDLYFLHFEIDV
FT                   MKRCLRDAVSGKRSDLNFKSFEPFFRKHSHLDFTALTDSKDLDEYLDSIQNTPYYGPLK
FT                   DLKDQGITSLSEFESALDILYFIRFWKSLKDQLSKDDREAIADCAGEKIDLLNIEWLAR
FT                   AKRHYKLSADAIMELLIPVWHRLKKSQARELAEAPSIEEFDRILKGTRYGNRIFRASGE
FT                   QQENPELHSLFRALLDAVYSKSGRNDPYSAAALNSYFYFKEEEIRKIITTVEGIRYSLG
FT                   SSEILTCLAES"
FT   CDS             complement(791549..791860)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40550"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRX5"
FT                   /protein_id="CBL40550.1"
FT                   /translation="MNNIINQLSQIEEKTVAILDGAADKKKTLAAEYEAKTKQFDEELN
FT                   HETELEIQSMRQKMEAEAAAELDRQKTAAGDQIARLEQHYEEKHSWYVDSLFRSMTEV"
FT   CDS             792135..793049
FT                   /transl_table=11
FT                   /locus_tag="CK3_07820"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40551"
FT                   /db_xref="GOA:D7GRX6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRX6"
FT                   /protein_id="CBL40551.1"
FT                   /translation="MEIQQFRYFLEAARYENLTKAAEDLHIAQPALSQSIKRLETELGV
FT                   SLFDRKNHRIELNEQGKLLKKRLIPILESIDNLKDELWESVYSSERTIYLNFLSASNLI
FT                   TNSIISYRALKPDVQFQVSQLEMTESCDIHIESRIAISVTPPHPQELPDGVVRREYLRE
FT                   EIFLAVPPDSKFAKHKTVDLREVKEENFIRLGNGWQLRGICDDFCRRAGIRPQAVFESN
FT                   SPESVRNLIAAGLGIGFWPEKAWGGKPGHGVVLIPIRYPNCRRDLVVTVFEQAGNKPVV
FT                   DEFVNYFCKYFEKDPSGMGDVTV"
FT   CDS             complement(793167..793976)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07830"
FT                   /product="Bacterial SH3 domain."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40552"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRX7"
FT                   /protein_id="CBL40552.1"
FT                   /translation="MARNDIPNGWDKIRQNVQETERLMGQKQYNQSMIKAKQTVEYMVK
FT                   LQCEQAGIMEGSMDSMIHELYNNGWISKSTAEHYLQIYDIGTKAAKNGDNGAYNANQAY
FT                   HVLSQEIYSFADNGKAPRGRRPAGSRPQQSRNRSAGSRQSGSGMQPADLLKFVVPIVLV
FT                   IILIVLIRVLTPKKPATEETSAPVITTETAETTAPETEPESTASGSSYKTTTTLNVRKE
FT                   PSTDADRIGKLDPGASVEYLRDHDDTWAVIKYNGQEAYVAKEFLTAE"
FT   CDS             794310..794954
FT                   /transl_table=11
FT                   /locus_tag="CK3_07840"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40553"
FT                   /db_xref="GOA:D7GRX8"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRX8"
FT                   /protein_id="CBL40553.1"
FT                   /translation="MRLRHIKGAEEEIAESPYVVQDPQSLKGRWHEFFGNDNPIRIEVG
FT                   MGKGKFIMELAQMNPDINYVGIERYSSVLLRGLQKRAELELSNIYFMRIDALELADVFA
FT                   EDEVERIYLNFSDPWPKDRHAKRRLTSDRFLAVYDKILQPDGIIEFKTDNQDLFRYSLE
FT                   SIPEAGWQVTSHTFDLHHSDMAEGNVMTEYETKFSAEGKPICKLTACRDKS"
FT   CDS             795002..795139
FT                   /transl_table=11
FT                   /locus_tag="CK3_07850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40554"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRX9"
FT                   /protein_id="CBL40554.1"
FT                   /translation="MSMWACVKRWLSQATCDKTELNRKIIRIRKCFDEANDVVCGRKKK
FT                   "
FT   CDS             795237..795554
FT                   /transl_table=11
FT                   /locus_tag="CK3_07860"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40555"
FT                   /db_xref="GOA:D7GRY0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRY0"
FT                   /protein_id="CBL40555.1"
FT                   /translation="METVFTSANFDADVLGSEIPVVVDFFATWCGPCRMMAPAIAELAG
FT                   EYAGKVKIGKLDVDENSDIAVRYGVMSIPTIILFKDGEIFSKSVGLQDKEVLENAIKEM
FT                   L"
FT   tRNA            795747..795822
FT                   /locus_tag="CK3_T_35510"
FT   CDS             796080..797048
FT                   /transl_table=11
FT                   /locus_tag="CK3_07870"
FT                   /product="L-aminopeptidase/D-esterase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40556"
FT                   /db_xref="GOA:D7GRY1"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRY1"
FT                   /protein_id="CBL40556.1"
FT                   /translation="MKEIKITEIENIRIGSAENKEAGTGCTVIICERGAAAGLDVRGGG
FT                   PASRESELLKPMAAADVIQAVLLSGGSAFGLDAAGGVMEYLEERGIGFDVGITKVPLVC
FT                   ESCLFDLMVGDFKTRPDKAMGYAACEGAEKNNYQDGNFGAGTGASVGKLGDKSLCMKGG
FT                   IGSYAVQIGDLKVGAIVAVNARGDIYDWKDGKKVAGLLNADRKTFADTEEAVYKSYEVV
FT                   KNKFTGATENTTIGAVITNAAFPKSSLCKIAGMAHDGYARAIRPVHTSSDGDSIYALSV
FT                   GDVKADQDMVGTLGAQVMAEAILRAVRSAESAYGLVGAKDL"
FT   CDS             complement(797115..798290)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07880"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40557"
FT                   /db_xref="GOA:D7GRY2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRY2"
FT                   /protein_id="CBL40557.1"
FT                   /translation="MKEFVKSITTPYEKELIETRRYLHRHPELSFQETDTAAYIRSTLN
FT                   ALGVPLMEGISGTSTVAVIKGEKTGPCIAFRADIDALPVEEENDLPFKSEVPGVMHACG
FT                   HDIHTAVLLTFAKVLTAHPELVRGTVKLIFQAAEEKLPGGAKALCEEGVMKDVDLIYGF
FT                   HCASAFPLGTIAVTPRAYSAAIGIYEVKIHGKGGHGGYPQNALNPVPVACMVGSALNQI
FT                   LAEKKNPLEGGVLTVSYINGGQYPNIITDTVTLGGNVRTLNNDLIDKVFDSIHSISRGI
FT                   CAGFGLTCDVTTTLGYPAAINVPEEIETVRSVTRDLGYTVYERPDALGGEDFAYYLLEK
FT                   PGAYFQIGMADPERPITSSPHHNCHFQLDERGISEALEMELGLYLRVTGQM"
FT   CDS             complement(798341..799552)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07890"
FT                   /product="Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40558"
FT                   /db_xref="GOA:D7GRY3"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRY3"
FT                   /protein_id="CBL40558.1"
FT                   /translation="MLAVFLSPIYLLFQAYILLWLYAWADSCSPALHSLFFRIPVTVLY
FT                   LFFAVSPLTGFLITKEPLHHFLRVISNYWLGTLEYILLFIITFDVIRRVTGHSFFMKYR
FT                   YPAMLHTMPKNLVIFGGFAIGLILMVSIYGVLHARRVYVRQDPVVIEKSSSLPGLKIAL
FT                   IADLHLGYNSTKSHVRKIVDTINSQNVDLVCIAGDLFDNDYDAIKDPDKVADILSGIKS
FT                   RYGTYACWGNHDVSEKILAGFTFPQKETIVRDGRFTEFLHHAGITMLEDETVCIDNAFY
FT                   LVGRRDKDMAKKEQLLRKTFSEITEPLDPSLPIIVMDHQPGELSEASDAGVDLDLSGHT
FT                   HDGQMFPANLVVHFLWENACGVLKKGSMTSIVTSGAGVWGPAMRVGTNNEVVIANVSFD
FT                   PATD"
FT   CDS             799675..799929
FT                   /transl_table=11
FT                   /locus_tag="CK3_07900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40560"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRY4"
FT                   /protein_id="CBL40560.1"
FT                   /translation="MIDLTGMISIPYLKKTVFTGSEKGTNFMIRKISGEEGEPDKIQAV
FT                   IWPGPFIFSVTEDEKKTYQEFEFSEDGIKAAVAWLNEVT"
FT   CDS             complement(800101..800931)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07910"
FT                   /product="ATP-utilizing enzymes of the PP-loop superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40561"
FT                   /db_xref="GOA:D7GRY5"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRY5"
FT                   /protein_id="CBL40561.1"
FT                   /translation="MNNTINVSIDCVPAALREFFAEHSTIALAFSGGTDSSYLLYAAKA
FT                   CGVNVHAYYVSTPFQPQFELDDAKLLAESLHADMTVLPFDVLTDKVVKSNPKDRCYYCK
FT                   NQVFGGILKAAKEDGFTEIMDGTNASDDAGDRPGMRALKEMKVLSPLRLSGITKTALRE
FT                   YSRNAGLFTWNKPAYACLATRVPSGISIEASVLKDVEWAEKSLSDLGFRDFRVRVYPDP
FT                   AAADPKADAPWCAKLQLTEDMIPKLMEQRKEICALLKQRFTDVTLDLVARTPSM"
FT   CDS             801263..802429
FT                   /transl_table=11
FT                   /locus_tag="CK3_07920"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /EC_number="3.4.17.11"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40562"
FT                   /db_xref="GOA:D7GRY6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRY6"
FT                   /protein_id="CBL40562.1"
FT                   /translation="MEDRELIVKTSAYIDRHRDEMLSLWEKIVSIESGTPDKEGVDRVG
FT                   AVLKDELESAGVETTVIPMERFGNLLTGVWNKEAAGQPIVLIGHMDTVFAKGTLEKNPF
FT                   RIDENGNAHGPGVLDMKAGLVIVVYVLKALHEYGYGKRPIRVVFAGDEENGHRQTNAES
FT                   EIRKLCAGCAAAFNFETGFIDDGLVVGRKGSCRVTLTVHGVAAHAGNDPERGRNAILEM
FT                   AHKVIEIQKLHDFEHGLFVNVGVIQGGTVANAVAASCEVGIDIRYDSFERLEETLQAIT
FT                   KIAETRTVPDTTADVTWTKPSTVMPVSEKNLELFRHVQKAADMIGYGKLQTKKVGGWSD
FT                   SCLAAAEGVPVVCAMGVKGANNHSMEEYAVAETLFSRAKLALASIITF"
FT   CDS             802462..803790
FT                   /transl_table=11
FT                   /locus_tag="CK3_07930"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40563"
FT                   /db_xref="GOA:D7GRY7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRY7"
FT                   /protein_id="CBL40563.1"
FT                   /translation="MLTDNPGKSLLFFVLPMILGNLFQQFYNITDSVVVGKFVGEQALA
FT                   AVGASYAITNVFIAIAIGGGIGSSVVISQFLGAGKLAKMKTAVYTTMFNFLGIAAFLAA
FT                   VGILFNNRILNLVNVPEDIFSDAALYLAIYFLGLPFLFMYNVQASIFNALGDSKKPLYL
FT                   LIFSSLLNIVLDMILVIIFKQGIRGVALATLIAQGISAVISFLLLMRKLKGYPAEEPVR
FT                   LYSGEMAVSMVKIAVPSTLQQSIVHIGILLVQSVINSFGSTAIAGYSAGMRIESLSIVP
FT                   MLAMGNAMSTFTAQNMGAGKIDRVKEGYRMCYVIVLTAGAVLCVMYQLAGGAFVSLFLD
FT                   SGSSEAYSVGLSYVKFLSFFYSFIGLKASTDGLLRGAGDVTAFTVANLVNLAIRVSVTN
FT                   LFAPIYGIQVAWMAVPLGWAANYVISFGWYLTGKWKKVRVIKK"
FT   CDS             803798..803887
FT                   /transl_table=11
FT                   /locus_tag="CK3_07940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40564"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRY8"
FT                   /protein_id="CBL40564.1"
FT                   /translation="MGNLRTEKCCTKVQADFMKYEKIVPMVQI"
FT   CDS             803963..805087
FT                   /transl_table=11
FT                   /locus_tag="CK3_07950"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /EC_number="3.4.17.11"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40565"
FT                   /db_xref="GOA:D7GRY9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRY9"
FT                   /protein_id="CBL40565.1"
FT                   /translation="MEQKILAYLKEHETEIFEDLKSLVLTEASTSDIEALAKVREKLVM
FT                   LIKERTGEDCFVYEAENGHCPVRFQYGKGTEKILFIGHYDTVHLIGALKYYTEGNELHG
FT                   PGVYDMKGGLISAIWTVKAYKDLGIDPGKRLEFIFNGDEETGSAESTDIICELAKDAKA
FT                   ALVCEPCTANGDLKTGRKGLVRFTVRIHGKASHAGNAHKEGINAIEELAHEILAIQKLT
FT                   DYEAGTTVNVGVCSGGTKPNVVPAEAEIEIDCRVKTAAEGDRIRKAINEIRTTVPGTTR
FT                   EVIERDSKMPMEETEANMALFEKAKICGEKVGLKFSHQFVGGGSDGNEVSALGIPTLDG
FT                   LGAAGDGAHSANEYILIDQYIPRIAMLASFVLTI"
FT   CDS             complement(805167..807461)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07960"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40566"
FT                   /db_xref="GOA:D7GRZ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRZ0"
FT                   /protein_id="CBL40566.1"
FT                   /translation="MAEKKTNSFFKRLVGFLHFLFACVTLVGIGFMYLNSNYGRGLDWI
FT                   KTETFEQSPDFSKKVQADITNIFDYVQYQDIFEVNGEVDYSQVVLEVTTGPGGEKSYTL
FT                   DDIIQYGKSLGYYMDESDNYALKGSPETLSEEDQEQVYVRYRCYQSEEDLTSPDQSFST
FT                   MPDLTYEILRRFSSYYSIYSRLMSDFTNLYFRVAYYSKNNAIYEIHTNAPEMSNDDIMA
FT                   MGRYIYYSGDSNDLAVRTNFESNFPSIPALMSKNNPYNGNSYYVVIGLDTSYKANDDYA
FT                   QAYTAYNKSRVNFSNGLYITIAGLAGSLVTFAFLLFLSGHASISDRTITLYPFDRTKTD
FT                   FMLLLMAFVSYLCIHIMAPVTSKLLHLVVTSDYWDRANLLVAFGYLYFCVILTFFSLIR
FT                   RYKAETLWKNSFLHDLTETLSESTFRYRITIGFVLYLAYNVFMITVGAFMIFHHENSVF
FT                   QFMPFIFVMIAWIAGNLLVFYFIYRNADQTDKIHAAIEKLASGETSYKVDVNDFSSLEA
FT                   ELAEGLNRISDGLETALAEQVKSERLKADLITNVSHDIKTPLTSIINYVDLIKRQHIED
FT                   PTVQKYLEVLDQKSQRLKTLTEDLVEASRASSGNIKLEITNIDFVELVQQTTGEFEEKY
FT                   AIRHLEIVNTLPNEVIMIEADGRRLWRVLENLYNNAFKYALEGTRVYVTIEDHGADVVF
FT                   TIKNVSANPLNISPDELTERFVRGDVSRTTEGSGLGLSIAKDLTTLQGGKFELIIDGDL
FT                   FKAQITFPIKN"
FT   CDS             complement(807473..808168)
FT                   /transl_table=11
FT                   /locus_tag="CK3_07970"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40567"
FT                   /db_xref="GOA:D7GRZ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRZ1"
FT                   /protein_id="CBL40567.1"
FT                   /translation="MPTILVCDDDKQIVEAINIYLTGEGFNVIKAYDGYEALELLEKNE
FT                   VNLMIVDVMMPGLDGIRTTLKVRETSSIPIIILSAKSEDTDKILGLNIGADDYITKPFN
FT                   PLELVARVKSQLRRYTQLGNLNQQGSSQVYKCGGLMINDENKEVTVDGEPIKLTPIEYN
FT                   ILLLLVKNAGKVFSIDQIYEKIWNEDAIGADNTVAVHIRHIREKIEINPKEPRYLKVVW
FT                   GVGYKIEKQ"
FT   CDS             809440..810936
FT                   /transl_table=11
FT                   /locus_tag="CK3_07990"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_07990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40568"
FT                   /db_xref="GOA:D7GRZ2"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRZ2"
FT                   /protein_id="CBL40568.1"
FT                   /translation="MAKYVMALDAGTTSNRCILFNEKGEMCSVAQREFTQYFPKPGWVE
FT                   HDADEIWASMLGVAVEAMNMIGATASDIAAIGITNQRETTIVWDKNTGEPIHHAIVWQC
FT                   RRTSEYCDTLKEKGLTDKFREKTGLVIDAYFSGTKVKWLLDNVPGARERAEKGELLFGT
FT                   VETWLIWKLTKGAVHVTDYSNASRTMLFNINTLQWDDEILAELDIPKCILPEPKPSSCI
FT                   YGETDPSYLGGPIPIAGAAGDQQSALFGQTCFTPGEAKNTYGTGCFMLMNTGEKPIFSK
FT                   NGLVTTIAWGLDGKVNYALEGSIFVAGAAIQWLRDELRIIDSAPDSEYMAKKVKDTNGC
FT                   YVVPAFTGLGAPHWDQYARGTIVGITRGVNKYHIIRATLESLAYQVNDVLEAMKADSGI
FT                   ELAALKVDGGASANDFLMQTQADIINAPVNRPQCVETTAMGAAYLAGLAVGYWSSKEDV
FT                   IKNWAIDKTFEPKIEAAEREKRIKGWNKAVKYAYGWAKED"
FT   CDS             811125..811838
FT                   /transl_table=11
FT                   /locus_tag="CK3_08000"
FT                   /product="Glycerol uptake facilitator and related permeases
FT                   (Major Intrinsic Protein Family)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40569"
FT                   /db_xref="GOA:D7GRZ3"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRZ3"
FT                   /protein_id="CBL40569.1"
FT                   /translation="MLPYIAEFLGTMMLIILGDGVVANVNLNKSGMKGAGAVQITLAWG
FT                   LAVLVPAFIFGEASGASFNPALTIALAVEGSFAWSMVPGYVIAQLAGAFVGASIVYLLF
FT                   KGQFDATEDPGTKLGVFCTGPSIPNTGLNILSEAVGTFILVFAIKGIGNVTGLSTGVDK
FT                   LFVFGIIVSVGMSLGGLTGYAINPARDLGPRLAHAVLPIKDKGDSNFSYGLVVPIVGPI
FT                   IGAIVAVLLYGAIPW"
FT   CDS             811938..812066
FT                   /transl_table=11
FT                   /locus_tag="CK3_08010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40570"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRZ4"
FT                   /protein_id="CBL40570.1"
FT                   /translation="MRLLGGLFFLKDGCRRIPKVVGYGGKLLKETGCKGVNGKCMM"
FT   CDS             812054..813490
FT                   /transl_table=11
FT                   /locus_tag="CK3_08020"
FT                   /product="Predicted dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40571"
FT                   /db_xref="GOA:D7GRZ5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRZ5"
FT                   /protein_id="CBL40571.1"
FT                   /translation="MYDVIIIGAGVAGSASARELSRYQAKICVLEKEEDVCCGTSKANS
FT                   AIVHAGYDAAEGSLMARLNVRGNEMMEQLSKDLDFPFKRNGSLVVCLHEDEMPGLEALY
FT                   KRGIANGVPGLRILNREKLRAMEPNISDEACAALYAPTGGIVCPFNLNIAMAENANANG
FT                   VEFHFDTEVTDLRPVEDGWEIRTSKGTYKTRYVVNAAGVYADKFHNMVSNKKIHITPRR
FT                   GDYCLLDKTAGNHVSHTVFALPGKYGKGVLVTPTVHGNLLVGPTAIDIENKEGTNTTRE
FT                   GLNEVITKAEMNVKNIPMRQVITSFAGLRAHEDGHEFLIGELEDAKGFIDCAGIESPGL
FT                   TSSPAIGEMVADILKEKMDLREKENFIATRKGVLNPNTLSKEERIQLIKEKPEYGNIIC
FT                   RCEMITEGEIIDAIRRPLGAKSLDGVKRRTRAGMGRCQAGFCSPRTMEILARECHKSMF
FT                   EITKSGGNSQIVKGINKDSL"
FT   CDS             813508..814776
FT                   /transl_table=11
FT                   /locus_tag="CK3_08030"
FT                   /product="Thioredoxin reductase"
FT                   /EC_number="1.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40572"
FT                   /db_xref="GOA:D7GRZ6"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRZ6"
FT                   /protein_id="CBL40572.1"
FT                   /translation="MKSYDIVIIGGGPAGLAAAVSAKKNGIESILILERDRELGGILNQ
FT                   CIHNGFGLHTFKEELTGPEYAGRFIKQAEELNIEYKLNTMVMDISEQKIVTAMNREEGL
FT                   FEIRAKAVILAMGCRERSRGALNIPGYRPAGIFSAGTAQRLVNIEGYMPGREVVILGSG
FT                   DIGLIMARRMTLEGAKVKVVAELMPYSGGLKRNIVQCLDDYGIPLKLSHTVVDIKGKER
FT                   LEGITLAQVDGKGKPIPGTEEEYSCDTLLLSVGLIPENEISRGMGVDMNPVTSGPKVNE
FT                   SLETNIEGVFACGNVLHVHDLVDFVSEEAAIAGKNAAAYVKQGENRPSGGHEIVLNPIE
FT                   GVRYTVPGTIDPARMDEELTVRFRVGGVYKNCYVSAYFGDERVIHRKRPVVAPGEMEEL
FT                   KFKKADLLKYPDLETITVKIEEA"
FT   CDS             814780..815139
FT                   /transl_table=11
FT                   /locus_tag="CK3_08040"
FT                   /product="Uncharacterized protein with conserved CXXC
