spacer

EBI Dbfetch

ID   FP929061; SV 1; linear; genomic DNA; STD; PRO; 3114788 BP.
XX
AC   FP929061;
XX
PR   Project:PRJNA45957;
XX
DT   25-MAR-2010 (Rel. 104, Created)
DT   25-MAR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Clostridiales sp. SSC/2 draft genome.
XX
KW   .
XX
OS   butyrate-producing bacterium SSC/2
OC   Bacteria; Firmicutes; Clostridia; Clostridiales.
XX
RN   [1]
RG   metaHIT consortium -- http://www.metahit.eu/
RA   Pajon A., Turner K., Parkhill J., Duncan S., Flint H.;
RT   "The genome sequence of Clostridiales sp. SSC/2";
RL   Unpublished.
XX
RN   [2]
RA   Pajon A.;
RT   ;
RL   Submitted (24-MAR-2010) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
XX
DR   MD5; f62432ebd62882f893cd257681cca2a6.
DR   EnsemblGenomes-Gn; CL2_R_32020.
DR   EnsemblGenomes-Gn; CL2_R_32030.
DR   EnsemblGenomes-Gn; CL2_T_31500.
DR   EnsemblGenomes-Gn; CL2_T_31510.
DR   EnsemblGenomes-Gn; CL2_T_31520.
DR   EnsemblGenomes-Gn; CL2_T_31530.
DR   EnsemblGenomes-Gn; CL2_T_31540.
DR   EnsemblGenomes-Gn; CL2_T_31550.
DR   EnsemblGenomes-Gn; CL2_T_31560.
DR   EnsemblGenomes-Gn; CL2_T_31570.
DR   EnsemblGenomes-Gn; CL2_T_31580.
DR   EnsemblGenomes-Gn; CL2_T_31590.
DR   EnsemblGenomes-Gn; CL2_T_31600.
DR   EnsemblGenomes-Gn; CL2_T_31610.
DR   EnsemblGenomes-Gn; CL2_T_31620.
DR   EnsemblGenomes-Gn; CL2_T_31630.
DR   EnsemblGenomes-Gn; CL2_T_31640.
DR   EnsemblGenomes-Gn; CL2_T_31650.
DR   EnsemblGenomes-Gn; CL2_T_31660.
DR   EnsemblGenomes-Gn; CL2_T_31670.
DR   EnsemblGenomes-Gn; CL2_T_31680.
DR   EnsemblGenomes-Gn; CL2_T_31690.
DR   EnsemblGenomes-Gn; CL2_T_31700.
DR   EnsemblGenomes-Gn; CL2_T_31710.
DR   EnsemblGenomes-Gn; CL2_T_31720.
DR   EnsemblGenomes-Gn; CL2_T_31730.
DR   EnsemblGenomes-Gn; CL2_T_31740.
DR   EnsemblGenomes-Gn; CL2_T_31750.
DR   EnsemblGenomes-Gn; CL2_T_31760.
DR   EnsemblGenomes-Gn; CL2_T_31770.
DR   EnsemblGenomes-Gn; CL2_T_31780.
DR   EnsemblGenomes-Gn; CL2_T_31790.
DR   EnsemblGenomes-Gn; CL2_T_31800.
DR   EnsemblGenomes-Gn; CL2_T_31810.
DR   EnsemblGenomes-Gn; CL2_T_31820.
DR   EnsemblGenomes-Gn; CL2_T_31830.
DR   EnsemblGenomes-Gn; CL2_T_31840.
DR   EnsemblGenomes-Gn; CL2_T_31850.
DR   EnsemblGenomes-Gn; CL2_T_31860.
DR   EnsemblGenomes-Gn; CL2_T_31870.
DR   EnsemblGenomes-Gn; CL2_T_31880.
DR   EnsemblGenomes-Gn; CL2_T_31890.
DR   EnsemblGenomes-Gn; CL2_T_31900.
DR   EnsemblGenomes-Gn; CL2_T_31910.
DR   EnsemblGenomes-Gn; CL2_T_31920.
DR   EnsemblGenomes-Gn; CL2_T_31930.
DR   EnsemblGenomes-Gn; CL2_T_31940.
DR   EnsemblGenomes-Gn; CL2_T_31950.
DR   EnsemblGenomes-Gn; CL2_T_31960.
DR   EnsemblGenomes-Gn; CL2_T_31970.
DR   EnsemblGenomes-Gn; CL2_T_31980.
DR   EnsemblGenomes-Gn; CL2_T_31990.
DR   EnsemblGenomes-Gn; CL2_T_32000.
DR   EnsemblGenomes-Gn; CL2_T_32010.
DR   EnsemblGenomes-Tr; CL2_R_32020.
DR   EnsemblGenomes-Tr; CL2_R_32030.
DR   EnsemblGenomes-Tr; CL2_T_31500.
DR   EnsemblGenomes-Tr; CL2_T_31510.
DR   EnsemblGenomes-Tr; CL2_T_31520.
DR   EnsemblGenomes-Tr; CL2_T_31530.
DR   EnsemblGenomes-Tr; CL2_T_31540.
DR   EnsemblGenomes-Tr; CL2_T_31550.
DR   EnsemblGenomes-Tr; CL2_T_31560.
DR   EnsemblGenomes-Tr; CL2_T_31570.
DR   EnsemblGenomes-Tr; CL2_T_31580.
DR   EnsemblGenomes-Tr; CL2_T_31590.
DR   EnsemblGenomes-Tr; CL2_T_31600.
DR   EnsemblGenomes-Tr; CL2_T_31610.
DR   EnsemblGenomes-Tr; CL2_T_31620.
DR   EnsemblGenomes-Tr; CL2_T_31630.
DR   EnsemblGenomes-Tr; CL2_T_31640.
DR   EnsemblGenomes-Tr; CL2_T_31650.
DR   EnsemblGenomes-Tr; CL2_T_31660.
DR   EnsemblGenomes-Tr; CL2_T_31670.
DR   EnsemblGenomes-Tr; CL2_T_31680.
DR   EnsemblGenomes-Tr; CL2_T_31690.
DR   EnsemblGenomes-Tr; CL2_T_31700.
DR   EnsemblGenomes-Tr; CL2_T_31710.
DR   EnsemblGenomes-Tr; CL2_T_31720.
DR   EnsemblGenomes-Tr; CL2_T_31730.
DR   EnsemblGenomes-Tr; CL2_T_31740.
DR   EnsemblGenomes-Tr; CL2_T_31750.
DR   EnsemblGenomes-Tr; CL2_T_31760.
DR   EnsemblGenomes-Tr; CL2_T_31770.
DR   EnsemblGenomes-Tr; CL2_T_31780.
DR   EnsemblGenomes-Tr; CL2_T_31790.
DR   EnsemblGenomes-Tr; CL2_T_31800.
DR   EnsemblGenomes-Tr; CL2_T_31810.
DR   EnsemblGenomes-Tr; CL2_T_31820.
DR   EnsemblGenomes-Tr; CL2_T_31830.
DR   EnsemblGenomes-Tr; CL2_T_31840.
DR   EnsemblGenomes-Tr; CL2_T_31850.
DR   EnsemblGenomes-Tr; CL2_T_31860.
DR   EnsemblGenomes-Tr; CL2_T_31870.
DR   EnsemblGenomes-Tr; CL2_T_31880.
DR   EnsemblGenomes-Tr; CL2_T_31890.
DR   EnsemblGenomes-Tr; CL2_T_31900.
DR   EnsemblGenomes-Tr; CL2_T_31910.
DR   EnsemblGenomes-Tr; CL2_T_31920.
DR   EnsemblGenomes-Tr; CL2_T_31930.
DR   EnsemblGenomes-Tr; CL2_T_31940.
DR   EnsemblGenomes-Tr; CL2_T_31950.
DR   EnsemblGenomes-Tr; CL2_T_31960.
DR   EnsemblGenomes-Tr; CL2_T_31970.
DR   EnsemblGenomes-Tr; CL2_T_31980.
DR   EnsemblGenomes-Tr; CL2_T_31990.
DR   EnsemblGenomes-Tr; CL2_T_32000.
DR   EnsemblGenomes-Tr; CL2_T_32010.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01699; Clostridiales-1.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; FP929061.
DR   SILVA-SSU; FP929061.
XX
CC   This is a reference genome for the metaHIT project
CC   DNA source: Rowett Institute of Nutrition and Health, University of
CC   Aberdeen -- http://www.rowett.ac.uk/divisions/ghp/
CC   Sequencing technology: 454
CC   Genome coverage: 29x
CC   Annotation was added using ab initio prediction IMG/ER --
CC   http://img.jgi.doe.gov/submit (Markowitz, Szeto et al. 2007).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3114788
FT                   /organism="butyrate-producing bacterium SSC/2"
FT                   /strain="SSC/2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:245018"
FT   CDS             27..353
FT                   /transl_table=11
FT                   /locus_tag="CL2_00100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37134"
FT                   /db_xref="UniProtKB/TrEMBL:D4MWY9"
FT                   /protein_id="CBL37134.1"
FT                   /translation="MKETYLDDEYLRRHEHEEFARRVDQENKRQNRRLDIIDSTLSQLN
FT                   ELTISVQNLATSMKHMLDIQTEQNKRLEELENRDGEKWRSISMYVLTALIGAVIGFVLK
FT                   QVGI"
FT   CDS             368..742
FT                   /transl_table=11
FT                   /locus_tag="CL2_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37135"
FT                   /db_xref="UniProtKB/TrEMBL:D4MWZ0"
FT                   /protein_id="CBL37135.1"
FT                   /translation="MKELFEQNKVLFLAVITILIAVFLIKKLIEYVQKKGLEGIRLYVY
FT                   ELFVEAEERFKESGQGQAKFDYVIQLARSLLPKPVQIFVTDNMLKEAVQLWFDGIKDLL
FT                   DDGKLNASILEEREEERKGE"
FT   CDS             748..1422
FT                   /transl_table=11
FT                   /locus_tag="CL2_00120"
FT                   /product="Phage-related lysozyme (muraminidase)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37136"
FT                   /db_xref="GOA:D4MWZ1"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023347"
FT                   /db_xref="UniProtKB/TrEMBL:D4MWZ1"
FT                   /protein_id="CBL37136.1"
FT                   /translation="MAHVTNKCIKLVKKFEGLYKKAYRDEVGVWTIGYGITNADKSITG
FT                   ATIKAGLVISEKTADNWLERSLNSKYLQKVMKYDKKYNWNQNEIDALVSFAYNIGSIDG
FT                   LTANGTRSRATIAAKILEYNKAAGKVYRGLTRRRKAERKLFLTATKAKKKAKKKAVKKV
FT                   YAKVNTKHDPLTIRKSASSTAAVLGRVPKKSKVKVIKKGSTWTKVKYKSVTGYSATKYL
FT                   KF"
FT   CDS             1584..1733
FT                   /transl_table=11
FT                   /locus_tag="CL2_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37137"
FT                   /db_xref="UniProtKB/TrEMBL:D4MWZ2"
FT                   /protein_id="CBL37137.1"
FT                   /translation="MNKDIKSEVYNALANIMFETGASKEDMDKAINWFNEKFYVDANEE
FT                   EEND"
FT   CDS             1726..1941
FT                   /transl_table=11
FT                   /locus_tag="CL2_00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37138"
FT                   /db_xref="UniProtKB/TrEMBL:D4MWZ3"
FT                   /protein_id="CBL37138.1"
FT                   /translation="MIKFEKGQVYTGSDSDIYVKGAYGSMVRFIEGCSPAAIHDMQEIP
FT                   AENLEEYINEWGFKRADPEYEAFLNA"
FT   CDS             1976..2317
FT                   /transl_table=11
FT                   /locus_tag="CL2_00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37139"
FT                   /db_xref="UniProtKB/TrEMBL:D4MWZ4"
FT                   /protein_id="CBL37139.1"
FT                   /translation="MKIETLLNKARENAKKQVWLDYLDICDWNEEKTKELIKRERENGE
FT                   FVKFVESETIDNIYKLIRTIRNTALMSDEEKEAAIAEIHNCPEWERLEKRVAMTFANHL
FT                   VKYENVYMK"
FT   CDS             2369..2770
FT                   /transl_table=11
FT                   /locus_tag="CL2_00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37140"
FT                   /db_xref="UniProtKB/TrEMBL:D4MWZ5"
FT                   /protein_id="CBL37140.1"
FT                   /translation="MKNKNYKYYQPNDKDTKDKYGDCVIRALTKVLCKDWLTVFDELLP
FT                   YAKELQCMPNERRCYEEYLFDNGFAYQGVSNRKGSKRPTVESFSKDHKQGSYFVNVANH
FT                   VVAISDGSYYDTWDSGDCCLYGYYYKEGK"
FT   CDS             2821..3081
FT                   /transl_table=11
FT                   /locus_tag="CL2_00170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37141"
FT                   /db_xref="UniProtKB/TrEMBL:D4MWZ6"
FT                   /protein_id="CBL37141.1"
FT                   /translation="MTKNAEKKARSMLSRLSLEQLIKEFDMTEGMPASFELSMVRGWIM
FT                   DELEKRNPTAYDKWLDMDYPTNKALRELYLGDQALQTAETK"
FT   CDS             3129..3533
FT                   /transl_table=11
FT                   /locus_tag="CL2_00180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37142"
FT                   /db_xref="GOA:D4MWZ7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MWZ7"
FT                   /protein_id="CBL37142.1"
FT                   /translation="MLTYKTDIIQRLKEAGYNTSRIRKEKLISENALQQIREGEMVAIK
FT                   TLTKLCELLDAQPGDLIGYDNGNDKIRKTITLDVEFDRNFTPPLFFDNDEENSVCKGCP
FT                   FYFSKDECNPCCVCPSINEDEKCPIHLINI"
FT   CDS             3597..4034
FT                   /transl_table=11
FT                   /locus_tag="CL2_00190"
FT                   /product="Uncharacterized phage-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37143"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:D4MWZ8"
FT                   /protein_id="CBL37143.1"
FT                   /translation="MYNAVDVASYIVGRCANLGRPVTNLQLQKILYYVQLNFLRRFDEC
FT                   AFWDDIQALRHGPAVKEVYYKYNIWGRNEIVPRAVQSAKETFLEKDRELIDRVTDACLL
FT                   LDPWELVERSQKAGGPWHRSFDGNLDKVIPKELMKKYAKDH"
FT   CDS             4553..4708
FT                   /transl_table=11
FT                   /locus_tag="CL2_00200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37144"
FT                   /db_xref="UniProtKB/TrEMBL:D4MWZ9"
FT                   /protein_id="CBL37144.1"
FT                   /translation="MKLRNVSGVVGGIVACGAVGGLQQETMPLLQGTLCMILGILMIAA
FT                   CMHDRD"
FT   CDS             4745..5140
FT                   /transl_table=11
FT                   /locus_tag="CL2_00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37145"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX00"
FT                   /protein_id="CBL37145.1"
FT                   /translation="MTAVNRLTEEQIEKLAVEVRQFLIDHEMWQDVAIYFNGKCFTTYD
FT                   KEAGKYYYNDPDHLIVVENKDPNDYFDYVAEEHVLSMGFEGPLYALINYPQGTGDYRKL
FT                   YKFNQIFKNYGLYYELGDAWNLSCYYV"
FT   CDS             5167..6009
FT                   /transl_table=11
FT                   /locus_tag="CL2_00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37146"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX01"
FT                   /protein_id="CBL37146.1"
FT                   /translation="MTYSEFKTRMTEDVKKYMDGNHPGYEVSLENVAKVNRDFVEMIAI
FT                   SNKDTHERPAIDVKELWDDAKRRGMSYEEMSREVMKRLDLTLKAVPEVVLDDLIDFKSR
FT                   VILTLINTEKNQNILSYVPHRTYYEFSIVCRFIAHEDEEATTSGIVTNKMLEKAGYTEE
FT                   ELYKFAYENTRKDVDISKMFGMYVLTTKRRMYGAASILFPEMVKEIADHCGCDLYLIPS
FT                   STCEWMAVPVRTISGSGGAAEVNKMIREANSVAVEEEEILGERCYHYDYKTGEIRLAQ"
FT   CDS             6040..6216
FT                   /transl_table=11
FT                   /locus_tag="CL2_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37147"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX02"
FT                   /protein_id="CBL37147.1"
FT                   /translation="MYDYSGDMSFFQNQLSDAGITKDMLDLDEFAGSTQEELQLIVDYA
FT                   IKVQKSKEDQEND"
FT   CDS             6209..7150
FT                   /transl_table=11
FT                   /locus_tag="CL2_00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37148"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX03"
FT                   /protein_id="CBL37148.1"
FT                   /translation="MTREYYEINEDAARQAKAMWSHSDYVMGSKTEEYKKAVDEAYDLV
FT                   DKIKDQRPKQAEKAENIARRYAKKLADNYNKGFRIELMCPSILISGAGNFPVKKKEKQN
FT                   EARDRNLKEYNQILGYIDKLKDILHGNEVIKSKDADAVEMLQEKLDKLVKNQNMMKAVN
FT                   AYYRKHKTLKGCPEFSEETAIKLEESLDDRKKEQHRVFMRYELQNNNSNIRSIKKRLEG
FT                   LKKEKEQGDSEISLDKFGLDIKENKEIMRIQFFFSGRPKPAVRDVMKSKSFRWSPKNGC
FT                   WQRQLTSNGRYAAKKAVEEIEKLELEDIYDEI"
FT   CDS             7140..7826
FT                   /transl_table=11
FT                   /locus_tag="CL2_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37149"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX04"
FT                   /protein_id="CBL37149.1"
FT                   /translation="MRFEKYGYAVEVDIETKKFNVSNKYGDHGGGYIIRNVIDEQICEI
FT                   LLLDFLSNHTVSDITKNRYQKMVALNEKNEYIQLQAVKRLHSYFIQEYDNELMYIRSVY
FT                   AGEIGKCDIIEKMKEMYNIQHGLMADVFKSPFDDCTNKGISSKADELYIAYDKAPLILT
FT                   DIRECVTVEKLQTRYGEYVKCKPVYESNNMYAAGGNFLYTSDCRFKEITGIEYPVPIHD
FT                   HRVELF"
FT   CDS             7846..8283
FT                   /transl_table=11
FT                   /locus_tag="CL2_00260"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37150"
FT                   /db_xref="GOA:D4MX05"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX05"
FT                   /protein_id="CBL37150.1"
FT                   /translation="MNKVVLMGRLTRDPEVRYTEGDNPTTIARYTLAVDRKFKRDGEPT
FT                   ADFIRCIVFGRAAEFTEKYLQKGIKVVISGRIQTGSYTNKEGVKVYTTDIVVEEQDFAE
FT                   SKAVSEQNRENYNHEGQAGESAGSDGFINVPEGLEEELPFS"
FT   CDS             8301..8483
FT                   /transl_table=11
FT                   /locus_tag="CL2_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37151"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX06"
FT                   /protein_id="CBL37151.1"
FT                   /translation="MDNKEVEQRLIDSKQLREMLNCGRSTAEKIANDAGARVKIGKRVL
FT                   WNVKKIDEHLEKISK"
FT   CDS             8511..8660
FT                   /transl_table=11
FT                   /locus_tag="CL2_00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37152"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX07"
FT                   /protein_id="CBL37152.1"
FT                   /translation="MEELTKVVTELHAYGLKQHTIVKMVKDIFASVDNAEVKISPKSVK
FT                   KTIR"
FT   CDS             8672..9076
FT                   /transl_table=11
FT                   /locus_tag="CL2_00290"
FT                   /product="MazG nucleotide pyrophosphohydrolase domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37153"
FT                   /db_xref="GOA:D4MX08"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011379"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX08"
FT                   /protein_id="CBL37153.1"
FT                   /translation="MTGNEYQNLAMRTNDGLGTERLLDMADNLEQGLTDAMPETDIDLG
FT                   GLINGLFGLSGESGEFIDMIKKWIFHEKELDEDHAKKELGDVMWYVAMICESFGWSLDE
FT                   IMQMNIDKLKKRYPEGFDTERANNRKPEDV"
FT   CDS             9092..9355
FT                   /transl_table=11
FT                   /locus_tag="CL2_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37154"
FT                   /db_xref="GOA:D4MX09"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX09"
FT                   /protein_id="CBL37154.1"
FT                   /translation="MAKKGMLTRKQYKSIKKMDHNDMETWVESIYQSGYNDGRKSVPGI
FT                   DLEEVKKVILNIKGIGEKKAAAIIESLDINMAKKVESTQKEC"
FT   CDS             9539..9667
FT                   /transl_table=11
FT                   /locus_tag="CL2_00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37155"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX10"
FT                   /protein_id="CBL37155.1"
FT                   /translation="MGDRWEKQSRKPEQVEDNAKALGVCLEEADIVQMKKDIETLL"
FT   CDS             9690..10718
FT                   /transl_table=11
FT                   /locus_tag="CL2_00320"
FT                   /product="Predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37156"
FT                   /db_xref="GOA:D4MX11"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX11"
FT                   /protein_id="CBL37156.1"
FT                   /translation="MKLALIGTGKIIEDALFAMEPVESIERTAIFARSHSRDKAEKFAK
FT                   QYAIKEVYTDYEELLEKTEADTVYIGLINSAHYPYAKQALLAGKNVILEKPFTGFYEET
FT                   KDLEQIANDKKLFIFEAITVLHNEVFYEMKKNLNKLGNIRMALCNYSQYSSRYDAYLEG
FT                   DITHSFDPAYYGGSLYDINVYNIHYCVGLFGEPKDATYYPNIGPNGIDTSGTLVMEYDG
FT                   FSAVCTGSKDSDSPGYVCVQGEKGFMKVDSKPNIASELKTVYADENIKEKVKDAAGAMV
FT                   RATITEDYKAPEHYHRMTQEFTDFARVIDEKDYETAKEFLDETVAVVKVLETARKKAGI
FT                   EF"
FT   CDS             10747..11964
FT                   /transl_table=11
FT                   /locus_tag="CL2_00330"
FT                   /product="conserved hypothetical protein TIGR00275"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37157"
FT                   /db_xref="GOA:D4MX12"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX12"
FT                   /protein_id="CBL37157.1"
FT                   /translation="MKVIIIGGGAAGMMAAYQAAKCGNDVSLYEKNEKLGKKIFITGKG
FT                   RCNVTNACEIEELLDHVVTNKEFLYSGFYSFTNDAMMEFLEELGCPLKVERGNRVFPVS
FT                   DHSSDVIAALQRGLRKENVDIYFNTTVKKILIEDGIVTGVRLASGDTVKADKVVVATGG
FT                   MSYQATGSTGDGYDFARKAGHKVTKLTPALVPFEIKEDYCKQLMGLSLRNVAVTMTADG
FT                   KKIYDDFGEMLFTHFGISGPVVLSASSYIGKYQGKELKFIIDLKPALNKEQLDHRVLKD
FT                   FNKTLNKDFVNSLDHLLPKKLIPVMIELSGIPEHKKVNEITKKERERFVSLLKHLELTI
FT                   TGVRGFKEAIITQGGVNVKEIDPGTMESKKIKGLYFAGEVLDLDAVTGGFNLQIAWSTG
FT                   YLAGMN"
FT   CDS             11997..12659
FT                   /transl_table=11
FT                   /locus_tag="CL2_00340"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37158"
FT                   /db_xref="GOA:D4MX13"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX13"
FT                   /protein_id="CBL37158.1"
FT                   /translation="MYSIAIDGPAGAGKSTIAKTIAKKLEFIYVDTGAMYRAMALYFIR
FT                   HEIDPKDEEAINKACPDIHVSINYEDGVQQVLLNGENVNGLIRTEEVGNMASKTSAYKM
FT                   VRATLLDLQRDLAKTANILMDGRDIGTNVLPNADLKIYLTASSKVRAERRYKELVEKGV
FT                   EADFDKIEEDIIIRDRQDMEREIAPLKQAEDAVLVDSSDMTIEEVVDAIVAEFEKVK"
FT   CDS             12693..14591
FT                   /transl_table=11
FT                   /locus_tag="CL2_00350"
FT                   /product="(E)-4-hydroxy-3-methyl-but-2-enyl pyrophosphate
FT                   reductase (IPP and DMAPP forming)"
FT                   /EC_number="1.17.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37159"
FT                   /db_xref="GOA:D4MX14"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX14"
FT                   /protein_id="CBL37159.1"
FT                   /translation="MEVILAKTAGFCFGVKRAVDTVYKEAGKKNVYTYGPIIHNSEVVN
FT                   DLKKKGVEVINSREELEALEEGTVIIRSHGVAREIYDLIHEKGLELVDATCPFVRKIHK
FT                   IVEKAGNDGDQVIIVGSEHHPEVQGIKGWCTGEVHIISDAEQFEGIDLNKPTTLVSQTT
FT                   FNYKKFQDLVEILNKKGYDIGVCNTICNATEERQLEAKSIAKGVDAMVVIGDKQSSNSQ
FT                   KLYEISKKECENTFFVQTLRDLDLKLFESTGKVGITAGASTPQKIIKEVHASMTEKSFE
FT                   ELLEESFVTIHNGEVVKGTVIDVKPDEIILNIGYKADGILTRSEYSNDSANVDLTTVAK
FT                   VGDTMETKVLKVNDGEGQVLLTYKRLAAEKGNKRLEEAFENKEVLKAPVAQVLDGGLSV
FT                   LIEEARVFIPASLVSDSYERDLKKYEGQEIEFVISEFNPRKRRVIGDRKQLLVAAKKEK
FT                   QKELFEKIEAGMKVEGVVKNVTDFGAFIDLGGADGLLHISEMSWGRVENPKKVFNIGDK
FT                   VTVLIKDIQGEKIALSLKFPEENPWLKAEEKYKVGSVVTGKVARMTDFGAFVELESGID
FT                   ALLHVSQIAKEHIDKPSDVLSVGQEIEAKVVDFKKDDKKISLSMKALANEEEKTEE"
FT   CDS             14733..18194
FT                   /transl_table=11
FT                   /locus_tag="CL2_00360"
FT                   /product="pyruvate carboxylase"
FT                   /EC_number="6.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37160"
FT                   /db_xref="GOA:D4MX15"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX15"
FT                   /protein_id="CBL37160.1"
FT                   /translation="MELKKFKKVLVANRGEIAIRVFRALNELGITTVGVFSKEDRYALF
FT                   RSKADESYQLNPDKGPIDAYLDINTIIRIAKEKNVDAIHPGYGFLSENPDFVDACEKNG
FT                   ITFIGPSSSLMRKMGDKISSKQMAIEADVPIIPGVDHAVHGLEEVTKIANQVGYPVMLK
FT                   ASNGGGGRGMRIVHSAEEMPKEYAEARDESKKAFGDDQIFVEKYLKSPKHIEVQIIGDQ
FT                   YGHVVHLYDRDCSVQRRHQKVVEYAPAFSVPEEVRQQIFEASIRLAKHVGYKNAGTLEF
FT                   LVDADNNAYFIEMNPRVQVEHTITEMVTGIDIVQTQVLVAEGYSLDSEEIGIGSQEEVT
FT                   CNGYSIQTRITTEDPMNNFLPDTGKITVYRSGAGNGIRLDGGNAYAGAEITPYYDSLLV
FT                   KAISHDRTFGRAVDKSIRVLKEIRIRGVKTNIPFLINVLNNETFREGRCYTTFIEETPE
FT                   LFLLPESQDRATKILEFLGNKMVNVQKAVLDKPDFEARTLPKYDTEKKIYGSRDKFLEM
FT                   GAKDFTQSLLNEKRLLITDTTMRDAQQSLMATRMRTKDLIGASDATNAFMENAFSVEAW
FT                   GGATYDTAYRFLKESPWKRLKLLRQHMPNTLIQMLLRASNAVGYSNYPDNVVKKFIEEA
FT                   SQKGVDVFRIFDSLNWVENMKMPIETALKTGKIVEGTICYTGDITDPNETKYTLDYYVK
FT                   KAKELESLGVHIFTIKDMAGLVKPYAAKKLISALKEELNIPVNLHTHDSTGNGVSTLLM
FT                   ASEAGLDIADCAIGSMSSMTSNPCMNSLVEALKGTERDTGLNPDELTELSQYYARIRPI
FT                   YKQFESGMDAPNTEIYKYEIPGGQYSNLLAQVKEMGAAEDFEEIKGLYKDANQLLGNIV
FT                   KVTPSSKVVGDFAIFMFKNGLTKENILEVGKDLSYPDSVVEYFEGMIGQPEGGFPEELQ
FT                   KIVLKDKKPIDVRPGSLLPDEDFDYIAKGLKENFYTENMEDPDILSQKTLSYALYPKVY
FT                   EDYCRHFEAYNDVTGLESHVYFYGLRKGEETTLKLDEGKYLIIKFIDMTEPDEDGYRLL
FT                   DFEVNGSIREIKVLDKNLEVKTDRRVKADKSNPAHLGSTIPGTVGKVLVNEGDEVTVNM
FT                   PLMTVEAMKMETTVVSTVNGKVDKIYVKEGEQVNQEDLLISFEIDE"
FT   CDS             18324..18974
FT                   /transl_table=11
FT                   /locus_tag="CL2_00370"
FT                   /product="Protease subunit of ATP-dependent Clp proteases"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37161"
FT                   /db_xref="GOA:D4MX16"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX16"
FT                   /protein_id="CBL37161.1"
FT                   /translation="MKDNERQEIEKFGQLQENGIFTMTIIGEIEGHQLSAQNAKTTKYE
FT                   HMIPALAKVEQDESIKGILILINTIGGDVECGLAIAELIASLSKPTVSLVLGGSHSIGV
FT                   PLAVAADHSFIVKSATMMIHPVRSSGTFIGVIQSYRNIEKIQDRITTFISDHCKMKKER
FT                   VEELMLHIGQQVKDVGMILSGEEAVKEGLIDEMGGIKEATDRLIEIINQSENK"
FT   CDS             19097..20584
FT                   /transl_table=11
FT                   /locus_tag="CL2_00380"
FT                   /product="Iron only hydrogenase large subunit, C-terminal
FT                   domain"
FT                   /EC_number="1.12.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37162"
FT                   /db_xref="GOA:D4MX17"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027631"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX17"
FT                   /protein_id="CBL37162.1"
FT                   /translation="MRGIQTPVRNVRRRIFKEIAKFGYEQRNLQDLEDLPYEIVPGEVA