FT                   pairs"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40573"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRZ7"
FT                   /protein_id="CBL40573.1"
FT                   /translation="MEERRLTCIGCPMGCPLVVTMDGGEVVSVTGNTCKRGEIYGRKEV
FT                   TNPTRIVTSTVRVSGGSIDMVSVKTKEDIPKGKIFDCVKALKTVEVAAPVHIGDVIMKD
FT                   VAGTGVDVVATKNVE"
FT   CDS             815177..815389
FT                   /transl_table=11
FT                   /locus_tag="CK3_08050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40574"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRZ8"
FT                   /protein_id="CBL40574.1"
FT                   /translation="MIEVLSAYRFLRRMEVGQFLFMWEIATKLHVSEFPENMYLGVLFV
FT                   KIRTSVLNLFLVDSGRMCYLQNIYF"
FT   CDS             complement(815386..817323)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08060"
FT                   /product="alpha-1,4-glucan:alpha-1,4-glucan
FT                   6-glycosyltransferase"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40575"
FT                   /db_xref="GOA:D7GRZ9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7GRZ9"
FT                   /protein_id="CBL40575.1"
FT                   /translation="MTRTKKTTAPAKTKEIGLGFITELDRYLFGQGTHYKIFEKLGAHP
FT                   KTYKGKAGMYFAVWAPHAKAVGVVGDFNGWDPDAAPMSPLADSGIYEAFIPGVGLGELY
FT                   KFAITTQEGMILFKADPYAVHAEFRPGTASITEDINGFKWDDAAWMETRKKADPVKSPM
FT                   AIYEVHLGSWRKKDRPQKEGYYTYMEAAHELADYVKKMGYTHVELMGIAEHPYDGSWGY
FT                   QVTGYYAPTSRYGTPKEFMYFVNYLHKKGIGIILDWVPAHFPKDAHGLADFDGQPLYEY
FT                   ADPRKGEHPDWGTKVFDYSKNEVKNFLIANALYWVENFHVDGLRVDAVASMLYLDYGRS
FT                   DGNWVPNKYGENKNLEAIEFFRHLNSVLTGHLTGAMMIAEESTAWPGVTKPPEEGGLGF
FT                   TFKWNMGWMHDFLEYMKLDPYFRKFNHNKMTFGITYATSENYILTLSHDEVVHLKCSMI
FT                   NKMPGLNGDKFANLKAGYTFMMGHPGKKLLFMGQDFGQYHEWDEKVSLDWYLADEPLHK
FT                   DLQKYYSDLLHVYQKYPALWQLDSDWNGFQWINANDGDRSIFSFIRRDETGKKNLLFVI
FT                   NFTPVARDDYRVGVPKSGTYSLILDSEHGLYKRGEHAFSARSKKSECDGQPYSFAYPLP
FT                   AYGTAIFKFN"
FT   CDS             complement(817327..818664)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08070"
FT                   /product="Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40576"
FT                   /db_xref="GOA:D7GS00"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS00"
FT                   /protein_id="CBL40576.1"
FT                   /translation="MHTWYEQAVFYHIYPLGLLGAEKTNTLTETAHRLTELESWIPHIS
FT                   DLNGSAIYIGPLFESCTHGYDTKDFRLVDRRLGSNEDFARFVRLCHENGIRVVVDGVFN
FT                   HTGREFFAFQDIREKREASPYKDWYRGVNFGWGSPLGDPFGYEAWQGHFELPCLNLRNP
FT                   EVRQYLFDSIQFWVDNFNIDGIRLDCANVLDFGFMKELREKTSAMKPDFWLMGEVIHGE
FT                   YNRWVNPEMLHSVTNYELHKALYSGHNDHNYFEIAHNVRRLEAVGRSLYTFVDNHDEDR
FT                   IASKLNNLANLFPVYQLLFTLPGIPSVYYGSEWGIEGKRSRTSDEVLRPALNLSDMLGK
FT                   APELASHIAALGKIHTENDAFHNGSYKELLLTNRQYAFSRSGEHGTVISAVNNDEQPAS
FT                   ISIPLPCAASDVVSLLPGEIPFSLENGRLSVTLPANGGAIFKLQEV"
FT   CDS             complement(818670..818909)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08080"
FT                   /product="Protein of unknown function (DUF2508)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40577"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS01"
FT                   /protein_id="CBL40577.1"
FT                   /translation="MIFMFFSKKNASKQAYRRETNELKRQIELSKTAILSAQNQFEQVV
FT                   DPTLVDCYIYELNAAQLRYQFLLRRLKKRELQEV"
FT   CDS             complement(819080..819415)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08090"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40578"
FT                   /db_xref="GOA:D7GS02"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS02"
FT                   /protein_id="CBL40578.1"
FT                   /translation="MISENLLGDIFEECIPLFIALGDRTRLTILQCLFETQTTGEGRIP
FT                   GLNVNEITDRTSLSRPAVSHHLKILKDTGLIDVLRKGVCNYYYLTNKSAIDKLGRLKEE
FT                   LEKYPES"
FT   CDS             820457..821473
FT                   /transl_table=11
FT                   /locus_tag="CK3_08120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40579"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS03"
FT                   /protein_id="CBL40579.1"
FT                   /translation="MKKLIAVYDADTRYAERLSDYVNRKEKGVFTAQAFTSKEKLAEYA
FT                   KKHEIDVLLSGERTDSGDISGIPSAQKIYMSEETEKQMDSGKEIYKFQSGDDIIREVMA
FT                   AYSEIPGIRPNTAGAMGQSRRIIGVYSPIGRCGKTCLALAIGQILAKEEKVLFVTLDTF
FT                   TGFTGLLNERWKRDLSDLIYYYKQDRFHVIRLNSIVYYLGDMAWIPPIRIPQDYTQLSV
FT                   QEMADLLERILQEGNYTTLVLDVGDYGRDALPLLEKCQVIYTPIREDPFSAEKMREFEE
FT                   YLEAVGNGAVMEKIQKIHVPMVTGGRRMEHFPQELLWGDMGDFVRSLLKGQRNLWDS"
FT   CDS             821461..822699
FT                   /transl_table=11
FT                   /locus_tag="CK3_08130"
FT                   /product="Flp pilus assembly protein, ATPase CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40580"
FT                   /db_xref="GOA:D7GS04"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS04"
FT                   /protein_id="CBL40580.1"
FT                   /translation="MGQLKQMLRAQILAEMTYDRQMSDEEIAELIDRRMDVCMEEQPEE
FT                   FPQTLGERLKLHRELFDSFRRLDILQELVDDPRVTEIMVNGPDQVFVETGGKIGRWEKS
FT                   FESREQLEDLIQQIVSSVNRIVNTSMPLADARLSDGSRVHVVLEPIALNGPILTIRKFP
FT                   EPMTMERLLDYGSISPEAADLLKTLVAARYNIFVSGGTGAGKTTFLNALSEFIPPGERV
FT                   ITIEDAAELQLNHIENLVRMETREANAEGAGAIGIGELIRAALRMRPDRLIIGEVRGKE
FT                   ALDLLQSLNTGHDGGFSSGHANSVKDMLSRLETMVLMAADLPLAAIRSQIASAVDIMVH
FT                   VSRMRDKTRKVTAIEEVDRFENGEIILNPLFTFREAEKAGDGFGNTGKVEGSLEQIGTL
FT                   KHREKLRLAGYRV"
FT   CDS             823423..824649
FT                   /transl_table=11
FT                   /locus_tag="CK3_08150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40581"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS05"
FT                   /protein_id="CBL40581.1"
FT                   /translation="MREKTRRGRLNEYGNEYGKYAACVLSGFVLYGLSEAVGEIGDPVR
FT                   DGVLARNEYGGGDRQYELLVEGLENGEEQVKVTVPERKMSDAEVQKELPGIMEYLKGEI
FT                   LGGNSSLSKVQSDLNLTRTLVKYGLSVEWESGDPETVSDMGLIGSEMPESGKTVTLRAG
FT                   LMNGSSVTWVEIPVTVFPETETLGETFSAFLGKLAEKDLETGQVVLPETFDGRTLHYRS
FT                   ADGCGNGGLIFLGIAAALCLFLKEKSDAKEAKKQWEDRMILDYPELLSDFVVLTGAGYP
FT                   VRQAWKKQVVDAESKNTVLIHPVYREMRTALNQMETGTPEIRAYGEFGRRIGLGCYIKF
FT                   ASLLGNSVSTGGKDLRRLLEEEMETAFRQRKELALRKGEEASTKLLIPMFLMLGVVMVM
FT                   VVAPAFLSL"
FT   CDS             824745..824912
FT                   /transl_table=11
FT                   /locus_tag="CK3_08160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40582"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS06"
FT                   /protein_id="CBL40582.1"
FT                   /translation="MQLKRFLMEEDGVGVIEVVLILVVLIGLVIVFKTQINKLLTAIFT
FT                   EINKQAKEVY"
FT   CDS             824913..826769
FT                   /transl_table=11
FT                   /locus_tag="CK3_08170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40583"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS07"
FT                   /protein_id="CBL40583.1"
FT                   /translation="MRYRGEITVFLSLTLICVLSLVLGLVESARTAGARLYLRMASDSA
FT                   VSSVMSYYNRNLWDRYQLLFLEYESEAAIKETFGRYLDFYLEQANMYPARRKNVTLSGM
FT                   SRMVDENGRWLEEEIAAYMKYRLPELAVSGSGVLKESEQVKKAGDFHTLYDSCCGSGRS
FT                   VRRLEKAGQAVEKSLKTIEETREKLCDAADEERAAAFKRHAAVLKRELKGFPGLVKQFQ
FT                   KELERLETENKKMDSGQLEDETASGTLGQEISTCNEVVKSAKERLDGYLQNETQTERNL
FT                   ELLEEACGLLDMESDAEDEEEEETEWEQISQCVEEMENLESVDSGPKDKKKAAALDRLE
FT                   ELFDKELLDILLPAGTAISQNAVSLKGIPSASKYQNDTESSDTEGTGLLEAASRQMAVN
FT                   AYVPLYFASFLKENESEPSALRYEMEYLLAGKKSDRENLKDAVNQVLTLRGAMNLLFLL
FT                   NSPDKKAEADALAAAVSVGIVPAQMALSFFILTLWAFGEAVLDVKMLLAGGKIPFWKTE
FT                   GTWKTCLSGLLDQSFLKETGESSGDGRTYTEYLSCLIFLMDRKTRNFRIMDLIQWNIRT
FT                   EQADFSVANCAYQIEIEAEVLQKHMFFQKEEYKGTVYVAGSY"
FT   gap             826895..828014
FT                   /estimated_length=1120
FT   CDS             828033..828944
FT                   /transl_table=11
FT                   /locus_tag="CK3_08180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40584"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS08"
FT                   /protein_id="CBL40584.1"
FT                   /translation="MAVLFFASFDEMNKQCHSYRKNMSLQVHDPLLARRAHPCTSSLPA
FT                   SMTVEAALVLPLALFFFLALLQPVIWLDRQRKVQTAMERIGEEISQYGILAESVETGDS
FT                   ELPAFCTDAAAALWIRGKVGQYADHVTVKKADVYGENGEIEFAAEYQEEIPFFETVLGK
FT                   QTETVAVKRRSWIGIPGKLKGDGTSQDGDGDEQTEMVYVGAGIGRYHLFRDCHYISNEY
FT                   MTVTRSEAENGKVPGEKRTPCAVCGKKGDGSETVYITTAGEHYHCNKNCRSMISYVREV
FT                   PKDEAEHLGLCSYCVRKKGETE"
FT   CDS             828941..829372
FT                   /transl_table=11
FT                   /locus_tag="CK3_08190"
FT                   /product="Type IV leader peptidase family."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40585"
FT                   /db_xref="GOA:D7GS09"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS09"
FT                   /protein_id="CBL40585.1"
FT                   /translation="MNLFFVFLGTAAWQDLRTRSISLEVLAGGAAVGIITCIWKERLPG
FT                   EIVLAMIPGITLLLIGMLTRGLLGEGDGWFFIVSGFFLGWQECVMLLISGQIFCGIFGL
FT                   AIMVGAQIGTGRENIRKLRLPFLPFLLPASLWMVLMRMI"
FT   CDS             829369..829569
FT                   /transl_table=11
FT                   /locus_tag="CK3_08200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40586"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS10"
FT                   /protein_id="CBL40586.1"
FT                   /translation="MRKTTCIKKYYSASITVEASIILSVVLLSLAAFIRYAYTVHDTVT
FT                   GSMILEETLERARNNVNEKKR"
FT   CDS             829596..829781
FT                   /transl_table=11
FT                   /locus_tag="CK3_08210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40587"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS11"
FT                   /protein_id="CBL40587.1"
FT                   /translation="MGNPRLYLGAYELHLNLGALTAEGDAAAGDWSLHIERADIHPETF
FT                   LRQQDALKKIKDRIDD"
FT   CDS             829781..831244
FT                   /transl_table=11
FT                   /locus_tag="CK3_08220"
FT                   /product="FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40588"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS12"
FT                   /protein_id="CBL40588.1"
FT                   /translation="MKTEFKREMNRNYMVLHPEKEIGGSYALRMLSENRINGLLPFQEK
FT                   RIDGETFLYFNITSRQSLARMMEYRSFKAKEIRQITSDLVVTMTALERFLMDGDQLCLE
FT                   PDMIYVDPDDLKANFCLLPGSGSQFEESFRKLARYILDHVDHTDGDAVVLAFALFRAGE
FT                   KENLGIRDLEKCLQAGERDGKEDIFGENTGKEKLYEAERKMVREYGTGAAGELPRHQGE
FT                   KQNGSEGKYRYSEIKKTDLSGETEELAEEKGLKHGKNLFSVLFAVLMAAVPVAVYFIVG
FT                   IDRILEWKWGILAAEGVLMAGVIFFRVKKDEEETGETEEDWEVEFREEEDRERGGMPDK
FT                   IEYRRDMAEVWGDAENNENGIYTDPNDLRTDVRQRESDEMQTVLLTGRQIYPATRRLVP
FT                   ENGGEDVLVRYFPFIIGKNREISDFCLNLPQISRIHAKIEEDKDGYMITDLNSTNGTSV
FT                   NGRFLETNESIHIEPGEMLSFADQRYRFL"
FT   CDS             831357..832457
FT                   /transl_table=11
FT                   /locus_tag="CK3_08230"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40589"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS13"
FT                   /protein_id="CBL40589.1"
FT                   /translation="MAFQMPEYHQPDFSKEQFIKAPDAKLEIVEIDGVAPEYFHSTSMF
FT                   PEYFKIQGKWVLAEESRMDSSVVICPDGHLEVVENRNLKKGDKVILGRSEACEEGIYVH
FT                   STGFQTEADALADKFVFRQGRSRETSYARDYDRLMDLLRYEKEHGKIVWVMGPAFSFDY
FT                   DARNAMQSLIDNGYAHGLMAGNALATHDLEGALLHTALGQDIYTQVSQPNGHYNHLDVL
FT                   NKVRRSGSIPKFIEDNHIDNGIIYGCVKNHVPFVLTGSIRDDGPMPEVIGDAYKGQSAM
FT                   RDMVRDATCVICLATMLHTIATGNMTPSFRVMKDGTIRPVYLYTVDADEFVVNKLMDRG
FT                   SLSATTIVTNVQDFITIIAKGLGVMK"
FT   CDS             832480..833100
FT                   /transl_table=11
FT                   /locus_tag="CK3_08240"
FT                   /product="Uncharacterized membrane protein (homolog of
FT                   Drosophila rhomboid)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40590"
FT                   /db_xref="GOA:D7GS14"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS14"
FT                   /protein_id="CBL40590.1"
FT                   /translation="MGSRYGKKAYVNGLLIALNVLFFLYLEITDSSEDAYFMYTKGAMF
FT                   APAVLEDGEYYRLLTAMFMHFGIRHIMNNMLVLFVIGDNLERALGHVKYLIFYLLCGIG
FT                   SNWVSMMAHTADTMTVSAGASGAIFGVVGGLLYVVTANRGQLEDLNTRQLVIMIFFSLY
FT                   LGYTSTGVDNIAHLSGLVIGFVLAIILYHRPARDRWADGGIKR"
FT   CDS             833097..833513
FT                   /transl_table=11
FT                   /locus_tag="CK3_08250"
FT                   /product="Diadenosine tetraphosphate (Ap4A) hydrolase and
FT                   other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40591"
FT                   /db_xref="GOA:D7GS15"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS15"
FT                   /protein_id="CBL40591.1"
FT                   /translation="MKDCNCIFCKIANGEIPSSTVYEDEDFRVILDLGPAAKGHALILP
FT                   KEHFKDVTELDPKIAAKVLPLGAKLGTAMKKSLGCAGFNLVQNNGEAAGQTVFHFHVHV
FT                   IPRYEGGPVIAGWEPGKEDPEVLAETAEKIKDAL"
FT   CDS             833540..834085
FT                   /transl_table=11
FT                   /locus_tag="CK3_08260"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40592"
FT                   /db_xref="GOA:D7GS16"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS16"
FT                   /protein_id="CBL40592.1"
FT                   /translation="MPQDKDELLQVLITKYAQMYMKLAYAIGVPYDDVEDIVMEAFWSF
FT                   YRADYGGKLESEKAIKVMLARIVENKCIDYFRKEKRSIKPNEDEDVSELEYVADLSTYD
FT                   PLQSVISRESCGQIFEVLDGLGESWKDVTVMYFIQGFTTEEICERLEITNDMCRSRISR
FT                   ARKYLRENLKSRMDRGHL"
FT   CDS             complement(834076..835146)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08270"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape
FT                   ptide) pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40593"
FT                   /db_xref="GOA:D7GS17"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS17"
FT                   /protein_id="CBL40593.1"
FT                   /translation="MKTILLTGGGTAGHVTPNLALIPSLKAAGYDIRYIGSYNGMERKL
FT                   IENAGIPYNGISSGKLRRYFDLKNFTDPFRVLKGYAEALKLMKKYKPDVLFSKGGFVAV
FT                   PVVLAAKHYHIPTIIHESDMTPGLANKLCIPSAKWVCCNFPETLKYLPEGKAVLTGSPI
FT                   RAELLQGDRLAGLQYTNLSAAKPIILVIGGSLGSVKVNGAVRSILPKLLEQFQVIHICG
FT                   KGNLDESLIGTPGYVQYEYVDSPLKHLFAAADLIVSRAGANSICEILALRKPNVLIPLS
FT                   AAASRGDQILNANSFAKQGYSTVLEEEKVTDATLFDAIHDTYENRRTFIDSMEKSHLNN
FT                   AIDTIMKLINDCADHK"
FT   CDS             835261..836142
FT                   /transl_table=11
FT                   /locus_tag="CK3_08280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40594"
FT                   /db_xref="InterPro:IPR025377"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS18"
FT                   /protein_id="CBL40594.1"
FT                   /translation="MADTENREDQKISECLREAFGYSDDQLLKQLDQANETFKDVNFTG
FT                   AEDRLMKRFLARKAELEKETASQTPTLVPQNESANIQIAEELPKKTVTVISEAEEKKKN
FT                   EKKVIRFGKKKVLATAALVAVIAGMLGGTAVGKKSYFLKVRRNEATISLDNDKNMPSNS
FT                   KLEQAYEALESELGLPVLKLGYIPKELQFINYDIYEDGGQIEFSYCGKSVYLIQRKKEM
FT                   SVSAEIKSDRNEEGIIFNKWINKDIEYYINDLEDNNQECECFITINNSYYYLFGYIEKE
FT                   EFEKILEYLNFF"
FT   CDS             836208..836738
FT                   /transl_table=11
FT                   /locus_tag="CK3_08290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40595"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS19"
FT                   /protein_id="CBL40595.1"
FT                   /translation="MKVMKRIIGMALIFTLMTCGTAFAGLKDVRNSLLNTYTQSRLLAD
FT                   TCVSDGDITPNSARGRVFSAGMLELVNKQDGTLHISVDTFAHSVVDDIYQSVFLDMWDE
FT                   SKEKWVQVGHWEFEKTIKEDENLTSYHVGFTVSGCEVNRYYRARAIHLVQWGDDAEGKS
FT                   TQTDGVLLTDHAV"
FT   CDS             complement(836953..837201)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40596"
FT                   /db_xref="InterPro:IPR023806"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS20"
FT                   /protein_id="CBL40596.1"
FT                   /translation="MVYKTQGTCSREIHFDVENNKLKNVSFVGGCNGNLKGIGLLVEGM
FT                   DIDDVIKRVEGVSCNGRPTSCPDQLARALKQYKEQQA"
FT   gap             837308..838556
FT                   /estimated_length=1249
FT   CDS             838920..839612
FT                   /transl_table=11
FT                   /locus_tag="CK3_08310"
FT                   /product="methylthioadenosine nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /EC_number="3.2.2.16"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40597"
FT                   /db_xref="GOA:D7GS21"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS21"
FT                   /protein_id="CBL40597.1"
FT                   /translation="MLGIIGAMEVEVEKLRAKMTETEMKTVAGMNFCKGKLEGKDVVIV
FT                   RSGIGKVNAGICSQILVDLYQVDGIVNTGIAGSLRNEINIGDLVLSTVAVQHDVDAGGF
FT                   GYPAGEIPQLGVKEFPADERLLALAEEACREANPDISTFKGRVASGDQFIDSKEKKNWI
FT                   HDTFDAYCTEMEGAAVAQAAYLNKVPYLIVRAISDKADDSAHMDYGEFEAKAVEHSVNL
FT                   MLALVKRI"
FT   CDS             839824..840954
FT                   /transl_table=11
FT                   /locus_tag="CK3_08320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40598"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS22"
FT                   /protein_id="CBL40598.1"
FT                   /translation="MLEFLQTGRMLYVLAAICALGTLSTLVTGSLYKRLIKETGNMALT
FT                   KDKNLKALKQRMENVFLINHGIRNVNAYIEKQLYGFRFMHMSLDGWDNLSVQAMILCFM
FT                   AGGAAAFGAYWYRCDNYYIVLYGAAGVFGGLFLAFVDNGIGAGTKRKQLADHLVDYVEN
FT                   SPHFYKSVDNSAYAGQERKKAVGSSDIVDFSGTSGIGYGRNQENARKEKLNSRFSVLGK
FT                   KKDAQAANGNGETDQVEKGSLARTRDTGRTSRLDGKGPAFQENEDDQAVNGNSAGSSSK
FT                   KTAGKADYNRGTVQNVRDIGQENSGTGGKVPTSETELAQSINHLSESLKQIAASREQPE
FT                   EMLKDSDRLDLIRNSIPPAELDMLKTLFNTLQSGGV"
FT   CDS             841189..842538
FT                   /transl_table=11
FT                   /locus_tag="CK3_08330"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40599"
FT                   /db_xref="GOA:D7GS23"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS23"
FT                   /protein_id="CBL40599.1"
FT                   /translation="MGKEIVFDYSKTAGFISEEEMKNMKSTVMGAKDVLTAKSGAGNDY
FT                   LGWIDLPVDYDKEEFARIKKAAEKIQGDSDVLLVIGIGGSYLGARAAIEFLSHSFYNVL
FT                   PKGKRKTPEIYFVGNSISSKYIHDLQDVLEGKDFSINIISKSGTTTEPAIAFRVFKEML
FT                   IGKYGKEEANKRIYATTDKAKGALKNLANEEGYESFVVPDDVGGRFSVLTAVGLLPIAV
FT                   SGADIDALMTGAADARKVALETEYEKNPALLYAAVRNILLRKGKQVEIVANYEPSLHYV
FT                   SEWWKQLFGESEGKDQRGIFPAAVDLTTDLHSMGQFIQDGARIMFETVLNVEESPAEIV
FT                   LQREDVDTDGMNYLAGKTVDFVNKSAMNGTILAHTDGSVPNLMVKIPAQDAYSLGQLFY
FT                   FFEFACGVSGYILGVNPFNQPGVESYKKNMFALLGKPGYEEAREALLKRL"
FT   CDS             complement(843015..843281)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40600"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS24"
FT                   /protein_id="CBL40600.1"
FT                   /translation="MFRIWGKIWKDNHLVRDMVSCNNDYSMSRTAMVFQALDEICHEFD
FT                   LSQPIWLDSNIRDFQLHDKTRFTKDSFIESIDFDYLEFQVIEE"
FT   CDS             843467..844567
FT                   /transl_table=11
FT                   /locus_tag="CK3_08350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40601"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS25"
FT                   /protein_id="CBL40601.1"
FT                   /translation="MGQPITDYAAFFASAGQAVQELEALNTEVEQLEADEKKLESSLKG
FT                   KQRSVTETISQTVKQRKEEITKSYDAELGKAQERLKKVKAKREKAKNQGVKERIEEDTR
FT                   GLVRENKELADQIKTLFKANHVPGFCRGNYYYALYFTRTFKDFLTLLVTILICFLAIPC
FT                   GVYFLIPERRTMYLVGIYVAAILIFGGIYVTVGNMTKVRYMDVLKEGLGIRAKIRANKK
FT                   EMKVIAKTIRRDKNETIYNLQKFDDEIAQLDQDVAEINRKKKEALTTFDTVTRTIISDE
FT                   ITANNKEEIDRMEDELASLSEKLRSTRTAAKEKSLFITDNYEVYIGKGYMTSEKLQALA
FT                   DIVRSGAASNISDAIAVYKSQEETAK"
FT   CDS             844834..845823
FT                   /transl_table=11
FT                   /locus_tag="CK3_08360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40602"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS26"
FT                   /protein_id="CBL40602.1"
FT                   /translation="MRKIGMKIAVAAAVFCMAMPFASFAGTWKSDANGMWYQFDDGSYP
FT                   KGRWAWIDTDNDGMAESFYFDENGYVLRNTTTPDGYQVNRIGAWVVGGEVKQKAGGETK
FT                   NSSSGTSGNSSGGSNSNSNSNNSGYWNYGYNYDPDWYLKADYLSEIDKAAYHYSSKYYN
FT                   WDAYNPDEIAKVREQVDRIAANPCDATASAEMVSVEIPVWRLRNGQKVAGTAHVQVLSS
FT                   IANDVKEIFTEIYNGPEQFPIESVGGYNWRSNGLGSNHSSGTAIDINPDANPQIDVDGT
FT                   TVLIGNKWEPSVNPYSIGRDSDVVKAFGKHGWNWGAGFSRADMMHFDY"
FT   CDS             846165..846767
FT                   /transl_table=11
FT                   /locus_tag="CK3_08370"
FT                   /product="putative sporulation protein YyaC"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40603"
FT                   /db_xref="InterPro:IPR009665"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS27"
FT                   /protein_id="CBL40603.1"
FT                   /translation="MRFGRRKITYYDTEAGFEAEKFAARLLLLLMNEMRASGRRQVVFL
FT                   CIGTDRSTGDSLGPLIGSRLEAEEISNVVVIGTLEHPVHAVNLDRTLEHIEEHYPDAII
FT                   IAVDAAVGRWDHVGLVTLEKGPLRPGLGVRKELAAVGDISITGIVGGAESGDPLFLQSI
FT                   RLSMVMRLADCISRSICLGMRIIGRRVENFSSQAAPF"
FT   CDS             846899..848299
FT                   /transl_table=11
FT                   /locus_tag="CK3_08380"
FT                   /product="LysM domain."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40604"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS28"
FT                   /protein_id="CBL40604.1"
FT                   /translation="MGELYNPFPKLPKNIRQIGDTDQVVRLYVEDYVNTYLKRLYPAGN
FT                   QTLRVGLLLGSTENYDGTPYIFIDGAIEMEDVEVSGEKIEFSENAWKKAYRGIEESFPK
FT                   RTVQGWFICGAPSSQLSPLNYWKQHNQYFNGKNKLMYLNHGLEGEEAVYVTSEDGFYRL
FT                   KGHCIYYERNQMMQDYMVTRKDVRRVESGSHEKVIKDFRQRMTVRKEQADAGRHMSGIL
FT                   GTACGVLTVAVLAGGVVLVNNYHKMRQMESVLTSVVPAGTANWSDYLDKLNQEPDFVIE
FT                   ERPGNVFPTEASGETGESYAAETMETTEAGTDTEAASVDNQTQNHSTGSTDGQQAQSTP
FT                   GSSGGQTGTVSQPSDTAAAASNETSAASGAVEEAVPSTSAESPTQPRVGMGKESEQSST
FT                   ESSKKEPVDYAAASANGYRIYEIGDGETLYGICWKEYGNLKRLSEICELNHLDNVDHIV
FT                   AGQKLVLP"
FT   CDS             848481..849926
FT                   /transl_table=11
FT                   /locus_tag="CK3_08390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40605"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS29"
FT                   /protein_id="CBL40605.1"
FT                   /translation="MSDMQSMDRENKKRQLRQNIVQMPDNGSEEPMDGGRLAKYKRKKR
FT                   IIAAAAVCFLAALGFTGYRYMNEYEYTGYSVQWERSMRYTENSGADKKTQVAETSAAAD
FT                   SAGTDGAGETASAENSGSSGAGSGTPDETASAETSAPAEASKTVGDSSFVKFAMFGDNV
FT                   IKYTKDGASYIDASGKTIWTQSYEMKTPIININGDYAVIADQQGNEMYICSKEGCTGTA
FT                   KTQLPITKAAVSARGVAAAVVEDSTASYIFYFKKDGESLGINIKMLLSGDGYPVDIALS
FT                   PDGKQIVMSVMYMKNGALKNKVAFYDFSEIGKNVNNRFIAAFEEEFDDKMVGRIRYLND
FT                   QTVCAFSDKGLTFISVKNVIPDTNVTFVPVDEEIQSICYSDKYAAVVVDSTSGSPYRLD
FT                   VYNTDGKKVTSIDFDYAYTGVLIDGDRLILYNEESCREYNLDGHERFNGQFDFPVSLVR
FT                   AGKNRTNSLITVGSEVMKEIKLR"
FT   CDS             850020..852002
FT                   /transl_table=11
FT                   /locus_tag="CK3_08400"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40606"
FT                   /db_xref="GOA:D7GS30"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS30"
FT                   /protein_id="CBL40606.1"
FT                   /translation="MNTIDNLAINSIRILSADAIQKANSGHPGLPLGSAPMAYELWAHH
FT                   MNHNPANPEWANRDRFILSGGHGSMLLYSLLHLFGYGLTKEDLMNFRQVGSLTPGHPEY
FT                   GHTVGVEATTGPLGAGMGMAVGMAMAEKHLASVFNKESYPVVDHFTYVLGGDGCMMEGI
FT                   SSEAFSLAGTLGLGKLIVLYDSNRISIEGSTDIAFRENVEERMKAFGFQTITVEDGTDI
FT                   DAIGAAIEVAKADTEHPSFITIKTEIGFGCPAKQGKASAHGEPLGVDNIKAMRETLGWQ
FT                   YEEPFFVPEEVYEHYSRLAEEKADVEAAWNAMFAAYCDEYPEMEKLWEQYHTAPDAKAL
FT                   IENEALWLTKDKAEATRSLSGKMINILKDIMPNMIGGSADLAPSNKTAMKDAGDFSAEN
FT                   PAGRNLHFGVRELAMTAIGNGIMLHGGLRAYVATFFVFSDYVKPMARLSALMGVPLTFV
FT                   LTHDSIGVGEDGPTHEPIEQLAMFRAMPNFHVFRPCDATETSAAWLSAVTSEKTPTALV
FT                   LSRQNLNPIPGSSKDALKGGYVIDDCEGTPDAILIASGSEVDLAVKAKAELTAEGKKIR
FT                   VVSMPCMDIFEEQSAEYKESVLPKEVRRRIVVEALSDFGWGKYVGLDGAYVTMKSFGAS
FT                   GPAAKLFEKFGFTVENVVNTVKTLF"
FT   CDS             852076..852177
FT                   /transl_table=11
FT                   /locus_tag="CK3_08410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40607"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS31"
FT                   /protein_id="CBL40607.1"
FT                   /translation="MGRQLRKVVYCPDRWLKAVVGRIAENQGKGEHT"
FT   CDS             852174..853115
FT                   /transl_table=11
FT                   /locus_tag="CK3_08420"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40608"
FT                   /db_xref="GOA:D7GS32"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS32"
FT                   /protein_id="CBL40608.1"
FT                   /translation="MSLKCIGIDIGGTSVKLGIFEEDGTLVKKWEIPTRKEENGKYILG
FT                   DIAASIRRMAKESGLELSDFSGAGMGFPGPVLPNGHCEVCVNLGWKAGNPQQELSRLLD
FT                   GMVVKSGNDANVAALGEMWQGGGKGYKNLVMVTLGTGVGGGIILNEKIWTGEQGVGGEI
FT                   GHIHVMEGEKEACNCGGHGCLEQVASATGIARTARRMLAADNRPSTLRSLKNISAKNVL
FT                   DAAKAGDALALESLNKSCYYLGWALATISMVLDPQAFLIGGGVSKAGTFLTDIIKRYHD
FT                   ELSPMATKKADIVLAKLGNDAGIYGAAKLIIG"
FT   CDS             853427..855100
FT                   /transl_table=11
FT                   /locus_tag="CK3_08430"
FT                   /product="Inorganic pyrophosphatase/exopolyphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40609"
FT                   /db_xref="GOA:D7GS33"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS33"
FT                   /protein_id="CBL40609.1"
FT                   /translation="MAVEELKKTLVLGHRNPDTDSICSAICYAGFKHQLTGENYEPCRA
FT                   GNVNPETQYVLDYFKLKAPRLVENVKTQVKDIEIRKTKGVSRGISLKNAWGLMQENNVV
FT                   TLPCVTEEGLLEGVITIGDITKSYMNLYDSSIISKACTKYANILDTLEGSMVVGDSEAY
FT                   FDRGKVLIAAANPDLMENYIEKHDLVILGNRYESQLCAIEMEAGCIIVCEGAGVSLTIR
FT                   KLAQERGCAVITTPYDTYTTARLINQSMPISYFMTKENIIEFSEEDYLDDIREIMASKR
FT                   HRDFPILDSDGKYIGMISRRNLLGAKGKSIILVDHNEKSQAVEGMESADIREIIDHHRL
FT                   GTVETMSPVFFRNQPLGCTATIIYQMYQENHIEIDKTTAGLLCSAIISDTLLFRSPTCT
FT                   PIDKAAGLALAQIAGLDIEKYAIDMFSAGSNLKGKSDGDIFYQDFKRFTVGNSVFGIGQ
FT                   ITSLNAVELKDLRTRMSAYTEKEREQHEIDMMFFMLTNILTESTDLICTGQGAEQLIAN
FT                   AFHVKDEDMENVSGQTGIVKLPGVVSRKKQLAPQIMMALQ"
FT   CDS             855284..856030
FT                   /transl_table=11
FT                   /locus_tag="CK3_08440"
FT                   /product="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenases, DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40610"
FT                   /db_xref="GOA:D7GS34"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS34"
FT                   /protein_id="CBL40610.1"
FT                   /translation="MGKRQFKPGNMLYPVPAVLVTVADREGNSNIFTVAWAGTICTNPP
FT                   MLSISVRPERHSYHMMKETGEFVVNLTTESMAWATDYCGVRSGRDVDKWKETGLTPEKA
FT                   NVVDVPVIKESPVNIECRVVKVEELGSHHMFIADVVAVDVDEAYMDEKDTFHLSMAKPL
FT                   AYSHGRYYGMGEELGSFGYSVRKQEKSVKAGRKTSRSAEKAGGTGKVRKSADVNGGKKA
FT                   TTRPEQSRKANGQKSGGPRNDKKRQK"
FT   CDS             856110..856622
FT                   /transl_table=11
FT                   /locus_tag="CK3_08450"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40611"
FT                   /db_xref="GOA:D7GS35"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS35"
FT                   /protein_id="CBL40611.1"
FT                   /translation="MKKKNILMIGMPASGKSTIGVLLAKRLGYSFVDVDLVIQEKTGKL
FT                   LKEIIAEEGDDGFLRVEEQANLDLDVEKSVIAPGGSVIYEAKAMEHYKETATIVYLKLC
FT                   YEDLESRLGNLVDRGVVLKDGMTLRDLYNERLPYYEKYADITLDETGKEFGELVDELRA
FT                   YFENLEK"
FT   CDS             complement(856732..857400)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40612"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS36"
FT                   /protein_id="CBL40612.1"
FT                   /translation="MKNFVITVARGFGSGGRAIAAKLADELNIHSYDNRILTLASQYSG
FT                   YPEHYFKEADETLNGSLITKQLQALPKRHSPTGELSRFTSDDRLFEYQKIIIEKLAASE
FT                   SCVIVGKCADYILKDYDNVVSIYVEAPRSYTLRRVMERMDDITVEEAHHLITKTDKYRA
FT                   DYYKYYTGGNYWTNPVNYDLTFNNARLGDDRCVKLVLECMKLKFRDDFKEYMKSIGKDI
FT                   "
FT   CDS             complement(857434..857694)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40613"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS37"
FT                   /protein_id="CBL40613.1"
FT                   /translation="MVDSKKLISLVEKYEKLIYDTADHIWAHPETGFREWKTSAYMEQH
FT                   FEELGYTLTKAGNIPGFYTDLDTGKPEILFQPASPDSLFCF"
FT   CDS             complement(857939..858913)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08480"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40614"
FT                   /db_xref="GOA:D7GS38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS38"
FT                   /protein_id="CBL40614.1"
FT                   /translation="MQKNVIMSVDHLSKDFVIRGKKLGEKSKLLHALSDVSFDIYEGET
FT                   LGIIGESGCGKSTLGRCLVKLHKPSAGTITYNGKDLWNLPVYEREAARRDIQMIFQDPY
FT                   SSLDPRKTASYSIEEAMKVHHIGDTARERRQKALESLQEVGLDIQHMERYPHEFSGGQR
FT                   QRVNIARALSMEPKIIVCDEPVSALDVSIQAQVINLFRRLQKQFNLTYVFISHDLGIIK
FT                   YISDRIMIMYLGRVMEFYTSEGIYADPKHPYTQALLSAIPPESPFDKKERLPLTGDIPS
FT                   PIGDQVGCPLAGRCPHCTERCKKEIPKLVDTGDGHMVACFLYE"
FT   CDS             complement(858898..859926)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08490"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40615"
FT                   /db_xref="GOA:D7GS39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS39"
FT                   /protein_id="CBL40615.1"
FT                   /translation="MSENDVILKVNGLKTYFYQASGVSKAVDGVSFSLRQGTTMGIVGE
FT                   SGSGKSVTSASVMRLMPAKTGRIVDGSIIFDGVDIRNLSESQMEKFRGDECCMIFQNPM
FT                   TSLDPVFKIGHQMVEMIREHEKISKKDAWDKAVEALKLVGIPEAEKRMDAYPHELSGGM
FT                   CQRVIIAMAVCGHPKLIIADEPTTALDVTVQAQVLELLKDLQKKLNTAILLITHNLGVV
FT                   WEMCDTVMVMYAGNTVEYADTKTLYKEPLHPYTWGLLDSMPKLSSSTKEDLKTIPGTPP
FT                   DLRLTGHCCNFYNRCPYATEICRQQVPPLKEVAPGHFVACHRQDGEHRLTRGEVNVTCK
FT                   KM"
FT   CDS             complement(859939..860877)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08500"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40616"
FT                   /db_xref="GOA:D7GS40"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS40"
FT                   /protein_id="CBL40616.1"
FT                   /translation="MTLSKKKKPAAASSVVSGEALGMDANIAMLVKERNANNAWHKLAR
FT                   NKTALVGFFIVAFMVVIAVFAPLIAPYDPNAINPVLPFKGIGTPGHLFGTDDLGRDILS
FT                   RIIYGSRISMIVAVGATIVGAIIGVLIGLTAGYFGGWIDAVFMRIMDGMFSFPFILLAM
FT                   ILITVLGNGVMNVILAIGIASVPGFARVTRGQVLIVKEEEYCNACRVVGVSPVRLLFLH
FT                   ILPNCVSQIIVYATLRIASAIISEASLSFLGLGIALPTASWGSILRVGRDCLTTAPHVA
FT                   GTAGAFILVTVIGFNLLGDGIRDVMDPKMKQ"
FT   CDS             complement(860884..861834)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08510"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40617"
FT                   /db_xref="GOA:D7GS41"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS41"
FT                   /protein_id="CBL40617.1"
FT                   /translation="MGKIIIKRLLQTIPTLLVVVTLTFCLTRMLPGDPAVAILGIEANA
FT                   EDIEAMRAEMNLDKSLPEQYALYLGGLVHGDFGYSYSYRQDVLPLITSRIPNTLTLTLT
FT                   ALLFAFIIGTNVGIIAALKQNTIFDYIVMVITLVGVSMPIFWLALMLVLQFSVKMNLLP
FT                   VMGMGDLSKSFGDVVSHMILPGFCLATIPMATFARTMRSSMIDIMSSDYIRCLRARGIK
FT                   KLKVILIHGLKNALPPLITVLGLQIAGTFTGAIITEGIFSWPGMGTMINTAINNRDYSL
FT                   IQGAVLFSAIMFVFCNMLVDIAYAILNPKVKLEKG"
FT   CDS             complement(862073..863773)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08520"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40618"
FT                   /db_xref="GOA:D7GS42"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS42"
FT                   /protein_id="CBL40618.1"
FT                   /translation="MKKRRLIALAAAAVMAASSLTGCGGSQTSSTTAAGSTAETAAASS
FT                   NAVSPDAKSTDQTLGGGIAVGSSDGEAVKGGTLVVSMPSSPRTLDPKAYSTMYENHIMY
FT                   NVLDTLFVWDKDYKEVIPSLATDYTVSDDGLTYTINLRDDVYFQKGKFQDGRKMTADDV
FT                   VYSLERSKEESTTDRICRDFFDYCEAASPTQVVIHMKSVAGPFISQLAGIGNAILPKEE
FT                   VEGWGEDFGSHIVGTGAFTLEEIVTDEKVTLKKNENYWGTEPNVDGIEFRIISDSNQAI
FT                   NAVQTGEVDIAMYLQGEAIKRAQDADLLLQAPSSAVTFVRFNMQNGPTANADVRKALTM
FT                   AVDIDSMVAGIYQYGEGTRAYQPLPVYSFAYDTAYNDLVPSYDPEGAKKLLAEAGYPDG
FT                   FTMSLYIGSTTYREKMAQMLQYYWSQIGVTLDIKSSTMADWSAAVVDSWQSDVVNSYGV
FT                   SWNSDPDPYGFLGKFFSSQTLHASSNAGGYNDAELDELLNEGFGSTDNAKRAESYKKVI
FT                   EKVMNEYTGIYYAYECRNWAVSPKVHDAVLRADNQMLVATPFNNIWVEK"
FT   CDS             864915..865949
FT                   /transl_table=11
FT                   /locus_tag="CK3_08530"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40619"
FT                   /db_xref="GOA:D7GS43"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS43"
FT                   /protein_id="CBL40619.1"
FT                   /translation="MRKMKTIMSLAAAAALAGILLTGCSTEADEKTAVTAAPIEAAAAE
FT                   AASGTGTEAEKTEGGALAGKKISVMTPYLTSVTTNQMAGYIKEDLEAEGAEVFVIDTAN
FT                   DFAELASRIEDVVSSGTDGIVLVSADPNQVANQLQDAFDADIPVFGCDSGFIDGMQINA
FT                   TSDNYQMGELIVRYLFDDLMGGKGTVIALTHRPHPGVVKRCEAFDDIIKEYPDIKLITE