FT                   KYRDSIYRERAIVGERLRLAMGMSLNPADKPTRITKEIDESNISEKYYEPPLLQVIPSA
FT                   CNECKEKAFIVGEQCQGCMAHPCMEVCPKKAISFKDGYSYIDQEKCIKCGQCKKVCPYG
FT                   AIYERKRPCANACGVGAIETDYAGRAKINPDKCVSCGMCMVNCPFGAIADKSQIYQLIK
FT                   AMNEGAEVIAILAPAFVGQFGPKATPNKIKAALLDIGFADVWEVAVGADAGALEEAKHY
FT                   VQSVATGKLPFLLTSCCPSWSMLGKKYFPEVIDEISNALTPMVATARAARIASPNAKIV
FT                   FVGPCVAKKLEASRRTVRSEVDFVITFEELAGMFDAKEIDFNTYEKEEELNDAFGAGRG
FT                   YAVASGVAGAIKACIDEYYPGTEVKIDHVEGLADCKKMLLQAKAGKKKGYLIEGMGCPG
FT                   GCVAGAGTNIPVMKAQIQVKKFVKEAEDFVPPETAQY"
FT   CDS             20733..23132
FT                   /transl_table=11
FT                   /locus_tag="CL2_00390"
FT                   /product="DNA translocase FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37163"
FT                   /db_xref="GOA:D4MX18"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX18"
FT                   /protein_id="CBL37163.1"
FT                   /translation="MAAKKTRKRKTSSAKKRTRTRQKDFAPFYKEIAVLVVFALFIFLF
FT                   LSNFGICGYIGNSISTFFFGAFGTTHYIIPAVSFILAILLISNDYSSLAVKKTCFAILL
FT                   LCMVSTIFQMIYNIEVRDAYSAFVFSGRTHRGGGYLGALICSILYKELGGAGSVLVVLL
FT                   ISVISLILVTERSLLSFLKKAVDFFTVEGYEEDIEERLAKKKRKAKEVSKEDKETAPRK
FT                   KRSMHIPDLRSGRPKPSQASPMPPMEPEEKTKQTPIQKDFDDLIVQEETDKEPKEIFEP
FT                   VQPNASKKSFVNKDKNTPSKPVEILPQVRTKEGDYKFPPVSLLEKGKKTAGNNKEELRQ
FT                   TAQKLQKTLEDFGVHVTITNISCGPSVTQFELHPEQGVKVSKIVNLADDIKLNLAAADI
FT                   RIEAPIPGKSAIGIEVPNKTNQMVMFRELIENQEFAQARSKIAFAVGKNLAGQVIVSDI
FT                   AKMPHLLIAGATGSGKSVCINTLIMSILYKATPDEVKLIMIDPKVVELSAYQGIPHLLI
FT                   PVVTDPKQASSALNWAVMEMGERYKKFAEVNVRNLTGYNEKVEESIKNGMEGEDFKKLP
FT                   QIVIIVDELADLMMVAPGEVEDAIVRLSQLARAAGIHLVIATQRPSVNVITGLIKANVP
FT                   SRIAFSVSSGVDSRTIIDMNGAEKLLGKGDMLFYPSGYQKPIRVQGAFVSDEEVSKVVE
FT                   FLKEENNAEDSYGADIQEKIQTAAVKAATSQERDEYFEKAAEFIIDKDKASIASLQRVF
FT                   KIGFNRAARLMDQLCEAGIVGEEEGTKPRKVLMSEEQFEQYKEDYL"
FT   CDS             24871..25716
FT                   /transl_table=11
FT                   /locus_tag="CL2_00410"
FT                   /product="5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37164"
FT                   /db_xref="GOA:D4MX19"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX19"
FT                   /protein_id="CBL37164.1"
FT                   /translation="MQIIDGKKISQEIKDEVKEEVAQLKAEGKDIALAVIQVGADPASS
FT                   VYVRNKKRACEYVGIESVSYELPEETTQEELMAIVDKCNKDPKINGILVQLPLPKHLDE
FT                   DEVLLAIDPKKDVDGFHPVSVGNMVIGEKGFLPCTPAGVIQLLKRSGVEIDGKECVVVG
FT                   RSNIVGKPMAMLLLRENGTVTVCHSHTKDLKEVCKRADILVVAIGKPKFIDDSYVKDGA
FT                   VVIDVGIHRNENNKLCGDVDYDKVAPKTSAITPVPGGVGPMTIAMLMKNCVESKKLFGE
FT                   "
FT   CDS             25722..27068
FT                   /transl_table=11
FT                   /locus_tag="CL2_00420"
FT                   /product="SSU ribosomal protein S12P methylthiotransferase"
FT                   /EC_number="1.3.1.74"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37165"
FT                   /db_xref="GOA:D4MX20"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023970"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX20"
FT                   /protein_id="CBL37165.1"
FT                   /translation="MKILFISLGCDKNLVDSEVMLGLLTKHGYTLTDDETQADVIVINT
FT                   CCFIHDAKEESINTILEMAQYKEQNLKALVVAGCLAERYKDEILKEIPEIDAVLGTTSY
FT                   DSIVEAVNTALEENTGEHFEHYESIDYLPDNSEVERVVTTGNHMAYLKIAEGCDKRCSY
FT                   CIIPKIRGRFRSVPMQELLNEAKRLASEGVKELVLVAQETTLYGKDLTGEKQLPLLLHE
FT                   LCKIEGIEWIRLLYCYPEEITDELIKVIKTEEKVCNYIDMPIQHSENRILQRMGRRTSR
FT                   EDLVAVIKKLRKEIPDITIRTTLITGFPGESQEDHEGLMNFVEECQFDRLGVFTYSPEE
FT                   DTLAATFEDQIDEEVKEERRDELMSLQQEISYEHTQQLVGKTIKVMVEGYLFEDDIYVG
FT                   RSYMDAPKVDGCVFINSPEELMTGDFVYVKITQGREYDVIGEVDYEFTK"
FT   CDS             27052..27594
FT                   /transl_table=11
FT                   /locus_tag="CL2_00430"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37166"
FT                   /db_xref="GOA:D4MX21"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX21"
FT                   /protein_id="CBL37166.1"
FT                   /translation="MNLPNKLTILRTLMIPVFLFFLLTDCAGDYSKWIAVVVFILASLT
FT                   DFLDGHIARKYNLVTNFGKFMDPLADKLLVCSAMIALVGMHRLSSIVAIIIIAREFIIS
FT                   GFRLIASDNGIVIAASYWGKFKTNFQMFMIIMLIIDLGTSTAVMIENILIVIATALTII
FT                   SLVDYLVKNKQVLSEGN"
FT   CDS             27616..28482
FT                   /transl_table=11
FT                   /locus_tag="CL2_00440"
FT                   /product="Predicted nucleotide-utilizing enzyme related to
FT                   molybdopterin-biosynthesis enzyme MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37167"
FT                   /db_xref="GOA:D4MX22"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR020817"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX22"
FT                   /protein_id="CBL37167.1"
FT                   /translation="MTAEIICVGTEILLGNIVNTNAAYLSERLASLGISVFFETTVGDN
FT                   PERLENVIRQGLERSDILILSGGLGPTKDDLTKEIATKACGQELVEDEEALRRLKEYFA
FT                   RSHRNMTENNLKQALVPEDCTVLYNENGTAPGMVIHAKEGKKVVLLPGPPNELLPMFHD
FT                   QVEPIIKELSSEVLYSDVVKIDCMGESRVAAEIEDLIEKQTNPTVAPYAKLGEVHLRVT
FT                   AKAVSEDEAKKLVTPITEELYRRFGHKIFTTKEDETLEDVVVDMLSKHHIRSQQQNPVQ
FT                   QECLQQG"
FT   CDS             28464..28862
FT                   /transl_table=11
FT                   /locus_tag="CL2_00450"
FT                   /product="competence/damage-inducible protein CinA
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37168"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX23"
FT                   /protein_id="CBL37168.1"
FT                   /translation="MFTARLVNVAGASDVLNESFITYANEAKMKYLGVKEETLNTVGAV
FT                   SEDTARQMAEGVARQAGSNVGVGITGLAGPGGETPEKKAGLVYIGVSVNGKTKVNKYQL
FT                   NGNRQKVRETAVCRALTMVRHALVEEFL"
FT   gap             28929..29069
FT                   /estimated_length=141
FT   CDS             29147..30202
FT                   /transl_table=11
FT                   /locus_tag="CL2_00460"
FT                   /product="protein RecA"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37169"
FT                   /db_xref="GOA:D4MX24"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX24"
FT                   /protein_id="CBL37169.1"
FT                   /translation="MKQEEKLKALDAALVKIEKDYGKGSVMKLGEYQADRTIEVTPTGS
FT                   ISLDIALGVGGVPKGRIIEIYGPESSGKTTVALHMVAEVQKRGGIAGFIDAEHALDPVY
FT                   AKNIGVDIDNLYISQPDTGEQGLEITETMVRSGAIDIIIVDSVAALVPKAEIDGDMGDS
FT                   HVGLQARLMSQALRKLTGVVSKFNCTVIFINQLREKVGVMFGNPETTTGGRALKFYSSI
FT                   RLDVRRTETLKQAGEMIGNRTRIKVVKNKVAPPFKQAEFDIMFGKGISKYGDILDLAAD
FT                   ADIIHKSGAWYAYNGEKIGQGRENSKKYLEDHPDIAETVEHAIRVHYGLLEEDAENANN
FT                   DPKAEAQVSEE"
FT   CDS             30202..30804
FT                   /transl_table=11
FT                   /locus_tag="CL2_00470"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37170"
FT                   /db_xref="GOA:D4MX25"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX25"
FT                   /protein_id="CBL37170.1"
FT                   /translation="MIITKLDKVGTKQVRLFFDEEKYCLLYYNEIRRLGFHEQDEIGQE
FT                   EFEELNKLLLHRAKLKAMSLLKYQDRTKKELKERLMRAEFPEFITEGAVAYVESFGYIN
FT                   DEEYVRRYMEYKSGSKSKIQIKMDLRKKGITAETLERVFEEYEYEEDDILEEQVKKRIR
FT                   QKGSVTKENFQKYYGYFARKGFNSGKILDLLRKYMED"
FT   CDS             30976..31569
FT                   /transl_table=11
FT                   /locus_tag="CL2_00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37171"
FT                   /db_xref="InterPro:IPR029002"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX26"
FT                   /protein_id="CBL37171.1"
FT                   /translation="MRKKSHISLAGQIMDSMELDNVFDYRLPFYVGSIWPDCRPSFVTT
FT                   PHKFDITFDDIERKISKFIANYDKDKGMNMRRCAGLGVIIHYIADYFTFPHNDHYPGNV
FT                   KDHCYYERDLKFGMRAFLQTEEAAQIKEHVAAYDSVEELTSYIRSIHNSYMKLAHTVEE
FT                   DIRYIVHACTTVVKSVMNMVSYAVGTSVMNIQYV"
FT   CDS             31755..32414
FT                   /transl_table=11
FT                   /locus_tag="CL2_00490"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37172"
FT                   /db_xref="GOA:D4MX27"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX27"
FT                   /protein_id="CBL37172.1"
FT                   /translation="MVNIMVVEDEKPISNLIALSLKKAGYHSECAYDGLEAIDMLEKNY
FT                   PDLILLDIMLPGADGFEILEYVKPLEIPVIFLTAKGDLNDRVNGLRYGAEDYIVKPFEI
FT                   MELLARIEVVLRRYHKLDRIINILGLEIDTDAMCVKKEGKEINLTKKEYDTLLLFARNP
FT                   GNVLFREIIYERVWGGDYIAGSRTVDLHVQRVRKKVGWEDFLITVPKMGYRLEVPR"
FT   gap             32928..33827
FT                   /estimated_length=900
FT   CDS             34730..35551
FT                   /transl_table=11
FT                   /locus_tag="CL2_00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37173"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX28"
FT                   /protein_id="CBL37173.1"
FT                   /translation="MKKQIRNALLVVAALLLVVLFYFLPNIQAALVDKKTFGQSEDLSL
FT                   NPVEISVEATQTTLEKLKIINNHILSVAVRPSSRTVDGRDVEKTAKKQTNLLLKKMKIA
FT                   YRVDEDWKITYKKLYTYIKKKDDMIDEGSVSNISNVKNLLVWYITLSPESSEDEIVNLI
FT                   MDAYTDQILAIDVYSYDYTKDWKDIADHLEDIPAGFLSYLNLKQSEYNLKKRLMGNVNV
FT                   TEQYQKAKSAKGSYSQISGRIGIYAIQNKKQTYIPIEWSGYGFMINNVYNN"
FT   CDS             35653..36867
FT                   /transl_table=11
FT                   /locus_tag="CL2_00530"
FT                   /product="Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37174"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX29"
FT                   /protein_id="CBL37174.1"
FT                   /translation="MSNINISYKELKQLEKGSYQLLDMRDESNTSYGMIPGAVVAAGED
FT                   ELGTQAKEYIDQGKKVILYCTKGIFSKEAAEKLAEEGINVLSLEGGYTGWLLSLMKEEQ
FT                   ENDQKTEQNNKEAEGKGKKKELTRTQEIEKSIRKKFHKQIFSKFVKAIKTYDLVQENDK
FT                   IAICISGGKDSMLMAKLFQELKRHNKFHFDLVFLVMDPGYNEMNRQIIENNAKLLDIPI
FT                   TVFESDIFDAVYEIEKSPCYLCARMRRGYLYSKAKELGCNKIALGHHYDDVIETILMGM
FT                   LYGAQVQTMMPKLHSTNFEGMELIRPMYLIREDDIKHWRDYNGLHFIQCACKFTDTCTT
FT                   CNPDGVTKSKRMETKQLIAKMKEINPYVESNIFKSVENVNLKTIIAYKKDGVKHSFLDT
FT                   YDQEN"
FT   CDS             complement(36930..38558)
FT                   /transl_table=11
FT                   /locus_tag="CL2_00540"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37175"
FT                   /db_xref="GOA:D4MX30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX30"
FT                   /protein_id="CBL37175.1"
FT                   /translation="MIQANNVTLRLGKRALFEDVNIKFTEGNCYGLIGANGAGKSTFLK
FT                   ILSGEIEPSKGDVSITSGQRLSVLKQDHYQYDDHIVLDTVMMGNQRLYEIMKEKEALYA
FT                   KEDFTDEDGIRASELEGEFADMNGWEAESDAATLLNGLGIPSDIHYTKMADLNGSQKVK
FT                   VLLAQALFGNPDILLLDEPTNHLDLDAIYWLEEFLINFDNTVIVVSHDRYFLNKVCTHI
FT                   ADIDYAKIQLFSGNYDFWYESSQLLTKQMKEANKKKEEKMKELQDFIARFSANASKSKQ
FT                   ATSRKKALDKIQLDELKPSSRKYPYINFKPNREIGNDALVVENLTKTIDGVKVLDNISF
FT                   LMKPTDKIAFVGPNTLAATTLFKILSGEMEPDSGSYKWGVTTTQSYFPKDNTKDFSQDE
FT                   TIVEWLTQYSEDKDATFVRGFLGRMLFSGEDALKKVGILSGGEKVRCMLSKLMISGANI
FT                   LLLDEPTNHLDMESITALNEALKDFTGALLFTSQDHQFVQTTANRIMEITPNGLIDKEC
FT                   TYDEYLENDEAARKRQIVEIEEDDE"
FT   CDS             38730..39083
FT                   /transl_table=11
FT                   /locus_tag="CL2_00550"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37176"
FT                   /db_xref="GOA:D4MX31"
FT                   /db_xref="InterPro:IPR007394"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX31"
FT                   /protein_id="CBL37176.1"
FT                   /translation="MERIVEQNLLYDFYGELLTAHQKEIYGEHILNDMTATEIAAEFGI
FT                   TRQAVHDMIRRCDKILADYEARLHLVAKFLTAKEKIKEIHTLSRRLLKEDKEQMEEDIR
FT                   QIESVCNQVLEDL"
FT   CDS             39102..40442
FT                   /transl_table=11
FT                   /locus_tag="CL2_00560"
FT                   /product="signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37177"
FT                   /db_xref="GOA:D4MX32"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX32"
FT                   /protein_id="CBL37177.1"
FT                   /translation="MAFESLSEKLQGVFKNLRSKGRLTEDDVKAAMREVKRALLEADVN
FT                   FKVVKTFIKSVQERAVGQDVLNGLNPGQMVIKIVKEEMEALMGSTMTEIQLRPGNEITI
FT                   ILMAGLQGAGKTTTCAKLAGQYKKKGKRPLLVACDVYRPAAIKQLQVNGEKVGVPVFTM
FT                   GDKQNPVDIAKASVEHAQKNGNNIVILDTAGRLHIDENMMTELVEIKENVDVFQSILVV
FT                   DAMTGQDAVNVAKEFNEKVGVDGIIITKMDGDTRGGAALSIRSVTGKPILYVGMGEKLE
FT                   DLQQFYPDRMTSRILGMGDVLSLIEKAEQTINEEDALRMTEKMKKAEFDFNDFLDQMDQ
FT                   MKKMGGLSNLLSMIPGVGNKMQGLDIDDGMMDKTAAIIYSMTKEERANPKIINASRKRR
FT                   IAAGAGVPIAEVNRLCKQVQNQKQMMKQMSGMFGGKGGKRGGFKLPF"
FT   CDS             40509..40754
FT                   /transl_table=11
FT                   /locus_tag="CL2_00570"
FT                   /product="SSU ribosomal protein S16P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37178"
FT                   /db_xref="GOA:D4MX33"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX33"
FT                   /protein_id="CBL37178.1"
FT                   /translation="MAVKMRLKRMGQKKAPFYRVVVADARSPRDGRFIEEIGTYDPNQD
FT                   PSVIKFDEEAAKKWLATGAQPTDTVAKLLKAAGIEK"
FT   CDS             40780..41007
FT                   /transl_table=11
FT                   /locus_tag="CL2_00580"
FT                   /product="RNA-binding protein (KH domain)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37179"
FT                   /db_xref="GOA:D4MX34"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX34"
FT                   /protein_id="CBL37179.1"
FT                   /translation="MKHLLEVIAKALVDQPDKVTVTEKETADAVVLELHVAEGDMGKVI
FT                   GKQGRIAKAIRTVVKASVDKGDKKIVVDIQ"
FT   CDS             complement(41135..41605)
FT                   /transl_table=11
FT                   /locus_tag="CL2_00590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37180"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX35"
FT                   /protein_id="CBL37180.1"
FT                   /translation="MNQNTVTGDYININLRQLGATSIKEFNSIMHIAEFDLGDGLIVSY
FT                   VFNITRHNKYFLQRMQPYAMVHGKFASDQEIIDFITADLKRFENAKNSHNFNTFLLISH
FT                   LGHHITENIEQLFLNYNVDADKLESIEDSLEESLVEIQSLFEKSDKLDLPED"
FT   CDS             complement(41650..42918)
FT                   /transl_table=11
FT                   /locus_tag="CL2_00600"
FT                   /product="possible tyrosine transporter P-protein (TC
FT                   2.A.45.2.1)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37181"
FT                   /db_xref="GOA:D4MX36"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX36"
FT                   /protein_id="CBL37181.1"
FT                   /translation="MSLQQIIAIIIFLCTMGAIITGKVHNTVASLTGAACLVLTHILSI
FT                   EDCIDAVDVETICILVGMMLLVAVIKNSGIFEYIAIKAAKIAKGRPWPIMVIFILITAV
FT                   CSGMLDNVTTVLLVGPMTLAITNILKVDPVPYIITQIMASNIGGTATLIGDPPNIMIGS
FT                   AAKLSFVDFILNTGVATVFVIIVGLICMYFIYGRKLFVTDESIAKVMQLDENKAIKDRK
FT                   LMHESVIVIILVALCFIFHDQLGVQSCTVAIAAACIMLLIGGQEPEEIIADVEWPTILF
FT                   FIGLFIVVGGMKKVGVITMLANGLISITHGNMVVTMMVILWVSAIVSSFLDNIPFVATL
FT                   IPMILTMQSEGMDVAPIWWALSLGACLGGNGTLIGASANVVLSGISKNNGHPITFGQYF
FT                   KIGFPMMILSIIVCSVFLLIRFA"
FT   CDS             complement(43063..43263)
FT                   /transl_table=11
FT                   /locus_tag="CL2_00610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37182"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX37"
FT                   /protein_id="CBL37182.1"
FT                   /translation="MENQNKVYQEVAEECSQYCPCGCDHSVKNVSTGDDTKAPSCLNCK
FT                   HFSVSEQHCQLDLYDQIVTNL"
FT   CDS             complement(43357..43836)
FT                   /transl_table=11
FT                   /locus_tag="CL2_00620"
FT                   /product="LuxS protein involved in autoinducer AI2
FT                   synthesis"
FT                   /EC_number="4.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37183"
FT                   /db_xref="GOA:D4MX38"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX38"
FT                   /protein_id="CBL37183.1"
FT                   /translation="MEKIASFTINHLKLLPGVYVSRKDAVGSETLTTFDLRMTAPNREP
FT                   VMNTAEMHAIEHLAATYLRNNKEWQDKIIYFGPMGCRTGFYLILAGDLTSKDILPLIIS
FT                   TFEFIRDFKGDVPGASAKDCGNYLDMNLPMANYLADHYLKNALYVADDKNLNYPE"
FT   rRNA            44196..45716
FT                   /gene="16S"
FT                   /locus_tag="CL2_R_32030"
FT                   /product="16S rRNA"
FT   gap             45792..46210
FT                   /estimated_length=419
FT   rRNA            46407..49292
FT                   /gene="23S"
FT                   /locus_tag="CL2_R_32020"
FT                   /product="23S rRNA"
FT   CDS             50542..52035
FT                   /transl_table=11
FT                   /locus_tag="CL2_00640"
FT                   /product="Phage Mu protein F like protein."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37184"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX39"
FT                   /protein_id="CBL37184.1"
FT                   /translation="MFLFRKVKKRGSMKPNDVKEALERFLNSSSPELTRLLVRYWKDQQ
FT                   TVFTFKEIREAIQAGVISKKSVEEWQQDYSKLVHDKIAPEMVKAMKAGAKNQNQHKGID
FT                   IGYKFDADHWAVSDWLENHTAELVTNCTRVQKDAIQSMIDIGIRKHMGTDELARFIRPC
FT                   IGLTKPQTQAAMKYYETIKAELEKKHPRTKPEKIEQMARDKQMKYAERQLRERAKTIAQ
FT                   TERAFAYEYGRYQHTKNLVDQGILPPQDKKWSATDSENTCSTCRELNGKVVGMDEEFAP
FT                   GKLLPPLHPRCKCCVMYVNSKSMAAEYETEEDELREYSTEEIETHANKMSEIADKHLDL
FT                   ESSWSGKVVVDDDSGVYGIQWNGDIITRHETAPHILLHEQLHARSVTKYDHKMYKQYEN
FT                   MEEGSVQFAAQEISKKENIQILESQYDHMTEALRNINKVAGLFKNDYDFAMKLISVPLP
FT                   DRYDWLNNMIYDKMMLSGNIEDYQKVSHWMEALENGKTS"
FT   CDS             52019..52267
FT                   /transl_table=11
FT                   /locus_tag="CL2_00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37185"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX40"
FT                   /protein_id="CBL37185.1"
FT                   /translation="MEKHLELKERFDQLMKQDMDVSEHEQEWFELLDDMHEWLKDKTIP
FT                   RNIRRQFEPLGMLEVTMKICDGIHYANGTGRYAKKEE"
FT   CDS             52267..52566
FT                   /transl_table=11
FT                   /locus_tag="CL2_00660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37186"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX41"
FT                   /protein_id="CBL37186.1"
FT                   /translation="MKYKAIEQTVQAVQITPDIDMIAPDWFTKKMNTEEIMIDRVQKDG
FT                   ATAVIGCTVYFNARRYKGSRLVARIGDYVVKDSVGRLNVVRKNDFDRLYKKEEA"
FT   CDS             52563..53027
FT                   /transl_table=11
FT                   /locus_tag="CL2_00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37187"
FT                   /db_xref="InterPro:IPR027924"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX42"
FT                   /protein_id="CBL37187.1"
FT                   /translation="MRYFNDYIRSPAQTQDSIRKSLNRVDITKKDEEKQYVFGWAKIAV
FT                   DENGNQLIDRQNDLIDPEELEQTAYTYVEFYREAGEMHERGGAGVLIESIIFTKEKMKT
FT                   LGIEEGTLPEGWWVGFHITDDDVWAKIKDGTYTMFSIEGKAKRIEVEEDE"
FT   CDS             53027..53521
FT                   /transl_table=11
FT                   /locus_tag="CL2_00680"
FT                   /product="Protein of unknown function (DUF2829)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37188"
FT                   /db_xref="InterPro:IPR021361"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX43"
FT                   /protein_id="CBL37188.1"
FT                   /translation="MEFRDAFKIMKSGGKVKLPSWGGYWFWDVEKQSIMMHTKDGEDID
FT                   IRETKCPEYTFGNITSDEWMIADEENCPELGGAAYFDFSNAIKYLKRGLKVARKGWNGK
FT                   KQYIQLATCISYTAADGTIVNCDHNDIGNKAIAFIGTSGVQMGWLASQADMLANDWMFA
FT                   D"
FT   CDS             53947..55065
FT                   /transl_table=11
FT                   /locus_tag="CL2_00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37189"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX44"
FT                   /protein_id="CBL37189.1"
FT                   /translation="MKTKGKTKLEDLEVKKIDAVDIGADQKANILIKKRGGAEEPKGNF
FT                   FKRFFNAFCDSLGVNSEDVRKSMEDEATSFDDVMNEKKIYDVRDQIWNACNSLEQSIVS
FT                   ILLDKECEDKQAAIAQSIDQFKAFSDDASKSWIKLERAATDKEDTVVADDFEIAKMQEV
FT                   IEKSCDPETINKEKKEKENEMAFDISNMTEEEKKEALKALQDDANAKKEDTAKRADIDG
FT                   QVQEAVNKAMEGVTKDFTSMMKKIMEPIQKRAEEAEQKSLEEVAKKYELLGTKAEELVP
FT                   VLKSMKATSDEAYNNFIASMDNNLAVIQKSGLFEEIGKSGGAHTGNDDTEGVAKMNAKV
FT                   AEIKKSMPNLTDAQAQDIVMQNDPELRAMFDK"
FT   CDS             55085..55474
FT                   /transl_table=11
FT                   /locus_tag="CL2_00710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37190"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX45"
FT                   /protein_id="CBL37190.1"
FT                   /translation="MANRTYEYNPTGGSPVINVTAGAELKTAVAVLLTKDGAKIPEAGK
FT                   EATGIVLLGDETVAKGDDITVQIRNQGMWAAGAKIEAGDFLAVDAEGLCQKATTGQYIL
FT                   AMALTPATAKGDIVNVAIIHAGYEA"
FT   CDS             55495..56529
FT                   /transl_table=11
FT                   /locus_tag="CL2_00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37191"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX46"
FT                   /protein_id="CBL37191.1"
FT                   /translation="MNTGHNNAAAIAVDIAKGWRPNYYLTNMAMSYFQAPGMNVAPSIF
FT                   PILPVHASTGSYYIFNKEEIAKDQVKRKPKFGAVDPAVFSHSDDTYKCEVDQIIVGVDN
FT                   ITALDYQRTGAPATIDPRRAKVKQVSEQMNLHLDMVFANKFFNADAWANVKTGEATAST
FT                   SKQFVHFDDANADIVGQFDEMKKEILLNGRRMPNKLCLGYRAYKAIKNHPQFLERVTGS
FT                   GSTPNPALVNEQVIAAVLGLEEVKVLYATYNAAEIGQKADMKFVFDDNSALLTYAPKEV
FT                   DLEEPSAGYIYTWDMLGNGQWMATSQYDGPGGSHSEFIEGLMATDMKKTSDDLATFLSG
FT                   CVSE"
FT   CDS             56542..57033
FT                   /transl_table=11
FT                   /locus_tag="CL2_00730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37192"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX47"
FT                   /protein_id="CBL37192.1"
FT                   /translation="MNYVALKPVNFGGKQYKIGETIPEGVVDERRSLFLKKSGHIAEVA
FT                   SVNGAYAEDLNVNPNTLSIPLLQSKHELAVNAQQLLQFFATIQKTMEEAKIEIATMTEE
FT                   DTPILQLLHEIDSRKGIKAAVETRLADLSVDTDINQESEAVEETEEPAEQPEGGEENDV
FT                   "
FT   CDS             57023..57418
FT                   /transl_table=11
FT                   /locus_tag="CL2_00740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37193"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX48"
FT                   /protein_id="CBL37193.1"
FT                   /translation="MTYNYFPDEINTNDVMKMRFELADTDVSKDEMSAALSDEEITAVL
FT                   EQYPDNFKMAKLKLLEHMMFKYGQDVDNSVGPVSFNFGNRMNFWKQLYDDLKKEIASSS
FT                   VGIKPYENEKREYFYVGMMNHPGGGRF"
FT   CDS             57782..58192
FT                   /transl_table=11
FT                   /locus_tag="CL2_00760"
FT                   /product="Bacteriophage protein of unknown function
FT                   (DUF646)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37194"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX49"
FT                   /protein_id="CBL37194.1"
FT                   /translation="MGVEAEFQACAKNLDESIKREMMRKGAMATNTLRNIEIEVLSKGG
FT                   SGKKYKRLPNRSSAPGETPAPQSGKLRQDWDDQTLIEGDQVTSRIKSNSKHAEWLEGGT
FT                   KKMAKRPFIDPIKKKAEPEIVKIFGSDFEVTL"
FT   CDS             58189..59055
FT                   /transl_table=11
FT                   /locus_tag="CL2_00770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37195"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX50"
FT                   /protein_id="CBL37195.1"
FT                   /translation="MKEIIYKYLKSLNINGLAAFKNGPAIFLDQAPDDSDSRWDGSQYG
FT                   RIIYGLNLKDDSERKVSGTMEIAIAYLFNNQGYKNLLEAKKILKKAFEGVFLTDEDTTI
FT                   SLVWRKSESFQEAIEGQMDVEVCGSVLTFDAYAFPKHSYLPLDAVGSLAKHIDENWNVT
FT                   VINNTELDEIWKPDDEEVVVYTRLDSMQPGTFPSTYACTWFTNNIKVHVISGSDVNADQ
FT                   FVMNLLQDLQERERFVMNDGSPFFVNQLAYSTKLDPLKDGQVTVRGQYGKLRDVETVDE
FT                   LKTITIS"
FT   CDS             59065..59259
FT                   /transl_table=11
FT                   /locus_tag="CL2_00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37196"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX51"
FT                   /protein_id="CBL37196.1"
FT                   /translation="MAEKKDETKTVPEVTYTVDEYVENPQVLGVSQDIIRTAFARAGVK
FT                   EATQSTAKKLVDTFKKKEV"
FT   tRNA            complement(61021..61108)
FT                   /locus_tag="CL2_T_32010"
FT   CDS             complement(61208..61762)
FT                   /transl_table=11
FT                   /locus_tag="CL2_00800"
FT                   /product="hydro-lyases, Fe-S type, tartrate/fumarate
FT                   subfamily, beta region"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37197"
FT                   /db_xref="GOA:D4MX52"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX52"
FT                   /protein_id="CBL37197.1"
FT                   /translation="MEKHLNVPANTEELAELKAGDYVYLTGTIYTARDAAHKRMYETLL
FT                   DGKELPVDVKGQFIYYLGPTPAREGQVIGSAGPTTSSRMDKYTPTMLDQGLKGMIGKGK
FT                   RSSEVIESIKQNGAVYFAAVGGAGALLSKCIKEAEVIAYDDLGTEAIRKLRVENFPVIV
FT                   VIDNQGNNLYETAVENFKKLK"
FT   CDS             complement(61838..62680)
FT                   /transl_table=11
FT                   /locus_tag="CL2_00810"
FT                   /product="hydro-lyases, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha region"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37198"
FT                   /db_xref="GOA:D4MX53"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX53"
FT                   /protein_id="CBL37198.1"
FT                   /translation="MRTIHTDEIIKNIKEMCIEANLSLTEDMKCRFKNATESEKSPLGK
FT                   QILNQLQENMEIAAADQIPICQDTGMAIVFLNIGQDVHIEGMDLHDAVNEGVRQGYTEG
FT                   YLRKSVVKDPLIRENTKDNTPAIMHIDIVPGENLEILVAPKGFGSENMSRIFMLKPADG
FT                   EKGIKKSVIQAVKDAGPNACPPMVVGVGLGGSFEKAAFLAKKALTRNLDTPSEKPHIAK
FT                   LEKELLEEINQLGIGPGGLGGSTTALGLNIETYPTHIAGMPLAVNICCHVNRHAHRVL"
FT   CDS             complement(62832..65315)
FT                   /transl_table=11
FT                   /locus_tag="CL2_00820"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37199"
FT                   /db_xref="GOA:D4MX54"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX54"
FT                   /protein_id="CBL37199.1"
FT                   /translation="MDENTIFDKVHDIDLKKTMENSYIDYAMSVIASRALPDVRDGLKP
FT                   VQRRILYAMIELNNGPDKPHRKCARIVGDTMGKYHPHGDSSIYGALVNMAQEWSTRYPL
FT                   VDGHGNFGSVDGDGAAAMRYTEARLSKISMELLADINKNTVDFRPNFDETEKEPAVLPS
FT                   RFPNLLVNGTQGIAVGMATNIPPHNLREVINAVIKIIDNQVEEDRETTIEELLEIIKGP
FT                   DFPTGATILGRSGIDQAYRTGRGKIKVRAVTDIEAMANGKQRIIVTELPYMVNKARLIE
FT                   KIATLVREKKVEGITELRDESDRSGMRICIELRRDANANVILNQLYKHTQLQDTFGVIM
FT                   LALVDGQPKTMNLHEMLDYYLTHQKDVVTRRTRYELNKAEERAHILEGLLIAQDNIDEV
FT                   IKIIRGAENIQAAKLELMERFGLSDAQAQAIVDMRLRALNGLERAKLEKEYKELMERIG
FT                   ELKAILADEKKLLGVIKDEIALIRDKYGDERRTQIGFDVDDISMEDLIPRENTVITMTK
FT                   LGYIKRMTVDNFKSQNRGGKGIKGMQTIDEDYIEELFMTTTHHYIMFFTNTGRVYRLKA
FT                   YEIPESGRTARGSAIVNLLQLQPGEKITAVIPLVDYEEGKYLLMATKYGVVKKSSIMEY
FT                   ANIRKTGLAAITLKDDDQLIEVKYTEDDEDVFLVTKNGQCIRFHESDVRCIGRTSMGVR
FT                   GINLTGDDEVIGMQLDSQGEALLIVSANGMGKRTLTSEFTTQHRGGKGIKCYKITEKTG
FT                   DVVGVKAVNDDNEIMMITTEGIIIRTAVDSISILGRNTSGVKVMNVGENVEVASIAKVR
FT                   EEKLEDEMEKNTTEE"
FT   CDS             complement(65330..67252)
FT                   /transl_table=11
FT                   /locus_tag="CL2_00830"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37200"
FT                   /db_xref="GOA:D4MX55"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX55"
FT                   /protein_id="CBL37200.1"
FT                   /translation="MGTQKNGEYGADQIQILEGLEAVRKRPGMYIGSTSEKGLHHLVYE
FT                   IVDNAVDESLAGFCDTIIVTLNKDGSVTVEDNGRGIPVGINKKKGVSSVEVVFTILHAG
FT                   GKFGGGGYKVSGGLHGVGSSVVNALSDWLEVTVCKEGHIHKQRYERGKVCYPLKVLGDT
FT                   DKTGTTVTFYPDATIFETIDFDYNTLKRRLRETAFLTKNLKIVLTDDRGEEQVSETFHY
FT                   EGGIKEFVTYLNKGKEALYPDVIYCEGEKDGVYVEVAFQHNDSYNETSLSFVNNIITPE
FT                   GGTHLSGFKMALTSTFNDYARKNNLLKEKEDNLSGEDIREGLTSVISIKIGEPQFEGQT
FT                   KQKLGNSEARGAVNSILSEQLKYFLEQNPQVAKIICEKAVLAQRARDAARKARDLTRRK
FT                   TALDGMSLPGKLADCSDKNPENCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILNVE
FT                   KARLDKVLVNKEIQAMITAFGTGIHEDFDIEKLRYHKIIIMTDADVDGAHIATLLLTFI
FT                   YRFMPELIKKGYVYLAQPPLYRVEKNKKFWYAYSDEELNNILQEIGRDNNNKIQRYKGL
FT                   GEMDAEQLWDTTMDPEKRILLRVNLDEDSASEIDLTFTTLMGDQVEPRREFIEANAKYV
FT                   QNLDI"
FT   CDS             complement(67262..68347)
FT                   /transl_table=11
FT                   /locus_tag="CL2_00840"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37201"
FT                   /db_xref="GOA:D4MX56"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX56"
FT                   /protein_id="CBL37201.1"
FT                   /translation="MIIKSLELKNYRNYDELSMNFASGTNLLYGDNAQGKTNILESIYL
FT                   SATTKSHRGNKDRELIKFEENEAHIRIHFEKQGIDHQLDMHLKKNKAKGVAIDRIPIRR
FT                   SSDLLGQIPVILFSPEDLKIVKSGPSERRKFLDIELSQMERLYLYQLTNYNKILVQRNN
FT                   LLKQIRFQNNLIETLEAWDIQLVKYGSEVIKYREKFIKHLGEVCQKIHNKLTGGKEKIL
FT                   LEYDRDVGYDSYLTELAKKRQKDLKYSTTTVGPHRDDISFIVNGIDIRKYGSQGQQRTA
FT                   ALSLKLAQIQLMREVMKESPILLLDDVLSELDSNRKTYLLESIKDTQTIITCTGLDEFI
FT                   SKHLPIQRMFQIKAGKIVKEN"
FT   CDS             complement(68359..68565)
FT                   /transl_table=11
FT                   /locus_tag="CL2_00850"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37202"
FT                   /db_xref="GOA:D4MX57"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX57"
FT                   /protein_id="CBL37202.1"
FT                   /translation="MEIKLKDEFIKLGQALKAAGLVDSGVVAKIVIQDGEVLVNGEVET
FT                   RRGKKLYGGEVVSFDGQEIHIVK"
FT   CDS             complement(68581..69684)
FT                   /transl_table=11
FT                   /locus_tag="CL2_00860"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37203"
FT                   /db_xref="GOA:D4MX58"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX58"
FT                   /protein_id="CBL37203.1"
FT                   /translation="MKIICTKSDLVHAVSIVSKAVSNNTTLPILKCILIEASTGNIKLT
FT                   ANDMELGIETTIDGQIHQPGKIAIEAKLFSEIVRKLPDNDITIETDDQYKATITCEKAC
FT                   FQIMGQEGEEFPSLPEIEKNQSITLSQFSLKEVIRQTIFSISDNENTKLMTGELFEVKD
FT                   DQLSVVSLDGHRISIRHIELKDHYDPFKVVVPGKTLQEIVKIISGEMDENVSIYVTSKH
FT                   ILFEFDNTRVVSRLLEGEYYKISQMLSSDYETKITINKKEFLNCIDRASLLIRESDKKP
FT                   IIIDIADHSLKLNINSFFGSMEEEILIQKEGRDLLIGFNPKFLMDVLRVIDDEEINIYL
FT                   VNPKAPCYIKDDAGTYNYLILPVNFNH"
FT   CDS             complement(69967..71310)
FT                   /transl_table=11
FT                   /locus_tag="CL2_00870"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37204"
FT                   /db_xref="GOA:D4MX59"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX59"
FT                   /protein_id="CBL37204.1"
FT                   /translation="MLSMKNEIEKIWDDVLVKLEQEHDVSSAAINAWIKPLHIKDVQSN
FT                   KIILSLDAKYDERGIQFIKKKMYDFYISLAISDLTGKKYDIEFELEKEGEKPQETPAAA
FT                   PEHDNNNLNPRYTFDTFVIGDNNRMAHAASIAVAEAPAEAYNPLFLYGGAGLGKTHLMH
FT                   SIAHYIIEHNSSLNVLYVTSEDFTNEVINSIQHKKQEELRSKYRNIDVLLVDDIQFVIG
FT                   KESTQQEFFHTFNALYNSKKQIILSSDKPPKELDVLEERLRSRFSWGLPVDIQPPNYET
FT                   KVAILRKRAELDNIYIDDEIFDYIATHIKSNIRDLEGALNKIKVYSKLNKKPIDLELSK
FT                   IALQDLIDNKTKQAITPELIMQTVAEHFNIQTSDIISKKRSHDIAYPRQICMYLCKKMT
FT                   DQSLVKIGEIIGKRDHSTVIHGIEKIEKDLDKDPELSKVIDVITKKMD"
FT   CDS             71717..71851
FT                   /transl_table=11
FT                   /locus_tag="CL2_00880"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37205"
FT                   /db_xref="GOA:D4MX60"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX60"
FT                   /protein_id="CBL37205.1"
FT                   /translation="MKMTFQPKKRQRSKVHGFRKRMSTANGRKVLKSRRAKGRNRLSA"
FT   CDS             71901..72239
FT                   /transl_table=11
FT                   /locus_tag="CL2_00890"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37206"
FT                   /db_xref="GOA:D4MX61"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX61"
FT                   /protein_id="CBL37206.1"
FT                   /translation="MKNYHSLRNNREFQMVYNEGNSKANRYLVLYYRKNDLEYNRLGIS
FT                   VSKKVGNSVVRHRTTRLIRESYRLNQDNLKTGYDMVVIARQTAKGQNYHTIESAFLHLI
FT                   DLHHLKKS"
FT   CDS             72485..73486
FT                   /transl_table=11
FT                   /locus_tag="CL2_00910"
FT                   /product="membrane protein insertase, YidC/Oxa1 family,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37207"
FT                   /db_xref="GOA:D4MX62"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX62"
FT                   /protein_id="CBL37207.1"
FT                   /translation="MMLLAQAQQSTGNGGILAPFVIIFGWIIRAIYDGLAAMGIYNVGL
FT                   CIILFTLVSKLILLPVTMKQQRSMKINQHMQPEINKITKKYRNKRDQASMMKQQEEMQK
FT                   VYAKYGSSPTGGCLPTLIQFPIIMALYYVIRGVNTYIPQIARDVQFKPNLFLGMDLNSA
FT                   PGFRLTPLLIIPVLSFIFQFLSAKTSMSTTQMDDSTPGAGMTKSMMYTMPLMSFVMCIS
FT                   LPIGIGLYWSASALFQYIQQVAFNYHYDHADMDKIIEKSREKAAKKKKKKGPSLYEKML
FT                   GMQAEQQGQQGADSNIKKSANLKSTQNIEYSGNSKGGIASKANALNKNKGGK"
FT   CDS             73489..74295
FT                   /transl_table=11
FT                   /locus_tag="CL2_00920"
FT                   /product="Predicted RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37208"
FT                   /db_xref="GOA:D4MX63"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX63"
FT                   /protein_id="CBL37208.1"
FT                   /translation="MSAKRFTGKTESDAVMNAAMELGIPSTDLKYTVIDSGSNGFLGLF
FT                   KKPVIIEIKEEEKETEVMKSQTIEKEQPKKKAEKKPSKKVDEKSNRQPKKSPKVKDEVP
FT                   VKEPRKNKTPENIDQIVKDTEKYLDEVLRAMGLDPKLNLYYNRRDNVLNINVSGEKMGA
FT                   LIGKHGQTLDALQYLISLYVNKESDSFVKIKLDTENYRERRQQTLEKLAGSIAYKVKKN
FT                   KKPIYLEPMNPNERRIIHSALQRDPEVITKSEGKDPYRKVVVMLKK"
FT   CDS             74344..75720
FT                   /transl_table=11
FT                   /locus_tag="CL2_00930"
FT                   /product="tRNA modification GTPase trmE"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37209"
FT                   /db_xref="GOA:D4MX64"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX64"
FT                   /protein_id="CBL37209.1"
FT                   /translation="MKSNTIAAIATPMTNSGIGIIRISGDEALDIIEKVFKPKKKDKKI
FT                   KDVKTYTAHYGHVYDESTLLDECIVLVMKGPHSYTAEDVVEINCHGGVVVMKKVLEAVF
FT                   KAGATPAEPGEFTKRAFLNGRIDLSEAEAVMDLIQSKNEFAMSTSLKQLEGALGKKITE
FT                   IRKQIIHSVAFIESALDDPEHYSVDGFSDELKDQVEVIINQLNEFLENADNGRILKEGI
FT                   QTVIVGKPNAGKSSVLNVLLGEERAIVTDIAGTTRDTLEESIQIKGIPLNIIDTAGIRD
FT                   TNDLIEKIGVDKAKDLLTKADLVLYVVDTSDPLTKDDEEIMELIEDKQTIVLLNKADLD
FT                   QVVKVSDLKEKGFEQIVQISAKEQTGIEELYQLIQDIFFEGHVSFNDEIYLTNMRHKTE
FT                   VSEALKSLAMVLQSIEDGMPEDFFSIDLLDAYEHLGFITGESVGEDLVNEIFAEFCMGK
FT                   "
FT   CDS             75723..77606
FT                   /transl_table=11
FT                   /locus_tag="CL2_00940"
FT                   /product="glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37210"
FT                   /db_xref="GOA:D4MX65"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX65"
FT                   /protein_id="CBL37210.1"
FT                   /translation="MNNLEEKYDIIVVGAGHAGCEAALAAARMGFETICFTVSMDSVAL
FT                   MPCNPNIGGSSKGHLVKEIDALGGEMGKNIDKTYLQSKMLNKSKGPAVHSLRAQADKKM
FT                   YSISMTQVMGNTPNLTLRQGEVTEILVEDGKIKGVKTYSGAVYYAKAVVLTTGTYLKAR
FT                   CIYGEVSNHTGPNGLQAANYLTDSLKSHGISMRRFKTGTPARIDKNTIDFSKMAEQFGD
FT                   ERIVPFSFTNKEEDIKRDQISCWLTYTTEETHEIIKENIHRSPLFSGAIEGTGPRYCPS
FT                   IEDKIVKFPDKNRHQVFIEPEGEYTNEMYVGGMSSSLPEDVQYKMYHSVPGLENAKIVR
FT                   NAYAIEYDCIDATQLKASLEFKEIDGLFSGGQFNGSSGYEEAAAQGLMAGINAARKLQE
FT                   KDPIILDRSQAYIGVLIDDLVTKETQEPYRMMTSRAEYRLLLRQDNADLRLTKIGYEAG
FT                   LISQERYDKLLVKEQQIEDEMKRLEDINVGASKNVQSLLEELGSTTLKSSAKMTELIRR
FT                   PELTYMDLAPIDPERPEYDLDVQEQVNINIKYEGYIKRQLSQVKQFKKMEKKRIPEDID
FT                   YEDVGSLRIEAKQKLSKIRPSSIGQASRISGVSPADISVLLIYLEQMHHRR"
FT   CDS             77610..78320
FT                   /transl_table=11
FT                   /locus_tag="CL2_00950"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.-.-"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37211"
FT                   /db_xref="GOA:D4MX66"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX66"
FT                   /protein_id="CBL37211.1"
FT                   /translation="MERLREKAAAFGIKLSDHQLEQFETYYEMLVEKNKVMNLTAITEK
FT                   NEVIDKHFADSLALIKSGVSLTGQKILDIGTGAGFPGIPLKIAFPELEIVLLDSLNKRI
FT                   KFLNEVIEALGLEKITAIHGRAEDFAKQKEYREQFDYVVSRAVANLTVLSEYCLPYVKE
FT                   DGYFLPYKSGDIKEEAANSKKAVKILGGSIEDIISFEIPDTDMARTILKIHKTKATPKR
FT                   FPRKAGLPTKEPIC"
FT   CDS             78380..79132
FT                   /transl_table=11
FT                   /locus_tag="CL2_00960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37212"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX67"
FT                   /protein_id="CBL37212.1"
FT                   /translation="MEKNKDKSHLIDQLYDYLEEQIQELKTDRNQLNHKMQDMIQEKNE
FT                   KEGAINNQQKIYQIRKVFSPLPLEIEEEKQPVSEDMIQIEKEIHEFQMILREKEEKITK
FT                   LHDYQKGLEETCLFAEEFVEREDQKILFVPAFEQLMGYVKKLYPTQRINYQDSSESSKV
FT                   CMTFSFLKGFQAVLESLLNEIGVFVLNFEMNIYEYKILINIEAKPKVIKNAKDFYEKRS
FT                   VLENKLTKEFSIERWKTNAVVVKTMIEM"
FT   CDS             79145..80830
FT                   /transl_table=11
FT                   /locus_tag="CL2_00970"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37213"
FT                   /db_xref="GOA:D4MX68"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX68"
FT                   /protein_id="CBL37213.1"
FT                   /translation="MRNKVIDLLDQTIEELDKEKIDGILEIPPKDDMGDFAFPCFQLAK
FT                   VFRKAPNMIATEIAEKIPASEDVSKVEAMGPYVNFFLNKENYVKEVLAKVNGTYGAQEI
FT                   GKGKTVCIDYSSPNIAKNFHVGHLRTTIIGNSLYHIFDKLGYKVERINHLGDWGTQFGK
FT                   LIVAYKKWGSKEAVEEKGIPELLRIYVKFHEEAEKDDTLNDQAREWFAKMEQGDEEALS
FT                   IWEWFKDISMVEYKRIYKMLNMDFDHYTGESFYRDKTAAVVEELKEKNLLKESEGAMIV
FT                   DLDEYDMAPCLVMKKDGSSIYATRDLAAIFYRKKEYNFDKCIYVTGLEQKLHFAQVFKV
FT                   VELMGYEWAKENLIHVPYGLVSLEGGKLSTRSGNIVYAEDILKESVSKIREIIAEKNPD
FT                   LKDKEDVAQKVGIGAIIFNDLYNQRIKDVTFTWEKIHSFDGETGPYVQYTYARAASVLR
FT                   KTGITEVGEIDPSLVTDETSVALLKEIERFPEVIKVAADRLEPSVISRYVMGVAQSFNR
FT                   FYHENQCNVEDQKLKEARVKIVILAKQVIKDGLDLLGIQCPEQM"
FT   CDS             81115..81885
FT                   /transl_table=11
FT                   /locus_tag="CL2_00980"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37214"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX69"
FT                   /protein_id="CBL37214.1"
FT                   /translation="MGRIIAIANQKGGVGKTTTAVNLSAALAARGKKTLLVDMDPQGNT
FT                   TSGLGLEKNELDKTTYEVITGEEKIQNCIVKDLFDNLSLLPANRNLAGAEIELMTVDKM
FT                   QFIMKHNLEKVKKQYDFIIIDCPPALGMLTVNAMTAANTVIVPIQCEFYALDGLTQLIY
FT                   TIELIQKSLNPDLTIEGVVFTMYDARTNLSLQVVENVKSYLNQNIYKTIIPRNVRLAEA
FT                   PSHGLPINLYDPRSSGAESYDLLAEEVIENGGEN"
FT   CDS             81885..82805
FT                   /transl_table=11
FT                   /locus_tag="CL2_00990"
FT                   /product="ParB-like partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_00990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37215"
FT                   /db_xref="GOA:D4MX70"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX70"
FT                   /protein_id="CBL37215.1"
FT                   /translation="MSAKKMGLGRGLNTLIPKAPIVDEEDVEQVKKKVSRSSKTKKKEE
FT                   TKKELTLPIDKIEPNPDQPRNQFDEDTLQELADSIKQYGMLQPILVTPKDDFYEIIAGE
FT                   RRWRAAKQAGLNEVPVMIRKYNENEIVEIALIENIQRDNLNPIEEAMAYKRLMEEFELK
FT                   QDEVATKVSKSRASITNSLRLLKLDPRVQKMLEEEMISTGHARALLAISNKDKQYEIAQ
FT                   KVFDEKLSVRDIEKLVKDLKKIKKNKKEEKDVHDFLYTELEESMKQILGSKVSIKNKKN
FT                   NKGKIEIEYYSRDELERIVDMIRSI"
FT   CDS             82818..83309
FT                   /transl_table=11
FT                   /locus_tag="CL2_01000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37216"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX71"
FT                   /protein_id="CBL37216.1"
FT                   /translation="MTDFFNSVGMEYVVIGLAAALLLALILVIVALVKVGKLKKRYEKF
FT                   LSGKDGKSLEESIVKRFDKLNEIIVEQDFLEQEIQRIDEEHKSSFSKMEVYKYNAFSDM
FT                   GGETSFVIALLDHNNNGTLLNGMSSQNATYVYAKEIRNGASKVALSNEEKLTLEKCINK
FT                   "
FT   CDS             83322..84608
FT                   /transl_table=11
FT                   /locus_tag="CL2_01010"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37217"
FT                   /db_xref="GOA:D4MX72"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX72"
FT                   /protein_id="CBL37217.1"
FT                   /translation="MLDIKFLRENPDVVKQNIKNKFQDRKLPLVDQVIELDKENREIKQ
FT                   EVQALRADRNKLSKQIGALMGQGKKEEAEEVKKQVTASADRIEELSEREKVVEEKIKEI
FT                   MMTIPNIIDPSVPIGKDDSENVELERFGEPVVPDFEVPYHTEIMESFDGIDLDSARKVA
FT                   GNGFYYLMGDIARLHSAVIAYARDFMIDRGFTYCVPPFMIRSNVVTGVMSFDEMDAMMY
FT                   KIEGEDLYLIGTSEHSMIGKFIDTTTEEAELPKTLTSYSPCFRKEKGAHGIEERGVYRI
FT                   HQFEKQEMIVVCKPEESKDWYEKLWKNTVDLFRSMDIPVRTLECCSGDLADLKVKSVDV
FT                   EAWSPRQKKYFEVGSCSNLGDAQARRLRIRIKGENGNYFAHTLNNTVVAPPRMLIAFLE
FT                   NNLREDGSVAIPEVLRPYMGGKESLQPKK"
FT   CDS             84722..85390
FT                   /transl_table=11
FT                   /locus_tag="CL2_01020"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37218"
FT                   /db_xref="GOA:D4MX73"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX73"
FT                   /protein_id="CBL37218.1"
FT                   /translation="MKAKIIIVEDHEPIRNELKILLSKYGYEIIVLDRFDTVVEDCLRE
FT                   DVDLILLDINLPFYDGYYVCRAIREKSEVPIIVVTSRDSEMDELMSINLGADDFITKPY
FT                   NTQILSARISAMLKRTHKEKVNDFLQYQGLKLQLNSSTVIYKDQIIELSKNEMRILYTL
FT                   LQHKESIVSRDQLMESLWQSNEFIDDNTLTVNVNRVRKKLEVAGLKDFIKTKRGQGYMI
FT                   "
FT   CDS             85387..86403
FT                   /transl_table=11
FT                   /locus_tag="CL2_01030"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37219"
FT                   /db_xref="GOA:D4MX74"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX74"
FT                   /protein_id="CBL37219.1"
FT                   /translation="MKTKEFFRMEYAQILIYIVFLGLLEVLLFIFEANYFLMIYLLLIG
FT                   LILEGVYLCQRYMKKYRYYKKVKAKLDILEQKCMITEMLELPDFAEGEFLYEILQTCNK
FT                   SMNDEILKYKIEAAGYREYIEMWIHEVKTPLAATRLILENHPSEITRAMDEEMQQINYY
FT                   LEQALYYARSNSVEKDYLVKELSLKEVVENAVKANAKSLIGNKIKIKIENLDQKIFSDE
FT                   KWVLFILNQVISNAIKYKKEEAEISFCARCEKNEILLEIRDNGIGISPKDLPRITDKGY
FT                   TGTTGRNYQKSTGMGLYLCKKLCSKLQLSFYIESKEEEYTKVTIGFPRNSMIFLNEE"
FT   CDS             86422..87207
FT                   /transl_table=11
FT                   /locus_tag="CL2_01040"
FT                   /product="histidinol phosphate phosphatase HisJ family"
FT                   /EC_number="3.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37220"
FT                   /db_xref="GOA:D4MX75"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX75"
FT                   /protein_id="CBL37220.1"
FT                   /translation="MFADYHVHSHFSEDTDFPMELEIQKAIKLGMDELCFTEHSDYDVP
FT                   TVVNCDYDAYFEEMEKMKDKYKGQITLKTGIEFGIQTHTTKAYEETFRQYPFDFVIFSC
FT                   HQVENKEYWRQEPQEGKTQLEYNRRYYQEILDVVKVYKDYSILGHLDVIKRYDKQGEIE
FT                   FEKIQDLIEQIFEVVIADGKGIELNTSSRAYKLKSLMPSKEILKLYHDMGGKIITIGSD
FT                   AHNADRIGDCVMESQKILKDIGFDGIYTFEKMKPEFHRF"
FT   CDS             complement(87285..87635)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01050"
FT                   /product="Cupin domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37221"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX76"
FT                   /protein_id="CBL37221.1"
FT                   /translation="MFLKNEDVKIGTIPDANGSDNPLKKMEFLTEKEMKDSSRLFGKVI
FT                   VPPGSALAYHTHEGEGEAYHILQGKGLYNDNGTKYEVHPGDTTFTCDGAGHAIENIGDE
FT                   DLVFMALILLDK"
FT   CDS             87736..87816
FT                   /transl_table=11
FT                   /locus_tag="CL2_01060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37222"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX77"
FT                   /protein_id="CBL37222.1"
FT                   /translation="MDTKMIYWYIIDKTIRETKKDKEMEK"
FT   CDS             87813..88580
FT                   /transl_table=11
FT                   /locus_tag="CL2_01070"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37223"
FT                   /db_xref="GOA:D4MX78"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX78"
FT                   /protein_id="CBL37223.1"
FT                   /translation="MSSVLKVDNIEKYYGSKANLTKAIDRISFEVEEGEYIGIMGASGS
FT                   GKTTLLNCISTIDQVTAGNIMINGMDITKLKGKHLSRFRREELGFIFQDFNLLDTLTAF
FT                   ENIALALTIMKIPAREIEDRVRSIAEKLMITEVLNKYPYQMSGGQKQRVASARAMITNP
FT                   SLILADEPTGALDSKAARMLLDSMETMNVELNATILMVTHDAFTASYCKRILFIKDGKI
FT                   FNELVRGNDSRKRFFDRIIEVVTLLGGDSTNVF"
FT   CDS             88570..90618
FT                   /transl_table=11
FT                   /locus_tag="CL2_01080"
FT                   /product="Predicted permease."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37224"
FT                   /db_xref="GOA:D4MX79"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX79"