FT                   QHVPAEQPINDAQDIVANLLTANPDKDSITAVFAAWDEPAIGAAKALQEAGRDEVIVTG
FT                   VDGNEQAVEMIKDGTNLKATVKQNFEGMADIVCEQMDKYFAGEEIEKGEMYAPAELITQ
FT                   ENAQ"
FT   CDS             866074..867720
FT                   /transl_table=11
FT                   /locus_tag="CK3_08540"
FT                   /product="ABC-type sugar transport system, ATPase
FT                   component"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40620"
FT                   /db_xref="GOA:D7GS44"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS44"
FT                   /protein_id="CBL40620.1"
FT                   /translation="MLLDVKSVDKKFNGVYALKGLDFSLGEGEVHGLVGENGAGKSTFI
FT                   KILGGVYKRDGGSILWNGKDLPEAIRPEESRNLGINIIFQDNVLIPAFTGMENICLGRP
FT                   YPVKGELIQWKEMEREAAAKAEELGIHLDLKKPVSMMTPAQKKCVEIVRAMMSDCKLLI
FT                   LDEPTASLSDKETNLLFSIVRNLKAKGTSVLYVTHRLEEIMELTDQVTVLRNGTLVSTV
FT                   DTAGTSRKELVRLMSGNEAEAGVEDTETGKDVKSKLQGGAADRASGKGGVKQPVSSEAE
FT                   KTDTQGAELLGTGADGEIRKTALEVHGIRSKDGIVRGVDLNVKAGLITGMFGLCGSGRT
FT                   EFLECIYGTRKLAGGEVMVNGAVTSHPTPSESIRQGIAFICEDRRGKAMIPAFTVEENM
FT                   MLSSIDRYTKSGWFQKRAADKKAMDMIEALKIKCVGLSQPAKELSGGNQQKVVFAKALL
FT                   TEPSIWLCDEPTQAVDVATRQEIHRLLKEEAKKGKAVLYVSSDLTELLEVADEVAVMAC
FT                   GRVRKTFENKDLKPTDVLACCYEAEREESDR"
FT   CDS             867717..868658
FT                   /transl_table=11
FT                   /locus_tag="CK3_08550"
FT                   /product="Ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40621"
FT                   /db_xref="GOA:D7GS45"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS45"
FT                   /protein_id="CBL40621.1"
FT                   /translation="MRGKALKNYGTVAALVIIIGIFGLLRPASFFTLKNFLNITRQSAP
FT                   LAMVALGATFVMTINEFDLSIGNIVSLGGVVAALLSIQGVPIPVCFLAAVVAGLIVGCV
FT                   NGVIVAKFGILSFITTLGMGTVLDGVIYGLTGGTTVFNGIPKAFTIPGILKIAGIPFIT
FT                   IVAAMLYIVFHMFMNHMSAGRKLYAIGGSKEASETAGIRIFRYRILAFALSAAMAGLAG
FT                   ALVASRVGSANTTAGQGYFLQSYAAVFIGCTVSKSGVPCVIGTLVGTIILAVLANGLTI
FT                   LQMPSFMQNIITGGIIILAVVLQKLGAGHGSR"
FT   CDS             868781..870286
FT                   /transl_table=11
FT                   /locus_tag="CK3_08560"
FT                   /product="Sugar (pentulose and hexulose) kinases"
FT                   /EC_number="2.7.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40622"
FT                   /db_xref="GOA:D7GS46"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS46"
FT                   /protein_id="CBL40622.1"
FT                   /translation="MLAATFDIGTTAVKAVVVNENGEPVFTGSSVIHTIETGNFKEQDP
FT                   DEWYGAFCSLSKEMLEIIPAAEIGAIIFSGQMQDVISVGTEGKALRNAILYSDGRADEQ
FT                   ARMIIREAASRNVVPLGDAYIAEITGNHFDGSMPLAKILWLKENEPEIYEKTACFLISS
FT                   KDYIIGRLTSVFAGDMTACSTAGAMDLDKKIWSEEFIGAAGINIRKFPKLFYAHECVGT
FT                   VTKTGAAESGYRTGTKVYAGTGDAGATTLASGILAPGEYNINLGTSGWVAAVSNQRMES
FT                   EGGGFNLAAMQKDLLINVVPFLNGGNVHQLIAKILSRNPDGAPDFGYISELLEKAEPGS
FT                   HGLFFLPYVAGERFPIMDSSVRGSFLGLSQETTAADMAESVLEGVAFSIRQGLELFDHP
FT                   ATKITLIGGGARERRWCRILSNVMGQKIFVYKDPDLLPALAIASAVFLAEGVIPDYKSF
FT                   IETLESQGHCDTVEPDPEVSEKYHRIYQKYKNIYPLVREFYSR"
FT   CDS             870484..871668
FT                   /transl_table=11
FT                   /locus_tag="CK3_08570"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40623"
FT                   /db_xref="GOA:D7GS47"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS47"
FT                   /protein_id="CBL40623.1"
FT                   /translation="MSKGRFGAHGGQYIPETLMNAVLELEEAYNHYKNDPEFQKELTIL
FT                   LNEYAGRPSRLYYAEHMTKDLGGAKIYLKREDLNHTGAHKINNVLGQVLLAKKMGKTRV
FT                   IAETGAGQHGVATATAAALFGMECEIYMGEEDTKRQALNVYKMRLLGAKVHAVTTGTGT
FT                   LKDAVSEAMREWTNRIEDTHYVLGSCMGPHPFPTIVRDFQAVISKEIKEQMLEKEGRLP
FT                   DAVLACVGGGSNAIGAFYNFIEDKDVQLIGCEAAGRGVNTAETAATIATGRLGIFHGMK
FT                   SYFCQDEYGQIAPVYSISAGLDYPGIGPEHANLYDTGRAQYVAITDDEAVDAFEYLSRI
FT                   EGIIPAIESAHAIAYAMKLAPTMGKDKIIVVNVSGRGDKDCAAIARYRGEDIHE"
FT   CDS             871661..872443
FT                   /transl_table=11
FT                   /locus_tag="CK3_08580"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40624"
FT                   /db_xref="GOA:D7GS48"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS48"
FT                   /protein_id="CBL40624.1"
FT                   /translation="MSKIANAFKGGNGKAFIPFITCGDPSLEVTEQLVYAMEEAGANLI
FT                   ELGIPFSDPTAEGPVIQAANIRALSGGVTTDKIFAMVEKIRKNTQIPMVFMTYANVVFS
FT                   YGTERFIKKASELGMDGLILPDVPYEEKEEFDSVCKKYDMDLISLIAPTSHERISMIAK
FT                   EASGFVYCVSSLGVTGTRSEITTDIGAMVKLVKKAKDIPCAVGFGISTPEQAKKMAGLS
FT                   DGAIVGSAIVKLCGTYGKDAVPYVKEYVKSMCDAVHGI"
FT   CDS             872800..873528
FT                   /transl_table=11
FT                   /locus_tag="CK3_08590"
FT                   /product="Uncharacterized membrane protein, possible Na+
FT                   channel or pump"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40625"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS49"
FT                   /protein_id="CBL40625.1"
FT                   /translation="MPVGIIINALSVASGGVVGALFGHKLPTRINSELTKIFGVCSMGM
FT                   GVSSIGLMKNMPAVIFAVIIGTAFGLAVNLGGIINSGAACMEKPVGKIFPNKNASMSRE
FT                   EYMTMLVTIIVLFCASGTGIYGSLDSGMSGDHTILISKSILDFFTAMIFGGTLGMVVAA
FT                   VAIPQCVIFLAIFAAAKFIFPLTTPDMIADFKACGGFLLLATGFRIAKIHNFPVADMIP
FT                   AMVLVMPVSWFWGNVVVPML"
FT   CDS             873781..874701
FT                   /transl_table=11
FT                   /locus_tag="CK3_08600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40626"
FT                   /db_xref="GOA:D7GS50"
FT                   /db_xref="InterPro:IPR007710"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS50"
FT                   /protein_id="CBL40626.1"
FT                   /translation="MTKSYMIKEMIMQLLSDGAGHSVSEMKDYLFEKGLEDYSEGQFAG
FT                   SVNNLLRNKKIEKVNRGTYKIAGENLTGEGRGSVMKKCFVVSPIGDAGTDIRKNADQLY
FT                   QHIIKPVCEKCGFAAQRVDEFNTSNSITQEILDALNDYDLVIADLTGHNPNVFFEIGYR
FT                   TKSQKPIIHLKRKDETIPFDVSSIRTFEYDLTDLDMVTATKDRLEQVIRNFKYDEYKES
FT                   KRGNNFENNMIVASLNDIQYKIDVLTEEIKKKENETIKTVIETFNAQKPEPESLETEMM
FT                   KILMPELIKNPNAADVLLRLSEKFK"
FT   CDS             complement(875743..876273)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08620"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40627"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS51"
FT                   /protein_id="CBL40627.1"
FT                   /translation="MHVISEKGNMNHKKDYPTAVKLLSWLPALCVAITIFWFSAQPAAE
FT                   SAEMSDTVSRLILILGTKLGFFHGDPAQYADLIELMSFPVRKAAHMTEYLVFYCTVRFG
FT                   LHFTYRTSNMKLRLLIALAIVFLYACTDEFHQLFVPGRAGRFTDVLIDCFGCAVVTLIC
FT                   LHFYQLDNKNSSS"
FT   gap             876581..876876
FT                   /estimated_length=296
FT   CDS             complement(878061..879083)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08650"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems, periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40628"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS52"
FT                   /protein_id="CBL40628.1"
FT                   /translation="MKKLITLGLAACMTFSLAGCSGSAGKETAAASAAETTAETSAEAE
FT                   TSAEATADAETSIDKLTVTYVTSPLNVPTIIEKDQGIFEKELGVPVEYAELTSGADQTQ
FT                   ALASGDVQVLYAVGATSVILSAANGADIKVLNMYSRSPKAFCMYSKDETLTTPESLKGK
FT                   TIAGPTGTNLHELLVSYLAQAGMTLDDVNYVNMTIPDAKAGLDGGSVDVALLAGATAYN
FT                   AEQQGYHLVADGDGLISALIAVATTQKFYDEHPDVIEKLNAAQDEIASYMADNQDAAIE
FT                   TVAAALDLDVDAVKEMYGFYDFSTEITDADKEGFQKTADFMYESGMIENELDVNTLFIQ
FT                   "
FT   CDS             complement(879324..880040)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08660"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40629"
FT                   /db_xref="GOA:D7GS53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS53"
FT                   /protein_id="CBL40629.1"
FT                   /translation="MAGIRLKDIHKTYQVDGRMFPVLNGVDLEIPEGKITVILGQSGCG
FT                   KTTLLRLTGGLESADSGEVLWGGAHKTAFVFQEPRLMPWLNVWNNIIFGLKKNQVDQEK
FT                   IQDIVSTVNLSGFEKAYPSQLSGGMQQRAAIARALAYEPTFILMDEPFAALDYFTREQM
FT                   QRELLRVQQKERSSIMFVTHSIDEALILGDQIVMIEKGLVKHVYPVKTPSGERNLLNEE
FT                   FIALKRDIIENLNFIN"
FT   CDS             complement(880027..880797)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08670"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40630"
FT                   /db_xref="GOA:D7GS54"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS54"
FT                   /protein_id="CBL40630.1"
FT                   /translation="MNQKFKKYFPPLIGILAVFAVWYIVCRAGILSSYVLPSPGRVFQS
FT                   FCKMLQSGELFRDLRISFLRVGKGFVIAFILAFAFGMLRAMIPASAGYYEYLVQFFKNV
FT                   PPLSMIPLLILWCGIGETTKTVIIVLASFFPMYLNIVKGFTGCDQKLLEVGTMFGYTER
FT                   QKFFRIMLPYAMADILVGMRIGLGYSWRAIIGAEMVAASTGLGHMILFAQQMPRTDKVI
FT                   VGIFAIGIAGYLTDRIFGLLISIFLKGAGENGWN"
FT   CDS             complement(881499..881810)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08690"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40631"
FT                   /db_xref="GOA:D7GS55"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS55"
FT                   /protein_id="CBL40631.1"
FT                   /translation="MFDVLQRITDLRLARNWSEYQLSVRSGLPQSTISSWYRKKMLPTI
FT                   PSLQRICDAFDLSLAQFFAVENCTELTDDQLSLIKQWELLTAEQKQAILNLIHSIIFQ"
FT   CDS             883093..883257
FT                   /transl_table=11
FT                   /locus_tag="CK3_08720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40632"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS56"
FT                   /protein_id="CBL40632.1"
FT                   /translation="MAMANAQKAVELSNKERLEFYRLIGEGFKDIQDGRTSTISEVREK
FT                   LEKAREKRG"
FT   CDS             883547..884902
FT                   /transl_table=11
FT                   /locus_tag="CK3_08740"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40633"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS57"
FT                   /protein_id="CBL40633.1"
FT                   /translation="MDIKRHVYQTLLKWKNDNCHTTLEVNGARQVGKTYIINKFADENF
FT                   SHKVYINLFELSGEQFISCYQKACNWRPGEGPRPQAPLHDAFRLFDENFSDTEDTVIII
FT                   DEIQESAEIYNRIREFTRQFRCRFIVTGSYLGRIYEPEFRYSSGDVTSIQIYTLSYEEF
FT                   LEAADTDLFEKYKLLGKKLDSVTGAELKSWYDIYCQIGGYPSVVREYLNSKSIERARSE
FT                   LIRIIDTFMNESIRYFTDVLDTQVFTDIFLSICRILGREKKGLEEDSISEELQKLVTRD
FT                   YSSNISKAVCNRAISWLRFCGVIGFCGKIIEMDILNFKPGCRCYFMDLGLASYYMARVG
FT                   AAQTEIAGMLSENFVYINLKKRQDFPEEIAFEMPAFATFKGGEVDFVVQGLKSSRRYAI
FT                   EVKTGKHIGNTAKKVLESGKADCLLYLKGDTLGGQEGKIETVPIYLLEKLNF"
FT   CDS             885140..885643
FT                   /transl_table=11
FT                   /locus_tag="CK3_08750"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40634"
FT                   /db_xref="GOA:D7GS58"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS58"
FT                   /protein_id="CBL40634.1"
FT                   /translation="MKNNATNSPVLTLVYGAAIAAIYVVLTMVFLPISFGPIQFRISEL
FT                   LCVLPYFTPAAIPGLFIGCLLANFLGGAAALDVIFGSIATLIGAVGSYLLRKNRYLVSV
FT                   PPILANMIIVPWVLRFAYGSEDMIWFSTITVGIGEILAIGILGQILLSVLIRYQHVIFG
FT                   KAAA"
FT   CDS             886087..887469
FT                   /transl_table=11
FT                   /locus_tag="CK3_08760"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40635"
FT                   /db_xref="GOA:D7GS59"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS59"
FT                   /protein_id="CBL40635.1"
FT                   /translation="MYQIDFNKPEHIHFIGIGGISMSGLAEILLERGFTVTGSDAHESE
FT                   LTDKLTVHGAKIVYGQRAENITDDIDAVVYTAAVHPDNPEYAAAAAKNLPILSRAELLG
FT                   QLMKNYEKSIAVSGTHGKTTTTSMLTEILMDEKKNPTISVGGMLDSIGGNIRVGGPELF
FT                   VTEACEYTNSFLSFFPNMEIILNIEADHLDFFKDIEDIRHSFRKFAELLPANGVLIINS
FT                   DIRDYKEICDGLPIKVITVGSDPAKSHYSAADVTFNENACATYTLLEDGKAIDTITLGV
FT                   PGIHNVYNSLASIAAAHELGIRGEGIRNGLLRFTGTHRRFEKKGMIGGVTVIDDYAHHP
FT                   QEIAATLAAAKNYPHREIWCVFQPHTYTRTKALMEDFAKALSAADHVVLADIYAARETD
FT                   NLGISSGTLAEKIAALGTDTHYFPSFDAIETFLLENCVNGDLLITMGAGDIVKVGEKLL
FT                   GQ"
FT   CDS             887717..887842
FT                   /transl_table=11
FT                   /locus_tag="CK3_08770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40636"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS60"
FT                   /protein_id="CBL40636.1"
FT                   /translation="MRRDNECAGKCGAARKTENVRRKWPMERTTDRAEGGYIRQI"
FT   CDS             889116..890114
FT                   /transl_table=11
FT                   /locus_tag="CK3_08790"
FT                   /product="replicative DNA helicase loader DnaI"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40637"
FT                   /db_xref="GOA:D7GS61"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS61"
FT                   /protein_id="CBL40637.1"
FT                   /translation="MALSNSQYDAIMRVYNQRQFQDKREQDKRIAEVYEKVPQVEALSD
FT                   EIAATMAQAARKILAGDRAAADQLKKDAEFLKEQKAIYLKQNGYPANYLELQYVCPDCK
FT                   DTGYADGKKCHCFKHMEIEILYDQSNIREVLERENFDTLSMAYYDRDHVDEKTGMTVYD
FT                   YMSKVIRECREYVEKFKNEKGSILFTGNTGCGKTFLSNCIARELIRRYFSVVYLTATDM
FT                   FDILAGSRFNGGDDDEAKDRASYILDCDLLIIDDLGTELINTFTASQMFYCVNERLNRN
FT                   KGTIISTNLTLGELQDAFTERVTSRIMSRYKIIPLIGDDIRLVRRGFMRRG"
FT   CDS             890326..891504
FT                   /transl_table=11
FT                   /locus_tag="CK3_08810"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40638"
FT                   /db_xref="GOA:D7GS62"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS62"
FT                   /protein_id="CBL40638.1"
FT                   /translation="MLYEEKQIETIPVGPLGLIPLKSCEDLGKKVDAWLVEWRKERESE
FT                   HKTTIAFAGYQRDSYIIGAKTPRFGSGEAKGELTESVRGDDLYIMVDVCNYNMTYTMNG
FT                   LKNHMSPDDHYQDLKRVIAAVGGKGRRINVIMPFLYESRQHKRTGRESLDCAMALRELV
FT                   DMGVENIITFDAHDPRVQNAIPLKGFETVQPIYQFIKYLLKNEKELEIDSDHMMVISPD
FT                   EGGMGRAVFFANVLGLDLGMFYKRRDYTKIINGRNPIVAHEFLGASVEGKDVIIVDDMI
FT                   SSGESMLDTAKELKRMKARKVFICTTFGLFTGGLKKFDEYYENGIIDRVLTTNLVYQTP
FT                   ELLSKPYYINVDMSKYIALIIDNLNHDASLSDLLNPTGRINRLLAKYRAGER"
FT   CDS             complement(891817..892479)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08820"
FT                   /product="AroM protein."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40639"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS63"
FT                   /protein_id="CBL40639.1"
FT                   /translation="MKKIGAITVGQSPRVDLIPEIQPILGDSVEIIQAGALDGLSKEEI
FT                   SKFVPRPGENVLVSRLTDGTSATFGESYILPRLQLCIDDLEQQGVSLILFLCTGEFPAE
FT                   FRSNVPLIFPDHILKGLIPAIGVKNLSVIIPTKEQEAQMPGKWKDCCDSLHVTSVSPYG
FT                   DPLAVFAAAKEIPADTDLILLDCIGYTIEMKERIQALTQKPVLLSRTLVARVIRELV"
FT   CDS             893245..893883
FT                   /transl_table=11
FT                   /locus_tag="CK3_08830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40640"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS64"
FT                   /protein_id="CBL40640.1"
FT                   /translation="MKKTYLYMTAVAMSAALAAGCQKAEPAETTAAAETVAEPTGTGMA
FT                   ESESSETSGTAAQDDERLADYHLLQGIVTGTNDEKGTFTLKADDGGEYVITTGNIGDVE
FT                   TEIADDSLVVIGYIGVEIHDNMDLEKVNMVIAAPGDDDWTITYAEGTTTANAMSTFMMV
FT                   TADGTEMGFMKDGCPMDEDALGGDSGAKIGVVYMDSEDVSFPLEIKKLQ"
FT   CDS             894060..894554
FT                   /transl_table=11
FT                   /locus_tag="CK3_08840"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40641"
FT                   /db_xref="GOA:D7GS65"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS65"
FT                   /protein_id="CBL40641.1"
FT                   /translation="MADLFHRVSIRKFKDEAVSNEDIGYILEAAMAAPSAKNQQPWEFY
FT                   VVENREVLKQLGESSPFSAPAGKAPVAIVTAYREECDLPEFAQIDMSIMMENLWLAADE
FT                   IGLGGVWLGVAPREERMKDVEKIVGIPAGQRAFGIFALGYPDEERTQQDRFDQSRIHYV
FT                   K"
FT   CDS             894610..894732
FT                   /transl_table=11
FT                   /locus_tag="CK3_08850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40642"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS66"
FT                   /protein_id="CBL40642.1"
FT                   /translation="MSVEKQNFICRAYSRVFVGLFLDWVSNGMKAKDLDCFSDA"
FT   CDS             complement(894943..895887)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08860"
FT                   /product="Zn-dependent dipeptidase, microsomal dipeptidase
FT                   homolog"
FT                   /EC_number="3.4.13.19"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40643"
FT                   /db_xref="GOA:D7GS67"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS67"
FT                   /protein_id="CBL40643.1"
FT                   /translation="MNPYALIDLHCDTLTDCIHKGLTPDTLDDPGRVLSLSSLPSDVHW
FT                   AQFYAIFIPDQHRGQAAIDYYETNRDNFNRQMEKFHDRISPCRSVSDMHAAWEAGKTAA
FT                   FLTIEGGAALAGDITRVKKLADDGVRCMTLTWNGENELGSGHTTTHGMTDFGRQAVREM
FT                   EDRGILVDVSHLNDTGYADLFETARRPFVATHSNARAICSHKRNLTDDMIREMVRRNCL
FT                   IGLNYCKSFITDGGIGDSPDDLYRHIEHFFSLGAYENIALGSDFDGAALPTYLNTPAKA
FT                   ADLYEYFLEKGMSKELAEGIMFRNAEEFFRKNL"
FT   CDS             complement(895950..896924)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08870"
FT                   /product="Penicillin V acylase and related amidases"
FT                   /EC_number="3.5.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40644"
FT                   /db_xref="GOA:D7GS68"
FT                   /db_xref="InterPro:IPR003199"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS68"
FT                   /protein_id="CBL40644.1"
FT                   /translation="MCTAATYKTKGFYFGRTLDYEFSYGEEITITPRNYPIPFRHMGTL
FT                   ASHYAIIGMAHVADNYPLYYDAMNEKGLGMAGLNFVGNAAYAEQVDGTQNVAQFEFIPW
FT                   ILSRCATIPEVREALSRMNLVGTPFSPQMPAASLHWIIADKNEAIVVESMADGLHVHDD
FT                   PAGVLTNNPPFDLQMFHLNNYLGLSPRQPENHFSPELPLATYSRGMGALGLPGDLSSQS
FT                   RFARVAFTRANSISGDSEEESVSQFFHILGSVDQQRGCCEVAEGKYEITIYTSCCSAET
FT                   GTYYYTTYENHQVTAVDMKKEALDSDALIRYPMILKGEIRRQN"
FT   CDS             897273..898133
FT                   /transl_table=11
FT                   /locus_tag="CK3_08880"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family (TC 3.A.1.3.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40645"
FT                   /db_xref="GOA:D7GS69"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS69"
FT                   /protein_id="CBL40645.1"
FT                   /translation="MKKRLLSAVMASAMVLSLAACGGAKTETTAAETTAEKKEETTTAG
FT                   TTAAETAEAAGGTLIVGFDQDFPPMGFVGDNGEYTGFDLDLAKEVASRLGLEYKAQPVA
FT                   WDSKDMELESGNIDCIWNGFTITGREDDYTWTTPYMANKQVFVVANDSDIKSQADLAGK
FT                   VVEVQADSSAEAALKENQDLANTFGQLLTTPDYNTAFMDLEQGAVDAVAMDVIVAGYQI
FT                   KQRNADFKILDDSLSEEEYGVGFKKGNTELRDKVQGALEEMAADGTLAKIADEWFGEDV
FT                   TTIGK"
FT   CDS             898382..898483
FT                   /transl_table=11
FT                   /locus_tag="CK3_08890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40646"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS70"
FT                   /protein_id="CBL40646.1"
FT                   /translation="MEYVSFADQNHAPSLTDVRLKYEGKQVKIVWVK"
FT   CDS             898471..899130
FT                   /transl_table=11
FT                   /locus_tag="CK3_08900"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family (TC 3.A.1.3.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40647"
FT                   /db_xref="GOA:D7GS71"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS71"
FT                   /protein_id="CBL40647.1"
FT                   /translation="MGKMTIGQMVAQLASGMLISTQIFVITLLFSLPLGLIVAFGRLSK
FT                   NRVISMIVKFYISIMRGTPLMLQLMVVYFGPYYLFHIKVGSGYRLTATFIGFVINYAAY
FT                   FAEIYRSGIQSMPIGQYEAAQILGYTKAQTFFKIILPQVIKRILPSITNEVITLVKDTS
FT                   LSFTLSVAEMFTIAKALAASQTNMIPFVAAGIFYYVFNLIVAVVMEWIEKKLDYYR"
FT   CDS             899150..899914
FT                   /transl_table=11
FT                   /locus_tag="CK3_08910"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family (TC 3.A.1.3.-)"
FT                   /EC_number="3.6.3.21"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40648"
FT                   /db_xref="GOA:D7GS72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS72"
FT                   /protein_id="CBL40648.1"
FT                   /translation="MNLLELNHVEKSFENLSVLKDISISIGEGEIVSIIGPSGSGKSTL
FT                   LRCATMLEKMDGGEIVYLGKKAAWTDKDGHVVYADKKDMKEIRSQYGLVFQNFNLFPHY
FT                   SVLKNIVDAPIHVQKRDKETVYQEARELLKKMGLADKEDYYPCQLSGGQCQRVAIARAL
FT                   ALNPKILFFDEPTSALDPELTAEVLKVIRSLADLNIAMVIVTHEMAFARDISHRVIFME
FT                   GGVIVEEGTPEKVFSSDNERMKSFLGRYGEIL"
FT   CDS             899917..900204
FT                   /transl_table=11
FT                   /locus_tag="CK3_08920"
FT                   /product="Sodium/hydrogen exchanger family."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40649"
FT                   /db_xref="GOA:D7GS73"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS73"
FT                   /protein_id="CBL40649.1"
FT                   /translation="MLTSLALIFLVGLSAAAICGRLRLPRIIGMLFTGIILGPHVLGLL
FT                   DDKILSISSELRQMALIIILLKKYRMWAIMSAKYAVSGRRFHQGRFISLS"
FT   CDS             900236..900748
FT                   /transl_table=11
FT                   /locus_tag="CK3_08930"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40650"
FT                   /db_xref="GOA:D7GS74"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS74"
FT                   /protein_id="CBL40650.1"
FT                   /translation="MDFEKLCAERYSLRKYADRPVEAEKLEKVLEAGHNAPTAHNLQPQ
FT                   RILVMQSREALEKAEECTACKFHAPVILVVAYDPAKAWNREGDMKNHGEIDATIAATQM
FT                   MLQAADLGLGTCYVGMFSQEKLHELFPEMKGLVATAMLPLGYPAETAHPSRLHTDRMPL
FT                   DEMVIRL"
FT   CDS             900951..902201
FT                   /transl_table=11
FT                   /locus_tag="CK3_08940"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40651"
FT                   /db_xref="GOA:D7GS75"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS75"
FT                   /protein_id="CBL40651.1"
FT                   /translation="MEYKVSEKIQKKFDTLTKDAKVQKALQFMEDDQNEIIDRQIELTL
FT                   IPAPTNHEQKKAARLLEMFKEEGLTDCHIDEYGNCIGIRKGTGGGKTVLVEGHMDTVFP
FT                   LDTKLEIVREDGFIKCPGIVDDTRGCATVLSTIRALNAAGIETKGDIQFVGTVQEEGTG
FT                   ALKGMQYYVNHHPELDASISVDGPGFQEITYEATGIQTYEINFHGIGGHACGAFAKVAN
FT                   PIHAAGRAIAKISEIQVPKEPMTTFAVTTMQAGSFEAVHAIVPVAQIRFNFRSNSQEEL
FT                   EKLRKKIFDAIDEACREETERWGMDTITYDVKHICDVNAGHQDAHAPIIEGAMAAAEYL
FT                   GCEEPKLGNGGSTNCNRALEAGLPAVCLGMGADYDIHAHMLSEQFKVEGAYKGCQQTLL
FT                   LALLCAGMDDVESIIEK"
FT   CDS             902618..903997
FT                   /transl_table=11
FT                   /locus_tag="CK3_08950"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40652"
FT                   /db_xref="GOA:D7GS76"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS76"
FT                   /protein_id="CBL40652.1"
FT                   /translation="MKKIRMLLPTGAVIGMLVVGTAFPAMAAADSDTAKFVRGTTINAV
FT                   DVSKQTAQQAKGYLEGYFNEHYEIKIQDADGNLEVLKGTDVGYHLNVTGSVDDILKEQN
FT                   DTGRKTGPGSDQSYTVTVEATLDDGKLAAALANLHCVTAATPTSNAYISAYEEGKPFTI
FT                   VPEVQGNELDMDKMKAAVKSALLSQKKQIRLADEDCYKKITVKSDDANLVQLCTTLNAY
FT                   KDIQITYVFGSSRETLDGLELAKWVTGTNGTEIQVDRDKAVAYVKSLADKYDTYGNHKY
FT                   KTTSGRDVVVYGKYGWKINQTAETDALVEAVKACQTTEREPIYESRGATHDGYDFGQTY
FT                   IEVDLATQHLYFYKDGKVIIDSPFVSGNVSKNYTTPPGLFELYYKQKDRVLKGEDYAAP
FT                   VKYWMPFNGGIGLHDADWRSKFGGTIYQTNGSHGCINLPPKVAAQVYENAYKGIPIICC
FT                   N"
FT   CDS             904152..905027
FT                   /transl_table=11
FT                   /locus_tag="CK3_08960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40653"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS77"
FT                   /protein_id="CBL40653.1"
FT                   /translation="MDKQQVLNQLRNAKEIYVIMSLCTKMPYVVCDKETFDDEVLLYFK
FT                   EEDIRREGKRLIEEKIPVQIAKVDANQMLHFYGNLYTMGVNCLMVDQYMESECRIQLPE
FT                   LVSRPGQNKPDAPEDEKKTWIENPSLHLTALYFMQELRRQKFEKMPDELKEMQEEILAD
FT                   FTRGTYITAFQEGAGVPLLKQKNGDAYQPIFTDIIEFGKFNSKNQFKAIAVTADKIPSI
FT                   LVKEAKGVVVNPFGVNLQMPITKRTVPNPEAAAHADAQAAVQATQVEVNATHERAGAEE
FT                   ESGAGNKAEN"
FT   CDS             907301..907933
FT                   /transl_table=11
FT                   /locus_tag="CK3_08980"
FT                   /product="Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40654"
FT                   /db_xref="GOA:D7GS78"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS78"
FT                   /protein_id="CBL40654.1"
FT                   /translation="MDSQILYRVQREDLPRLQKMLVECFARDPLYETLIPDAETRKRLM
FT                   PELFECDLNEFYETCEIFADSPELNGLLVVSDEAEEYDPVRFYLTEAWASLKTDEYLIK
FT                   EDKSLKTLWNFIRGRDYLNSHWTAQLHQENRLHIIYLAVSPNVQHHGVAEKLMDDAIHY
FT                   AEEHRMMISLETHNEKNVAFYAHFGFKVFGIVEKGMGLKQYCLVREI"
FT   CDS             complement(908079..909104)
FT                   /transl_table=11
FT                   /locus_tag="CK3_08990"
FT                   /product="Sugar kinases, ribokinase family"
FT                   /EC_number="2.7.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_08990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40655"
FT                   /db_xref="GOA:D7GS79"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS79"
FT                   /protein_id="CBL40655.1"
FT                   /translation="MSKRVITFGEIMLRLAPEGYYRFVQANNFGATYGGGEANVAVSLA
FT                   NYGFDAAFVTKLPKHEIGQAAVNELRRYGVDTSTITRGGDRVGIYFLEKGASQRPSKVI
FT                   YDRAHSAISEAAPEDFDWAKIFEGADWFHFTGITPALNDTVAAICLEACKKAKELGITV
FT                   SCDLNYRNKLWTKAKAGEVMGELCKYVDVCIANEEDASDVFGIKASNTDVTKGAVNHEG
FT                   YKDVAKQLADRFGFQKVAITLRESISANDNNWSAMLYDGKDYYFSKKYAMHIVDRVGGG
FT                   DSFGGGLIYACLSDMDAQSIIEFAVAASCLKHSIEGDMNMVSVDEVKKLAGGDGSGRVQ
FT                   R"
FT   CDS             complement(909264..910223)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09000"
FT                   /product="Entner-Doudoroff aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40656"
FT                   /db_xref="GOA:D7GS80"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS80"
FT                   /protein_id="CBL40656.1"
FT                   /translation="MNEVLEKIQKIGIVPVVVLDDAKDAAPLAKALCEGGLPCAEVTFR
FT                   TAAAEESIRIMAKEFPEMLVGAGTVLTTEQVDRAVNAGAKFIVSPGLNPTVVKYCVDKG
FT                   IPVTPGTSNPSDVEMAISLGLDVVKFFPAEQAGGINMIKAMAAPYTQMKFMPTGGINAK
FT                   NINSYLAFDKILACGGSWMVKKDLVAAGEFDKIRDLTKEAVQTMLGFELAHIGINCDSE
FT                   TEAEKTADAFDGLFGFTKKVGNSSVFAGTAVEAMKSKGLGSKGHIAVATNSVVRAKNYL
FT                   EMMGYKFNEESAKFKGDKMTAIYLADEIGGFAVHLVQK"
FT   CDS             910581..911510
FT                   /transl_table=11
FT                   /locus_tag="CK3_09010"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40657"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016732"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS81"
FT                   /protein_id="CBL40657.1"
FT                   /translation="MDIQFQKLGAENFAELSKYYGRRHDNTCDSVMLDNFLWADYYHVH
FT                   FCERDDKAVLWIMKILGKMYASLPVCAIEDMPHYFKEIEQYFNDNLHLPLEIYLADQEA
FT                   VDCLNLPADRYSVTELPDAKDYLYSAEALKTLAGKALHKKKNNLNAFKKAYEGRYEYRT
FT                   LCCSDGCEIWKFLDQWREGKGQEVEGHLDYEVEGIHEILRNCSMLSVRMGGIYVDDRLE
FT                   AFSIGSYNSKEKMAIIHIEKANPEMRGLYQMINQQFLIHEFPEAEIVNREDDMGLPGLR
FT                   QAKMSYAPMDFARKYRIKQLDFEAQSAE"
FT   CDS             911514..912539
FT                   /transl_table=11
FT                   /locus_tag="CK3_09020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40658"
FT                   /db_xref="GOA:D7GS82"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS82"
FT                   /protein_id="CBL40658.1"
FT                   /translation="MIRYLETEEKGRCLDLWREAFPEDSTEFCDYYFKEKMKDNKVLVR
FT                   EENGEIVSMLHRNPYRIYMRGSEAVCDYIVGVSTLVAGRHKGYMRSLMLAMLRDMQEER
FT                   MPFTFLMPARESLYRPYDFRYIYDQPRWVLKYNPHIHREPCNLKTLGADLAEWQTAWLK
FT                   RKYEVFAIRDEAYLQRMEKELASENGTCTLLYDDDWFIGMQSEWGLKEREMRYLYTGEH
FT                   YRSEAGRKPAIMARIVCMPEFVKTIRLAENCPQDEVTVEIGINDLFVPQNQGAWLWQLT
FT                   KEGSRMIQESRFIAKGKMEVLTISELTEWLFGYRTPAQVAKIPYGEYIEPFRGVFLDEV
FT                   V"
FT   CDS             912682..913404
FT                   /transl_table=11
FT                   /locus_tag="CK3_09030"
FT                   /product="NAD-dependent protein deacetylases, SIR2 family"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40659"
FT                   /db_xref="GOA:D7GS83"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS83"
FT                   /protein_id="CBL40659.1"
FT                   /translation="MTERETLKKWLDESSNIVFFGGAGVSTESHIPDFRSTDGLYNQQY
FT                   DYPPETILSHSFYMRKPEEFYRFYRNKMLFPNAEPNRAHKALAKLEKMGKLKAVVTQNI
FT                   DGLHQKAGSREVLELHGSVLRNYCTRCGKFYGLDAILNSTGVPKCTCGGTIKPDVVLYE
FT                   EGLDQETIEKSVKYIANADVLIIGGTSLTVYPAAGLIDYYRGHKLVLINKSVTPMDNRA
FT                   DLVISGPIGEVLGDAVGV"
FT   CDS             913524..914513
FT                   /transl_table=11
FT                   /locus_tag="CK3_09040"
FT                   /product="Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40660"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS84"
FT                   /protein_id="CBL40660.1"
FT                   /translation="MYQAAENRYETMEYKRCGRSGLKLPRVALGLWQNFGLEKTITDQE
FT                   EILCHAFDRGITHFDLANNYGHPANGLAEKNFGQALKDCLGTYRDELVISTKAGYDMWP
FT                   GPYGNWGSRKYLMASLDQSLKRLGLDYVDIFYHHRPDPETPIEETMGALSDIVRSGKAL
FT                   YVGLSNYKEEETRKAVKILKENGTPCLIHQPRYNMLERWVEDGLLSALDENGVGCICFS
FT                   PLAQGALTDKYLKGIPAGSRASREGTTVAQRYLSDEQLEKIKQLNQLAEERGQTLAQMA
FT                   IAWILRRPEVTTVLVGASRVSQLDDSLAALECTGFSEDELKKIDEILA"
FT   CDS             914623..914820
FT                   /transl_table=11
FT                   /locus_tag="CK3_09050"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40661"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS85"
FT                   /protein_id="CBL40661.1"
FT                   /translation="MVYEVGDIVKLKKPHPCGSQEWEILRVGADFRLKCMGCGHMVMVT
FT                   RRLVEKNTRGLRKPDGTEVK"
FT   CDS             complement(914915..915418)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09060"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40662"
FT                   /db_xref="GOA:D7GS86"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS86"
FT                   /protein_id="CBL40662.1"
FT                   /translation="MTPEHPIILCGFTSSGKTTIGKLLSEQLGLPFYDTDQMLIEHYKM
FT                   TIPGIFAKGGESLFRDYEHEIAHQVCGLGPSVVSTGGGMLTFDRNGEILEKSGTIFYID
FT                   RPFEDCYRNLALHPERPLFKNHTKEEIENTYLTRRGLYKKYAKYDIPNTKGPQDAVEKI
FT                   CALL"
FT   CDS             complement(915644..916549)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09070"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40663"
FT                   /db_xref="GOA:D7GS87"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS87"
FT                   /protein_id="CBL40663.1"
FT                   /translation="MNTNQLRYFVTAAECRSFTKAADQFYITQTAITQQIRALEDSLGV
FT                   PLFDRSSRPISLTPAGSAFLSDARSILGRIDQAVNRIQEVSTGMVGTLRIGYTKGFERS
FT                   NFSNSLRFFHNKYPNILVSCYRRNTDLLAAGLLKDEYDIIFTWDSTELVKNESIEYRLI
FT                   ERSPLMVAVYSNHPLSRRESLQRSELHGERLLFMTPSSTGDSVSDLRFYEMYEQAGYHP
FT                   DIFFRSNDVESILMMVSIEEGISIIPSYVTHKLTNAENLVFIPLIGEEEVVEIIAAWKR
FT                   SSGNLALQQFLGHYPLLKSE"
FT   CDS             916835..918202
FT                   /transl_table=11
FT                   /locus_tag="CK3_09080"
FT                   /product="Na+-dependent transporters of the SNF family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40664"
FT                   /db_xref="GOA:D7GS88"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS88"
FT                   /protein_id="CBL40664.1"
FT                   /translation="MLMKRENFGSRLGFLLVSAGCAIGIGNVWRFPYVAGQNGGGVFVL
FT                   FYLLFLLCMGVPVLTMELAVGRAGRKSAVGAYRALEKPGSKWHVHGWFCILGCYLLMMY
FT                   YTTVSGWMLSYFVKFATGTFTGMNADQVAGVFGDMLGNPGEMGFWMAVTVVVGFFICSR
FT                   GLQNGLEKITKWMMAALLLLILVLAGHSLILPGAKEGLSFYLLPDFKRASEVGLGSVIM
FT                   AAMNQSFFTLSLGIAAMEIFGSYMSEEHTLAGEAVRICGLDTLVALSAGLIIFPACFSF
FT                   GVQPDAGPQLIFITLPNVFANMAGGRIWGMLFFLFMSAASFSTVIAVFENLLSSCMDNF
FT                   GWSRRKASVINCIFVLIASLPCVLGYNVWSNLHIIGARDVLDSEDFLVSNLLLPLGSLV
FT                   YLLFCVSKWGWGYDKYLAEANNGAGLKMPGANWAKIYFRYVLPVLILVILIQGLIG"
FT   CDS             918407..919537
FT                   /transl_table=11
FT                   /locus_tag="CK3_09090"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40665"
FT                   /db_xref="GOA:D7GS89"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS89"
FT                   /protein_id="CBL40665.1"
FT                   /translation="MKKMIALGMAAIMCLSMTACSVSTSSKTETTAAATEAAETTAEAA
FT                   KDSETTAEAAGDLVATADYPTKPITMIIPYGAGGTTDTWGRKLAVLLEKYLGQPITVTN
FT                   QGGASGSIGSQFVKEQPSDGYTLLVCAETMGTYRTMNICDLGYDDFTVISPLVGDPKVL
FT                   VVGKDSKYNTLQELLDAIKENPGKITMSHSGPGGSGHNQGLVLKELGYEVAMTSFDSGN
FT                   DALLGVIGGQVDFTNPNISTLGGYIESGDVKPLAVFSDKRMDAYPDIPAFTETVPEAEK
FT                   YLNIPYTLLSFAVNNDTPQEVVDVLKAASEKVFADPEWTDFVKQNAADPVYDEYKDDAS
FT                   IQAFYDNWKSVICWLQYDNGVAEKSPEEFGIKRIGE"
FT   CDS             919541..920068
FT                   /transl_table=11
FT                   /locus_tag="CK3_09100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40666"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS90"
FT                   /protein_id="CBL40666.1"