FT                   /protein_id="CBL37224.1"
FT                   /translation="MYSKIAFSNVKKSIRDYTIYFLTLTFGICLFYMFNSVQAQQAVLK
FT                   LNASQKSMMHLMSVIINGISVFVAIILGFLIVYANQFLMKRRHKEMGIYLLLGMEKRQV
FT                   SKILLIETLLIGVLALIAGLVSGVFLSQGLAMLTAKMFAVQMKEFKFVFSQTAFIQTIL
FT                   YFAIIFIIVMIFNGITISKYKLINLLNSAKKNQKTRLKNPILSVILFLISIGILGIAYH
FT                   LIQKNQMLAVDNDFKISVLLGVVGTFLFFFSLSGFLLELAKRSKKFYYNGLNMFVLRQI
FT                   NSKITTTFVSMSMLCLMLFLAISAFATGSGLASSVKTDLEDMTKFDCTFYGLSEKGYQE
FT                   EQQQKFIKKLDDLGLTIKKDAKEILPITIYQNGTFRKCRYKMEPLLKGREKYSDYTKDY
FT                   VKKIYETPLTFAKLSEYNKIRKAIGEKELTLKSDEYILNCDYGNLIPIMEKAANDKQKL
FT                   TLDGKTYKMKYGLQKDTYMVAAAKTDMGTVILNDEIIQSLKIDYSTLYLNLNWKGNAQK
FT                   VSRKYTEYLKQMIINSKMPNSLYSATISKEEVYEQSTGLSTIMTYIAIYIGLVFLITCA
FT                   AVLALQQLSENADNIEKYKLLSKIGTSQKMINRAIKAQIILYFCLPLSLALIHSYVGIK
FT                   TAKILISTLGQINITKAAAQSLIIVIVIYIGYMIATYLGSKSMLKEK"
FT   CDS             91619..92524
FT                   /transl_table=11
FT                   /locus_tag="CL2_01100"
FT                   /product="fructose-1-phosphate kinase"
FT                   /EC_number="2.7.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37225"
FT                   /db_xref="GOA:D4MX80"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX80"
FT                   /protein_id="CBL37225.1"
FT                   /translation="MIYTVTFNPAIDYVIKVDNLTLGQVNRTTREYIFCGGKGINVSHL
FT                   LANLGVDSVGLGFIAGFTGDVIESGAKELGFKPDFIRVREGMTRINVKVKSNEESEING
FT                   LGPVIHDDELEQMFKKLDELEDGDILVLAGSIPATLPSDVYERIMGRLQGKDIRIVVDA
FT                   TKDLLLNVLKYHPFLIKPNNHELGEMFDVVLKTNDEIVEYAKKLQEKGARNVLVSMAGD
FT                   GAILITEEGEVHVTPCPKGEVKNSVGAGDSMVAGFITGYLRSNGDYNEALKMGTAAGSA
FT                   TAFSEDVATGEKIMELYKTL"
FT   CDS             92620..93159
FT                   /transl_table=11
FT                   /locus_tag="CL2_01110"
FT                   /product="5,10-methenyltetrahydrofolate synthetase"
FT                   /EC_number="6.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37226"
FT                   /db_xref="GOA:D4MX81"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX81"
FT                   /protein_id="CBL37226.1"
FT                   /translation="MTKKEARQQVKEWMKKLDKNYIEKADQSIFEQVKELKEFQEAKTI
FT                   FCYASMKNEVDTWQLIALALKQGKNVGVPLCIGKGIMEVRQIHALDDFEEGAYGIMEPS
FT                   RRCPILSKEKIDVAVIPCVSADREGRRLGHGAGFYDRFLDGVTFPKILVCYKELMMDQV
FT                   PTEEHDILMNQVICDE"
FT   CDS             93198..94100
FT                   /transl_table=11
FT                   /locus_tag="CL2_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37227"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX82"
FT                   /protein_id="CBL37227.1"
FT                   /translation="MRKILKKTATLMMTAVIGVSMSCPKMIVYAGQRMQMQERYTTPKE
FT                   WNYAEITAYQFGSTDKFEDYLQTGGTHLYNDKFQEKDHMIKITVADSGYFTIATQTDGN
FT                   RSQKVKLYDSTKEKVLAQTTSDGDLEYGRLAKAGEVFYLQMPEKIDKIFVTTGVIKDGF
FT                   GSMKASDTYYESGTGSTTYHPFSIKKRSAVEFNISAIDRNSEITYAHIEKKENGQWKRI
FT                   DDTVKIKPASYDDDFVHGLTKGEYRLAIKAPTTQLNAVSYTSSSKSKKVAYKKSKAKKI
FT                   KLDGQTSNIYNRRENFKMV"
FT   CDS             94048..94341
FT                   /transl_table=11
FT                   /locus_tag="CL2_01130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37228"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX83"
FT                   /protein_id="CBL37228.1"
FT                   /translation="MDKHRIYTTGEKTSRWYKISITSTKKKRILNLGKNTVSGGYKFTI
FT                   YKKGKKKAIKTIKVTGNANAKIAKMPKKKGTYYIRISKLTKKTNGTYEIGYY"
FT   CDS             94371..95531
FT                   /transl_table=11
FT                   /locus_tag="CL2_01140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37229"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX84"
FT                   /protein_id="CBL37229.1"
FT                   /translation="MARRGIKKMGAVLIAAGLSIAMCSPSVSANVRTNINTDKITQKKT
FT                   ARYVEPEEWNKEELTAYQFDSEVDMMKYLVSGGMHLYNKNYKGSDRWVKIKVADPGLFM
FT                   VGVVSNDETKIPVYDASKKRIIVNNLNDGGDKEYVGIVKTGDEFYVKLPEKIDKVIILT
FT                   GVIKTEFTSMANQKSYYELGKGTTTYHPFSVAKRSKVQFDITSIGKKHEKVGVYIEKNV
FT                   NGTWKKVGYGTTVKPDKYDSALLYGLEAGKYRLALKTPKDQIINIEYTRDKSKKKAAYK
FT                   KSKAINLKSDIDSIYTSTEKAARWYKASVSSTKKRKAVTLSKDSVGGGFKFCVYQKGKR
FT                   LKTVKVTKNDKVKTVKLPKKKGAYYVKVTKLTSKTTGAYYLGTYTY"
FT   CDS             95554..96723
FT                   /transl_table=11
FT                   /locus_tag="CL2_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37230"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX85"
FT                   /protein_id="CBL37230.1"
FT                   /translation="MKKMKSRSFRILMAAVISAAMLCPQVKVSAADGLVSKAATSYFPS
FT                   KTVMKKTARKTEPEEWNQKEIKAYKFGTLEDALYYALTGGIKYYDQNYFKNPDLIKLTP
FT                   VESGALGLAVVGDNKQEAILYDSNKKMIKKLPLSYVKAQVNAGETYYIEFPKNCKEGLI
FT                   TAYVLQNECGGLAKNDLNMQKGEEKETYHTFKMTKRGFAGFVVASMVEDGGNTSYKVQK
FT                   NEKGKWITIGRTKSFKPTNEDETQIAVGYGLSKGNYRLVLKAPKEQLNTMLYTTKNYAK
FT                   KKVAYKKSKAKNLNATEMYTMNEKAARWYKVSVKSSKKQSKLKILTVADQGGFKFTIYE
FT                   RGKKKPVKTVKTSAKHLEKTVKLPKKKGMYYVKVSKRTKKTNGYYEIKK"
FT   CDS             96875..97933
FT                   /transl_table=11
FT                   /locus_tag="CL2_01160"
FT                   /product="Membrane-associated lipoprotein involved in
FT                   thiamine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37231"
FT                   /db_xref="GOA:D4MX86"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX86"
FT                   /protein_id="CBL37231.1"
FT                   /translation="MKLKKLICIVMVSVLGVLSFAGCAKKQDEKKTETSSEASTQEASA
FT                   QVFAMDTYMNLKAYGKNAQKAVDDAKSEIERLDQLWSAVDKNSEIYQLNQKKKMKVSDE
FT                   TLELIEFAKKKSKESNDAFDISIYPIVELWGFPTQKYRVPSDSEIQKLLKNVNSQKIKI
FT                   NKKTNVVTLEKNMKIDLGGIAKGYTSQRIAKIYKKDGVKSGVISLGGNVQAIGTKTDGS
FT                   RWKVGVQSPDDTESMIGAYEAADEAVITSGAYERYFEKDGKTYHHIIDPATGKPSEKDL
FT                   KSVTIISKNGTLSDTLSTTLFVMGKDKAISYWKEHSKEFNMILVDENNKVYISQGIKDH
FT                   FSSDSDFTVIKK"
FT   CDS             97971..99569
FT                   /transl_table=11
FT                   /locus_tag="CL2_01170"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37232"
FT                   /db_xref="GOA:D4MX87"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX87"
FT                   /protein_id="CBL37232.1"
FT                   /translation="MKIIDQLKKVNLIQFVPAIFVISLVGNSVFGYTAPKSEKSKNNSE
FT                   NQVEAATTQAKKKTKKANAGDIDLSKIKDGTYEGQANGYRGLVKVSVTVKDHKITAIKV
FT                   LSNSDDAAFFNRASAGVIKNILAKQSLKVDVVSGATYSSNGIIKAVKNALTGEEDKSSA
FT                   KAGGSSAKSAGSVGTADESGTYKDGTFIGTASGYHGTVKVSVTIKKNKIKSIKILENHD
FT                   DAAYFNRAKGILLPLMVKKQSTNVDAVSGATFSSNGIIKAVRNALSKAAVNKSSSDSSS
FT                   TSTTKDTTKKDTTEKVSGTYKDGVYEGTGTGFRGKITVSVRIKKSKIVEIKLVKNEKDD
FT                   AAYFERAWSEVPFSIIAVQSANTDKVDAVSGATYSSKGIMEAVRDALKKALAKKDTETT
FT                   VETNNTNNSTNDNNTNTDNSSEDNTTTVPTTPTDQTYTGSAVCEPDEDGDFDAYDLTLE
FT                   VVVSSDGKVKGIQNIKWSDKSMQSWYKDAEKKIVPQLIANGLDTSKNYDVVTGATCSSN
FT                   ALINAYKNAISKINQ"
FT   CDS             99591..100004
FT                   /transl_table=11
FT                   /locus_tag="CL2_01180"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37233"
FT                   /db_xref="GOA:D4MX88"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX88"
FT                   /protein_id="CBL37233.1"
FT                   /translation="MKQLKKYKHFLMRLLNLVLIVGVCFAYHNIATIRAEKEAKITAEN
FT                   SGSGSWKDGIYEGSGQGFGGQIVVSVTIKNGSISDIQIKEAKNEDSAYFNNAKKIIDTM
FT                   KQKQTADVDVASGATYSSKGIIAAVRNALKEAS"
FT   CDS             100004..100852
FT                   /transl_table=11
FT                   /locus_tag="CL2_01190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37234"
FT                   /db_xref="GOA:D4MX89"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX89"
FT                   /protein_id="CBL37234.1"
FT                   /translation="MNLRQKRDIRRLTRQIIQIIFFLWMPALYTSAFSGVRYVIEQIRA
FT                   GKPIEQNAFLVMLIALCGFTILFGRFFCGYACAFGTLGDGMYALSQWVQKKVKKKLPWV
FT                   SEETGRKLQKMKYIVLLVLMLIYALGFTKKFHGTSPWEVFSMLYTGKIPDASYLAGWVI
FT                   FVLILVGMCLKERFFCQYLCPMGAIFAWLPTLPFSVLDRDRSNCIPKCRACEIKCPVDH
FT                   QIKRDQKNGGECIHCMQCVDVCPKQNIHLCSGKKLKGNEILIILLKLVLFIGVCIFAQS
FT                   L"
FT   CDS             101055..102884
FT                   /transl_table=11
FT                   /locus_tag="CL2_01200"
FT                   /product="Protein of unknown function
FT                   (DUF1533)./Fibronectin type III domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37235"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011432"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX90"
FT                   /protein_id="CBL37235.1"
FT                   /translation="MRKGMWKKGLTVAMAAAMLAGPVSVPAVFNNGVAVVKADETNKGQ
FT                   DVYVLMNIPYADFYKAELNNTVKVDATTSATKTKTKSTLANGSYHADNTGEHISGITYP
FT                   VKIKAGTDLSKLTKITDASKVSITVNMKGKETTTEYKGKDALFESADYSYYELGTTAPA
FT                   YYKELTVNENGSYSFGKTTATEKTVKGAAIEKFKTSSKYGDYQLNLNFDKVADSDQISG
FT                   NTKVLAAVITTIDGTQYGLRHVENIWKGTEFAWGTGFTTQSHGCPISGEHYASMMGKTI
FT                   DAVTYYTENGVVKYDIDDTYVPYKFDTSAFKVENADVTSGSAKVTVPTLPEAYDAEYAV
FT                   EGLTNVSVENGTLKYNATGVKPGQYTLNVTDKSSKYVPFSTSFTLTTDNVVAAYNNDVK
FT                   APALVAAKDVQADDFANFVKNIQKVSVNGKEYAASGKGAVKLINADGTLVTTADALKAE
FT                   GTYNIVVTATGYNKTLEFTYTNKSDTTATKPSDATAATKPAATTTATKPAVKPVKKVTV
FT                   KKQTAKVKAGKKKLTVTWKKDKNVSGYQIKIATKKNFKGAKTYTVKSYKTYKKVIKKLK
FT                   AKKKYFVKVRAYKTVGKSKVYGAYSAVRSCKVK"
FT   CDS             complement(102978..104165)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01210"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37236"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX91"
FT                   /protein_id="CBL37236.1"
FT                   /translation="MDYHILKKYRYTNRNQFESIYSSRYKNELALHYDFEIHGFPCFSL
FT                   PTTEILNLTSRIYKLTQTLIYLKSKLPQIALEQYTQTCLVDEVKLTNEIEGVNSTRREI
FT                   QDILNTQSITKKNMRLYGLVQKYNLLKNSEKISIHNCSDIRNIYNELVSEEIKNNDPLN
FT                   LPDGIFFRRKSVSVYSPHMKEIHRGISGETEIIACMEKALFILHNKSIPPLIRISVFHY
FT                   LFGYIHPFYDGNGRTNRFISSYLLSKELEPLISYHLAKTIKQNISKYYKSFDYTNDTDN
FT                   RGDLTGFITNFLEIILASIEALIDSLEDKIERLHYFERILLSNFKDKTDYGILHLLLQN
FT                   SLFGLEPLSAREMAEMLDKSYVTINNRLKKDSIKTLLRSDIPHKYDLDLDNLKTL"
FT   gap             104261..105164
FT                   /estimated_length=904
FT   CDS             complement(105213..106292)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01220"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape
FT                   ptide) pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37237"
FT                   /db_xref="GOA:D4MX92"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX92"
FT                   /protein_id="CBL37237.1"
FT                   /translation="MKRIVLTGGGTAGHVTPNMALVPKLIDEGYNIYYIGSYEGMEKKL
FT                   IEDIGVTYYGISSGKLRRYFDIKNFSDPFRVIKGFFEAKKILKKLRPDVVFSKGGFVTV
FT                   PVVIAAKQLHIPVIIHESDMTPGLANKLSIPSASKVCCNFPETVKLLPEGKAVLTGSPI
FT                   REELFTGKCEEGLRLCGFTEEKPVLLVIGGSLGSVAINNAIRSNIDALLEKYQIIHLCG
FT                   RNNLDESLEGREGYKQFEYVKDELKHYFACANVVVSRAGANAICELLALRKPNILIPLG
FT                   LEASRGDQILNAESFENQGYSYVLQEKDVTSETLLNAVNSVYEDRDKYIEAMNHSKLAN
FT                   PIETIVNLANQLASRKKKR"
FT   CDS             complement(106309..106554)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37238"
FT                   /db_xref="InterPro:IPR023806"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX93"
FT                   /protein_id="CBL37238.1"
FT                   /translation="MVYKTKGTCSSEIEFEVENGILTDIHFVGGCQGNTTGVAALAKGL
FT                   PIDEVIDKLSGIQCGFRGTSCPDQLSKALIAYKENN"
FT   CDS             106725..107417
FT                   /transl_table=11
FT                   /locus_tag="CL2_01240"
FT                   /product="methylthioadenosine nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /EC_number="3.2.2.16"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37239"
FT                   /db_xref="GOA:D4MX94"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX94"
FT                   /protein_id="CBL37239.1"
FT                   /translation="MIGIIGAMEEEVSQLIEAMEEKEKVTCAGMDFYCGKLKDKEVVIV
FT                   QSGIGKVNMALCTQILADRFDVKAVINTGVAGGLYKDIEIGDIVISKDAVQHDVDATVF
FT                   GYKVGEIPRMDTSYFEADKDLIELAKKTCDEVNPDIHSYVGRVVSGDQFISDNKKKHYL
FT                   INEFDGYCAEMEGAAMAQAAHLNQIPFIILRAISDKADQEAAGSYEEFEKAAIKHIVRL
FT                   VLGILDRM"
FT   CDS             107509..108198
FT                   /transl_table=11
FT                   /locus_tag="CL2_01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37240"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX95"
FT                   /protein_id="CBL37240.1"
FT                   /translation="MEMLRETFFMKGFITAMVIAVLTKVIVWANYHRLLVSSEEMERPK
FT                   RHWIGTLKKKIENYYNLQTKVNNISCIVDKYFEADKILGINSFFLEQIPGFCAIICVGL
FT                   GCLGAIRGIAMNADINFWGRNLIIGVVCGISIFMMDYLTKMDQMKRKIKINLINYLENI
FT                   LPNRMLNYTKKQNYKENLENKKKEEIKKEKKQVANIEEHWGEIASSRECQLTDEDLQIL
FT                   KDFIKDL"
FT   CDS             109181..109693
FT                   /transl_table=11
FT                   /locus_tag="CL2_01270"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37241"
FT                   /db_xref="GOA:D4MX96"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX96"
FT                   /protein_id="CBL37241.1"
FT                   /translation="MNKIAQFHKVSFEQFKESWDDSFPGASEEEIKEIYDQIKLPKRAT
FT                   RGSAGYDFFSPVDFELKPGETIKIPTGIRVFIESDWVLNIFPRSGLGFKFRLQMNNTVG
FT                   IIDSDYFYSDNEGHIFVKLTNDTNEGKTVSVAQGTGMVQGIFMQYGVTIDDDATEVRNG
FT                   GFGSTTK"
FT   CDS             complement(110029..110580)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01280"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37242"
FT                   /db_xref="GOA:D4MX97"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX97"
FT                   /protein_id="CBL37242.1"
FT                   /translation="MKGNGHPTNNQNISEYVALLYQKYSHKLYCNAFHYTSNPSIAEDG
FT                   VQQIFEKILLHPDTALHVPEHEIIYYLFAIQRNVMYTLTMDEYKNSHYPLDYDDGNDIS
FT                   RNLIDPEDLFIRYIYLDSLKIIFSTLTPDFRDTIIFHYFYGFKYSEIACMFHISERAVK
FT                   KRIAVAKKRVRTMFQKEDFL"
FT   CDS             complement(110643..110909)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37243"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX98"
FT                   /protein_id="CBL37243.1"
FT                   /translation="MFRMWGKIFHENHMLKDTVICIDSDLNRTRKVYQALEEICYEFDL
FT                   SKPLWLDHNKNDFIHHSKTRFNSDSFVEDIDFDFLEIQVIEED"
FT   CDS             111043..112098
FT                   /transl_table=11
FT                   /locus_tag="CL2_01300"
FT                   /product="Predicted membrane protein, putative toxin
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37244"
FT                   /db_xref="GOA:D4MX99"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:D4MX99"
FT                   /protein_id="CBL37244.1"
FT                   /translation="MKILKRIFIDGLSGMAIGLFATLIIGTILEQAGTIIGGDIGNMIV
FT                   MVASIAKVLTGAGIGIGVASKLGESTLVCASAASAGMIGAFASGLLNGSVSSSGKILLS
FT                   GPGEPLGAFVAAYIGIEIGRIFIGRTKLDIILTPLTTIVCGGIVGLTVGPYISDLMKQI
FT                   GEMIRWGTEQQPFLMGIVVSVLMGMALTLPISSAALGIILNLSGIAAGAATIGCCAQMI
FT                   GFATASLRENGIGGLLAQGIGTSMLQVPNIVRKPLIWLPPIITSAILGPISTVVLKMTN
FT                   NAIGSGMGTAGFVGPMMTYKTMTTGGTSAVTVIVMILVMQIIAPAFLTYFISEAMRRAG
FT                   LIKDGDMKLDI"
FT   CDS             114038..115231
FT                   /transl_table=11
FT                   /locus_tag="CL2_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37245"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXA0"
FT                   /protein_id="CBL37245.1"
FT                   /translation="MEQKTKSGFSLYVNSNENIQNALFLREKKKKYRMGLIIAFVVVCI
FT                   CTILAYRYRTYHRMKVVKTITKELTESFQSFAYKKGTICYSEDGISFLDGKGNEKWNKT
FT                   YSIKNPQASYCGDYIVVASKNGNEIALLDSDGQMKKFSVSYPIVDLEVAKQGVIALILH
FT                   GDNGNYIELYDAAQKKLVSIKVTSDQNGYPMDIDLSSDGQNLLVSYLVVDGINVKSRVA
FT                   LYNFGQEGEDSGDQMIGGFDFKDTVIPKVSFMGDSKAVAIGDDQMIFFKVGKTISKKQT
FT                   ISFDKDVSSVAVNDDYAAFVFEDQKKTDQEKYEAVVYNKTGRKLMSHKFSSEYNKLLLG
FT                   EKELLLAGNYHCSIVNFAGHEMFKKDFKKRIVNISPTGKRQKYLITYENSTNLSEIY"
FT   CDS             115244..115780
FT                   /transl_table=11
FT                   /locus_tag="CL2_01340"
FT                   /product="Uncharacterized membrane protein, required for
FT                   colicin V production"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37246"
FT                   /db_xref="GOA:D4MXA1"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXA1"
FT                   /protein_id="CBL37246.1"
FT                   /translation="MGEIIVAVFGIYLILQMIIGYRRGLIKSMLNLASWILTFAIAYKG
FT                   AAYFKEIVIQNVPEIQGTIVTDRIAYMIAYMGLMIVCKIIFSVVIRLANKVTRVPGVGF
FT                   INKVAGAALGLIKGSLIIMVVVFFISLMPHVGMESEYAQIVGGSEVMQTMVETNPLEQM
FT                   IKQQIQIETQKLLQQ"
FT   CDS             116234..116518
FT                   /transl_table=11
FT                   /locus_tag="CL2_01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37247"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXA2"
FT                   /protein_id="CBL37247.1"
FT                   /translation="MKVETWCSQNGITKSNYYYRLRRVREAYIETTQSSETTFVELPVM
FT                   SESEKSEKQESKNLPVARIHTDDNLSIDIFSSISADQIQSLIGAVTNVK"
FT   CDS             116508..116870
FT                   /transl_table=11
FT                   /locus_tag="CL2_01360"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37248"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXA3"
FT                   /protein_id="CBL37248.1"
FT                   /translation="MLNDAHGFKKIYIATGYTDLRRGIDGLAAIIRFQFDLDPFDRNTL
FT                   FLFCGRRSDRIKALLWEGDGFLLMYKRLNIGAFNWPRSADEAVEISQEEYERLMQGFEV
FT                   IAKRPITEMKHPPTEL"
FT   CDS             117153..118787
FT                   /transl_table=11
FT                   /locus_tag="CL2_01370"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37249"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXA4"
FT                   /protein_id="CBL37249.1"
FT                   /translation="MAFKYTEDQLNKMDKALLIELFLGLQDQMEELTKETHALNQKMQL
FT                   LMEQVVLAKHHRFGKSTERMEDTTQISFMEIDGKIVFFNEAEAVSDPDMEEPEELELKK
FT                   GSRRKQGKKDQDLSGLPVRRIDHYLSEQELEDEFGENGWKQLPDMISRQYCFVPAKVEI
FT                   EEHHIGVYADKKDEHMVRAPHPKALLHGSLVSPSLGAAVMNGKYVNAVPLYRLEKEFER
FT                   YGLAISRANMANWMIRLSEEYLSVFYDHLHRKIYDFDVIGADETPVEVNKDGRPAGSKS
FT                   YIWVYRSGGINSTHHIVLYEYQKTRNASHPVRFLKDYEGICVTDGYQVYHSAEKTLEHV
FT                   TIAGCWVHARRYFDEALKIIPQAVRSKSWGYLVMKQIQAIYREEGKLKDLKTEERLKQR
FT                   QLVIKPLVDALFAYAKQHQVPVGTQGKLARAVTYLLNQEKYLRVFLENGEVPMDNNASE
FT                   RAIRGFCIGRKNWQLIDTIRGAENSAIIYSIAETAKANDLKPYEYFEHLLTEIPKHMED
FT                   TDRSFLDDLLPWSEKLPKEIKKTNKRS"
FT   tRNA            118882..118953
FT                   /locus_tag="CL2_T_31500"
FT   tRNA            118986..119056
FT                   /locus_tag="CL2_T_31510"
FT   tRNA            119099..119175
FT                   /locus_tag="CL2_T_31520"
FT   CDS             complement(119288..120796)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01380"
FT                   /product="transcriptional antiterminator, BglG family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37250"
FT                   /db_xref="GOA:D4MXA5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXA5"
FT                   /protein_id="CBL37250.1"
FT                   /translation="MLISDRSKEIIENLMNANGPLTVSALSKKLGVTERTIYRQIPEVT
FT                   EIIESYDLTLDNSSGNGFMIFGSLYNLKRLNSAFEEVKTEQNYSNKERVDIILLTLLNE
FT                   DDYIKTQALAIDLNTSSQTIRNDYQSMKEKLQGHNVQFETKKSEGVRLTGHEIPKRHLF
FT                   VNVLLQNIAPDNFFDWLKDNNYRPNHFIDLLKNFDYEEPLKVLYQKMQNVIRKRHLNIS
FT                   DKELQEFLVLIAIFIKRHTYINDQEDILKLTIQDSNTDYEDHFRQDILKILEVDFKIQL
FT                   YDNERDYFHWMIHLYVGRSHYELNQQISAFQNLDHISSLINEIEKKFHFPFSEDKNLAE
FT                   NLLLHINMAMERIQSGITVTNPMLEDIYQSDPKLYEIVKESFRNIFQPIKIPEDEIGYI
FT                   VIYFIASMDYLSKNSISVLVVCSTGIGSSKMLRSRLEREFSEIDVKKIISLHKLHDEDL
FT                   KQYDFIISTVPLDLDESKYLCVSPLLNDGEKEKVRKQIDILNKR"
FT   CDS             complement(120813..122009)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01390"
FT                   /product="Mannitol-1-phosphate/altronate dehydrogenases"
FT                   /EC_number="1.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37251"
FT                   /db_xref="GOA:D4MXA6"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXA6"
FT                   /protein_id="CBL37251.1"
FT                   /translation="MKAVMYGAGSIGRGFIGALFSEIGYEVVFIDVNDDVIHLINKEKT
FT                   YPQIIMNEEQPVHWIKNIRAVDGKDPEAVSNEIADADIMATALGAAVLEKVAPVIAQGL
FT                   LKRWEKESSNTLDILICENLMDADILLRDYLLKALPEDKHALFEKNVGLVETSIGRMVP
FT                   PADPDLIPEDEHPLAVRVEPYDFLPVDKAAFKGMIPEYKKIIPYEPFHYYLERKLYVHN
FT                   MAHVTTAFLGQYLNKTYIHEAAHDIYIQSIVRGCMTESCMMLSEKYQVPFSKLNAHMND
FT                   LLHRFKNSYLKDTVTRVARDPMRKLQPSDRLIGAARSCESLHITPVYLSFAIALALSFM
FT                   EGEDALNLMETVCKIKKEEPIAERIIYFYNKIKNKNISLDQLYTIIDNLQSDIQGETI"
FT   CDS             complement(122109..123545)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01400"
FT                   /product="Phosphotransferase system, mannitol-specific IIBC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37252"
FT                   /db_xref="GOA:D4MXA7"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXA7"
FT                   /protein_id="CBL37252.1"
FT                   /translation="MKEKTSISQKLQKFGSVLAGMVIPNIGAFIGFGLITAFFLETGWT
FT                   PNAKLAKLISPILNYLLPILIGHTGGKMFGGDRGGVIGALVTMGAIVAVDGTPMFLAAM
FT                   ILGPVAGVCIKKFDQAVDGKIPSGFEMIVNNFSLGIIGAILCCFAMLVFGPVMETVTTV
FT                   LTNGVNWIVAHNALPLSAIFVEPAKVLFLNNALDHGIFGPIGYEQVKTLGHSALFLLVP
FT                   NPGAGLGLLLAYWFFGKGEMKEAAPGMILIHFFGGIHEVYFPYVLANPLTIIGMIAGGI
FT                   VGTGTLTFLNVGTVATPSPGSIFSVVALSPKNCMFGVLLSVVLSCVVSFLLNAIFVKRM
FT                   VAKGGDTSLGESVVPKEAMGSSASSNESTAITNDSSLGVAGVDIKNIKKIVVACDAGMG
FT                   SSAMSAAALKKKVKAADLPIEVINTAISKIPDDADLIITHVELTGTAKAAQPNKQHLSI
FT                   SNYLKAPEYDQLVERFKNEL"
FT   CDS             complement(123548..124009)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01410"
FT                   /product="Mannitol/fructose-specific phosphotransferase
FT                   system, IIA domain"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37253"
FT                   /db_xref="GOA:D4MXA8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXA8"
FT                   /protein_id="CBL37253.1"
FT                   /translation="MASKLLSNEFQKHICLDYECTTIEEAIHKAGDLLVQVGCVKPPYI
FT                   NGMIRREQETSTDIGLGVMIPHGTEDTLNFVLKPGISIVQIPHGVSYHGNTIHLVIGIS
FT                   SREEDSLQELMQITDILLKPEKCHQFLNASSKQEFIDMINQNYVEEGEL"