FT                   /translation="MKNKIHSLIVEGIVFCGSGLVLLSYSLSSYAKGFNKSWAQSPYLF
FT                   PLIVAIAMIGLSLWIVGEGVTAMKKAAANPDDKKPEKAGKTEKRRWVVIALILCAIYYA
FT                   ALAFIKIPYITIGILSFAYTFSTFEVVTVVFLIAMMIFMGVRKIPVLVFVPIGTTLFLS
FT                   LAFRTFLHVLLP"
FT   CDS             920084..921586
FT                   /transl_table=11
FT                   /locus_tag="CK3_09110"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40667"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS91"
FT                   /protein_id="CBL40667.1"
FT                   /translation="MMQMLSVVDPRFILMVLLGSVAGLFVGAIPGLSVSMATALLVSIT
FT                   YTWEHSDALAMIMGVYVVGVFSGAVSAILINIPGAPSSVVTTLDGYPMSKKGQSYKALF
FT                   TATIYSFIGSLFGLLALGLLAESVSRVAIKFTKMDYFLLALFGLATVGSVSTKNYAKGL
FT                   ISVMIGLVISMIGLDPLMGTKRLTFGIQNLAGGVSTVPALVGFFGFAEVLSVVYNMKQE
FT                   QNVLAMEKTKVSLKEILKSWKLSLYTSTIGLLVGALPGAGGPVASFIAYNEAKRLVKKP
FT                   EVPFGEGAVEGIVASESSNNACIGGALIPMLTLAVPGDAVTAIILSVFYVHGLQPGPLF
FT                   ITQNKESFYSIVVAGIIACFALLLLGLIVAPRICKVITIPKNIMIPVVTSLCVIGSFAC
FT                   NNRLFDVGLMFFFGLMGFMMRRFDYPVAPLILAMVLGKMMDSNFRQAVSLASSSDNPFM
FT                   AMFGHPITIVLSICTLFVLLGNIPWTKPYIDKVKGIFSRKTA"
FT   CDS             921827..922114
FT                   /transl_table=11
FT                   /locus_tag="CK3_09120"
FT                   /product="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40668"
FT                   /db_xref="GOA:D7GS92"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS92"
FT                   /protein_id="CBL40668.1"
FT                   /translation="MNKYELAVVLSAKLEDDERAAALEKVKGYITRFGGNIVDVDEWGK
FT                   KRLAYEIQKSKEGFYYFIHFEGEANCPNEVEAHIRIMEPVVRYLCVRQDA"
FT   CDS             922133..922678
FT                   /transl_table=11
FT                   /locus_tag="CK3_09130"
FT                   /product="single stranded DNA-binding protein (ssb)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40670"
FT                   /db_xref="GOA:D7GS93"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS93"
FT                   /protein_id="CBL40670.1"
FT                   /translation="MNRVILMGRLTRDPEVRYSQGERSMAIARYTLAVDRRGRRSQDGD
FT                   QGQTADFINIVAFDRAGEFAEKYFRQGMRVLVSGRIQTGSYVNKDGQKVYTTDIIVDDQ
FT                   EFADSKGQGGDNSGFGGGNSYGGGKPRRLSAGDKTCSVQCHRRWIYEYPGWSRGRRTSI
FT                   QLNTSLRQYSALLLIRCE"
FT   CDS             922750..923016
FT                   /transl_table=11
FT                   /locus_tag="CK3_09140"
FT                   /product="SSU ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40671"
FT                   /db_xref="GOA:D7GS94"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS94"
FT                   /protein_id="CBL40671.1"
FT                   /translation="MAFNKGDKSDSSRVRRGGMHRRKKVCVFCGDKNGEIDYKDVNKLK
FT                   RYVSERGKILPRRITGNCAKHQRALTVAIKRARHIALMPYTCE"
FT   CDS             923538..928541
FT                   /transl_table=11
FT                   /locus_tag="CK3_09150"
FT                   /product="Putative cell wall binding repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40672"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS95"
FT                   /protein_id="CBL40672.1"
FT                   /translation="MKKQYLAWGLAISLSIGTIFGNSGVSWAFENTNQDKTANVEKEES
FT                   SLWDELGLLTPSNAIELMTSSNAATENTTNKPTETTGLKKQFTTEDGIIVEIDSQDVIL
FT                   PENTQIQVKKVDLGSEITDSVRSSMQENQKELEQIYAYDISFWNDGEEFEPSDGVKVTF
FT                   KLPDTMTGEQVDESEIFHVKDGEDVAEFVPKTVEGDQEISCQSVGFSVYGIAVAQAEEW
FT                   IPIYTAGDLQNIQNDLAGNYKLMNDIDMSDFSWKPIGEDTKQKLRGFTGTLDGQNFSIS
FT                   NLSLKAGKSYRDSNLNIGYGIFTELLGTVKNLKITDSVFEVDDDHISNNAISSIDVGIL
FT                   AASLTGGSVENCVAQNCEIDLRTTLEIPAMNVGTFAGKTSGTSFIKNCKADNSTIKGST
FT                   YSRLTLGGIAGSAYEISDSIFAGSVNVVSSGNFSSASYVGGISGITRNQMKNCVNSGNI
FT                   TATASSQIIAGGITGRASGMALPVSMCVNYEAVYTDSRLDRGVAGGIVGELYSSFVENC
FT                   YNAGNVKVVTGYAGGIIGYDNQTTRSISRCYNIGSVETESNDKKSYAGDIIGYTQNGVS
FT                   AVTGTDGKVALLLRAVDKKCYYINTAVGNKNERMDNVVKVTLSEMEEQSTFEEFDFDNV
FT                   WVMGEETYPYPVLQFQNDVPQQPDNPDIPDSDEQLGWVKFKNGKVGYYILENNQCQLLK
FT                   SGIYKLNYTDQNGVIFNGRWKFNENGYVMTGMHDGLYYCEDEDGLYPYGMCIPDKGLDG
FT                   ILKEEYNQSHIRPSTVLSRYSFISTYMDDMNYFSYILSAKIDDGWMKLTGDAFLRLAKQ
FT                   LGFIDIDDINVEYLMTESNNRKILAKVLDVKFAVEGEKIDDSIELWTDPKVVAKAWDEV
FT                   KDERGYIKFIIEKVSDALKNEEKYSDSFNELAKEVKKKESNGEDAEEILGIVAAKNYEL
FT                   FDTIMEQVNGWSDALRDHSEKISYLNELEASIDKIDSGKIKNIQNLKNAVSELRNNYEE
FT                   RIKLQVFDTCFAVIEQGNSWNEVLTGEKRPLTGWDFKENTKYNMSKVVADVIKDLGEGS
FT                   LPLLKGLSKAITTIQTIDGRPEAVNTIAQTQMLYTVAYDVLREKEEKLLIDGDSESLAD
FT                   YLNAFEFMRCITILRYQNMKKVYDSIYSRDGLKQFKVDFLQKEIDKLQRITPLNYFEDE
FT                   FASLTFAGSWDESGEKYYYATDGDERFYIENRWAYIDGKRYYFDQNGRVLVGTQKITDE
FT                   TGEGEYYFSTGDGSEHNKDHRGAMQTGPIEINGKEYYYDSNSGVNRGRKVINSRIEIGP
FT                   KDYRYYGPDGAYDREKSGFSEVTDTDPNHKFYDKGGIRYATNCPVDIIIYDENDNMVGK
FT                   IVNDQVQNVTDDEIDVYVDSAGQKIVGVPQSGKYKLEIIARAAGTMDYSVAEFASDGSG
FT                   LIGKTDYRAVTLNQADHFYGITESMFYNGEEHNSYRLLKENTEIELAEYQDTLTSYLIN
FT                   ASAEGHGTVEGSKAAIRGDFAKLTAKPDSGYRFVGWYDKDGNCVSKELEFRFRVLEEQN
FT                   FTAKFTVRGASDSGSDSSDDSDDTSYIPKRGVTGKWIKNEKGWWYQRIDGTWPHDEWCE
FT                   LEYLGRKEWYYFDKNGYVVTGWLKWNGCYFYLNPISDGWFGRMETGWKKIDGKWYYLEP
FT                   VSGQNKGHLFVNTVTPDGYKVDSNGAWMK"
FT   CDS             929353..930528
FT                   /transl_table=11
FT                   /locus_tag="CK3_09160"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40673"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS96"
FT                   /protein_id="CBL40673.1"
FT                   /translation="MIHDGFIYLATLMLLAAILVNLPVYLRGKGAQTFFKFAPPIVLIY
FT                   LGMMLLCTMKVWDLQDTSAIYVSIKNPLLYAMLFLMLLRCDLKKIIKLGPKMLIGFFSA
FT                   SISIGVGFVVSYGIFHKLLGPESWKALAALCGSWLGGGSNMLAIQAILDVSEESLAYSL
FT                   VMDSVCAVIYVMFLLWVINFSKEFNSWTKADVRLIDEVGASLEKEAREDKRPLTWKNML
FT                   LLIGVSFFISSLSKDAGVMVASVLPVFDKATWTVLLVTAVGLIVAMTPFGKIKGTEEVS
FT                   NIMLYIVIAMIASRADISAMGNAPVWLAAGFLILLIHIAVMVILAKLIRLDIFTCAVAS
FT                   LANVGGTATAPVLAGAYSSALVPIGILMALLGNIIGTPGGAFVGYLMSLIG"
FT   CDS             930956..932296
FT                   /transl_table=11
FT                   /locus_tag="CK3_09170"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40674"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS97"
FT                   /protein_id="CBL40674.1"
FT                   /translation="MERFILKKLLAWKNSPYRKPLIMKGVRQVGKTWILKEFGRRCYEN
FT                   TAYFNFDENEEYKQFFETTKDVERILQNLMMASGQKIVPEKTLIIFDEVQDCPKVINSM
FT                   KYFCENAPQYHVACAGSLLGIALAKPSSFPVGKVNFMQIDPMTFNEFLLANGDENLAQY
FT                   LEQVDTLEPIPDAFFNPLYEKLKMYYVTGGMPEPVLMWTEARDVSAMQEALSGIIGAYE
FT                   RDFAKHPDLSEFPKISMIWKSIPSQLARENKKFIYKVVKEGARAREYEDALQWLVDARL
FT                   VHKIYRSSAPGLPIAAYDDLSAFKIYLVDVGLLRRLAQLAPTAFGEGNRLFTEFKGALT
FT                   ENFVLQTLITQLEVMPRYWSQNNPPYEVDFLIQRENDIFPVEVKSEANTTSKSMKKFKE
FT                   LFPDKVKLRIRFSLDNLKLDDDVLNIPLFMADQADRLIGLALEQLQK"
FT   CDS             complement(932440..933252)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09180"
FT                   /product="Metal-dependent hydrolases of the beta-lactamase
FT                   superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40675"
FT                   /db_xref="GOA:D7GS98"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS98"
FT                   /protein_id="CBL40675.1"
FT                   /translation="MKATVLSDNIPAENLGCEWGLSIFIEYHGKHILLDAGASGLFLKN
FT                   ADVLGLNMKDVDFGVLSHAHYDHADGIPEFFRVNSFAPFYFRETTGENCCKGVWNYKKY
FT                   IGIPKGMLKKYPDRIKLVSGDFSPCDGVYLIPHKTPGLEKKGIREHMYLKEKRRWKPDF
FT                   FSHEQSLVFDTPDGLVIFNSCSHGGADTIIREVTATFPDKKVKALIGGFHLYNKTDAEI
FT                   LALAEGIRSTGISSVYTGHCTGDHAFDLLKETLGESVHKLHAGLVMEF"
FT   CDS             complement(933313..933414)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40676"
FT                   /db_xref="UniProtKB/TrEMBL:D7GS99"
FT                   /protein_id="CBL40676.1"
FT                   /translation="MRKKIDKKEIAKEICKAAKLYKTSFLQEVRICV"
FT   CDS             complement(933837..933941)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40677"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSA0"
FT                   /protein_id="CBL40677.1"
FT                   /translation="MEILGIVLAILSFGATCFKAGYSLGRDIEKNAKK"
FT   CDS             934392..936431
FT                   /transl_table=11
FT                   /locus_tag="CK3_09210"
FT                   /product="Predicted signaling protein consisting of a
FT                   modified GGDEF domain and a DHH domain"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40678"
FT                   /db_xref="GOA:D7GSA1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSA1"
FT                   /protein_id="CBL40678.1"
FT                   /translation="MKDDKKVSHILQLYLQWPVFLTALVILAGAAVNLISRKAGFVMLA
FT                   FTVIYAACAGTLYMYGKKRALGSLVSFASAYSWSQKQLLASLELPYAIADTDGKILWMN
FT                   RAFEAVTKEEKSAGKSLTMLFKEITVESLEKMENAMEVHVIYGESKYRVSMKRVTIRPD
FT                   ELASGIPEKQTEQQILAVYLYDETELYNYKQAITDQKMVAGLIYLDNYDEALESVEEVR
FT                   RSLLTALIDRKINKYISAVNGIVKKLEKDKYFFAIKQCYMPRLEKERFGLLEEVKTVNI
FT                   GNEMAVTLSIGIGMNGDTYSQNYDYARTAIDMALGRGGDQAVVKCGQKIQYYGGKAQQL
FT                   EKTTRVKARVKAHALRELLETKDCLLIMGHKIGDIDCFGAAIGMYRIASALNKKAHIVI
FT                   NEVTSSVRPMMERFETGDYPKDLFLTGSEAADIVDNNTALVVVDVNRPSITEEPDLLKL
FT                   VKTIVVIDHHRQSSEIITNATLSYVEPYASSACELVAEILQYVADSIRIKSPEADAMYA
FT                   GIVIDTNNFTNQAGVRTFEAAAFLRRNGADVTRVRKLFRDSMEDYKARAEAVRQAEVYK
FT                   KCFAISVCPSEGVESPTVVGAQAANELLDIVGMKASVVLTPYEGKIYISARSIDEVNVQ
FT                   VMMEKLGGGGHRTIAGAQLPGATVEEAKEKVKGVIDMMLEKGEI"
FT   CDS             936433..936879
FT                   /transl_table=11
FT                   /locus_tag="CK3_09220"
FT                   /product="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40679"
FT                   /db_xref="GOA:D7GSA2"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSA2"
FT                   /protein_id="CBL40679.1"
FT                   /translation="MEVVLLEDVKALGKKGQVVKVNDGYARNFILPKKLGVEATSKNLN
FT                   DLKLQKANAEKVAAEQLAEAKKLAEEIDKMSVTVSIKAGEGGRAFGSVSTKEIAKAAKD
FT                   QLKLDIDKKKMVLPEPIKSIGSFEVPIKLHKEVTARLSVKVVEA"
FT   CDS             937053..938393
FT                   /transl_table=11
FT                   /locus_tag="CK3_09230"
FT                   /product="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40681"
FT                   /db_xref="GOA:D7GSA3"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSA3"
FT                   /protein_id="CBL40681.1"
FT                   /translation="MEEALVKRVLPHSVEAEQSVIGSMLMDRDAIIAASEIVVADDFYQ
FT                   RQYGIMFDTMVELFNEGKPVDLVTLQDRLKEKDVPPEVCSLDFVRDILATVPTSANVRS
FT                   YATIVHEKAVLRRLIKINEEIANNCYSGKDSLEVILADTEKQIFNLLESRASGDFVPIR
FT                   QVALNVLDKIEQATRSKSTVTGLPTGFIDLDYRMSGLQPSDLILIAARPSMGKTAFVLN
FT                   ITDYIAVRRQKTCLIFSLEMSKEQLVNRMLSMESNVDSQKLRTGTLTDADWDAVVEGIG
FT                   TIGSSKLVIDDTPGISIMELRSKCRKVKLEHGLDLVMIDYLQLMSGSGKNGDNRQQEIS
FT                   EISRSLKAIARELSVPVIALSQLSRACETRTDHRPMLSDLRESGAIEQDADVVMFLYRD
FT                   DYYNKDTDNPNTAEVIIAKQRNGPIGTVYLGWKPELTRFVNIAKEQQ"
FT   CDS             938394..938501
FT                   /transl_table=11
FT                   /locus_tag="CK3_09240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40682"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSA4"
FT                   /protein_id="CBL40682.1"
FT                   /translation="MHGQAPAFEWNLKEFHRKRAFLSYWDMASHILLAI"
FT   CDS             938635..939294
FT                   /transl_table=11
FT                   /locus_tag="CK3_09250"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40683"
FT                   /db_xref="GOA:D7GSA5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSA5"
FT                   /protein_id="CBL40683.1"
FT                   /translation="MSETHYLISDASKKVDVESHVLRYWEEELEMNIPRNEMGHRYYTD
FT                   FHIRLFKQIKELKEKGYQLKAIKTALAKTLDAEGESVAPTDVLEEDVMTALKECTEQEK
FT                   RDLEKLDPGEAAELMNREKAEQFREFLTQMIGQAIEENNEKLSQDISRMVNDKVLKEID
FT                   YLMRVADERDEERFRQLDETIRLYQKENKGRGGSCGGESAVFAVDLQKEKVWEKWE"
FT   CDS             939285..939386
FT                   /transl_table=11
FT                   /locus_tag="CK3_09260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40685"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSA6"
FT                   /protein_id="CBL40685.1"
FT                   /translation="MGISFDESNNENSFREDPDSGSESTEIKKPLFE"
FT   CDS             940170..940376
FT                   /transl_table=11
FT                   /locus_tag="CK3_09270"
FT                   /product="Domain of unknown function (DUF1858)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40686"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR023883"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSA7"
FT                   /protein_id="CBL40686.1"
FT                   /translation="MQISKEMLIGELLQVDENMAQILMGAGMHCIGCPSSQMESLEEAC
FT                   MVHGIPVEKLVSVINEYLAQKQQ"
FT   CDS             complement(940650..941414)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09280"
FT                   /product="Negative regulator of genetic competence,
FT                   sporulation and motility"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40687"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSA8"
FT                   /protein_id="CBL40687.1"
FT                   /translation="MKIERINENQIRCTLSNFDLSVRNMNLGELAYGSEKARNLFREMI
FT                   QRAANEVGFEAEDIPLMVEAIPMANESVMLIITKMEDPEELDTRFSKFSPEEDENDNGW
FT                   GNLTAEVLEGADGLINILTQSGILKPEGEKAPAAPAATANGPQGKEELKNPAQFTRIYQ
FT                   FSTLDLVCEAARQTGAVFKGNSVLYKNPENGVFYLILKKENDSESSFNRVCNTLSEYGT
FT                   RLKGDAAASGAYYAEHYDVIVKKDALKVLQNL"
FT   CDS             942991..943593
FT                   /transl_table=11
FT                   /locus_tag="CK3_09300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40688"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSA9"
FT                   /protein_id="CBL40688.1"
FT                   /translation="MEKKKIITETQEKRCRMIGIAGSNTGVGCTHFSIMLTNYLAGYLR
FT                   RKAILLEFNESGDLEKLEYVCTGQMGQKNPYRVLDADYYKYAGPEAVKEVLQRGYDDIL
FT                   IDFGSVKDGANELYWRCDKKFLVGSFTEWQQEGFREFEMEQRAKQKKSWQSLAVFGSEE
FT                   TRREFSRRFRINTERIPFSADAFSVTKECGGFFQRIL"
FT   CDS             943865..944170
FT                   /transl_table=11
FT                   /locus_tag="CK3_09310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40689"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSB0"
FT                   /protein_id="CBL40689.1"
FT                   /translation="MGMETANGTYDSENRSVEEMTRYLNGLKRYTEKGIPIYMDGKLSG
FT                   QREWEKLFEVREDGMFYMGDYVQAEGGGLKEIRFDKVYLSEADIMETKGRRRRTRK"
FT   CDS             944471..944521
FT                   /transl_table=11
FT                   /locus_tag="CK3_09320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40690"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSB1"
FT                   /protein_id="CBL40690.1"
FT                   /translation="MNAEFWEPACGKSDNE"
FT   CDS             944518..946167
FT                   /transl_table=11
FT                   /locus_tag="CK3_09330"
FT                   /product="Predicted glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40691"
FT                   /db_xref="GOA:D7GSB2"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSB2"
FT                   /protein_id="CBL40691.1"
FT                   /translation="MRKVVPVLVAVGLIILIAVGFVGFQVLDRYMPTKERADLAEVYDV
FT                   SGDETAILYNYERQEQTGIYENGQTYLPVSWVNDHINERFYWDSTEDLLVYALPDQIVY
FT                   ADAETKGANGAPLLLVKDDEVYLTLGLIANYTDVQIQTFDFGDGRRVLINDWGTRNIAR
FT                   VKKAGSLRVKGGVKSKILTDFAKDDTVTVLDTMEKWSKVASSDGNIGYVENKRLAAAES
FT                   QKFSGNFTAPVYKNTSMSGKIVLGWHQVTSQDGNNTFDSIVAKTKGMNVISPTWFSLTD
FT                   NNGNYRSLANKDYVAKAHAKGLQVWALIDNFSADVQTETLLASTSTRRKLIDSLIMDAE
FT                   KYDLDGLNLDFESLKTEAGVHYIEFIRELSIPCRQKGIVLSVDNYVPARYNSFYNLKEQ
FT                   GIVADYVIMMGYDEHFAGGEPGSVSSISYVKNGISGMLEDVPKEKLINAVPFYTRLWIE
FT                   AGDGSITSKAMGIADAKKWVDNNQVELTWQADTAQYYGEKQTNDGAQFLWMEEERSLKE
FT                   KMNVVRQNDLAGVACWKLGFEDSAAWDSIQWN"
FT   CDS             complement(946195..947055)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09340"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40692"
FT                   /db_xref="GOA:D7GSB3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSB3"
FT                   /protein_id="CBL40692.1"
FT                   /translation="MKELPKDQENLAESFRLYLRKKNMSGNTGDAYGRAIRQLLSLYPV
FT                   PTESLLRKYRSLLIANYRPATINQRIYAVNHFLLFLEEEQPELSPDLSGFRLRSVKIPR
FT                   DTFQDSIITNEDCETLQRNLKAEHHDFWYFIVRFLVTTGVRVSELVQIKAEHLACGYLD
FT                   LYSKGGKIRRIYIPDSLCQEAKAWCDRRGITSGFLFVGKNGRPVTTRGIHSQLKHYAVR
FT                   YGIDPDTMYPHSFRHRFAKNFLALSSDISLLADLLGHESIETTRIYLTRSSKEQKLLLD
FT                   KMVTW"
FT   CDS             complement(947093..947947)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09350"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40693"
FT                   /db_xref="GOA:D7GSB4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSB4"
FT                   /protein_id="CBL40693.1"
FT                   /translation="MRKTALPTDRLSETARQKLSRFEAWLLRNGKSYQTIRSYLYTARH
FT                   FLSLYPEVSHDNLMLYKCCLIDHYKPSTVNLRIRAMNCFMEFLDLPASRVLMVRLQQKP
FT                   FLENVISQADYEYLKKCLLRDGKLTYYFAVRIMATTGVRISELLQIRVEDMIRGQMDLY
FT                   SKGDKIRRVYFPQNVQETCLLWLQNEKRTSGSLFLNRFGNPITTNGIRDQLKFFSLRYN
FT                   LDPSVVHPHAFRHLFAKNFIEKCDDIALLSDILGHESIETTRIYLHKSSTEQQNLFNQI
FT                   VNW"
FT   CDS             complement(947944..948075)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40694"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSB5"
FT                   /protein_id="CBL40694.1"
FT                   /translation="MSPTDFLLFLLPFPINNVFSSFLLLFLFPAIKYFQKQKGMIIL"
FT   gap             948676..948883
FT                   /estimated_length=208
FT   CDS             complement(949837..950889)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09390"
FT                   /product="Threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40695"
FT                   /db_xref="GOA:D7GSB6"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSB6"
FT                   /protein_id="CBL40695.1"
FT                   /translation="MANEKLKFVCDYMEGAHPAIMNELLSTNMMQTSGYGLDEFSESAR
FT                   DKIRKACGAPNAEVYLLVGGTQTNATVIDALLRSYQGVLCAETGHIAVHEAGAIEFGGH
FT                   KVLPLPHTYGKINAAQISAYMDTFLSDESHEHMVMPGMVYISQPTEYGTLYSLEELTDL
FT                   SEACRKYHLPLYVDGARLAYALASPENDVTLRDLARLCDVFYIGGTKCGAFFGEAVVIP
FT                   DPALISHFFTIVKQHGALFAKGRILGIQFDTLFTDDLYLHIGESALTCAAAIKLALKEN
FT                   GYQFFLETPTNQIFIILENEVLHRLEEQAEFSFWEKYDDSHTVIRIATSWATTKEHTDA
FT                   LIKLLKMNRT"
FT   CDS             950966..951070
FT                   /transl_table=11
FT                   /locus_tag="CK3_09400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40696"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSB7"
FT                   /protein_id="CBL40696.1"
FT                   /translation="MKKSENTEGNMGIQLMMAIRAEARIQNFFWIERR"
FT   CDS             951113..951841
FT                   /transl_table=11
FT                   /locus_tag="CK3_09410"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40697"
FT                   /db_xref="GOA:D7GSB8"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSB8"
FT                   /protein_id="CBL40697.1"
FT                   /translation="MKSGFSGKQSMKQKVIEPVLGICLLAMVVMAVKYGSIRVTGSGDA
FT                   YIKETPVVVVDAGHGGTDPGKVGVDGSLEKDINLAVAERLKTYLEQDDVKVIMTRETDT
FT                   GLYSETDSRKKMADMKKRCEIIEESGADLVVSIHQNSYHEESVSGGQVFYYRDSSKGKA
FT                   LAEILQDRFDYVLGDQNRRLPKANANYYLLLHVKCPIVIVECGFLSNRKEAALLNSGEY
FT                   QDKLAYTIHMGIIEYLNKKQ"
FT   CDS             complement(952486..953796)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09430"
FT                   /product="Aspartyl aminopeptidase"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40698"
FT                   /db_xref="GOA:D7GSB9"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSB9"
FT                   /protein_id="CBL40698.1"
FT                   /translation="MIQNLNEELFSFIKKSPTGFHAVHELANYLTEAGFERLAEGNTWN
FT                   LAEGGKYFVTRNQSAIIAFKVSRKDYSGFHIAASHSDSPTLKIKESSEMNIENQYVKLN
FT                   VEKYGGMLCAPWFDRPLSVAGRIIVKDGNRLTTKLINVDRDLLMIPNLAIHMNREVNDG
FT                   YKYNIQKDMLPLYRMSNSGKAFKEMIAEEAGVSVDQIKGMDLFLYNRMEGTVWGCDGEF
FT                   ISAPRLDDLQCAFTSTMALLNSESDRCIPVVAVFDNEEVGSGTKQGAGSTFLYDILRRI
FT                   NRSLGRTEEEYLTSLASSFMVSADNGHAVHPNYADKTDPTNRTYLNGGLVIKHSANQKY
FT                   TTDAVSAAVMRCLCERAGVPYQEFLNRSDILGGSTLGNISNAQVSLNTVDVGLPQLAMH
FT                   SPYETAGSKDMAYLEKAFEEFFKSAIRAEGDGTLVLE"
FT   CDS             954086..955249
FT                   /transl_table=11
FT                   /locus_tag="CK3_09440"
FT                   /product="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40699"
FT                   /db_xref="GOA:D7GSC0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR006637"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSC0"
FT                   /protein_id="CBL40699.1"
FT                   /translation="MDWKKIRQAVRTVLAAVLICAASVGITGDPAYAADMGAVYGIYEH
FT                   GTGWSGYHGDSKTARAGTGSYVTAIRASLQGQPEGMSGTLSYQVNLSGSGWLSWQENMT
FT                   PNGSTETDMPLEAVRMAFTGQLAENYDVYYSVYQNGSWTTPVKNGETAGTEGQGLRVDG
FT                   LWVTVTGKGAEVPEGPNGKSVDPTRPMVALTFDDGPSKYTPRILDSLEANGGRATFFMV
FT                   GNRVASYASTVKRMADLGCETDSHTWAHTYLTGMSEGEILQSLNQTRDAIVAAGGNAPK
FT                   GVRPPGGKINDASKAVLAKAGMPSIIWSVDTLDWKTRNAQHTIDTVLRQVQDGDIILMH
FT                   DLYEQSVIAAETLIPELTRRGYQLVTVSEMAELRGGMAAGQSYGHFR"
FT   CDS             955586..956224
FT                   /transl_table=11
FT                   /locus_tag="CK3_09450"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40700"
FT                   /db_xref="GOA:D7GSC1"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSC1"
FT                   /protein_id="CBL40700.1"
FT                   /translation="MNQNKVLSVRNLVLIAMFSALAAVLETIQVAVPFAPPFYKLDFAE
FT                   FPVLIGGFAMGPAQAALIAIVKNLLKLLLNGTSTYYVGELGNIIGSCMFSVPAALIYRR
FT                   HKTKKTAMVALAAGVICAIVGAVFVNCAITLPFYAKVAFGGIENIIAMGTKINPAVTNL
FT                   YTFAIFMIVPFNLVKCGLNAIVTALVYKHVSVIIHAGVHREKKTENTAA"
FT   CDS             956424..957218
FT                   /transl_table=11
FT                   /locus_tag="CK3_09460"
FT                   /product="Uncharacterized protein, putative amidase"
FT                   /EC_number="3.5.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40701"
FT                   /db_xref="GOA:D7GSC2"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSC2"
FT                   /protein_id="CBL40701.1"
FT                   /translation="MVRYYNELTRLEMEQVDKDETVVMIPVGALEQHGNQCPLGTDEII
FT                   AEGTARRIKEALDREIPDYPMLIFPLIPVGLSTEHVNFCGSVTLKPDTFYHVLYDICKG
FT                   LAHHGFRKIAILNCHGGNSPIIQVLSREVRSELGIAVFIINCGAFFGNQAVKDTVTPGN
FT                   IWDFHGGEMETSMVLAERPETVKLETSEAGIPRKFMGNKTFTVYGPITLGWVSEEWETE
FT                   DGKPIGIGGDPSGATAEKGSQIYDSFVESILSGLKEIRKWKD"
FT   CDS             957550..958620
FT                   /transl_table=11
FT                   /locus_tag="CK3_09470"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40702"
FT                   /db_xref="GOA:D7GSC3"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSC3"
FT                   /protein_id="CBL40702.1"
FT                   /translation="MNTKVVRIKEEEKTRETLEKNPGLLEAAEILKNGGLVAFPTETVY
FT                   GLGANALNEEAAKKIYAAKGRPSDNPLIAHISCMEELPAIVKEIPEAGRKLAEKYWPGP
FT                   LTMIFPKKDIVPYGTTGGLDTVAVRMPVDPVANCLIHLAGVPIAAPSANTSGRPSPTKA
FT                   EHVIEDMDGKIEMIIDGGAVGIGVESTIVDVSGEIPTLLRPGAITIEMLRETLGQVDID
FT                   PVILGPVSGDIKPKAPGMKYRHYAPKADMTLVEGDMDKVVAYINEQTKKAEAEGKKVGI
FT                   ICTEESQDMYQGGNLEVIGSREHEETVAHNLFAVLRDFDARKVDCIFSESFSKDQLGQA
FT                   IMNRLCKAAGYHIVNI"
FT   CDS             958755..959243
FT                   /transl_table=11
FT                   /locus_tag="CK3_09480"
FT                   /product="Deoxycytidylate deaminase"
FT                   /EC_number="3.5.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40703"
FT                   /db_xref="GOA:D7GSC4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSC4"
FT                   /protein_id="CBL40703.1"
FT                   /translation="MSEKRNGYITWDEYFMGVAKLSAMRSKDPNTQVGACIVSEDNKIL
FT                   SMGYNGFPKGCSDDEFPWDKMDEDPYNRKYFYVTHSELNAILNYRGGSLEGSKLYVTLF
FT                   PCNECAKAIIQAGIQTIVYESDKYANDASTRASKRMLNAAGVRYYQYNPTGRKIEYRV"
FT   CDS             959255..961108
FT                   /transl_table=11
FT                   /locus_tag="CK3_09490"
FT                   /product="Fe-S oxidoreductase"
FT                   /EC_number="4.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40704"
FT                   /db_xref="GOA:D7GSC5"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023970"
FT                   /db_xref="InterPro:IPR025288"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSC5"
FT                   /protein_id="CBL40704.1"
FT                   /translation="MKFLLAAINAKYIHSNPGVYSLRAFARTKIPGADIEIGEYTINHQ
FT                   MDLILQDIYRRKPDFIGFSCYIWNISYIMEIVRDVKKVLPEVEIWLGGPEVSYDAKKVL
FT                   TREPDVCGVMRGEGELTFTELVRAYLKREELCAASLDLDHIPGITYRAESGEVVERGPQ
FT                   RLLSLDEIPFYYDDMAGFENRIVYYESSRGCPFSCSYCLSSIDKTVRFRSLDLVLPELQ
FT                   FFLDHKVPQVKFVDRTFNCKRDHTLGIWRYLVEHDNGITNFHFEVSADIFDEEELELIG
FT                   KMRPGLIQLEIGVQSTNPDTIKEIHRHMDLVKLKQAVDRVYDYRNTHQHLDLIAGLPYE
FT                   NYESFMRSFDDVYRMRPDQLQMGFLKVLKGSYMEEQVAAYDLKYRGIPPYEVLSTKWLP
FT                   YSDVIRLKGVEDMVEVYYNSGQFPATMKLLEKKFARPSEIFTSLAEYYEKNGLTGISHS
FT                   RLARYEILYRFLEEKEVKVEQSTPAAEEPAGMEQKTGVIAAETAVKLTLADFRDSLMYD
FT                   LYVRENIKSRPSFASDQSPYKKEVREFFMAEEESPQWLTDYAGFDSKQMAKMAHLEHME
FT                   DGTFVLFDYKNRDPLSGNARAVRFRYDRKGSRMVPAKRARI"
FT   CDS             961163..961906
FT                   /transl_table=11
FT                   /locus_tag="CK3_09500"
FT                   /product="exonuclease, DNA polymerase III, epsilon subunit
FT                   family"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40706"
FT                   /db_xref="GOA:D7GSC6"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSC6"
FT                   /protein_id="CBL40706.1"
FT                   /translation="MADEMINSYVALDLETTGIGARHEKITEIGMVKVIDGETTDTYHT
FT                   MVNPHREIPKRIVELTGITDDMVKDAPGIEEILDEVLAFTEDLPLLGHQIIFDYGFLVQ
FT                   AAVNQKRKFEKYGVDTLKLCRYLMPGEEKKNLSAACAYFEVTQDTAHRALSDAYAAHNL
FT                   YQELKKRFGKERPELFTAKMLQYKAKKERTASKRQKEHLQDLLKYHRIDITVEIDHMSG
FT                   NEISRMIDKIIFQYGRIPENAKKQG"
FT   CDS             962035..962193
FT                   /transl_table=11
FT                   /locus_tag="CK3_09510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40707"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSC7"
FT                   /protein_id="CBL40707.1"
FT                   /translation="MGCNRNGKQEEVNVVFNMNDKKTRKIFSTIVIVLVVLAMVVPMIL
FT                   GSLLSIF"
FT   CDS             962257..963783
FT                   /transl_table=11
FT                   /locus_tag="CK3_09520"
FT                   /product="Uncharacterized vancomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40708"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSC8"
FT                   /protein_id="CBL40708.1"
FT                   /translation="MKKNVWIAGMTAILSAGLVWLAPVFTLADERIPDGVSVGAVSLSG
FT                   LTEEEAEKQIESYVNEKLNQDITLVVNGTEAKADAQTLGVAWDNRDEVAEAIQGTELKG
FT                   NLIKRYMKKKDLEVNPVKIELDLSVDQDKVSSFVSEKCGSAVADAVDATMTRKDGKFEI
FT                   TSSKEGLTVDMDATKAALNDALNSEDTDAIRVEASVTVKKPKVTEEDLATIKDVLGTFS
FT                   TSFATSGASRSTNLAVGAGKINGHVLMPGEVLSGYECMHPFTLENGYKTATAYENGKSV
FT                   DSIGGGVCQISTTLYNASLYAELEIVQRQNHSMSVSYVKPSMDAAIAGTYKDLKVKNPY
FT                   DTPIYIEGYTKGKTLTFTIYGKETRPSNRTLAFESETLSTTPSPTQEIQDPSLPAGQRV
FT                   KVESGHTGLKSKLYKCVYVGGQLQERTLLNSDTYNASKTVYRVGTGVAAPAETTPVAPA
FT                   APAETEAAAPAETAVPETQAPETAAPETAGPQPGENYGPGMSAQAGENAA"
FT   CDS             963809..964399
FT                   /transl_table=11
FT                   /locus_tag="CK3_09530"
FT                   /product="Hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40709"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSC9"
FT                   /protein_id="CBL40709.1"
FT                   /translation="MRKIEREPNGAGIFRPGQDLVVAGTVGKNGVKAALSAKEKEISAR
FT                   FPEWFVKRIREQADKKSELTPEMLNACGAGEWEEISEGGILAALWIISGAYEQGISFEL
FT                   RKIPVAQETIEICEFFDLNPYRLSSGECLLMAVENGGDAVKILSEAGIPSAVIGKVEKG
FT                   IARKMVGIGTTGFLERPAPDEIRKLTDAASEKE"
FT   CDS             964424..964906
FT                   /transl_table=11
FT                   /locus_tag="CK3_09540"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40711"
FT                   /db_xref="GOA:D7GSD0"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSD0"
FT                   /protein_id="CBL40711.1"
FT                   /translation="MREKILAIIEKNSRIDLKDLAALLGESEAAVANEIAEMEKENIIC
FT                   GYHTMINWDNTGDEKVIALIEVKVTPQRGMGFDKIAERIYQYSEVTSVYLMSGAFDFTV
FT                   IIEGKTMREVAQFVSEKLSPMDSVLSTATHFVLKKYKDHGTVMCGKAEDERMMITP"
FT   CDS             966270..966764
FT                   /transl_table=11
FT                   /locus_tag="CK3_09560"
FT                   /product="Predicted rRNA methylase (SpoU class)"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40712"
FT                   /db_xref="GOA:D7GSD1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSD1"
FT                   /protein_id="CBL40712.1"
FT                   /translation="MNIVLYEPEMPANTGNIGRTCVATNTKLHLIEPLGFKLSEKHLVR
FT                   AGLDYWDKLDVTVYSDYQDFLKRNPGAKIYMATTKGEHVYTDVPYDPDVYIMFGPESRG
FT                   IPEEILVENRENCIRIPMWGDIRSLNLSNSVAIVLYEALRQNGFEKMTMEGHLHHLHWK
FT                   E"
FT   CDS             966903..968441
FT                   /transl_table=11
FT                   /locus_tag="CK3_09570"
FT                   /product="Sulfite reductase, beta subunit (hemoprotein)"
FT                   /EC_number="1.7.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40713"
FT                   /db_xref="GOA:D7GSD2"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSD2"
FT                   /protein_id="CBL40713.1"
FT                   /translation="MMNEKWEEQFREQIHEFVGTIEKFDKGEIDRKAYKGISGGFGSYA
FT                   QRDPSKHMLRLRMAGGNLTEKRLEFLAEAVKDYGVELMKLTTCETVQLHNLKAEQVPVL
FT                   MEKAIASEIYSRGGGGDNPRNIMMSPLSGMQKGEAFDVKPYAEAAAEYLLSIAGEIHMP
FT                   RKLKVAFCNGADDSVHSAFRDMGFMANPDGTFTLRIAGGLGGGYKMGVLVDEHVPATEI
FT                   LYYIRAMIETFCQHGNYENRAKARTRFMQETMGVDGLKAAFLENVAKVKEKGGLDLHVE
FT                   AKPVTKKGSGEIFGKRVVAQKQPGLYAVAYHPIGGCLPAGKPAELLTLVREIPDAECRI
FT                   APHETIYIINLTADEAEKVLEATNDGAQNTFENSVACIGAAICQQGVRDSQAALRAAVE
FT                   AVREAKIPDGALPRICISGCPSSCSGHQAAALGFQGAAKTVDGKPESAFKMFVGGSDKL
FT                   GAAKFGEAGAVILECDLPKFFVDLGKAVASQNMNWETWIVGHEDEFKAIVEKYA"
FT   CDS             complement(968811..970646)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSD3"
FT                   /protein_id="CBL40714.1"
FT                   /translation="MRLLELHIDGFGKFHDRTISFNDGINIIYGKNEAGKSTLHTFIRG
FT                   MLFGIERGRGRAAKNDLYTKYEPWENSGTYEGWLRLEKDGTIYRIERRFRKENKSLKII
FT                   NETKGLEEEATPAFVSSLLDGLTETMYNNTISIGQLKSATEDGMVTELKNYIANMNTTG
FT                   NISLNITKATAFLRNQKRSLEAGLIPEASREFTSLLAEIRNVEAEIAGPEYENQLAAYQ
FT                   NMRTQVKGLIDNTQTQKKDLDEKLANGKKVLSDNGFTDRASVDAMSSDAERLYSEYNTL
FT                   NGECNKKSRKVLSGLTAVLGVAGLGAAATLGYFNLTAYLPVCGAAATAAVIFFIISLFI
FT                   LQKDKEYHRLFDNTSSELGALLARHLGDSAVSEDAMNAFRARMGEFSKLCDMVTQSEAE
FT                   IRKFLEDLSNLQTKQAGCSEMIEKQQRTQWELEKKLEHLSNCKNKAKALKRTLAENDRI
FT                   HDEIVAIDLAQETMADLSSSIRDSFGLYLNKEASQYITGITGGIYDSMSIDENLNVFLN
FT                   TKTKLVPLENVSSGTMDQVYLALRLAAAKLLQGSGSGFPLIFDDSFTQYDDERLKTALE
FT                   WLASAYGGQIIIFTCHRREAQMLRARQAEFQLIEM"
FT   CDS             complement(970643..971719)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09590"
FT                   /product="DNA repair exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40715"
FT                   /db_xref="GOA:D7GSD4"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSD4"
FT                   /protein_id="CBL40715.1"
FT                   /translation="MKFIHTADIHWGMIPDSDKPWGKKREQAIRLTFQGIIEDARDSRA
FT                   DLLLISGDLFHRQPLARDLKEVNYLFSTIPGTRVVIIAGNHDRIRKSSALLSFTWAPNV
FT                   TFLMGEELSSVYFEELNTEVYGFSYHTAEITEAKADNISLPASRRTRILMLHGGDAKHV
FT                   PFDRNALAASPFSYIALGHIHKPEILLENRMAYAGSPEPLDMTETGPHGYFIGEIDTTS
FT                   GHVTSLQFKEVCQAQYIPLVVNVTPQTTNTELSQIIADEIRKRGANNIYRFRIRGMRDP
FT                   DISFDLDFLSGQWNIIEILDESEPQYDFHALFAEHPSDMIGFYIQALMKDDMSPVEKKA
FT                   LYYGIHALLMTKDERSQP"
FT   CDS             complement(971935..973326)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09600"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40716"
FT                   /db_xref="GOA:D7GSD5"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSD5"
FT                   /protein_id="CBL40716.1"
FT                   /translation="MQLTTVKELFKERDKYLNQEIQVGGWIRSIRDSKAFGFIVLNDGT
FT                   SFDTLQIVYHDTMANFAEVSKLNVGASIIVKGTLVATPEAKQPFEIQATEVTVEGASSA
FT                   DYPLQKKRHTFEYLRTIPHLRARTNTFQAVFRVRSLIAYAIHQYFQEQGFVYVHTPLIT
FT                   SSDCEGAGEMFQVTTLDLDNVPKTEDGAVDYSKDFFGKHTSLTVSGQLNAETYAMAFRN
FT                   VYTFGPTFRAENSNTTRHAAEFWMIEPEMAFADLDDNMAVAEGMLKYVIRYVLENAPSE
FT                   MNFFNQFVDKGLLDRLNHVLNSEFGHVTYTEAVKLLEEHNDEFDYKVFWGCDLQTEHER
FT                   YLTEKIFKRPVFVTDYPKEIKAFYMKLNPDGKTVAAVDCLVPGIGEIIGGSQREDDYEK
FT                   LLARMNELGLKPEDYGFYLDLRKYGSVRHSGFGLGFERCVMYLTGMGNIRDVVPFPRTV