FT   CDS             complement(124104..125216)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01420"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37254"
FT                   /db_xref="GOA:D4MXA9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXA9"
FT                   /protein_id="CBL37254.1"
FT                   /translation="MGKRNKVTTRDIAEYTGVSQSTVSMILSNKPHVSFSKETIDKVRQ
FT                   GAKELGYKKPVAGVKKKEQALAKSIIVICPLLSNGYYSMIIHSITERAKDYGYTVFTVS
FT                   TLRDVSQEELYLNLLSGFELAGVISLYPPTKIAQANALSKQVPVVSIGDKPDACRFDAV
FT                   ELDSKKPGYIIAEHLLSLGHKHITYICTPIRPKEIGRIHRLAGLRSCFKDHGLDPEWVE
FT                   VKSPTIAAYGRYSADNSEYQNGYDMASQALDEHTSSTAFVGNNDMTAFGIMAAISDHGF
FT                   RVPHDYSVCGFDNIPLSSMPQIALTTIEHASLAKGREAVDIIYKKNTQKNISAKHHYIM
FT                   RMEYEPELIVRNSTGKCKITNKTKECHNIS"
FT   CDS             126980..128245
FT                   /transl_table=11
FT                   /locus_tag="CL2_01440"
FT                   /product="Thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37255"
FT                   /db_xref="GOA:D4MXB0"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXB0"
FT                   /protein_id="CBL37255.1"
FT                   /translation="MKYDVIVVGGGPAGLAAAVEASKNGAEKVLVVERDQELGGILNQC
FT                   IHNGFGLHYFKEELTGPEYAGKFIDMLNETNIEVMLDTMVLDVDETEKCVHAMNKKNGY
FT                   MKLEGKSIILNMGCRERTRGAIAIPGDRPAGVFTAGAAQRYVNIEGYMVGKKVLILGSG
FT                   DIGLIMARRMSLEGAKVVGCVELCPYSNGLNRNIVQCLNDYDIPLYLSHTITDIQGDKR
FT                   VEKVIVSKVDEKNQPIPGTEMEFDVDTVLLSVGLIPENELTRSAGITMDPATSGPVVYE
FT                   NMETSAEGIFASGNVVHVHDLVDFVTAESQKAGKSAAEYVKNGETKDQTCIDIKNGDGV
FT                   NGIVPQKVRPSNVDKKVEVMFRARNVFTDVAIKVRSNGEELASFKREHMAPGEMEKIVI
FT                   PKAFLDKVENGEITVSVEKVGA"
FT   CDS             128248..128598
FT                   /transl_table=11
FT                   /locus_tag="CL2_01450"
FT                   /product="Uncharacterized protein with conserved CXXC
FT                   pairs"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37256"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXB1"
FT                   /protein_id="CBL37256.1"
FT                   /translation="MTDLICIVCPKGCHLKVDEENGYKVTGNGCPRGAAYGEKELVNPT
FT                   RVITSTVRVEAKTARRVPVKTASDIPKGKIYDIMKELDKVTMKAPVAIGDVVIPNVLGL
FT                   GVDVVACKKVAE"
FT   CDS             128643..129686
FT                   /transl_table=11
FT                   /locus_tag="CL2_01460"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37257"
FT                   /db_xref="GOA:D4MXB2"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXB2"
FT                   /protein_id="CBL37257.1"
FT                   /translation="MSVITFVCAGQMNSAITFPAFENGHEVRLVGSPLDRDIIDGLKKD
FT                   NFHITLKRTLHDGIKYYQIEELEEALEGADLILGGVSSFGLDWFCDEILPVLPEDVPLL
FT                   TVTKGMVDLDDGTLVPYPHIFEQRQPEGKHINFNAIGGPCTSYELADHDDSHVAFCGKD
FT                   METLKFIKSLLTTDYYHISLSTDVVGVECAVAMKNAYALGVSLAVGLAEKRDGEIGAVH
FT                   YNSQAALFGQGVKEMIHLLELIHGGPENIIHGAGDLYVTVFGGRTRKIGTLLGRGLTFD
FT                   QAMEELQGVTLESIVIATRTARAVRKLAERGVVSLDDFPLLMHVDAIINEGAEVDIPWE
FT                   KFTTVVE"
FT   CDS             129868..131361
FT                   /transl_table=11
FT                   /locus_tag="CL2_01470"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37258"
FT                   /db_xref="GOA:D4MXB3"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXB3"
FT                   /protein_id="CBL37258.1"
FT                   /translation="MKKYIMALDAGTTSNRCILFNEQGVICSVAQKEFTQYFPHPGWVE
FT                   HDADEIWSSMLGVAVEAMNKLNITPDQVAAIGITNQRETTIIWDKNTGEPVYHAIVWQC
FT                   RRTSEYCDQLKEKGLTEKFRQKTGLMIDAYFSGTKVKWILDNIPGAREKAEAGDLLFGT
FT                   VETWLIWKLTKGRVHVTDYSNAARTMLFNINTLEWDDEILEELGIPKSMLPQARPSSEV
FT                   YGMADESYFGKEIPIGGAAGDQQAALFGQTCFTAGEAKNTYGTGAFLLMNTGTKPVFSD
FT                   NGLITTIAWGLDGEVNYALEGSIFVAGAAIQWLRDEMRLVDSSPDSEYMASKVKDTNGC
FT                   YVVPAFTGLGAPHWDQYARGTIVGITRGVNKYHVIRATLESLAYQTYDVLKAMEADSGI
FT                   KLSALKVDGGASANNFLMQFQSDILNTEVRRPRCVETTAMGAAYLAGLAVGYWKDKNDV
FT                   INNWNIDRKFHPEMKEDEREEKLAGWEKAVKYSFGWAKN"
FT   CDS             131407..132120
FT                   /transl_table=11
FT                   /locus_tag="CL2_01480"
FT                   /product="MIP family channel proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37259"
FT                   /db_xref="GOA:D4MXB4"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXB4"
FT                   /protein_id="CBL37259.1"
FT                   /translation="MLPYIAEFIGTMLLILLGDGVVANVNLERSGMKGAGAVQITFAWG
FT                   LAVLVPAFIFGSSSGAHFNPALTIALAAIGNFSWSMVPGYVIAQFAGAFVGAVLVYVLF
FT                   AGQFEVTKDQGTKLGVFCTGPSIANTGLNLLSEIIGTFVLVFAILGIGNVENAGSMGLN
FT                   YFFVFAIIVSIGMSLGGLTGYAINPARDLGPRLAHAVLPIPGKGDSNFGYAWIPVVGPI
FT                   IGALLAGGLFVIIPW"
FT   CDS             132158..132703
FT                   /transl_table=11
FT                   /locus_tag="CL2_01490"
FT                   /product="Predicted DNA-binding protein with PD1-like
FT                   DNA-binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37260"
FT                   /db_xref="GOA:D4MXB5"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR025707"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXB5"
FT                   /protein_id="CBL37260.1"
FT                   /translation="MDVFLDKKTSIFLIKSMKTPRKEIARALRYMQDYKIKKESMIMEY
FT                   KKFNNQYVIRIDKGEEICAKLKEVAQKENIKLAYLTGIGAAGKVTAGVFDTKEKVFKGH
FT                   TWEGDLEIVSIGGNINTMNGETYTHFHISVADEAGNVYGGHLTEAVISGTGELVLTEIE
FT                   GTVDRKFDEEIGLNLFEF"
FT   CDS             132729..134114
FT                   /transl_table=11
FT                   /locus_tag="CL2_01500"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37261"
FT                   /db_xref="GOA:D4MXB6"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXB6"
FT                   /protein_id="CBL37261.1"
FT                   /translation="MEMMTGRTLFRNYKEYDQKEVEICGWVKSNRGSKKFGFLVINDGT
FT                   FFEPIQVVYDQEMGNFDTVSKLNVGTAVIVNGTVIVTPDAKQPFEIHAKSVEVEGECPS
FT                   DYPLQKKRHTLEYLRSISHLRPRTNTFQAVFRVRSQIAYAIHKFFQERDFVYVHTPLIT
FT                   GQDCEGAGEMFQVTTMDLNKIAEEGKVDYEQDFFKKPVSLTVSGQLAGETFAQAFRNIY
FT                   TFGPTFRAEDSNTTRHAAEFWMIEPEIAFADLEDNMILAEQMIKYIINYVMEHAQEELQ
FT                   FFNKFVDKGLLERLNHVVSSDFGRVTYTEAVKLLEEHNDEFEYKVSWGIDLQTEHERYL
FT                   TEKIFKKPVFVTDYPKEIKAFYMKMNEDNKTVAAMDLLVPAIGEIIGGSQREDDLAKLE
FT                   ERITELGMKPEDYDFYLDLRKYGSTRHAGFGLGFERMVMYATGIANIRDVIPYPRTVGK
FT                   CQY"
FT   CDS             134167..134775
FT                   /transl_table=11
FT                   /locus_tag="CL2_01510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37262"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXB7"
FT                   /protein_id="CBL37262.1"
FT                   /translation="MHSIWQEQMEFPVYPILKRDKKTDILYVGATLKHAIEANFQKEMG
FT                   RSVMIIEEKSIGDMPELGGMGILKATNMNEFKELCILKNYIIRQHIPCDLEIISETSIQ
FT                   VHPVKLFLFMTKDVEVYEQTKITARQGKRLDIESAYIDAGQVIEDDKPCEKRYIHVFSE
FT                   AGFPEITKPDILEIRKYKEDYLVLSYQRKLEGSRHSWEI"
FT   CDS             134867..135313
FT                   /transl_table=11
FT                   /locus_tag="CL2_01530"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37263"
FT                   /db_xref="GOA:D4MXB8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXB8"
FT                   /protein_id="CBL37263.1"
FT                   /translation="MSMIDVIRKEMMTAMKNKDKERKESLSMLLSALKNAQIDKREDLT
FT                   EAEENTIIAKEIKQTKETMDTCPADRTDIIDECKARLAVLEEFAPEQMSEEQIEAEINA
FT                   VLAELGIDAPTMKDKGKVMKNLMPRVKGKADGKLVNQLVGAKLS"
FT   CDS             135310..135843
FT                   /transl_table=11
FT                   /locus_tag="CL2_01540"
FT                   /product="Amidases related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37264"
FT                   /db_xref="GOA:D4MXB9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXB9"
FT                   /protein_id="CBL37264.1"
FT                   /translation="MRNILIVVDMQNDFIDGSLGTKEAQEIVTPVAGKIRNFEGDIYGT
FT                   LDTHEEDYLSTQEGKNLPVKHCICGEDGWALNSEIMQAIAETKAEVHNFCRKGTFGSME
FT                   LAQILKETYEDQEVEIELIGLCTDICVISNAMLIKAALPEVKVSVDSSCCAGVTPESHR
FT                   NALEAMKMCQIEIC"
FT   CDS             complement(135939..136175)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01550"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37265"
FT                   /db_xref="GOA:D4MXC0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXC0"
FT                   /protein_id="CBL37265.1"
FT                   /translation="MARIIDTTEKNLIGHKVKQLRKKHHMSQKELSEKLETYAVYICRG
FT                   SISRIEDQSRTVTDIELYAISKIFQISIEELFD"
FT   CDS             complement(136340..137200)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01560"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37266"
FT                   /db_xref="GOA:D4MXC1"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXC1"
FT                   /protein_id="CBL37266.1"
FT                   /translation="MTSENDVLESIDKLYDQLFSKERQIADYIRANPQEVIMMNVSQLA
FT                   KASKTSEATVVRTCKHLGYQGYYQMRLVLSRDIGTKSNDADLNEEGDFVQRIFEHNIQN
FT                   LRAIASRLSKKELLTCAYKLTHATAVHILAIGNTTPIALDLSFRLSRFGVQAFSSSISE
FT                   YYLNNVSLGKETDVVIALSGSGTAKQVLQAVDIAKDIGMEIICITADKDSPLARISDHV
FT                   LSSYEELPLFNESKEPLSHLACMAIGDALLYAIKIYLMDKDTHPNSNIKKRTDDMEMFL
FT                   SSTKL"
FT   CDS             complement(137319..137954)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01570"
FT                   /product="dihydroxyacetone kinase DhaL subunit"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="2.7.1.121"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37267"
FT                   /db_xref="GOA:D4MXC2"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXC2"
FT                   /protein_id="CBL37267.1"
FT                   /translation="MNFSNKDGGKIIFELIKTIQDKKDFLSEVDGKIGDGDHGINMNKG
FT                   FTMTYCKVNGKDYDMTTAFSVLGDTLLEDIGGSMGPLYGAFFDGLSEASEDHDVIDKKT
FT                   FQEMIHTALEAIQDIGNAKRGDKTLLDTLIPAVEAYDAALEAGKDFKEALSELKSAAED
FT                   GWKSTEDMVAKIGRASRLGERSRGVLDAGATSCYLILESLATSIQSIL"
FT   CDS             complement(137965..138618)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01580"
FT                   /product="Dihydroxyacetone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37268"
FT                   /db_xref="GOA:D4MXC3"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXC3"
FT                   /protein_id="CBL37268.1"
FT                   /translation="MAVKKAKKAGIEVKTVVANDDCASAPKTELEKRRGVAGEVLMWKI
FT                   GGAKASMGADLDEVIAAAQKAINNTRSIGIGTAPCTIPAVGHPNFQIEDGTMEVGIGHH
FT                   GEPGIKVEPLKSADEIAEEMLNNILPDLPFESGNEVVVLLSGLGATPVMEQYIVYNKVE
FT                   EILKEHNISVYKSYVGNYFTSLDMMGITLTLMKLDDELKECIDMPCQSVGLTQF"
FT   CDS             complement(138822..138962)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37269"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXC4"
FT                   /protein_id="CBL37269.1"
FT                   /translation="MNRIYNNPDYMVEDMTKGFLKANKDLIAETENPQVVKYKKLLFLI
FT                   K"
FT   CDS             complement(138977..139429)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01600"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37270"
FT                   /db_xref="GOA:D4MXC5"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXC5"
FT                   /protein_id="CBL37270.1"
FT                   /translation="MKIAIGCDEAAYSLKKIIIDHLSNRDDVELKDFGAEAGEVVLYPD
FT                   VAKVVAEAVASGEFERGILVCGTGIGMCITANKIPGIRAAVCHDPFSTERSRKSNNAQI
FT                   MCMGERVIGPELAKYLVDIWLKCDFAGGGSTPKVNRINEIDAEYKK"
FT   CDS             complement(139448..140305)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01610"
FT                   /product="D-tagatose 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37271"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXC6"
FT                   /protein_id="CBL37271.1"
FT                   /translation="MNNKFGVDSFIWAESFSEKDLWIIPKAKELGFEVIDFAISNPFTF
FT                   PTEKVKESLKETGIDCVCTTTLTEETNPISPDPAIRKNALDAMKKCVDICNELNAPILG
FT                   GVNYAAWGYLTKKPRTQDEWNWGVENMKQVAAYAKETGNVTICVECVNRFETHFLNIAE
FT                   DAVAFCKATGMDNVKVHLDCFHMIREEKSFSEAVKTCGKQYLGYVHVNENDRGIPGTGL
FT                   VPFKEFFEAIKEIGYDGPLVIESFDPSFEELAGNCAIWRSFAKTGEELAVKGLANLKAI
FT                   AETV"
FT   CDS             complement(140315..141511)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01620"
FT                   /product="Phosphomannose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37272"
FT                   /db_xref="GOA:D4MXC7"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXC7"
FT                   /protein_id="CBL37272.1"
FT                   /translation="MSTIKEVFEAGKGILQLTPTWVPRGFNEPGHRLRLHPDDYYAFGM
FT                   DRGGICERWLGSINRALNGPKTGETEGMSYVLVNKETKEKVLFKDFIDELGADLIGDTL
FT                   MEKYGTWPVFAKLYDYDKPLFHHLHLKEEMANRIGMHGKPESYYFPPQYNAPYLGRFPL
FT                   TYFGFDPSTTKEEVMDCLRNYDVKDNRITELSRAYRIKLGTGWYTPAGVIHAPASVVTF
FT                   EPQWNSDVNTIMENVTMGEVNPHNLLTDCAPEEEKDDLEAIFNQIDWEESTRADYKETY
FT                   FREPKIKSSTNEAVEKWVAYANDYVAAKEVTVLPGQTYTLTDQSAYGLVVTQGHGFFGD
FT                   FECEAPGLLHFDDISGDEFFISEKAAKAGIVVKNTSTYEPLVLLQNYANNNPEVPAEK"
FT   CDS             complement(141558..142562)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37273"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXC8"
FT                   /protein_id="CBL37273.1"
FT                   /translation="MKQEKYIGHSSQISGVEEYRCLNGKSDGMHVLHIRNGLGMELMIN
FT                   ADRCADISRLSLDGKNLSYTSVVGNVAPDYFSIDSDGFGFLKSFNCGFITTCGFDNIGN
FT                   PNEDEGTLYGLHGNVGNIPAEYIYHTEDATSIEVHAIIKDHAIFGKKFTLHRTYVISKT
FT                   ENTFALHDKIVNEGSAPSPLMYMYHMNIGYPLLTENSEFYINSYEVVPRDEEAKKGLAQ
FT                   WNQMIPPTPNFAEQCFYHHYHTDLAKMMVYNKDIEKGIQICFDTKEFPQNLQWKMMGER
FT                   DYVLGLEPCTADLDGRHTIKKNSEILTLEPAESKDFSVNVHLFNDKFQWESAK"
FT   CDS             142853..143731
FT                   /transl_table=11
FT                   /locus_tag="CL2_01640"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37274"
FT                   /db_xref="GOA:D4MXC9"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXC9"
FT                   /protein_id="CBL37274.1"
FT                   /translation="MLMNMKELLSVANEHNFAVPAFNIGTGQILNAVVECCEEKQAPVI
FT                   LAIHPNELEFQGDSFIEMCKDRANKSHVPMCIHLDHGATMEQVQRAIRCGFTSVMIDAS
FT                   SESFEDNIKITKEVIKVAHPLGVSVEAELGTIGDIKEDSGNREIGSKEIIFTKPEDAKK
FT                   FVEETGCDTLAIAIGTAHGIYPKDFVPHLEQELLTEIKNTVSIPLVLHGGSANPDSEIA
FT                   EAVKRGVNKINISSDIKDAFYQQLRKTLGNDPVIREPFDLYLESIDAMKEVVNQKIDLF
FT                   NDADKMKYYKL"
FT   CDS             143762..144211
FT                   /transl_table=11
FT                   /locus_tag="CL2_01650"
FT                   /product="PTS system, fructose subfamily, IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37275"
FT                   /db_xref="GOA:D4MXD0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXD0"
FT                   /protein_id="CBL37275.1"
FT                   /translation="MDIKSVLDERIICTELDAVDKEDALKKMIKMLLDAGYIDDAEGFY
FT                   EDVLLRESQGITGIGNYIAIPHGKSSSVSKVGISIAKLNNEIQWETNDGKGVKVIFLFA
FT                   VGDDSENSLEHLKLLAQVAGRIASDEAVEQLLNAHSVEDIKKVFA"
FT   CDS             144228..144533
FT                   /transl_table=11
FT                   /locus_tag="CL2_01660"
FT                   /product="PTS system, fructose-specific, IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37276"
FT                   /db_xref="GOA:D4MXD1"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXD1"
FT                   /protein_id="CBL37276.1"
FT                   /translation="MKIVGVAACTVGIAHTYIAREKLMEAAKKRGHEIHMETQGVIGIE
FT                   DELDPKDIAEADVVILAVDVNVKGKERFAGKKMIEVPTETVVMSPNKLIEKIEQLV"
FT   CDS             144557..145636
FT                   /transl_table=11
FT                   /locus_tag="CL2_01670"
FT                   /product="PTS system, fructose subfamily, IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37277"
FT                   /db_xref="GOA:D4MXD2"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXD2"
FT                   /protein_id="CBL37277.1"
FT                   /translation="MKNLQIKKHMMTAISYLIPFVCTAGMLMVIGNIAGGTSVDDFTKQ
FT                   ISFPDFLTSLGGTGLGFLPVIICAGVSYSIADKAGIAPGVILGLLCKDAGYGFLGGLVS
FT                   GYLVGYFSVWLLKVVKVPKWVEGLLPQLILPLLGSLIIGALMKYIVGIPILMLTNAITG
FT                   MLENMQTNMSMIIPFGIIVGVLSAVDYGGPINKVVYAFVCGLLSEGIGGPVAILMQASM
FT                   IAPFGLTIGYFLSRILKRDIFSKEEVDNLKSAFIMGCCMITEGSYPIILNDLIRITICT
FT                   GVGAGVGGAICAALNVTSSVPHGGLFALPGFNYPQYWMLALLVGSCVFAVLLQFLKRKP
FT                   VEQDASEEKDIDLSDLKIS"
FT   CDS             146153..147004
FT                   /transl_table=11
FT                   /locus_tag="CL2_01690"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37278"
FT                   /db_xref="GOA:D4MXD3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXD3"
FT                   /protein_id="CBL37278.1"
FT                   /translation="MKNALELQNVSKSFKEFEMKDMTFSLPEGCILGLVGKNGAGKSTT
FT                   IRLIMDMIHKDSGTIYVLGKNIEEDFTETKQDIGVVLDEPSFPEYVTADQMNNIMKNIY
FT                   RNWDEKRYYELIDQFELPKWKKQFKNYSKGMKMKLAIAVALSHHAKLLILDEPTSGLDP
FT                   FMRDEILDILYEFTREEDQSVLISSHIVSDLERLCDYIAYIDQGSLKLYEEKDCLIEQY
FT                   GILKCSKEELKEFDEQAVKGVRENPYGVEALVDRSKMPKDYETDMATLEEIIVFLSKGQ
FT                   EE"
FT   CDS             147019..147651
FT                   /transl_table=11
FT                   /locus_tag="CL2_01700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37279"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXD4"
FT                   /protein_id="CBL37279.1"
FT                   /translation="MKGLIRKEWYSLWSQYRIHMLAMLGLGVLLPIIKNTDFFPDESFW
FT                   IYCAVITIFYILMHSVEYEKKSNWDMYRATFPINGREIVVSKYIFGFGIVIIASILVFA
FT                   GSMICQKMIVGRINIYFIGRVVKAIWINGTLDMIFVFPILCRYGYDEGRVSAAMIVCFL
FT                   GMLYPYRLQQLLLNLPFPTIVFMILLFIIWCFSGVLSCKLYEKRNDQ"
FT   CDS             148445..148672
FT                   /transl_table=11
FT                   /locus_tag="CL2_01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37280"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXD5"
FT                   /protein_id="CBL37280.1"
FT                   /translation="MDTYYVTRIEEPDFGCEGRPEGQEIKDKVYLKEEITKEETIIFME
FT                   DKLLYERDINEGMKVVIDGDGRLQKAEDRS"
FT   CDS             148669..150000
FT                   /transl_table=11
FT                   /locus_tag="CL2_01730"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37281"
FT                   /db_xref="GOA:D4MXD6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXD6"
FT                   /protein_id="CBL37281.1"
FT                   /translation="MKDLTKGKISTLILGFAIPVFLGNLLQLTYSLADTRIVGSFLGER
FT                   SLAAVGATTTISNLIVGFLLGLANGFAIITAQKFGAGDKKRVRRSFAIALMLGVIVSAI
FT                   LILIGTVFINPILGFLNVPGKLFIEAKQYILIIIIGLWVTMFYDILMAVMRAIGDTLTP
FT                   LLILAISVGLNIVLDLLFVAVWKTGTWGAAAATVLAQFIALVICCFYMIHKYELLRLNK
FT                   NDFKDVESKMIKEMLATGMSMGFMSSLVNIGSLTLQTAINKLGQEIIVAHTAARKITEI
FT                   YMIMFSVFGQTMATFCGQNMGAGKADRIKEGMKLAIIYTCVWSTFAMIASYTIGPQLVH
FT                   MVTGSHKDVVIVNATNYLKFNTIFYYVTAVISIVRNVMQGIGDQITPLVSSGLEMVGKV
FT                   VIAFTLVPLMGYAGVIVAEPIVWFIMVIPLLVQIIRTPKLKANK"
FT   CDS             complement(150111..151445)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01740"
FT                   /product="Glutamate dehydrogenase/leucine dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37282"
FT                   /db_xref="GOA:D4MXD7"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXD7"
FT                   /protein_id="CBL37282.1"
FT                   /translation="MSYVDEVIEQVVAQNPAEPEFHQAVKEVLESLRAVVEANEEAFRR
FT                   DALLERLVNPERQFKFRVPWVDDKGQVHVNTGYRVQFNSAIGPYKGGLRLHPSVNLGII
FT                   KFLGFEQIFKNSLTGLPIGGGKGGSDFDPKGKSDREIMAFCQSFMTELCKYIGADTDVP
FT                   AGDIGTGAREIGYMFGQYKRIRGLYEGVLTGKGLSYGGSLARTEATGYGLLYFTDEMLK
FT                   CNGKSIKGATIAVSGAGNVAIYAIEKAQQLGAKVVTASDSTGWIYDKDGIDVELLKEVK
FT                   EVKRARLTEYAAARPSAEYHEGRGVWSIPVDIALPCATQNELHLEDAKQLVANGCYAVA
FT                   EGANMPTTLEATEYLQKNGILFAPGKASNAGGVATSALEMSQNSERLSWTFEEVDGKLQ
FT                   NIMVNIFHNLDDAAKRYGMEGNYVAGANIAGFEKVVDAMTAQGIV"
FT   CDS             151651..152397
FT                   /transl_table=11
FT                   /locus_tag="CL2_01750"
FT                   /product="Glycosyltransferases, probably involved in cell
FT                   wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37283"
FT                   /db_xref="GOA:D4MXD8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXD8"
FT                   /protein_id="CBL37283.1"
FT                   /translation="MKSVAMAFYNGAKYIDEQIRSILDNMEETDELIISVDDASDGSEA
FT                   ILEDWVQNDQRIRIIKGPGKGVVKNFENAFKHCRGEIIFLSDQDDVWKKNKMREIERVF
FT                   EDPKVMAVVHDAQIVDEKLSSLDQTTFEWRNSGTGFWKNMKKNSYIGCCMAVRRSAMKR
FT                   ILPIPDDIWIHDQWIGLLSEQLGKVVFLEEPLIYYRRHGGNVTELTHGSITSMIKKRYH
FT                   MIMGINHRVKEWSRHDKQNQRHTENS"
FT   CDS             152360..154939
FT                   /transl_table=11
FT                   /locus_tag="CL2_01760"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37284"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXD9"
FT                   /protein_id="CBL37284.1"
FT                   /translation="MTNKIKDILKTHKYLLLSFFLPVLLLEGIAIAEKIQPFGSESFLI
FT                   VDALHQYLPFFADYQEKLKSMDSMFYSFHAGLGYNFLGLWAYYLASPLNLVIALVSKSM
FT                   LTMILSHLYVLKIALCCFTAAFYFRKRRGKDEISIVAFGMAYGLCSYMVGYSWNIMWME
FT                   VMMMLPLILYGIDKLIKEHDGRLYCFALFISLWCNFYMSYMTCLFLILWYLLYSHKNVK
FT                   EFFTNGFRFAGYSLLSGVMAAVVLLPAYLGIMQTSSAKLQFPKELWYGTFGNLFSRHFL
FT                   GTTPLTMAVDDSKINLYCGILTLLMAGFYLAVREIRLIDKIRRLLLLVFLFFSFNMPVL
FT                   GYVWHGFHDQYGIPNRFAFLYIFALLAMAYEGYCVLVRGKRKVSLWIYFAVILCGILIG
FT                   ITMKTSTVKLEMKTVYATVAAIAVYMICFALYQKKIFRKKIFTTLICFLFIVETAAMAV
FT                   MGFQENGTVDTDSYFQDTKAITEVKKEYQKNVETRMELISGRMLDESIWHTLNGMTLFG
FT                   STAQGNVVDMMDQLGFYTGVNEYLYEGATPFTNNLMSMKYQIYRPYDTKYTEFSLKESV
FT                   GNVTVYKNPYRTALAYTMDDLVQTWDYEDYNPFYVQNDLATSAFDVDELFHIVKTAKPQ
FT                   LNDCKITSDNGDGEYVFENTSARPDNMVFTIRSTKTRRLYIHFDGSQVENTVIEKNGEQ
FT                   VLTGRLDSQIIYLGNVQKGDEIRIKMQLKQDNEMSGVVRLTAAELDEEVMEELAQRMQE
FT                   NAWKLTSAKGNHLSGTIHAQEDQMLFFSIPYDKGWTVKIDGKKVKTKALGKAFLTVKVP
FT                   EGKHKVSLTYVSSGFKEGAILSVAGFVIFILITAFFRRKKKAAVKEI"
FT   CDS             155035..155895
FT                   /transl_table=11
FT                   /locus_tag="CL2_01770"
FT                   /product="Predicted secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37285"
FT                   /db_xref="InterPro:IPR009343"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXE0"
FT                   /protein_id="CBL37285.1"
FT                   /translation="MRKFIGKFLAAGLCVAMALSSVTVKADSVDQKYLALGADLTASQK
FT                   KKVLELLDLDDNSDYKVITVTNKDEHEYLDSYLSSRVIGTRALSSVTVEQKDDGNGVNV
FT                   TTQNISYCTSGMYRNALITAGIKNADVKVAGPFKISGTAALVGVMKAYEEMTGKKIPEK
FT                   SKDAATDELITTGEVAENIGSDDAEKLIADVKQKVAKDNLSSPSEIKQAIEESAKDLNI
FT                   NLSDADRAKIQSLMDKISGLDLNVSQLKSQAKDLYDKLGGSQGILDKIAAFFQSIFSWL
FT                   SNLFS"
FT   CDS             155968..156240
FT                   /transl_table=11
FT                   /locus_tag="CL2_01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37286"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXE1"
FT                   /protein_id="CBL37286.1"
FT                   /translation="MGQNEMIFYIVAAGCMICLMIGIVRKPAYLLVLLLRGAFCAMIVY
FT                   GISIVCMRKGITAPVNLNILSIGTGALLGLPGIIALYAAAVFLLQ"
FT   CDS             156364..156867
FT                   /transl_table=11
FT                   /locus_tag="CL2_01790"
FT                   /product="Flp pilus assembly protein, protease CpaA"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37287"
FT                   /db_xref="GOA:D4MXE2"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXE2"
FT                   /protein_id="CBL37287.1"
FT                   /translation="MKIRILLFLIMAAIYDYRDFKIPNKLNGAGALITLVLAGVSGMKA
FT                   ADMMIGVLVVLISCGLLFYIGCLGGGDVKLLMVCAISIGRAMPRFLILSFICNGIYAVI
FT                   FLWKRKNFHLRLFRLFQYVTQCKDNKRLLMYETENGNLMKDGMIHFSFGILAAYMICLL
FT                   GGGL"
FT   CDS             156864..157712
FT                   /transl_table=11
FT                   /locus_tag="CL2_01800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37288"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXE3"
FT                   /protein_id="CBL37288.1"
FT                   /translation="MKDISIGIYHKDHQYGKRLMEYLNHQKDFPMTASFTSDEEMFFKQ
FT                   EQEGDFECLVLAEETDYHGDFPVCRIGANESMGGMYCQSAKEIAAGIYHCLNVSPQIEN
FT                   ERIFGVYSPISRLEISAFARNMAASNGWIYFGMQPYGHFEEDETDDLLLFYIKEHKEDI
FT                   VLYFMEHQKKFDGCVGFAGASCYLDYRELSMQDYEWFFEKLRETGICIIFDIGIASPPD
FT                   LKFFGLFDRIFLPLMRQDLGCMEYKKFQKQMRKHGVWKLTNWEEVMLESWKNKGGRGQW
FT                   P"
FT   CDS             158880..159638
FT                   /transl_table=11
FT                   /locus_tag="CL2_01820"
FT                   /product="Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37289"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXE4"
FT                   /protein_id="CBL37289.1"
FT                   /translation="MKHIRNLWNLLKQEISLWKYERQELVKGICYIVMIAWLFFDRIAF
FT                   AILLIPYLFVFMKQQRIHKGHREKEKLRKEFREMMISIGNSLSAGYSIENALKTAKNDL
FT                   EMYEEHSLLAKELQLLINKLKMNEPVDNLLFDMAEHVGLEEFYQFAQVISIAKKSGGNL
FT                   IEITENTIEHLSQAIQTKEEIHTMIAAKQMEKKIMSVMPYFILLYVRIANPGYFDILYE
FT                   SFAGVLVAVISLLCLWIADIWAERVTEIEI"
FT   CDS             160986..161159
FT                   /transl_table=11
FT                   /locus_tag="CL2_01840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37290"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXE5"
FT                   /protein_id="CBL37290.1"
FT                   /translation="MRNFLKHFFKDESGMGVVEVILIIVVLIGLVIIFQTQIKKVVDSI
FT                   FKTITSKTGQVK"
FT   CDS             161156..162598
FT                   /transl_table=11
FT                   /locus_tag="CL2_01850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37291"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXE6"
FT                   /protein_id="CBL37291.1"
FT                   /translation="MIRDEQGSMSAFLAMLFLVFLLLISVCVEGIYMYTARGKAMGIYM
FT                   SGLSHTKGNYQKELADMYHIYAMDPRYHKKIETDFSDRMKESLDQNGDPFRFQTGSTKI
FT                   SDILDLSAQKGEVLKYQIRQQMQYEAAGDILKNLTKKIKAGEDQKNEFSGIKDQIQKEE
FT                   EEAEETENEKTLTSEPVKKDPRKGFMKLLKEGSVPLIMGEKKVSDLPINIVYGKKDTTK
FT                   QSVWNFMNRKDVEKELDEFEKTASTDSFASELPVVLYATKYFHFLTDTTKKDGIKYEIE
FT                   YLIAGKDSEKENLGMVFWRMIALRFVMNAACVYQDPAKEKEAALLAASILGVTGFPPAV
FT                   AVAKNLLLLALAYGESVIDVRNLADGKKIPAVKTSSDWQLSFAGLATLNCKRKPVKQGM
FT                   SYEDYLLLLLISQKDKRQKYFRMMDLMEQNIRRKVPDFKLDQCISSYKITQNLKLKKLG
FT                   FGGMILPFATYTDLKMSRYATY"
FT   CDS             162639..163526
FT                   /transl_table=11
FT                   /locus_tag="CL2_01860"
FT                   /product="TadE-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37292"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXE7"
FT                   /protein_id="CBL37292.1"
FT                   /translation="MFSCQKHFSKVNPVQNDNNNNKIVVKKFKRASSSASDLSGNEEGA
FT                   MTLEASLIVPIFLIVLLMLISAGEILMIHQQISHGACEAAKRAAVNEYRIRQKKKSGSD
FT                   LSGFSAKAAFLAAVNRKFLDHSALIGGSAGAAAACRLTLTSKGEYIVSVRYYIRKTMPF
FT                   LSTHTVSYEQSVRQKSMTGYVPDGDELKKGYVYITPHEAVYHKDLSCTHLSLDISVDED
FT                   VEKYRNKRTQYKPCDKCTKHEKGDFSCVYIAKEGESYHTDLGCSGLKRTVKQVDLSTLK
FT                   GMRPCTRCAKQGDT"
FT   CDS             163523..164017
FT                   /transl_table=11
FT                   /locus_tag="CL2_01870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37293"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXE8"
FT                   /protein_id="CBL37293.1"
FT                   /translation="MTVEISALLPIILMVLWMFFSYLFYFMNCGIAQGIMEEAVQKAAD
FT                   VKITGAEYDTGKLSYQKVNQKLITGNVISSNKSGNTKAEKEMKEQLRRHLFMAEVSLVR
FT                   VSTTPLRVSAKIKTRSAVVAGDFLSMFGICLFEYEGNDQAQGDFEIDQIRRWNALEGAM
FT                   D"
FT   CDS             165325..166308
FT                   /transl_table=11
FT                   /locus_tag="CL2_01890"
FT                   /product="Uncharacterized membrane protein (homolog of
FT                   Drosophila rhomboid)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37294"
FT                   /db_xref="GOA:D4MXE9"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXE9"
FT                   /protein_id="CBL37294.1"
FT                   /translation="MYQKIIELLKIHGYMKNDTETGPCYVKNINGRNKCVFVIFDKNPD
FT                   GSSILEEDLYHLEDHARQLFGMDCAVLTLILSQDDKPVFLDPKDQFDDLYGPLSIVLAQ
FT                   NEASQAGQESEIEVKDNKSVKDFWKSLYQYKATLLIFTANLICFILTETYGDKIYDSFA
FT                   CNAYRVKKLHEYYRLFTSNYLHFGWDHFFNNMAVFLLLGSSLEKVIGSVRYVILYTGAG
FT                   IAGSIISVAYYSMIGQDVLSAGASGAIFGLVGALAAIFLFCKEQRQRFDGFGIFIMIAG
FT                   SLYHGFQSGTTDNAAHIGGCIAGFILSMLLYVLGSLIAAHKQGRSV"
FT   CDS             complement(166238..166957)
FT                   /transl_table=11
FT                   /locus_tag="CL2_01900"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37295"
FT                   /db_xref="GOA:D4MXF0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXF0"
FT                   /protein_id="CBL37295.1"
FT                   /translation="MNDLQELSTFSHEINNSLTLIYGQIQCIEKTYDTLTRNDHWNRMK
FT                   DDFSSLFDFIHQFLAPAEESSAAMEPLDLISVISEIRSSWSYYLHKEQIRFFIQADPGT
FT                   AFYVYGARSKLFQLFHNLISNAVKAIQQKKETCRSPHITHITVHLSKEQGHIVLNLSDT
FT                   GIGMTTEQQSRAFYRGVSFHPGGNGIGLSVVQNIARDLHIKIHIDSAPNQGTTFTLIFP
FT                   AYEQQLSCPTRTEALTK"
FT   CDS             167150..168754
FT                   /transl_table=11
FT                   /locus_tag="CL2_01910"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37296"
FT                   /db_xref="GOA:D4MXF1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXF1"
FT                   /protein_id="CBL37296.1"
FT                   /translation="MSYMALYRKFRPTRFSEVKGQDHIVKTLENQMRTGRIGHAYLFCG
FT                   TRGTGKTTVAKILAKAVNCEHPVDGEPCGECEVCKAIAEGSSMNVIEIDAASNNGVDNI
FT                   REIKEQVQYSPATGKYKVYIIDEVHMLSIGAFNALLKTLEEPPEYVIFILATTEVHKIP
FT                   ITILSRCQRYDFHRITAATIKKQLSDLMEQEHVDTEDKALEYVARMADGSMRDALSLLD
FT                   QCIAFYLGEKLTYDNVLEVLGTVDIQVYSDLLDMILSQDINGVMDLLEDVARQGREWSQ
FT                   FITDFLWYLRNLLLVGQGNAAEEALEVSTDQLKLLQEKAQQVEENTLIRYIRILSELLE
FT                   RIRYATSKRVLVEVEMMKMCRPQMEADTNSLADRVRQLEQQLEQLLQSGIPVQQAAQAG
FT                   QNQIALQQEVKSEQDPVEQLNEKFPPAKVEELIELVNHWRDVKRNLSPQMKYCLQRATL
FT                   SVNEEGTALRVLFPKEMNVESGYFLEEPERIEQLKQELSRQSGRDVELEVSVMNTDNDD
FT                   SDMINLDCIHMDVKIED"
FT   CDS             168795..169148
FT                   /transl_table=11
FT                   /locus_tag="CL2_01920"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37297"
FT                   /db_xref="GOA:D4MXF2"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXF2"
FT                   /protein_id="CBL37297.1"
FT                   /translation="MAKRSGGFPGMGGNMNQLMKQAQKMQKQMEETTKALEESTYEATA
FT                   GGGVVKVVVSGKKEVVSVHLEEEVVDPDDVEMLEDLIVAATNEALRKMEEDSQEKMGKV
FT                   TGGLGGMGGGFPF"
FT   CDS             169164..169760
FT                   /transl_table=11
FT                   /locus_tag="CL2_01930"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37298"
FT                   /db_xref="GOA:D4MXF3"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXF3"
FT                   /protein_id="CBL37298.1"
FT                   /translation="MDYYSNQITQLIEELGKLPGIGPKSAGRLAFHIINMPQDQVQKLS
FT                   DTIISAKTNVHYCKECCTLTDNEICPICASDKRDHSTIMVVENTRDLMAYEKTGKYEGV
FT                   YHVLHGAISPMLGIGPDDIRLKELMARLQGDVKELIIATNSSLEGETTAMYISKLVKPT
FT                   GIKVSKIASGVPVGGDLEYIDEVTLLRALEGRTEI"
FT   CDS             170385..170801
FT                   /transl_table=11
FT                   /locus_tag="CL2_01940"
FT                   /product="Diadenosine tetraphosphate (Ap4A) hydrolase and
FT                   other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37299"
FT                   /db_xref="GOA:D4MXF4"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXF4"
FT                   /protein_id="CBL37299.1"
FT                   /translation="MKKEDCIFCKIAGGEIPSNTIYENSEFKVIMDIAPASKGHVLIIP
FT                   KEHFKDIYEIDAITAGKLFQLATVVARALKEVLHCDGLNVLQNNGLIAGQTVYHFHMHL
FT                   IPRYEGDDVTIGWKEHSTEDIDMEQLRQDIKKAL"
FT   CDS             170811..171404
FT                   /transl_table=11
FT                   /locus_tag="CL2_01950"
FT                   /product="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenases, DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37300"
FT                   /db_xref="GOA:D4MXF5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXF5"
FT                   /protein_id="CBL37300.1"
FT                   /translation="MAKTSWKPGNMIYPLPAVMVTCRDKGQDNIITIAWTGTICTNPPM
FT                   TYISVRPERHSYEMIKNSGEFVINLTTKQLTRATDFCGVRSGRDVDKFKEARLTKEEAQ
FT                   VVDAPIIAESPVNIECKVEKIVPLGSHHMFMAKVVNIMVDDDYMEDNGRFALEKTNPLI
FT                   YSHGGYYETGKKLGTFGYSVRKKKKRKKPNGRKK"
FT   CDS             171388..171891
FT                   /transl_table=11
FT                   /locus_tag="CL2_01960"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37301"
FT                   /db_xref="GOA:D4MXF6"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXF6"
FT                   /protein_id="CBL37301.1"
FT                   /translation="MAEKNNNYILIGMPGSGKSTIGVLLAKALGYDFVDTDLVIQQKGG
FT                   GLLKEIIARIGNDGFKQLEEDVNASIDVNKSVIAPGGSAVYSDKAMRHFKEIGTIIYLK
FT                   LDYQTVKRRLGNLKARGVVLEKGQTLRDLYNERIPYYEKYADITVKLDKLSIGNSLEKV
FT                   LENL"
FT   CDS             171990..173285
FT                   /transl_table=11
FT                   /locus_tag="CL2_01970"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37302"
FT                   /db_xref="GOA:D4MXF7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXF7"
FT                   /protein_id="CBL37302.1"
FT                   /translation="MEQYIIKGGNPLVGEVVIGGAKNAALPVLAAAVMTDGKCMIDNMP
FT                   DVRDINVLLQAMQEIGADVDRTGKHEVTISGKGIHPECDVDNEFIRKIRASYYLIGALL
FT                   GKYKRARVALPGGCEIGSRPIDQHIKGFKMLGAQIEIENGMISATAEELKGAHIYMDVV
FT                   SVGATINVMMAASLAKGNTIIENAAKEPHVVDVANFLNSMGAKIRGAGTDVIRIKGVEK
FT                   FGDCQYSIIPDQIEAGTFMTAAVATKGDIMIKNVIPKHLEAISAKLIEIGAEVVEFDDA
FT                   VRVSATKRLESTNIKTLPYPGFPTDMQPQMAVTLALSNGTSVISESIFENRFRYVDELT
FT                   KMGATIQVDGRTAIISGVEGFTGADVHAPDLRAGAALVIAGLSAKGFTTVSDIGYIYRG
FT                   YEQFEQKLKQLGGEIQLVNNEKEVTKFKLKIG"
FT   CDS             173302..173940
FT                   /transl_table=11
FT                   /locus_tag="CL2_01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37303"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXF8"
FT                   /protein_id="CBL37303.1"
FT                   /translation="MRQYLKNEVFKVSKWVELFISAIIMIAVIGGTIYLVKDVVQLMMN
FT                   YPTSRDIYKFVGVAFNLVICIEFVKMLCKHTPDTLVEVMMFAIARQMIVEHTSPQQNLI
FT                   VVLAIAILFAIKKFFFGKFDDIDKTVFLPTQRISSINELVHVEIPKETQHQTLGELLEK
FT                   QIGTESGNFQVGQCYFFKGGALRVAKVKNGKITQIEVIRSKNAPVVLKR"
FT   CDS             174017..175198
FT                   /transl_table=11
FT                   /locus_tag="CL2_01990"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_01990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37304"
FT                   /db_xref="GOA:D4MXF9"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXF9"
FT                   /protein_id="CBL37304.1"
FT                   /translation="MDKVLFTSESVTEGHPDKICDQISDAILDALLEQDPMSRVACETC
FT                   TTTGIVMVMGEISTKAYVDIQKIVRDTVREIGYTRGKYGFDADTCGVITTIDEQSSDIA
FT                   MGVDKALEAKENNMTDEEIDAIGAGDQGMMFGFATNETEEYMPYPISLAHKLSRQLTKV
FT                   RKDGTLSYLRPDGKTQVTVEYDDGKPSRLDAVVLSTQHDPDITQEQIHEDIKREVFDKI
FT                   LPADMVDDETKFFINPTGRFVIGGPHGDAGLTGRKIIVDTYGGYARHGGGAFSGKDCTK
FT                   VDRSAAYAARYVAKNIVAAGLADKCEIQLSYAIGVAEPTSIMVDTFGTGKKSNQELVDL
FT                   IRKHFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRNDLDLPWERLDKVDLLKGE"
FT   CDS             177200..177427
FT                   /transl_table=11
FT                   /locus_tag="CL2_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37305"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXG0"
FT                   /protein_id="CBL37305.1"
FT                   /translation="MQNKLFLKTADICELLEVKQTLAYEIIGNLNKELEEQGYLTLRGK
FT                   VPTKYFVKRFYGVEDTCEIPQEEGKEWFHA"
FT   CDS             177420..177638
FT                   /transl_table=11
FT                   /locus_tag="CL2_02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37306"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXG1"
FT                   /protein_id="CBL37306.1"
FT                   /translation="MRKRKMYLSVEDIAELFGLSVSFAYRVVERMNADLASKNYYVILG
FT                   RVPTRYVEDKIYGLEHVEQYLKEDKAV"
FT   CDS             177635..177685
FT                   /transl_table=11
FT                   /locus_tag="CL2_02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37307"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXG2"
FT                   /protein_id="CBL37307.1"
FT                   /translation="MSMMQEKMYINVYGCG"
FT   CDS             177666..177842
FT                   /transl_table=11
FT                   /locus_tag="CL2_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37308"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXG3"
FT                   /protein_id="CBL37308.1"
FT                   /translation="MYMDVDDVCAILGVSKIYAYSLMREYNKELKAKGYIVVAGKISTK
FT                   FLAEKIYGMKVED"
FT   CDS             177845..178078
FT                   /transl_table=11
FT                   /locus_tag="CL2_02050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37309"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXG4"
FT                   /protein_id="CBL37309.1"
FT                   /translation="MGVYKEGKNWKVQVYYKDWQGNRKRKQKRGFRTKGEAKEWEKDFL
FT                   QQQSQGVDIEFGNFLEIYYKDMDVYNPFQSRK"
FT   CDS             179143..181269
FT                   /transl_table=11
FT                   /locus_tag="CL2_02070"
FT                   /product="Predicted permease."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37310"
FT                   /db_xref="GOA:D4MXG5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXG5"
FT                   /protein_id="CBL37310.1"
FT                   /translation="MFYKLAWRNSKRSRNENLIYFFTMVIAAAAFYIILSLKEQDVIRF
FT                   LGEIESDAVQRLLTNLMPTVYFCVLLFVFFLVVFANKYQLECRSRELGLYLMFGMTKKH
FT                   LFIQIMVEGIITSFLALLGGLLSGTFLSEITSIATARLVGYGIIVHQSSFSISAVIFTI
FT                   LGFLLIQSVALFLLCGKLFRKELYQLLYGEIAKKHWNGNAYISFLSLILGCVFLIVAYW
FT                   IVLSHFTDGIIILFISVVLGIIGTILFIKGTARLLSVMATTKKHKSTKSLYTFTLRQLQ
FT                   ENVVYKYISISVASILMMLTIMLIADGSTRIISNGNELTKESSVYDFTIVGEEQTVQQC
FT                   LSSKELKPYVENLNRMEIGEISSKLSVDWSILREKVVQSLPSDVLDSATQEATGYSFGP
FT                   DQPASLNLLGCIDTNTSPHIIPISSYNRLLEAIGEKNINLKNEEMIYYINPDFLGKAQK
FT                   DTISLLNNIVSDSEANGQGLISIKGKSYSLVPNVTLKGLTADENIKIMSALIVSDEMYS
FT                   YLVNPNTTTVYWNFCIPDKLVKEKGLILSIMETQDLLKPSGLYYESYLNNFGRQLFYIV
FT                   SGGYTDLYMGFMLLIIACALLALQFLTQMQSTKSRYLTLSILGANRKQIKQSIKQQVLC
FT                   YFLLPLSLACVSGAVGLYTMQKHLHSASAQTENAYPLLIVMSIIVILVIVVYGIAVAKT
FT                   AIHEIGKMEYKTNA"
FT   CDS             181262..181978
FT                   /transl_table=11
FT                   /locus_tag="CL2_02080"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37311"
FT                   /db_xref="GOA:D4MXG6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXG6"
FT                   /protein_id="CBL37311.1"
FT                   /translation="MLKIKIFKEKGDDVVLARIAIVEDDVYMREELENLLKKNGYEVFS
FT                   ILDFENVISCIISYSPDLILLDINLPFYSGFELCKELKSKQLGTVLILTARDRLQDELH
FT                   ALGLGADDYLTKPCNMERLLARIKNLLRRTEEQVGQGLLNVQGFLLDPNTFTLYIGKTS
FT                   YILPKNEGKILLTLLKNAPNIVTKEELYNILWGTDEFIDDNALQVNLVRLRKTLARFGL
FT                   EQRIETVRGQGYRMKG"
FT   CDS             181988..183034
FT                   /transl_table=11
FT                   /locus_tag="CL2_02090"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37312"
FT                   /db_xref="GOA:D4MXG7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXG7"
FT                   /protein_id="CBL37312.1"
FT                   /translation="MKKLKTLSIYISSYRIWVLTLLGIDLFFAFLIWAVCPNNFVSYIG
FT                   LILLVLFLVIVIPLNISIRKYHKADIIFKNFLSDPSEVNEYLLTETVPIVFHSYINELG
FT                   NHLRKQQENLNDQKVKVSDFESYIENWVHEIKKPVSLMTLLLDNRKNEMSNMVHQRMLY
FT                   VRDQTRQDIEQILYFSRLGATHKDYYFEKISLKSICQESIEDNRTLLEEAGFSINYSGN
FT                   ENVVVSDKKGLMFILGQVISNSVKYSTKKEIPILSFSIMESQNEENILLSISDNGSNIP
FT                   ESDIPFVFDKGFTGNTGSYLSRSTGMGLYLVRKMANDLSIDVEIKNNSYGGVTIILFFP
FT                   KVKNSLRR"
FT   CDS             183041..183514
FT                   /transl_table=11
FT                   /locus_tag="CL2_02100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37313"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXG8"
FT                   /protein_id="CBL37313.1"
FT                   /translation="MQEQKKEKLKILVIDWLIILGVYLFVRLMFIMFGLHLNNTLLRIC
FT                   LAIFPCLLGGLYLYRVYKQESIGFYSLTLIVPSIIEKIVVYLLGAYLYDISSLNMIKVM
FT                   DMIGSNQPYVNVDVSQSICYLVNLSFFNWSYIILSIVFSCSCVFFIFRNLLNF"
FT   gap             184720..185247
FT                   /estimated_length=528
FT   CDS             complement(185281..185529)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37314"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXG9"
FT                   /protein_id="CBL37314.1"
FT                   /translation="MKHTMKKPSYYLLSQAMDGDEKAIEKILAFYDPYISKCCLRPLYD
FT                   EYGNVYIVVDMELKGLIREALIKMILGFDIALEIEEE"
FT   CDS             complement(185536..185952)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02130"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37315"
FT                   /db_xref="GOA:D4MXH0"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXH0"
FT                   /protein_id="CBL37315.1"
FT                   /translation="MKPSDFQKTVQCRFESCLKKVVRHVVKDYQKKLKRRQKEETLFCE
FT                   LPEIVVESLAVWDDYDTDYTIFNVCGSDIRICDDELAEALKHLSERNRENLLMYYFLEM
FT                   SDTEIAKRQNISRSGVFQNRHNSLELMKKILKEK"
FT   CDS             complement(188020..188223)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37316"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXH1"
FT                   /protein_id="CBL37316.1"
FT                   /translation="MNNVTEFLPFLVPLVISELALLAYTLYHILTHKSYKRGNRTLWLI
FT                   VVIVGMQFIGPILYFLLGKEDS"
FT   CDS             complement(188216..188950)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02170"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37317"
FT                   /db_xref="GOA:D4MXH2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXH2"
FT                   /protein_id="CBL37317.1"
FT                   /translation="MSKYTTGEIAKLCGVSVRTVQYYDERGILIPSELSEGGRRLYSED
FT                   DYKKLKIICFLRDAGISIKSIGELLSESNPSSVISVLLEKQEQLLQNEVKERQEQLAML
FT                   EGIKKALKGIENFSVESIGDIAYAMENKKKMKQLHAVLLITGIPLNIIQWVSIILWITT
FT                   GIQWLFWGYILVAIPYAIFIIRFLSKRIVYICPQCHEIFKPHLKEFIFSNHSMTLRKLT
FT                   CTSCGYHGFCVETYREEEKNNE"
FT   CDS             complement(189093..189317)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37318"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXH3"
FT                   /protein_id="CBL37318.1"
FT                   /translation="MIGLKKRDIKKALKAGAKAGSVSFADVRADIEATIDEAMNSTDPE
FT                   VQANFKKYFGNKRPTPEEYIYKITQKTKV"
FT   CDS             complement(190463..191122)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02200"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37319"
FT                   /db_xref="GOA:D4MXH4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXH4"
FT                   /protein_id="CBL37319.1"
FT                   /translation="MRIAIIEDDEITRLELSKLLNTQGYETVLLTDFGNLTDELKQYSI
FT                   ELVLLDINLPYENGYEVCRKIKQVMPVPIIFVTSRDTNADELKSIQVGGIDFITKPYDT
FT                   LILLEKIKRALQLSNPNNFRELVKKDCTLDLHLSILKYQEQSIELTRNEFRILYYFFMN
FT                   EDKVISKEELLEKLWNDKYYIDENVLLVNMTRLKKKMKEIGIVHLLENIRGKGWKL"
FT   CDS             complement(191181..193148)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02210"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37320"
FT                   /db_xref="GOA:D4MXH5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXH5"
FT                   /protein_id="CBL37320.1"
FT                   /translation="MLGKLAYRNTKRNIKDYLIYLITVTASFSLIFAFNLVASSDEIVK
FT                   LCSSMDAFKNSLFAVNILIIFVICFLINYTTKFMFEKRSKELGTYMLLGIKKKEIAHLV
FT                   IIENILLGILAFVLAIPIGFLFSQFVSLVIVNLLGIPKTLFISLNFVSIGLLIIYFLTI
FT                   YVLVLLNLLRRISKMTIRDFLYFDKQNEKKMFRDSKKRNVIFVLSIILGAISLFLWNSR
FT                   CTMDNFNKQETLTYLMVSVIMLIISIYGISTTCADMFLTVLLKNKKMKYQNDNLFVART
FT                   FASKARTMSFTFGTLSMLILTSLLALNYSSINKASYDISVNLNAPYDVQLFDDKQVFDE
FT                   YIRVIEEEYTIDNTIEYDIYKEPNHQVQNFFQSEYYDFDPVLKLSDYNRLLELRKMPLL
FT                   SLNDNEYYIVTNSKFAYEVEDNKDIETITVANKNLKLKGYDTKSYWNSITNTGRFVVVL
FT                   PDKYVQGLEVSENHLIIDTKEETDAELENKIKEDMQHQLVKVDKNGEINDESYRVNVRG
FT                   AEIEQQKAMVAIVASLFMYIAFILISAVGTILAVQSLSDSTKYKYRYLTLRRLGINDKS
FT                   LFKTIRKQLLILFCVPAISAILCSFVMMSSLNNVYQQILGDKHLYLIYFGLNLIIFFLI
FT                   YSIYWIATYIGFKRNINEES"
FT   CDS             complement(193138..193908)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02220"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37321"
FT                   /db_xref="GOA:D4MXH6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXH6"
FT                   /protein_id="CBL37321.1"
FT                   /translation="MEHILNLEQVKKYYGGNSGNITKAVDGISMYVDKGEFVAIMGASG
FT                   SGKTTLLNCISTIDTVTSGHITVNNQDITKIKDKDFADFRRENLGFIFQDFNLLDTLTI