FT                   NNCEL"
FT   CDS             973586..974896
FT                   /transl_table=11
FT                   /locus_tag="CK3_09610"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40717"
FT                   /db_xref="GOA:D7GSD6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSD6"
FT                   /protein_id="CBL40717.1"
FT                   /translation="MNIYDRIKTMSNEMAGDLTAQRRDFHKYAEPGWFEMRTSSIIARK
FT                   LTELGYEVLVGDQVCKKDSRMGVPSEEKLEEQYERAVAQGADPEFVKYTKGGMTGVIGI
FT                   LRCGEGPTVAMRFDIDALGVFEEHDPSHRPAKEGFNSVNEGFMHACGHDGHATIGLGVA
FT                   KVLMSIKDQLHGTVKLIFQPAEEGVRGAKSIVDNGHLDGVDYLIGSHVTNKKEDDPAVV
FT                   IPGSHGSLATTKYDVIFHGKSAHAGGSPEVGRNVMLAVGTAILNLYAIPRHSGGVSRVN
FT                   VGTVVAGSGRNVIADEAKMEIEVRGETTEINEYMKNYAVNIIESAAKMHGCTCEMKLMG
FT                   AANSLASSEALMERVKRVCEEDLHLPVAKEMSSKNGGSEDVSYMMNRVQEQGGQATFMR
FT                   VLTHEAGPGHSRIFDIDEQVLPNAVKIFCGVVYDIMH"
FT   CDS             complement(974988..976136)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09620"
FT                   /product="lactaldehyde reductase"
FT                   /EC_number="1.1.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40718"
FT                   /db_xref="GOA:D7GSD7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR013460"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSD7"
FT                   /protein_id="CBL40718.1"
FT                   /translation="MANRIMLNQTSYHGAGAIQEIANEAKAHGFKKAFVCSDPDLVKFK
FT                   VTAKVTDILTANGLDYELYSDIKANPTIQNVQHGVEAFKASGADYLIAIGGGSSMDTSK
FT                   AIGIIIANPEFEDVRSLEGVAPTKKPCVPIIAVPTTAGTAAEVTINYVITDIERKRKFV
FT                   CVDPHDMPIIAVVDPDMMSSMPKGLTASTGMDALTHAIEGYTTKAAWEMTDMFHLKAIE
FT                   IISKSLRGAVANTKEGREGMALGQYIAGMGFSNVGLGIAHSMAHTLGAVYDTPHGVACA
FT                   MMLPIVMEYNQECTGEKYREIARAMGVANVDSMSQDEYRKAAVDAVKKLSADVGIPSVL
FT                   EAIKEEDLPFLAESAHADACAPGNPKDASVEDLKDLFRKIMA"
FT   CDS             complement(976314..976895)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09630"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40719"
FT                   /db_xref="GOA:D7GSD8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSD8"
FT                   /protein_id="CBL40719.1"
FT                   /translation="MIESSTPAMKGEKTKYRLAAAMKECMKTTPVDAITVRQITERCGV
FT                   TRQTFYRNFLDKYDLINWYFDKLLAHSFEHMGRGTTVLDSLEKKFTYIQEEKTFFAAAF
FT                   RYDRQNSLREHDFKLILAFYENLIREKSGRPASPEIHFLLEMYCQGSITMTVKWVLGGM
FT                   DLTPSQFAGLLVRAMPAALRDLFLELHLLS"
FT   CDS             complement(977176..978687)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09640"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40720"
FT                   /db_xref="GOA:D7GSD9"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSD9"
FT                   /protein_id="CBL40720.1"
FT                   /translation="MEKKKGFQMPHTYIIIFGVILFAALLTVFIPLGKYDTKEITYMQN
FT                   GVEKTRTVLDPESFQYILDENGNKVTKAAPIFGTEDFGGQGILNYVFEGMTVGDKNGTA
FT                   VGIIAFILVVGGAFGIVLRTGAIESGIMRVIALTNGREILLIPILVVLFSLGGAVFGMG
FT                   EEAIPFVMILVPMFIAMGYDAVVGIMCSYVSTQIGFGSSWQNPFGLAVAQGVAGIPVMS
FT                   GAWFRIPLWIFFTGLTIVFTMRYAVKIKKDPQLSVAYESDEEYRKEFAKNGKEMPPFTL
FT                   GHKLVLLTVAACMVWTIWGVVSEGYYIPEIASQFFVMGLVSGIIGVVFKLNDMKVNDIA
FT                   KSFDHGAADLLGAAMCVGMAQGIIIILGGTSATDGTVLNTILHSISDGMQNFPPVISAW
FT                   FMYIFQSVFNFFVVSGSGQAALTMPIMAPLADLVGVERQVAVVAYQLGDAFTNFIVPTS
FT                   GCLLGALAAAKLDWGKWAKFQIKFQAVLFAFGSIAVILAVVIGLS"
FT   CDS             979177..980451
FT                   /transl_table=11
FT                   /locus_tag="CK3_09650"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40721"
FT                   /db_xref="GOA:D7GSE0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSE0"
FT                   /protein_id="CBL40721.1"
FT                   /translation="MVKKEMIAMLLAGGQGSRLGVLTQKVAKPAVSFGGKYRIIDFPLS
FT                   NCINSGVDTVGVLTQYQPLRLNAHIGIGIPWDLDRNVGGVTILPPYERSKGSDWYTGTA
FT                   NAIYQNLEYMESYNPEYVLILSGDHIYKMDYEVMLEYHKANNADVTIAAMPVPIEEASR
FT                   FGILITDDNNKITEFEEKPANPRSNLASMGIYIFSWKALKEALIKLSEEPGCDFGKHVI
FT                   PYCFEQGKRIFAYEYNGYWKDVGTLGSYWEANMELIDIIPEFNLYEEYWKIYTKSDRIP
FT                   PQYISADAKITKCIIGEGSEIYGEVTNSVIGSGVTIEKGAVVKDSIIMQDSVIGEGAVV
FT                   EKAIVAEDVKVGAGAHLGVGEYAPSKYDQKVYQFDLVTIGEHSVIPENVKIGKNTAISG
FT                   VTTAEDYPDGALESGGYIVKAGGIV"
FT   CDS             980448..981569
FT                   /transl_table=11
FT                   /locus_tag="CK3_09660"
FT                   /product="ADP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40723"
FT                   /db_xref="GOA:D7GSE1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSE1"
FT                   /protein_id="CBL40723.1"
FT                   /translation="MRAIGIVLAGGNSKRMRELSNKRAIAAMPIAGSFRSVDFALSNMS
FT                   NSHIQSVAVLTQYNSRSLNEHLSSSKWWDFGRKQGGMYVFTPTITAEHSDWYRGTADAL
FT                   YQNLDFLKKSHEPYVVIAAGDGIYKLDYNKVLEYHIEKKADITVVCKDMPGDVDVTRFG
FT                   MVKTNADGRIVEFEEKPMVADSHTISCGIYVVRRRQLIELIERCANEDRYDFVQDILVR
FT                   YKGLKRIYAYKLNTYWSNIASVDAYYQTNMDFLKPEVRNYFFKEYPDIYSKVDDLPPAK
FT                   YNPGASVKNSLVSSGCILNGDVENSVLFKKVYIGNNCIIKNSVILNDVYIGDNTVIENC
FT                   IVESRDTIRANTTYIGKPDDVKIVIEKNERYTL"
FT   CDS             981699..981974
FT                   /transl_table=11
FT                   /locus_tag="CK3_09670"
FT                   /product="Uncharacterized protein, involved in the
FT                   regulation of septum location"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40724"
FT                   /db_xref="GOA:D7GSE2"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSE2"
FT                   /protein_id="CBL40724.1"
FT                   /translation="MQVTDVRVRRIEKEGKMKAIVSITLDNEFVIHDIKVIEGEKGLFI
FT                   AMPSRKAADGEYRDIAHPINSGTRDMIQRVILDKYETTTLEEAQAV"
FT   CDS             complement(982129..983388)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09680"
FT                   /product="TRAP transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40725"
FT                   /db_xref="GOA:D7GSE3"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSE3"
FT                   /protein_id="CBL40725.1"
FT                   /translation="MAALLFISFIVLLLIGVPVAFAIAAAALLVLLKGDVKLLILVQRM
FT                   FASTDSFSLIAVPFFIFAGDLLAKGKVSKVLVEFAESLLGMLKGGLSIVSVLAGMFFAA
FT                   ISGSGAATTAAVGATLIPELKKRGYREDSAAALIAAAGTIGVVIPPSVPMVLYAVISED
FT                   SVNTLFKNGFVPGILMGVILVAISLYQARKFNYPKGKAFSVGNVLHTFKEAIWGILMPL
FT                   IILGGIFSGYFTPSEAAAVAVIYAIFVSFFIYRDLDFKGLVEIMKGSAKTSAVIMIIIA
FT                   CSGPFGWVLANYKIPEAIASGVLGISTNKYVIMFLISLIILLAGVFMETSSAIIILSPV
FT                   FLPLVKAMGISTVHFGILFVVGIAIGMITPPVAINLFVASGITGLPIERISKSVIPYLI
FT                   GLIIVFFMIVYVPLLIPGLM"
FT   CDS             complement(984115..985194)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09700"
FT                   /product="tripartite ATP-independent periplasmic
FT                   transporter solute receptor, DctP family"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40726"
FT                   /db_xref="GOA:D7GSE4"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSE4"
FT                   /protein_id="CBL40726.1"
FT                   /translation="MKKSAKLLSAVMAGAMVLSMAGCGSSSNSTETTAAAAETTAAAAD
FT                   SSAAESKEATSNTDATVIKLGTTVNEQDSFQVCAEKFAELVKERTNGAYEIEIHPNGAL
FT                   GDERTMLESMQMGTLDMGIITSGPFVNFSSAMGVLDMPFLFANNEEAYKVLDGEIGKEL
FT                   LGTLEDADLKGLAYAERGFRNITNSKKPITNAADVAGLKLRVMENDVYTATFKALDVNA
FT                   VPMAWSDALTALQQGTIDGEENPINVIYSYKLWESQKYVTLDRHSYSTAIITMSNDLFK
FT                   SLPEDVQKIFEESAQEAAEYERQWVADQEADQLQEIKDHGMEVVENPDVDSFRAAVQSV
FT                   YDAYPDYADYIKRIQDALK"
FT   CDS             985935..987260
FT                   /transl_table=11
FT                   /locus_tag="CK3_09710"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40727"
FT                   /db_xref="GOA:D7GSE5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSE5"
FT                   /protein_id="CBL40727.1"
FT                   /translation="MKPTVSIIVPVYNAEKFLNRCVDSILGQEYRDFELILVDDGSRDM
FT                   SGSICDAYAKTDERVVVIHKENSGVSDTRNQGIERAKGTYLQFVDSDDWLTPDATKLMV
FT                   RAAEEHGCDMVISDFYRVVGDMVSRKGDIESDCVIDREEFASFMMENPADYYYGVLWNK
FT                   LYRRDLVNRFGIRMDAEISWCEDFMFNLEYVRYAETFYALRTPVYYYVKTKGSLVNQKI
FT                   SITKTVKMKLMMFEYYNNFYKHVLDEEDYEKNRLQVYHFLVDAAKDGFVFPASIPGNRK
FT                   LGEERSSALQEVISDDGIIVDKYRDRKLLERYLESAALKHDMTMEELSLLLYLKDASHE
FT                   LSRKNLADLMDLSRGDLAVAVQRLSAKKMVEVTELPRRRGTERKIRLELLPASEVVIPD
FT                   LEAAENDYYQAKFGNFTEEEIRQYTLLARKVRENERSILQRG"
FT   CDS             987355..988170
FT                   /transl_table=11
FT                   /locus_tag="CK3_09720"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40728"
FT                   /db_xref="GOA:D7GSE6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSE6"
FT                   /protein_id="CBL40728.1"
FT                   /translation="MEKEKTCKIVFSDIDGTLLTSDGQITEGTKEMILNLENKGIPFIL
FT                   TSARSPEGVRVIKRMLGNHAPIIAFCGGLILDNDGHEIYSKMIPLKRALELKAMLDKDF
FT                   PAVACNTFGGEKWIVDDRDDWREQREEKIVGFPAEIGSIKDTFETEGGIHKFLLMGDPD
FT                   VMTKLAAVLARDFSDLQSAASNPEYLEITAAGVEKSEGLKTLCGKLGISPEEAAAFGDG
FT                   ESDLSMMRAAGFGAAMGNAPENVRRRAPMVTGKNDEEGLLKRLKEIFKD"
FT   CDS             988388..988996
FT                   /transl_table=11
FT                   /locus_tag="CK3_09730"
FT                   /product="LPXTG-site transpeptidase (sortase) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40729"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSE7"
FT                   /protein_id="CBL40729.1"
FT                   /translation="MKWKLLTGVGLLLIAAALLLTVYNIRESDRAGAESEEMVVRMESL
FT                   TADLPERLETEKKELVPEYKKNPEMEMPTVEVNGQECVGMIEIPALGLKLPVISEWSDA
FT                   KLKKAPCRYSGSAYLKNMIIAGHNYRTHFSGIKRLNPGDSVVFTDADGNVFSYEVAEIE
FT                   TVGGYDIEKMEAGDWDLTLFTCTNKGKARAAVRCREIEE"
FT   CDS             989002..989187
FT                   /transl_table=11
FT                   /locus_tag="CK3_09740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40730"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSE8"
FT                   /protein_id="CBL40730.1"
FT                   /translation="MCKAMEDLRNESYAEGREEGRESQAKDTAVRMSEKGNSVEEIAEI
FT                   VGFSTDKVKKWFVTEG"
FT   CDS             complement(989362..990363)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09750"
FT                   /product="Cell wall hydrolyses involved in spore
FT                   germination"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40731"
FT                   /db_xref="GOA:D7GSE9"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSE9"
FT                   /protein_id="CBL40731.1"
FT                   /translation="MRKLQNLISDFSKKFLLKAAAAASVLFLSTALLTLPSFAASAYDN
FT                   LAVANVTSEPLNMRTKPSTDGEIVGKCYRGAGGTVLEKKDGWTKVRSGKIEGWMCDKYL
FT                   LFGTDIEPLAKELGLLSAKITATTLNVREIPSTDSAILKQAAEGDSFPVLSESDGWTKV
FT                   QLSADTNGYISSQYASIGPVPAAAVDAKEESAALSASGNETSAAPSYVISATEDEIYLM
FT                   AACVAMEAGDDSYEDKLAVASCIVNRVKSGKWGKTISDVIYADGQFPGASSGLLDKYLA
FT                   KGPFKSCIKATKDALAGSNNIGDYLFFKAAKRASTGSYSSYKIVGGNCFYKK"
FT   CDS             complement(990474..990788)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09760"
FT                   /product="Predicted methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40732"
FT                   /db_xref="GOA:D7GSF0"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSF0"
FT                   /protein_id="CBL40732.1"
FT                   /translation="MAPSARFTEDFAYEVLSVAGEIPEGTVATYGQIARLIGRDKNSRL
FT                   VARVLSHASNYGDFPCHRVVNHSGRLVPGWPEQAFLLRQEGVELKDAIHVDLKKYQWEC
FT                   "
FT   CDS             complement(990790..991935)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40733"
FT                   /db_xref="InterPro:IPR025466"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSF1"
FT                   /protein_id="CBL40733.1"
FT                   /translation="MNKREISEIKKQFKKDNNAITRICGCYVDAEKQIKTTLKEAFFAL
FT                   SEEEIFKYYEIFKKSLSGGIGKNLHNLEYSIHDEGPDSAHELLMKLRDEKLADDETVDT
FT                   FYNKVIENYEYGENYYIILIHSAYDVPGKASDNEEMFDASEEVYNHILCCICPVKLSEP
FT                   GLSYNEATNAIEERPRDWWVQTPMTGFLFPAFNDRSSDIHSILYFSKNPEELHSEFIDA
FT                   CLGAPTPISFKSQKEAFQEILTDTLGEECDYEIVRQIHENLTELAEEHKEDEIPLTLTK
FT                   PEVKDLLEKSGVEPERLEHFDKVYEEAAGENTAILVPAITGTGKFAVKTPDVDIKVNPD
FT                   HLDLVETKFIGGRRCLVIAVEDNVEVNGMPVKMWEEQKEVQ"
FT   CDS             complement(992291..992839)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09780"
FT                   /product="NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes"
FT                   /EC_number="3.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40734"
FT                   /db_xref="GOA:D7GSF2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSF2"
FT                   /protein_id="CBL40734.1"
FT                   /translation="MSIKPWICNGSRTIIKDRWIDLHADDCALPDGTKISPFYVNDVPD
FT                   FVVVVAVTVDGDFVFVRQYRHGTRQILLELPAGCMEPTDADPGTGAARELFEETGYAGS
FT                   EPVFLCKVAPNAACISNFAHCYLIRDCKKVSSQHLDATEDLEIVVMSAEETKKLMAEGG
FT                   LVQAVHVAAMYYAEKILNK"
FT   CDS             complement(992985..993797)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09790"
FT                   /product="Metal-dependent hydrolases of the beta-lactamase
FT                   superfamily III"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40735"
FT                   /db_xref="GOA:D7GSF3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSF3"
FT                   /protein_id="CBL40735.1"
FT                   /translation="MNSELLYVFGTGNATVTNLYNTCFALRDGDEYFMVDAGGGNGILK
FT                   ILDNMQVPLEHIHHIFVTHAHTDHVLGIVWMVRMIATKMKKDQYVGDAYIYCHSELIET
FT                   IRTLCRLTIQDKFYNMIGNRIHLEEVKDGETRHILSYDVTFFDIHSTKLKQFGFTLTLN
FT                   NGRKLTCAGDEPYNPVCEKYVRGSDWLLHEAFCLYAERDIWKPYEKHHSTVKDACELAE
FT                   SLGIPNLVLWHTEDSNVAGRERLYKSEGKRYYSGNIYVPDDESLIALS"
FT   CDS             994226..996163
FT                   /transl_table=11
FT                   /locus_tag="CK3_09800"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40736"
FT                   /db_xref="GOA:D7GSF4"
FT                   /db_xref="InterPro:IPR009164"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSF4"
FT                   /protein_id="CBL40736.1"
FT                   /translation="MRDLDYLKLLAKEYPTVKAASSEIINLMAIRGLPKGTEYFFSDLH
FT                   GEYEAFIHLLRSASGIIREKISETFGYVISDEEEIALANLIYYPERNIRRIQKEGKFTE
FT                   DWQRITIYRLVRICKEVSSKFTRSKVRKKMPPAFAYIIDELLHVDYNDDNKKVYYDEII
FT                   HSIIDIEMGDQFIMALCNLIQNLTVDSLHIIGDIFDRGPRADIIMDELMHFHDVDIQWG
FT                   NHDISWMGAATGNLACICNVLRIAIRYNGFDVLEDGYGINLRPLSMFAAKVYRDDPCER
FT                   FLPKILDENIYDAVDPGLAAKMHKAITVIQFKVEGQITKRHPDYQINDRIHLEHINFEK
FT                   GTVNIHGKDYKMLDMNFPTIDPKDPLKLTKEEQELINSLALSFRHSETLHRHIRFVYSH
FT                   GAMYKRCNSNLLYHGCIPMKEDGTFEELKLKGIIYSGKRLLDYLEDVVKMAYFLPDDDP
FT                   TKDWYRDFMWYLWCGPKSPVYGKDNMATFENYFVADKAAAKENMNPYYKLCEKEEFCNK
FT                   ILKEFGLPIEGSHIINGHVPVKLKDGESPIKGNGKLFVIDGGLSKSYQPKTGIAGYTLI
FT                   FNSHHLALAEHKPFDRNHENTPKVMIVEKMKKRVMVADTDTGKELAAKIADLKELVAVY
FT                   RGGIIKEKLE"
FT   CDS             996170..996664
FT                   /transl_table=11
FT                   /locus_tag="CK3_09810"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40737"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSF5"
FT                   /protein_id="CBL40737.1"
FT                   /translation="MNKDEFLRRLEEALSGEVPASVIRDNLNYYADYLSQELGKGRTMD
FT                   EIIEEIGEPNIVARTIIDSAEAAGETGDGYGSFEDASPRGDDRRSTYSQESYQNGSAPN
FT                   IHYFDLNKWYWKLALVVILFLVISVVFSIMGGVFYLLIRFSGPILMCLIIYWLVKNFRG
FT                   R"
FT   CDS             997040..997744
FT                   /transl_table=11
FT                   /locus_tag="CK3_09820"
FT                   /product="Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40739"
FT                   /db_xref="GOA:D7GSF6"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="UniProtKB/TrEMBL:D7GSF6"
FT                   /protein_id="CBL40739.1"
FT                   /translation="MTKKLFRTLKITCLCIALTAALPIVSFADETTAAVKEDKMVVRII
FT                   HLDENGNLLEEDKQTATEETESSEETTDKEEANADEAVAEADSDEEEAAEAEADEAEAE
FT                   LEAAIEVENDLRSEIVTYALQFVGNRYKYGGTNPNTGVDCSGFTSYVMRHAAEVELPHS
FT                   SGGQSRMGRQVSSSEMRPGDIICYGSGKRINHVALYIGNGQIVHASTERTGIKVSRWNY
FT                   RTPVRIVNVLGD"
FT   CDS             complement(997872..998456)
FT                   /transl_table=11
FT                   /locus_tag="CK3_09830"
FT                   /product="Protein of unknown function (DUF1393)."
FT                   /db_xref="EnsemblGenomes-Gn:CK3_09830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL40740"
FT                   /db_xref="GOA:D7GSF7"
FT                   /db_xref="InterPro:IPR024529</