FT                   GENISLSLVINKQNPTDIEKRVHAIADKLGIRDILSKFPYEVSGGQKQRCACARALINE
FT                   PKLILADEPTGALDSKASRLLLETMSEINKKMQATILMVTHDPFSASFCERILFLKDGK
FT                   IFNEIFRGEKSRKDFFNEILDILTLLGGEVGNVR"
FT   CDS             complement(194075..194305)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37322"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXH7"
FT                   /protein_id="CBL37322.1"
FT                   /translation="MIGLKKRDIKKALKAGAKAGGVSLADVRADIEATIDEAMNSTDPE
FT                   VQANFKKYFGKKRPTPEEYIYTITKKTTVKL"
FT   CDS             complement(194337..194762)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37323"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXH8"
FT                   /protein_id="CBL37323.1"
FT                   /translation="MKKKLPFIIEIIIGIIFICFGYFVIDTDYYSTLFYAIGLGLAFAS
FT                   GVQLLKICYYEMPKNKEKLENINRENHINNVDERKVFLRMKAGSLVYQIMTFVYLFVAF
FT                   VFALLHIEAWIIGVIFGLFLLQTFLGIVLYKHFEKHF"
FT   CDS             complement(194786..195199)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37324"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXH9"
FT                   /protein_id="CBL37324.1"
FT                   /translation="MKHKIQKVELFVGVIVLLGGLLTYGLGVHQLLPVPRPDLVVYGTT
FT                   LIGIILILMGCDIFSKPTKEMQILENDERNIAITNASLANAYKVTLTLLVLVLFALIFM
FT                   GYMSKVVFFSIVGVIAIGQITWVITARYLDKKM"
FT   CDS             complement(195500..196411)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37325"
FT                   /db_xref="InterPro:IPR024735"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXI0"
FT                   /protein_id="CBL37325.1"
FT                   /translation="MFKKNKKQTETIKEPKEKKVRTVKVGTHKKTVIALWVVLIASVSF
FT                   GVYKNFTAIDQHTTHEKEIIELRLQDTNGIENFVKNFAKSYYTWNNSKEAIEARTQAIN
FT                   GYLTKELQDLNVDTIRTDIPTSSTVTNVIVWSIEQSGTDTFSATYEVDQQIKEGEQTSN
FT                   VKATYTVKVHVDADGDMVIVQNPTLAPAIEKSDYEPKTPEADASVDADTVNDATSFLET
FT                   FFKLYPTATEKELAYYVSGNVLEPIGRDYFYSELVNPIFIKDGDNVKVKVAVKFLDNQT
FT                   KATQVSQYELVLHKDSNWKIVG"
FT   CDS             complement(196427..197434)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02280"
FT                   /product="Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37326"
FT                   /db_xref="GOA:D4MXI1"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXI1"
FT                   /protein_id="CBL37326.1"
FT                   /translation="MKLKHIALIGSLFPILFSLVLFFGVLISADSDDENSNFSAGITGM
FT                   NLSAEVLKHQPMVEKYARENGISEYVNVLLAIIQVESGGTAEDVMQSSESLGLPPNSLD
FT                   TESSIKQGCKYFASLLSSCQNQGIDDLNVAIQSYNYGGGYVGYVAGKGKKYTFNLAESF
FT                   AREKSGGKKVTYTNPIAVAKNGGWRYGYGNMFYVELVNQYLTVPQVSGELAQKVMNEAL
FT                   KYQGWKYVYGGSNPNTSFDCSGLTQWCYGKAGISLPRTAQAQYDATQHLPLSQAKAGDL
FT                   VFFHSTYNAGTYVTHVAIYVGNNQIYHAGDPIGYADLSSSYWQQHLIGAGRVKQ"
FT   gap             199379..199827
FT                   /estimated_length=449
FT   CDS             complement(199873..202323)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37327"
FT                   /db_xref="InterPro:IPR016628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXI2"
FT                   /protein_id="CBL37327.1"
FT                   /translation="MFPIKYIDNNLVWNKDNEVFAYYELIPYNYSFLSAEQKFIVHDSF
FT                   RQLIAQSREGKIHALQIATESSIRSMQEQSKKLVTGKLREVAVQKIDEQTEALVSMIGD
FT                   NQVDYRFFLGFKLMVTEEQLNLKNIKKSAWLTFTEFLHEVNHTLMNDFVSMPNDEINRY
FT                   MKMEKLLENKISRRFKVRRLEINDFGYLMEHLYGRDGIAYEDYEYQLPKKKLNKETLIK
FT                   YYDLIRPTRCVIEESQRYLRLEHENKESYVSYFTVNAIVGELDFPSSEIFYFQQQQFTF
FT                   PVDTSMNVEIVENRKALTTVRNKKKELKDLDNHAYQAGSETSSNVVDALDSVDELETDL
FT                   DQTKESMYKLSYVIRVSAPDLDELKRRCDEVKDFYDDLNVKLVRPAGDMLGLHSEFLPA
FT                   SKRYINDYVQYVKSDFLAGLGFGATQQLGETTGIYMGYSVDTGRNVYLQPSLASQGVKG
FT                   TVTNALASAFVGSLGGGKSFCNNLLVYYAVLFGGQAVILDPKAERGNWKETLPEIAHEI
FT                   NIVNLTSDKDNAGLLDPFVIMKNVKDAESLAIDILTFLTGISSRDGEKFPVLRKAVRSV
FT                   TQSDSRGLLHVIDELRREDTPISRNIADHIDSFTDYDFAHLLFSDGTVENAISLDNQLN
FT                   IIQVADLVLPDKDTTFEEYTTIELLSVSMLIVISTFALDFIHSDRSIFKIVDLDEAWAF
FT                   LNVAQGETLSNKLVRAGRAMQAGVYFVTQSSGDVSKESLKNNIGLKFAFRSTDINEIKQ
FT                   TLEFFGIDKDDENNQKRLRDLENGQCLLQDLYGRVGVVQIHPVFEELLHAFDTRPPVQR
FT                   NEVE"
FT   gap             202734..203057
FT                   /estimated_length=324
FT   CDS             complement(203490..203993)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02330"
FT                   /product="Antirestriction protein (ArdA)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37328"
FT                   /db_xref="InterPro:IPR009899"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXI3"
FT                   /protein_id="CBL37328.1"
FT                   /translation="MQETRVLVETKGTTGEETISYWFDLPIDVAEFEEKLGIGAESGDY
FT                   LIIEKVVPFADEVHEHTSVYQLNELDFMYRQLSSDMQEEYVSLLTVYENLEALYICRNV
FT                   ITVYPNCKSMIDVARQKLMNDPTFKHLSEDCQAYYFDFEAYASHLLENRRYLVTEHAVF
FT                   ELPE"
FT   CDS             complement(204300..204719)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37329"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXI4"
FT                   /protein_id="CBL37329.1"
FT                   /translation="MNEREKIIRLWFDMWLKQQDLGMDKIFTEDVVYTESWCPKYENLK
FT                   TVKHWFNEWNTRGKVIIWDIKQFFHKENQTVVEWYFKNEMNTGSVEEFDGISLIEWTED
FT                   NKIKSLKEYGCNLNNYNPYQHSDNPQFRNEKISWF"
FT   CDS             complement(204956..205285)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37330"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXI5"
FT                   /protein_id="CBL37330.1"
FT                   /translation="MIIYSNLEINRIKDFWELLNCLDTETDYMMYEPNERKAKTTVQEL
FT                   KLDIQDNVIQGFDFLQVATKNDKIVGYIRAERGKFERNFHTAYIVIGILKNIEEKVLEL
FT                   LFLII"
FT   gap             205425..206255
FT                   /estimated_length=831
FT   CDS             complement(206921..208315)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02380"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37331"
FT                   /db_xref="GOA:D4MXI6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXI6"
FT                   /protein_id="CBL37331.1"
FT                   /translation="MRKIWNKGHRIRASDKHLVYHFSIGTLLFVFVAVLLLLNMKQLMR
FT                   TDWEHFSLLENGLTLSPYNFIAILIATGVCALVAFLYYRFCYDGFKKLLHRQKLARMIL
FT                   ENKWYEADTVQDSVFFTNLQSRSREKIVWFPKIYYQMEKGLLHIRCEITLGKYQDQLLR
FT                   LEDKLESGLYCELTDKTLHDGYIEYTLLYDMIANRITIDEVRAENGCLRLMKNLVWEYD
FT                   ALPHALIAGGTGGGKTYFLLTLIEALLHTNAVLYILDPKNSDLADLGTVMENVYHTKEE
FT                   MIDCVNAFYEGMVQRSEEMKRHPNYKTGENYAYLGLPPCFLIFDEYVAFFEMLGTKESV
FT                   SLLSQLKKIVMLGRQAGYFLIVACQRPDAKYFSDGIRDNFNFRVGLGRISELGYGMLFG
FT                   SDVKKQFFQKRIKGRGYCDVGTSVISEFYTPLVPKGHDFLQTIGSLAQARQDVTATCEA
FT                   KGDGTD"
FT   CDS             complement(208441..209064)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02390"
FT                   /product="Glycopeptide antibiotics resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37332"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXI7"
FT                   /protein_id="CBL37332.1"
FT                   /translation="MLPISDILIRSISGYVFIIPVLILYFFIRKKSGRKQSIFHIIAVF
FT                   VFCYYLFGILTVTGIGYTSTISFRPQISIIPFCGMISGPIDTILNLVLFVPLGFFLPLL
FT                   YKKYQHIKNVILTGFLFSLSIEIVQMFGWGATDINDLIINTAGACLGYLIYYLVSKILP
FT                   INFRKRLQSENVNDMVEIMLYAIYIFIVMITVQPWVIHSLLNIG"
FT   CDS             complement(209253..209636)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02400"
FT                   /product="Bacterial protein of unknown function (DUF961)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37333"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXI8"
FT                   /protein_id="CBL37333.1"
FT                   /translation="MRLSNGFVIDKEKTFGELKFTAVRDVFLQNEDGTPSTQLKKRIYD
FT                   LKCSLHGGIIPVSVPPEVPLREFPYNAVVELVNPVADTVSRKTYTGADVDWYVKAEDIV
FT                   LKNKGNQNAGSPQNHTPQGQPKK"
FT   CDS             complement(209652..209978)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02410"
FT                   /product="Bacterial protein of unknown function (DUF961)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37334"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXI9"
FT                   /protein_id="CBL37334.1"
FT                   /translation="MEMKYVVPDMAQSFGTLEFAGESEPVFERDKNNRRVLARRSYNLY
FT                   SDVQKGENVVVEIPVQAGEKKFQYEQKVKIVNPKLYGRGYAIGDMGHTDYVLVADDIVA
FT                   VEEK"
FT   CDS             complement(210217..213270)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37335"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXJ0"
FT                   /protein_id="CBL37335.1"
FT                   /translation="MKKILKRLCTGFLALATVVTALPSTPVHAESKQYWTESAERVGII
FT                   EKVMNDGSIGSTFNEGMMKVEGETAYCIDINTDFKNGYKTRADASSRMSADQISDVALS
FT                   LEYVKQYGEAHKELNYKQVYLLEQCVVWQRLSVHLGWQCDNVRASYDEIPKATQDEVFS
FT                   GAKAFVKENKGRYECGGYIYSGEGQELGQFWAKLNVGNAKLQKTSSNTSITNGNGNYSV
FT                   AGAIYGVFSDKDCTKQLATLTTDENGNTDVVEVKAGTVYIKELSAPAGYKVDKTVYSLK
FT                   IEAGKTATLNVSDTPKVTDTLIELFKIDMETQKDNPQGNASLAGAEFTWKYYAGFYNKD
FT                   NLPAEATRTWVTKTIAETDSNGTTHYLTKLADAYKVSGDSFYMQDGKAVLPLGTLTVEE
FT                   TKAPNGYLLEGAYMQAGDKSEQIKGLYLTQITEDGDLAVLSGSNQFSVSDKVIRGGVKI
FT                   QKRDLETGDTKPQGSATLKDTAFDIISLNENAVLVEGKLYKKNEVVKTIRTDIEGIAST
FT                   SADLLPYGKFRIVESEAPNGYLTDGAKPIDFAITENGKIVDLTDEAHSIYNQIKRGDIE
FT                   GVKIGAGTHKRLADVPFRITSKTTGENHVVVTDDNGQFSTSADWASHKHNTNAGKTSED
FT                   GVWFGTSEPDDNKGALPYDTYIIEEMRCDSNKGFELIPPFEIVVSRNNLVIDLGTLTDE
FT                   YEKEISIHTTATSKDGEKTILAGKEVTIVDTVKLDGLTKGTKYQLKGWQMLKEENAELL
FT                   IDGKRVENDYTFVADDEEMKVKISYTFNASALGGKNLVTFEELYDLSNPDEPVKVAEHK
FT                   DIEDDGQTVLITERIIKIHTTATDKDGNKEIEAGKDVTIIDTVTLEGLEIGTQYKLVGW
FT                   QMLKEENAELLINGKRVESDYTFIADSETMKVEVAFTFDATSLDGKQLVTFEELYDLSN
FT                   PDEPKKVTEHKDIEDKGQTITFKEKTEVPEEPEKPETPQTPEKPSRPSDSPKTGDNTNL
FT                   YGLLALLLTSGAGLAGIFFYKRRKMKKS"
FT   gap             214033..214612
FT                   /estimated_length=580
FT   CDS             214786..217422
FT                   /transl_table=11
FT                   /locus_tag="CL2_02430"
FT                   /product="Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37336"
FT                   /db_xref="GOA:D4MXJ1"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR025931"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXJ1"
FT                   /protein_id="CBL37336.1"
FT                   /translation="MKSVYMKNMLGSLGYSNEHFSENYSVQINGTSAIKFDYVAFSDRY
FT                   LKDVSTSCIAIQEVTDDSEETKYLEGAKYLATPIVIISKNIHVRVWNIAPQKTTLLSDS
FT                   EENIIHLYFEKNRFEFMSDNLIDAKMGYRQMNIFEASGLIDFSRAATCKILSEEFEKGL
FT                   LAAKKYLKSKKNINGQDLNNITSITMHVISALIINSKIRPDEKVPDIFDLLTSLSQTYI
FT                   EYFSNKLMFKYGKDLLSEIYKNLNCSINYQSVDHELLGYFYESTLLQLSEKKAENIRRE
FT                   FGIYYTPRILSQEIVSCIPFESIPIDERYVLDGTCGSGSLLLSACKRLEDLASYEKTEF
FT                   DRHDYLTRMIEGYDIDKFASEVARLSLLLYSLPYGNKWDIHAGDLLRISKSKIKEPFVI
FT                   LGNPPYEEVRGNSQKTQKATAFLDKYLEWLHDEGFIGIILPESFLQNDSSILQRKKLLN
FT                   EFDIMELWMLPGQIFENNCSTIVLIAQKKKTQCECLTKIKVLVRNKESIRDYFKHRRWD
FT                   FEFFINIQNSWKNEPRYRISVSPIEDILQKIVKGKRTIGDITQNVMGIMMPSNYNFSQM
FT                   KFDGWIPYIANANNFRKYVISPEMRDNVGFFDYHMSKEEEKEIKKDYKGLRLRRDYESI
FT                   YAASNKILVKMSSTPGEINCINALVDEDGYYPSHSFFVVISEDKKVSNYVLCALINSKI
FT                   INAYVRRECVKRTLTTSVVRSIPVPEFSDVQISKIEQCYLSIKEAYALDDKEKVEEVQE
FT                   KIDDIIFEAFELGKDEREKITKFFEVYTRDGDNSPSANVELEEYHNISGQVEKIDTERM
FT                   YCTVYLAEFGEQEIKIEKSMPGWFLRQGAEFSAKYHEGKLFEIKPLVYSYLDDDEIIAL
FT                   LSSKISE"
FT   CDS             217439..217984
FT                   /transl_table=11
FT                   /locus_tag="CL2_02440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37337"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXJ2"
FT                   /protein_id="CBL37337.1"
FT                   /translation="MESENQRVKFLDVGHGDSSVIYLNSGHSENENVVIVDIVDSDKLL
FT                   TELTSHKIKVVDLIIISHSDADHCRGVNDFLEKYMAVGIVKNICFNLDKRQPTKTMKLI
FT                   LKKFIEIYQKQRITLLTGQNDTSVQKRELISNDKSKLFLIYPNVAESTEAYLKNDTNNT
FT                   SIVCLLENDVCNVLFLGI"
FT   CDS             218017..218373
FT                   /transl_table=11
FT                   /locus_tag="CL2_02450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37338"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXJ3"
FT                   /protein_id="CBL37338.1"
FT                   /translation="MPELKCEILKMPHHGAFYDEKSGIGLKQILEILQPRDVIISSGDN
FT                   KKYKHPDIQTIELLKEKNIKVYCTEFTSLCHCNANEFNRKCYGDIEIAVTDTAYEIRTE
FT                   KENFSLLNHIACQE"
FT   tRNA            218867..218938
FT                   /locus_tag="CL2_T_31530"
FT   tRNA            218973..219045
FT                   /locus_tag="CL2_T_31540"
FT   tRNA            219052..219125
FT                   /locus_tag="CL2_T_31550"
FT   tRNA            219150..219226
FT                   /locus_tag="CL2_T_31560"
FT   tRNA            219250..219322
FT                   /locus_tag="CL2_T_31570"
FT   tRNA            219354..219439
FT                   /locus_tag="CL2_T_31580"
FT   tRNA            219487..219560
FT                   /locus_tag="CL2_T_31590"
FT   CDS             219750..220421
FT                   /transl_table=11
FT                   /locus_tag="CL2_02460"
FT                   /product="Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37339"
FT                   /db_xref="GOA:D4MXJ4"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXJ4"
FT                   /protein_id="CBL37339.1"
FT                   /translation="MKSRLKKITIFSLVFLFIFGTAITTTPKQQVKADDGYNGKIFRHW
FT                   CKLRASRSKRSKVLKRLEIGTPVTVYSTSGQWRKVSVNGKTGYVLKKYVYIDTDAPALE
FT                   GTTYDKGQTVAQFAQRFVGNSYVWGGTDLNRGADCSGFIGSVYRSFGYNLPRTSSELRR
FT                   AGRKVSYNEKQPGDIICYNGHVAMYIGNGKIVHASNRRTGIKISPRANYRRIVCVRRVV
FT                   E"
FT   CDS             220701..222656
FT                   /transl_table=11
FT                   /locus_tag="CL2_02470"
FT                   /product="Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37340"
FT                   /db_xref="GOA:D4MXJ5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXJ5"
FT                   /protein_id="CBL37340.1"
FT                   /translation="MNNLQEKVIRAMVDMYGFYSIEELSEMTEISISSIKRSLKDITKF
FT                   IEDYDGKLLRVPKKGICMVVTDQQRENILEALDSYANGNPESFYYRKNYILDILFNYPA
FT                   NYTVQLFSEELCVSRKMIEKDLKMIEEYLATFHLELSKVQNQGISIVGREFDIRQAIVD
FT                   TQNKKYWKHTYIEELPQELDYRISKRAFTYFSDYYSKEDIMMVQEYLADSEAELGVVLV
FT                   DISFCRLTEYLLLTKRRMEEGNKIRNKADRTMTKLDDIYVETAKKILDRMFPHEDEMEL
FT                   EYQFLAAKFAVAKTCEVEAEIQDDYLMNIAEDYIYTVFMAMEKESTYHYRELEKQIATF
FT                   LKKISIRHDYMLVEWDDLHKDVQQQIQSSYAVCLTYSFHLEEKLGFVLTQDEIAWLALL
FT                   IHQASMETGSEKQGIFVMATDPYSAKYEAMKIENEISNLEIIKIVHIHDFKPELTKGKL
FT                   VISTVPLKEKRNNVIEITKHVTQLDINKIISQMDEYAQEMKNEQVIETVKKAFQKELIV
FT                   IDALATTKKETIAQVSKLLLEQGCLSEDVTEKVFELEERRPTTIGSQIAMAHVYKDSVK
FT                   KSGIAVMRMKYPVKWSRSSKVKLVFFLAINMEESNEILKLFKYLYALIDNKEDIQKILE
FT                   ANSSGEIYELLMEEFH"
FT   CDS             222699..223580
FT                   /transl_table=11
FT                   /locus_tag="CL2_02480"
FT                   /product="Fructose/tagatose bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37341"
FT                   /db_xref="GOA:D4MXJ6"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXJ6"
FT                   /protein_id="CBL37341.1"
FT                   /translation="MLVNMKKILEIAEAEGYAIPCINTPNEETVRAVIGAAEELNTPII
FT                   IDHAQVHDSLIPIERIGPIMLKYAKEARVPVCVHLDHGSDYEFVMRAVKVGFPSIMYDC
FT                   SALPFEENVEKVAQFVKFAHAAGITVEAELGIMASTDEDTHDDDPEKRVLTNEDIREFF
FT                   TEPAEAKEFAERTKCDALAVCFGTMHGIYAEPPVLDIDRVKELREAIPDDTRIVMHGAS
FT                   GVEFDQVQNAIIAGCSKVNYYSYMAKATTKFVADKVAETDGKIAYHELQEAAYEFMKGY
FT                   AKDVIKAFKNGK"
FT   CDS             223608..224081
FT                   /transl_table=11
FT                   /locus_tag="CL2_02490"
FT                   /product="Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37342"
FT                   /db_xref="GOA:D4MXJ7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXJ7"
FT                   /protein_id="CBL37342.1"
FT                   /translation="MSGVNLAEVLLDEMVILDCEPFKDKENMFDVMTAKFEEAGFVSDA
FT                   KAYKDALEYRESLGPTYMGNFVAIPHGKCKEVLKPGIGFCRCKKPFIYESSGESGEVKY
FT                   IFVLAISENQENDYHLRVLATLAGMLAHEEFLELLEKAESYDDLIHGIKQLQL"
FT   CDS             224103..224402
FT                   /transl_table=11
FT                   /locus_tag="CL2_02500"
FT                   /product="PTS system, fructose-specific, IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37343"
FT                   /db_xref="GOA:D4MXJ8"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXJ8"
FT                   /protein_id="CBL37343.1"
FT                   /translation="MKVVAVTSCATGIAHTYMAAEAIMKVCKERGYKCKVEKQGALGLE
FT                   DKLRDRDIKEADLIVFANDVGLTKAERFEPYKDKIFQTKPHEVIKDPNIIFSGK"
FT   CDS             224448..225482
FT                   /transl_table=11
FT                   /locus_tag="CL2_02510"
FT                   /product="PTS system, fructose subfamily, IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37344"
FT                   /db_xref="GOA:D4MXJ9"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXJ9"
FT                   /protein_id="CBL37344.1"
FT                   /translation="MRDVIDDIKEAFLTGVSYMLPFVVAGGILVALGFLLGGYNIPSVE
FT                   PYGSTFASTIFWIGKIGLGTFMVPVLGAYVAYSIADKPGICVGMFGGWMATDPWGLGYQ
FT                   SGFIGALIAGIIAGYLVNALKKIPLPNAIRSLLPTLIIPVVGCAAICLLMHYVIGGPLG
FT                   ALTQALTKLLNDLGTGNLILLGIVQGCMLAFDMGGPCNKVAYAFALACMETGNYAPMAA
FT                   NFVACCAPPLAVALAMLIAPKKFTDEDRSGIPGCFAGALCMITEFAIPYAAKNIKYIPC
FT                   FMVGSAAGAAISYLWGITIRAPHGGVFVVFAMNKVLPFFITLLIAGAISAALIVLVTKP
FT                   QEEA"
FT   CDS             225520..226434
FT                   /transl_table=11
FT                   /locus_tag="CL2_02520"
FT                   /product="Cupin domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37345"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXK0"
FT                   /protein_id="CBL37345.1"
FT                   /translation="MAKLVDIQGRFPCEPDNKKPTLIKKWEYSTALYPPNNAFTSDNTF
FT                   TLVTTDTFMLGIYELGPGGVFAPLDIHPGDESYYILNGPVVQRSGNGQFAYLETGEGLF
FT                   MPEGAWHCCHNFSDQKTRILYFITPKAWDEHIPPAVIPTEEETKFYKGPNNDNLPDMRG
FT                   AIKDISRQGCTDDIGCWPVDPAEARKTGAVYAVRDFEKLNNVHGTTHPMLLRFITSNDY
FT                   GHFGEMVLPAGGYGPRCSDPDVHKGDGALYCVDGPVTVNLVDAEESFVLEPEDTFFLPA
FT                   GTKYQLVNFENKPVKVVFAITEL"
FT   CDS             226505..227167
FT                   /transl_table=11
FT                   /locus_tag="CL2_02530"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED/haloacid
FT                   dehalogenase superfamily, subfamily IA, variant 1 with
FT                   third motif having Dx(3-4)D or Dx(3-4)E"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37346"
FT                   /db_xref="GOA:D4MXK1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXK1"
FT                   /protein_id="CBL37346.1"
FT                   /translation="MKTYKGIIFDLDGTLLDTIEDLRDSVNDVMKIYGWKEHDTKACKQ
FT                   MVGNGFRKLITRALPEDKQKNELFIDEAVNQFSKAYQKRYLNKTIPYEGILKLLESLEE
FT                   KGIKIAVNSNKRGDYTSALVNKYFSQFPWTAVYGERESEGIPKKPDPSAALEIADLMKL
FT                   PKEEILYIGDSKTDMQTGQNAGMDTIGVSWGFRGRKELEENHASYVVDHPEDILKFI"
FT   CDS             227212..227985
FT                   /transl_table=11
FT                   /locus_tag="CL2_02540"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37347"
FT                   /db_xref="GOA:D4MXK2"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXK2"
FT                   /protein_id="CBL37347.1"
FT                   /translation="MEKKYLFFDIDGTLTDRSTGEIVPSAREALTRLEENGHFVAIATG
FT                   RAHYKARKFTDANGFKNMVCCGGNGCVIDNELVENIPLDKDGCIKIIHQAEELGYGWCV
FT                   ALDDTKDVYMTDDKFLRQVGKRKEPTRYIIDDMLEVEKADAIYKVYVAIPKEDEEKLTT
FT                   KELVGHLRFEPEYLMFQPDNKRGGIIKMMEHLNADIKDVVVFGDDYNDMDMFCPEWFSI
FT                   AMGNACQDLKDIANYVTDSNVDDGIKNACEHFGWI"
FT   CDS             228033..228485
FT                   /transl_table=11
FT                   /locus_tag="CL2_02550"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37348"
FT                   /db_xref="GOA:D4MXK3"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXK3"
FT                   /protein_id="CBL37348.1"
FT                   /translation="MKISLGCDEAAYQLKETIKQHLQEAGHEVIDNGVGEGEVELYPDV
FT                   AVRTCKKVTDGTCDRGILVCGTGIGMAMTANKVPGIRAAVCHDPFSTERSILSNDANVM
FT                   CMGARVIAPQLALYLLDIWMGLTFKNGPSTPKVERIMEYQKEFCGK"
FT   CDS             228498..229355
FT                   /transl_table=11
FT                   /locus_tag="CL2_02560"
FT                   /product="D-tagatose 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37349"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXK4"
FT                   /protein_id="CBL37349.1"
FT                   /translation="MKFKFGVDSFIWAEDFKEKDLWIIEKAKEIGFEVVDFAIANPYTF
FT                   PTEQVKAELARVGMDCVCTTTLTLETNPISPDEEIRKAAVAAMKKCVDICNTLGAPILG
FT                   GVNYAGWGYLTKKPRTDQEWDWGVACMREVAEYAKETGDVTICVECVNRFETHFLNIAE
FT                   DAVKFCKDVGTGNVKVHLDCFHMIREEKSFSGAVKTCGKEYLGYVHVNENDRGIPGTGL
FT                   VPFKEFFQALDEIGYDGPLVIESFDPSFEELAGNCAIWRNFADTGEELAIEGLKNLKAI
FT                   ADAM"
FT   CDS             229374..230372
FT                   /transl_table=11
FT                   /locus_tag="CL2_02570"
FT                   /product="dihydroxyacetone kinase DhaK subunit"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="2.7.1.121"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37350"
FT                   /db_xref="GOA:D4MXK5"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXK5"
FT                   /protein_id="CBL37350.1"
FT                   /translation="MNRIVNNPDFVVEDMLKGFVKTHKDIVSTTEDARVLKYKNAPVEG
FT                   KVGIVTGGGSGHKPAFIGYIGENLCDAVAVGEIFSSPTAKAFLDAIKEADSGKGVACLY
FT                   GNYAGDNMNVKMAMRKAKKLGIEVKTVVANDDCASAPKTELEKRRGVAGEVLMWKVGGA
FT                   KASMGGSLDEVIAVAQKAIDNTRSVGIGTAPCTIPAVGHPNFQIEDGTMEVGIGHHGEP
FT                   GINVQPLKTADDIAEEMLDIIIPDLPFESGDEVVVLLSGLGATPVMEQYIVYNRVEEIL
FT                   TEKGIKVYRSYVGNYFTSLEMMGVTLTVMKLDDELKECIDMPANSVGLKQF"
FT   CDS             230513..231151
FT                   /transl_table=11
FT                   /locus_tag="CL2_02580"
FT                   /product="dihydroxyacetone kinase DhaL subunit"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="2.7.1.121"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37351"
FT                   /db_xref="GOA:D4MXK6"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXK6"
FT                   /protein_id="CBL37351.1"
FT                   /translation="MTSFKNDDAGVIVDQLIKTIQKERDYLSEIDGKIGDGDHGINMNK
FT                   GFTMCEKKLEGTTYNLSEGLTTLGETLLEDIGGSMGPLYGMLFDEMAQACEDEEEITAD
FT                   VFAEMITASVEGIQDISPAQVGDKSLLDTLIPAKEAFVEAKEAGKDFAECLDAMNAAAE
FT                   KGWQSTKDLVAKIGRASRLGERSRGVLDAGATSCYFIITTIGSTAKSLL"
FT   CDS             231784..232656
FT                   /transl_table=11
FT                   /locus_tag="CL2_02600"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37352"
FT                   /db_xref="GOA:D4MXK7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXK7"
FT                   /protein_id="CBL37352.1"
FT                   /translation="MKVIELKDVKKSYGKNEILHGISLDIEEGSIHGLVGRNGCGKTTL
FT                   IKCLTGIYEQDQGQILVCGEEIFENPKVKAQVGYVADSNQYFEGYHIDEMVEFYKQIYP
FT                   TFDEKVFRDYNQSIGLDVSKRIKELSKGQAMSLASMLNLSIHPKVMIMDEPMSGLDVIA
FT                   QKQIKDFIVNEVDMNGMSVLISSHDLKDLESFCDSASMMKDGKILYHGTMDQMKERFTK
FT                   LQVVFGESKSEIFKELLGVITYSNLGSVYTVILEGYGEPIHEALKQAGAIVVEEIPLSL
FT                   EEVFVYSNR"
FT   CDS             232673..233761
FT                   /transl_table=11
FT                   /locus_tag="CL2_02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37353"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXK8"
FT                   /protein_id="CBL37353.1"
FT                   /translation="MKFFRKYDLVLPPVALLYGIFAWNMKYPGNELAQIMDNLVNGWFL
FT                   ITVLFAALSAGIVYQLQQNKKQQYIYSFPWTKKDIYQKSLTKLHISLLFAEIIYGIFFA
FT                   MKIATIPNAESITNVIICTLWNAVMCFTFCALIQISLIVTAYIWQGLIIAVVTFYVILP
FT                   MILQNLAFLLQLLFKVRSSRFAILEWVIYGRFGRTFLYPLNYQLDANVLDSNPIWKAQY
FT                   VNSAIICIAVLFAAGVFSIWFAKRQFIKQEQAQNRMLTRLSGMQNKVITTIVITILCFN
FT                   ALSNQEIYIHIFKYDKTLRTRIYGLIAWGKEFMCSSDSYKLIIQKLNAIHWFIYLVVIL
FT                   VITYFAVSIIQTIRRKCYERAC"
FT   CDS             233745..234794
FT                   /transl_table=11
FT                   /locus_tag="CL2_02620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37354"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXK9"
FT                   /protein_id="CBL37354.1"
FT                   /translation="MRGLVNHEKRNLLAITLVYTIVICFILQYVIANDISGTADQINNF
FT                   YGGIYNDYGNLFLGTLDQYYEMFIIVLMIPISFVAVIQYRESSTSKCGEFLMQLPIKRG
FT                   QIFLTRTITGMMTYTIPWLFLSFGMIMMRTKAQSWYEMNLSVCKNGAVLLGNDNMIHLC
FT                   AYLLFIWVSLTLIYAIAIFFQNICKRPWIAGAIGIGAMLFPNFMDYMMPKVLSFPDTIY
FT                   HGWWMATFFENGPITKQFIWDKGVNQLVTMASFDHFAQILLIQIVLIAVFFGVAFYVFQ
FT                   KSDMAKRNNFMYFPWMEHLFVWIFPFCVSLFIVVTGFKIQSYTGGILAAVIATIIYYIV
FT                   EKRKKRRAV"
FT   CDS             234794..236200
FT                   /transl_table=11
FT                   /locus_tag="CL2_02630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37355"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXL0"
FT                   /protein_id="CBL37355.1"
FT                   /translation="MYFSTSISYIIILSPLILLALLATIGIVLYRHPSKLQRKWYSVSF
FT                   KKRKRIKQIAILLGFCMAAGLFIYPLTSKKQFVSTISLSANENNFITEDKINQISKDRR
FT                   EIKNEQWLKEFYKMMKSDGESSSLLDDSGSYEVWKTSIMEDKTGEYELRLRAEDTVLHR
FT                   LSIQQPDEDIDSDGDFDSYDTDGFYDIIQRPDNTFEENYQKLTDSEKQEIQNLNWNYKD
FT                   GLLYATNENHKRCINGTSQYYMKNSKLINTMENSGYKGIKKWMEQCEKDTAGIKVKVGD
FT                   KTYLFHNTDKWHTFKKNGLTCLYNYKRFIIRFDFNKVIGLRSNLSDLPQNGREMWTAIS
FT                   DHSGSAANEVILRSYNDEELYARKNVQIFLQDHKIKQMLIYWDETEAFKGFTKEEKIFL
FT                   KGCFEKMGISSKDAQEWLNTFMIKKTPQSGKLGSWTYSKGNSKNQVISLINHNENNNYV
FT                   NFYKKSKGNN"
FT   CDS             236588..238195
FT                   /transl_table=11
FT                   /locus_tag="CL2_02640"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37356"
FT                   /db_xref="GOA:D4MXL1"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXL1"
FT                   /protein_id="CBL37356.1"
FT                   /translation="MPVKYVFVTGGVVSGLGKGITAASLGRLLKARGYHVTSQKFDPYI
FT                   NIDPGTMNPIQHGEVFVTDDGAETDLDLGHYERFIDEGLNKKSNVTTGKVYWSILSKER
FT                   RGDYGGNTVQVIPHVTNEIKSRFYRSEDPSDQEVAIIEIGGTVGDIESQPFLEALRQFQ
FT                   HEVGHENCILIHVTLIPYLKSSGELKTKPTQASVKDLQGMGIQPDILVCRSDYPLDDGI
FT                   KRKIAQFCNVERSRVIQNLDAEVLYEVPLMMEKEHLAHEVCECLNMPCPDPDLDDWKKM
FT                   IDAWKHPEHKVEIALVGKYVSLHDAYISVVESLEHAGVANSADVKIRWVDSERISSYNV
FT                   DEMLGGVHGILVPGGFGDRGIEGMICAIKYARENKIPYLGLCLGMQLTLVEFGRHVLGF
FT                   SDAHSQEFNPDTTHPMVHIMPDQDGVTDLGGTLRLGSYPCVLTEGSKAYELYGEKEIHE
FT                   RHRHRYEVNNEYRDILQENGMMLSGCSPDGRIVEMVEIPEHPWFVATQAHPEFKSRPNK
FT                   AHPLFKGFVEAALEHQGK"
FT   CDS             238363..240528
FT                   /transl_table=11
FT                   /locus_tag="CL2_02650"
FT                   /product="Calcineurin-like phosphoesterase."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37357"
FT                   /db_xref="GOA:D4MXL2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXL2"
FT                   /protein_id="CBL37357.1"
FT                   /translation="MRSNWRKQMMISALALTLSATNVAPVFASAAPDGKTNAVDIAQTM
FT                   GTTAQWNRWEKEWEILKNDWTQISLSPGSNATELNFAWYTPKQTNDDHSNANVPKLIIG
FT                   EGHNMKNAKVYEAEQTAVKDEQDNNGETYNSNKVTATGLKENKTYYYSYDNGNGYTKPA
FT                   EYTTKSTNNFSFAFVGDPQIGSSNELKGKDTKEFYDAQSNAVKSDAFNWSSTLNAALEK
FT                   TDDQLSFVVSAGDQIQTTKKKLPNKDASKSEIEYTGYLSPEALKSLPVATTVGNHDADN
FT                   ANYTYHFNRTNASELGSNKVVGGDYYFKYGNALFIMLNTQDTNVAEHKQFIEQTVAANK
FT                   DCKWRIVTLHQDIYGSAEHSNEPEITNLRYQLTPIFEQNDIDAVLTGHDHAYSRSKMLL
FT                   GGTKANDYTDDEFDAELEKDMDAGENPTTKTVAPGNIKNDSTDEKDQKYLTYLKSIMDE
FT                   KAIETVKKQGSSVINPEGVLYMTAGSSSGSKYYDLVPRQQTYIAHRWQEDVPTYSVVDV
FT                   TENSLTINTYRTDNDEKIDETFSITKSKGDTTSLNAEIKASESIVKQKDAYTTESYRVF
FT                   EQALTGAKEVAADKKATKDEVENALKVLTNAKAGLEKKATTKPATVKKPTAEKKVVVAK
FT                   ASAKLKAGKKKVTVKIKKASVSGYQIKYASNKNFKKAKTRNTRKTIYTIKSLRSKKKCY
FT                   VKVRAYKVVKGKKIYGSYSKVLKVTVK"
FT   CDS             240531..241643
FT                   /transl_table=11
FT                   /locus_tag="CL2_02660"
FT                   /product="archaeal flagellin N-terminal-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37358"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXL3"
FT                   /protein_id="CBL37358.1"
FT                   /translation="MKQKQMKGVCLLIAGILFLLLFFSFSGIEKTKLLDTDGRNFEKAE
FT                   VTNVISGNLSNSGSGKQTVELKLLSGDHKGKIIQATSSQSYLFGAKCKKGMKVIVIINE
FT                   SKGELLASVYSVNRGPMVWLMAAVFVAIVVAVGGRKGISSILSLVFTMLCIFFIFLPMI
FT                   YKGISPILAAVLVVAFTTVVTMCMVDGITKKSVAAMLGTIIGVVFSGAFALIFGQVTSI
FT                   TGYNVSDIENLVYVGEMTDIKIGELLFAGILIASLGAVMDVGMSIASTLNELKEQNPQM
FT                   MLKELFQSGMNVGRDMMGTMTNTLILAFTGGSINTLVFIFAYNYEYQQVINMYSVGIEI
FT                   MQGLSSSLGVIMAVPVTSWIAAFLYNKNQK"
FT   CDS             241774..242592
FT                   /transl_table=11
FT                   /locus_tag="CL2_02670"
FT                   /product="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37359"
FT                   /db_xref="GOA:D4MXL4"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXL4"
FT                   /protein_id="CBL37359.1"
FT                   /translation="MKVKGVRLYGVKDIRLEEFEIPEIAEDEILLKIECNGIAVSTLKE
FT                   ITLAQRHLRVPKNIKKNPVLIGHEFSGTIAKVGTRWKEDYQEGKQFVLVPEIPHQIESP
FT                   GYSYPYFGGAATYCIIPADVIEKGCLLQYEADSFYELAQAQALYSIVGSFHSNYHSKEG
FT                   THDHISGIKEGGNTIILGGAGPMGLMAIRYVLGMKKKPRRLVITDTNQERLEKVRKMIP
FT                   MQEGTRHGIELYYINPSMFTDSVPVLLAITNEKGYDDVFVYAPPKCVAEI"
FT   CDS             complement(242642..242887)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37360"
FT                   /db_xref="InterPro:IPR023860"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXL5"
FT                   /protein_id="CBL37360.1"
FT                   /translation="MESRIAIIGIIVEDIDASSKVNDILHDYGMYILGRMGIPYHEKGV
FT                   NIISIAIDAPQDIINTLAGKLGKVEGISAKTTYSKM"
FT   CDS             complement(242902..243102)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37361"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXL6"
FT                   /protein_id="CBL37361.1"
FT                   /translation="MSILIKDTTKEERAKIVEESIGNIAGACDGCSVGIVEMYQDYIDG
FT                   KKELREINMEFRAGYISEIRR"
FT   CDS             complement(243099..244430)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02700"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37362"
FT                   /db_xref="GOA:D4MXL7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXL7"
FT                   /protein_id="CBL37362.1"
FT                   /translation="MERDLTTGSIGRNILKFSLPYFLSYFLQTLYGMADLFIIGQFNGV
FT                   ASTTAVSIGSQVMHMITVMIVGIAMGTTVMIGKSVGAKQKKETSKIIGNTVSLFVCLSV
FT                   VLTVVLLFFVHPIVRIMSTPQQAVEGTTEYLTICFAGIPLITAYNIISSIFRGLGDSKS
FT                   PMYFIAVACGVNIVLDYVFIGGLHFGASGAALGTTLAQTISVIVALIAIRKKDTGISLK
FT                   RSDLKPEGKTLKNILGIGIPISLQDGFIQISFIVITIIVNQRGLNDAAAVGIVEKIISF
FT                   VFLVPSSMLSAVSAIAAQNIGAGKDERATKTLKYAIMISMSFGLCVAVLMQFISNFVVG
FT                   IFTVDTIVIHMGSQYIRSYIWDCMIAGIHFSFSGYFCAYGKSGISFLHNVLSIVLIRIP
FT                   GAYFASKWFIDTLYPMGCAAPAGSLLSVIVCGIAFIYLKRRRRL"
FT   CDS             complement(244493..244990)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02710"
FT                   /product="thiW protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37363"
FT                   /db_xref="InterPro:IPR012652"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXL8"
FT                   /protein_id="CBL37363.1"
FT                   /translation="MKLKKLTISAMLVAVAVILSSFSIPIGPSRCFPIQHLCNVLAAVF
FT                   LGPVYGVSMAFCTALIRNLLGTGSLLAFPGSMVGAFVSAMIFKYTRSKIGAYLGEVIGT
FT                   GILGGMLCYPIASMMMGQKAALFTFVGPFLASTLCGTVIAAVIITALYKSKAVRLIEEY
FT                   ID"
FT   CDS             complement(244997..245701)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02720"
FT                   /product="Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37364"
FT                   /db_xref="GOA:D4MXL9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXL9"
FT                   /protein_id="CBL37364.1"
FT                   /translation="MKVTIIHGQSHKGSTYHISKILADKIGGEVKEFFLPRDFGEFCIG
FT                   CTQCFRKSETLCPHYEKINPLTEALDEADVLIFESPVYVYHVTGSMKAFLDHYGYRWML
FT                   HRPEESMFHKQAVCISTAAGAGMKSTNKDMADSFFYWGVPKVYKYGVRVMATSYKDIKP
FT                   KIKAKIEKDTSKMAYQIKKNAGHVKTGIKTKICFYFMRMLHTRGWDEADLAYWSKKGWD
FT                   REKRPWKNNKGV"
FT   CDS             complement(245715..246131)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02730"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37365"
FT                   /db_xref="GOA:D4MXM0"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXM0"
FT                   /protein_id="CBL37365.1"
FT                   /translation="MKKFLEEFKAFALRGNVMDMAVGVLIGGAFSGIVTSLTDNFIQPI
FT                   IKLVMTGKVYTLEEISGYASAFGSSVVNFLIMAFILFCLLKAMNKVMSFGSKPEEPAQP
FT                   TTKICPFCMREIDIRATRCPHCTSVQPESEADQK"
FT   CDS             complement(246308..246934)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02740"
FT                   /product="Cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37366"
FT                   /db_xref="GOA:D4MXM1"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXM1"
FT                   /protein_id="CBL37366.1"
FT                   /translation="MSTNTIITIERQYGSGGHLIGEKLAESLGIPFYDSELIKVAAKES
FT                   GICEEIFESFDEKPTTSFLYSLVMDPYSLGYNSNSFDLPLNHKVFLAAFDTIKELASKG
FT                   PCVFVGRCADYALEDFDNCISVYVHAPFEDRIKRIENEYGIPNGKSKEMLMKKDKQRSS
FT                   YYNYYSSNKWGDAKSYDLCLNSSYLGIDGSVDLIKKVIAMKESEK"
FT   CDS             complement(247046..247984)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02750"
FT                   /product="riboflavin kinase/FMN adenylyltransferase"
FT                   /EC_number="2.7.7.2"
FT                   /EC_number="2.7.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37367"
FT                   /db_xref="GOA:D4MXM2"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXM2"
FT                   /protein_id="CBL37367.1"
FT                   /translation="MEYIHNTEQFQFHNTVVALGKFDGMHKGHQLIFDELIQYKQLGYQ
FT                   AAVFSFDRPPLNMLKHKHMRVIYTTNEKIKLLARRGIDIYIEHPFTDEFSHLSPEDFVI
FT                   KVLLEKTGMKVLVVGDDCGFGYKRQGNVELLERMSKEYDFKLIVIPKLELEGEIVSSTR
FT                   IRHLLSEGKVEEANRLMEDPFMICGSVVHGNHMGAEVLQMPTANQIPLEDKLLPPNGVY
FT                   VSRIHYKDETYYGISNVGVKPTIEGKKHMGVETYILDFHKNIYHKEIEVELLCFKRPEM
FT                   KFDSLESLSQQMHEDAEFARRYAKEHYGYEA"
FT   CDS             complement(247994..248893)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02760"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="5.4.99.12"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37368"
FT                   /db_xref="GOA:D4MXM3"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXM3"
FT                   /protein_id="CBL37368.1"
FT                   /translation="MYNGLLNIYKEKDFTSHDVVAKLRGILRQKKIGHTGTLDPNAEGV
FT                   LPVCLGKGTKLCDMLTGTKKQYKVSFVFEKETDTEDIWGTVTKTHEPLKQDAPIKDTIL
FT                   SFVGEYDQVPPMYSAKKINGKKLYELAREGKIIERKPERIRIYDISDIEISYPEVTMTV
FT                   TCSKGTYIRSLCRDIGHKLQNGACMTKLVRTRSSGFQLEYAHTLSEIEEAVKTGKIEEW
FT                   IIPIEKVFLKYQKGTVKKDYDKVLFNGNPLKKEMFYEIDLDTTKKLRVYDESEQFIGIY
FT                   YWKKNMFFPDKIFYDNNQ"
FT   CDS             complement(248907..249851)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02770"
FT                   /product="Exopolyphosphatase-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37369"
FT                   /db_xref="GOA:D4MXM4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXM4"
FT                   /protein_id="CBL37369.1"
FT                   /translation="MKHFNEQISKAKTIAITGHIHPDGDCIGSCLALKQYILDNYSGKK
FT                   VDVYLESISTEFRFLSHAQEIITESKDDESYDLFFVLDCGSEDRYEPFAAMVRCAKTLI
FT                   GIDHHISNDGFGDFYKIDPQASATCEVLCQIFEEDKISKECAQCLYTGIVHDTGVFKHS
FT                   NTTRKTMEYAGMLLEKGVSTTKIIDETFYQKTFVQNQLLGKALLKSQLYADGQIIISNL
FT                   SEQDFEELHASTSDSDGIIDQLRITKGVEAAIFLYPIENGYKVSMRSNEKVKVSEIAKT
FT                   HGGGGHIRAAGCSMKGTLKDIQSTIISEITEQL"
FT   CDS             complement(249838..250209)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02780"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37370"
FT                   /db_xref="GOA:D4MXM5"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXM5"
FT                   /protein_id="CBL37370.1"
FT                   /translation="MRKNSIKNTRINGEVQRELSRIISREIKDPRIAPMTSVVDAVVTS
FT                   DLKQCKAYISVLGNDEEKEETMKGLNSAVGYIRRELAHSINLRNTPEITFILDDSIEYG
FT                   VNMSKKIDELNHGSENETL"
FT   CDS             complement(250231..251877)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02790"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37371"
FT                   /db_xref="GOA:D4MXM6"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXM6"
FT                   /protein_id="CBL37371.1"
FT                   /translation="MLNVNSELDFEKAEEIAMEFDRLVEMEEQVDVIEELLKEEEEDET
FT                   DMIVRPPVVCVMGHVDHGKTSLLDKIRSSHVTTGEAGGITQHIGAYVVETSNGKITFLD
FT                   TPGHEAFTSMRMRGAQSTDIAILVVAADDGVMPQTIEAINHAKAAGIEIIVAINKIDKE
FT                   SANIERVKQELIEYELVPEDWGGSTIFCPVSAHTGEGIDELLDMVSLTAEVLELKANPN
FT                   RKARGIVLEAQLDKGRGPVATVLVQKGTLHVGDAVAIGSAHGKVRAMINDKGKRIKTAG
FT                   PSTPVEILGLSEVPNAGEVMMVMDSEKEARSVAEKFIAYGREKMLSETKQQLSLDDLFN
FT                   QIQAGSVKELNIIVKADVQGSVEAVKQSLVKLSNDEVAVKVIHGGVGAITESDVNLAAA
FT                   SNAIIIGFNVRPEPAAKDAASAEKVDLRLYRVIYNAIEDIEAAMKGMLDPEFVEKVTGH
FT                   AEVRQIFKASGVGTIAGSYVLDGTIQRDSSARIIRDGIVVHEGKLASIQRGKDAVKEVR
FT                   SGFECGLVMESYNDIKEGDQIESFIMEEVPR"
FT   CDS             complement(252213..252482)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02800"
FT                   /product="Translation initiation factor IF-2, N-terminal
FT                   region."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37372"
FT                   /db_xref="GOA:D4MXM7"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXM7"
FT                   /protein_id="CBL37372.1"
FT                   /translation="MAKFRVYEIAKKYNKDNKEILEILKANHVEVKNHMSTIGDEQIKM
FT                   IENALKPKKEAKQDHNSKKQENSKRKDNKKAQNMEKKNNKKLRK"
FT   CDS             complement(252503..252802)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02810"
FT                   /product="Ribosomal protein HS6-type (S12/L30/L7a)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37373"
FT                   /db_xref="GOA:D4MXM8"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXM8"
FT                   /protein_id="CBL37373.1"
FT                   /translation="MNKGLSLLGLAFRSGNLVSGEFAAREAVRKKTAALIIVANDASDN
FT                   TKKMFENQCKHYQVPFYCWGLKEELGHAIGKEFRASIAVTDQGFAEALLKQLDK"
FT   CDS             complement(252795..253064)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02820"
FT                   /product="Predicted nucleic-acid-binding protein implicated
FT                   in transcription termination"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37374"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXM9"
FT                   /protein_id="CBL37374.1"
FT                   /translation="MNRKIPTRKCIGCGELKEKNQLVRIVRSKEGEISLDMTGKKNGRG
FT                   AYICPDPQCLKQAFKKKGLDRSFKIGVPESVYETLKKEMEELYE"
FT   CDS             complement(253086..254273)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02830"
FT                   /product="transcription termination factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37375"
FT                   /db_xref="GOA:D4MXN0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR028620"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXN0"
FT                   /protein_id="CBL37375.1"
FT                   /translation="MSELIAALNQLEKEKGIDKDVIMEAIENSLLAACKRDFGSADNVV
FT                   VNMDRETGDIYVYAIKEVVDEVYDPALEISLGKAKAIDQNLNLGDTVRIEITPKDFGRI
FT                   AAMHARSVIVQKIKEEERRVVYDHFYCKEKDIVTGVVQRYVGENVSVSLDDKTDALLMK
FT                   SEQIRGEVFKPTERIKLYIVEVKETNRGPRILVSRTHPDLVKRLFEKEVAEIQDGTVEI
FT                   KNIVREAGSRTKMAVWSNDKNVDPVGACVGLNGARVNAIVNDLKGEKIDIINWNEDPCV
FT                   FIENALSPSKVVSVAVDVEEKSAEVVVPDYQLSLAIGKEGQNARLAARLTGYKIDIKSE
FT                   SQAAEEAAKVSEEPEADEFEIEEDLFNEEINDDFVEDAENTEEAVEDFDAEDIEE"
FT   CDS             complement(254901..259313)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02850"
FT                   /product="DNA polymerase III catalytic subunit, PolC type"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37376"
FT                   /db_xref="GOA:D4MXN1"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR006308"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR023223"
FT                   /db_xref="InterPro:IPR028112"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXN1"
FT                   /protein_id="CBL37376.1"
FT                   /translation="MEVTTKPFFSVFPDLKVSDDVRSLFEDANIREITLKKKENTLKIS
FT                   FQCDHLISRVDTWRMERTIREQLFSKRFVKIRFQESYHLSEQYNLKYLMEHYMKSFLFE
FT                   LKGKGEVIFNVVRKGDYRIEDDVITFYFEDTFVNRNKAPEIKEFFEMILKERFSIDAKV
FT                   GFDFSKTIDRSLKMESDYRLQQEIHTIVEHADIVEKEQKEEKKARKKAAATKKEHMFKK
FT                   KPKYSDDPTLLYGRNCDGELMEIKDIYDEIGEVVIHGQITFLETREIRNEKTIIIFHIT
FT                   DFTDTISCKVFVRNEQLPDILDGLKKGGFYRIKAVAMYDKFDHEISLGSVAGIKAITDF
FT                   REKRQDTSMEKRVELHLHTVMSDNDSVVQIKDIVNRAYEWGHPAVAITDHGVLQGFPIA
FT                   RHAYEDLRLKEDDPFKIIYGVEGYFVDDLGDLIIDSKGQSLMDSYVVFDIETTGFNSVN
FT                   DRIIEIGAVRVVEGEIKETFSEFVNPERPIPYKITQLTTITDDMVKDAGTIEEILPQFL
FT                   KFCAGSVLVAHNAGFDTGFIRENAKRLNLPYDHTVVDTLGLARCLMGHLGKFTLDNICK
FT                   HLNIILETHHRAVDDATATGKIFVEFISMLKEKDITDLDQVNEFANDNVDLIKKGRMYH
FT                   GIILVKNNTGRVNLNRLVSESHLNYFNRRPRMPKSLINKYRDGLIIGSACEAGELYQAL
FT                   LDERSDETIANIVSFYDYLEIQPVGNNEFMIGSERVENVNSIEDIQKFNQKIVDLGEQF
FT                   HKPVVATCDVHFLNPDDAIYRSILLAGKGFKDADQQAPLYFRTTQEMLDEFAYLGSEKA
FT                   KEVVITNTNKINDMIENISPIHPDKCPPVIPDSDKTLREICYNRAHEIYGDDLPERVTS
FT                   RLEKELNSIIGNGYAVMYIIAQKLVWDSNDHGYLVGSRGSVGSSFAATMSGITEVNPLP
FT                   AHYICPECHFVDFDSEQVQKYAKMGMSGFDMPDAYCPKCGAKMTKEGQDIPFETFLGFK
FT                   GNKEPDIDLNFSGEYQGKAHAYVEVIFGKGKAFRAGTIGTLAEKTAYGYVLKYLEERGI
FT                   SKRRCEIERLALGCTGVKRTTGQHPGGIIVVPHDKEIYDFTAVQHPANDMNTPIITTHF
FT                   EYHSIDQNLLKLDILGHDDPSMIRRMEDITGIDAQTIPMDDKGVMGLFHGTETLGITPE
FT                   DIDGTPLGSLGVPEFGTDFVIQMLQDTHPQSFSDLVRISGLSHGTDVWLGNAQTLIENG
FT                   DAVISTAICCRDDIMVYLINQGLEQEASFKIMEGVRKGKGLTDEQEQMMRDHNVPDWYI
FT                   WSCKQIKYMFPKAHAAAYVMMAWRIAWYKVYHPLAYYAAYFSIRAKAFSYEDMCLGKER
FT                   LDEKMSIIKNTPKHEVKNADLDLLREMKIADEMYARGYEFWPLDIYKAKAKDFQVIDGK
FT                   IMPALTSIDGMGEKAAQQVEEAAKGEPFTSLENFRNRTKAPQACIEKMKELGIMGDLSD
FT                   TDQLSFDFL"
FT   CDS             complement(259315..260376)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02860"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37377"
FT                   /db_xref="GOA:D4MXN2"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXN2"
FT                   /protein_id="CBL37377.1"
FT                   /translation="MYTRNQTRVISIGDVKIGGGNPVAIQSMTNTKTENVEETVKQILA
FT                   LEKAGCQIIRCTVPTMKAAEAFTEIKKQIHIPLVADIHFDYKLAIAAMEHGADKIRINP
FT                   GNIGGEENIRKVVETAKKYHVPIRVGVNSGSLEKPLVKKYNGVTAQGLVESALDKVAML
FT                   EKYDFHDMVVSIKSSDVLMCAEAYRLVADKINYPLHVGITEAGTVFSGNIKSAVGLGII
FT                   LNQGIGDTIRVSLTGDPVNEIASAKLILKTLGLRSGGIEVVSCPTCGRTNIDLIPLANQ
FT                   VETMAADFENLNLKVAVMGCVVNGPGEAKEADVGIAGGNGEGLLIKKGEVIRKVPEDQL
FT                   LDTLRYELEHWGE"
FT   CDS             complement(261425..262564)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02880"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37378"
FT                   /db_xref="GOA:D4MXN3"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXN3"
FT                   /protein_id="CBL37378.1"
FT                   /translation="MKYISIIGSTGSIGTQTLDIVRSNKDLKVTALAAGTSIDLLEKQA
FT                   REFQPVIVAVYNEQKAEELKLRLADTNIKVCAGMDGLLEAATQEQCSVVVTAIVGMIGI
FT                   RPTIAAMKAGKDIALANKETLVTAGHIIMPMAEELGVSIYPVDSEHSAIFQCLQSGKRD
FT                   DLDSLIITASGGPFRKKTTEELKHVTVEDALNHPNWSMGRKITIDSATLVNKGLEVIEA
FT                   KWLFGVDFDDIHVVVQPKSVIHSMIQFKDGSVIAQLGTPDMKLPIQYALFYPQHRNLAG
FT                   ERLDFAKLKEITFEEPPVDVLKGLPYAYKAGRIGGSMPTVLNAANEKAVALFLDRKIQF
FT                   LDIYDIIEDTMNAHKVIENPTLEEVLETEQWVYEHIESR"
FT   CDS             complement(262566..263378)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02890"
FT                   /product="CDP-diglyceride synthetase"
FT                   /EC_number="2.7.7.41"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37379"
FT                   /db_xref="GOA:D4MXN4"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXN4"
FT                   /protein_id="CBL37379.1"
FT                   /translation="MFKQRLISGIILVLIAAFGLYMGGIVTFAMTLIVALIGYSEILKI
FT                   YHIEKSSLAVIGYTGTILYYVALLFDLDQWTTAIIILFLIFLLGCYVVRFPKYKVDQMM
FT                   AGFFGFVYVAVMMSFIYQIRELQNGGEFVVLLFLAAWGNDTLAYCTGMLIGKHKMSPIL
FT                   SPKKSIEGLVGGIVGAAILGALYGLYLNTYIRFSFNPVTMFPIVCGLGGAVSVIGDLAA
FT                   SAIKRDSGIKDYGTLIPGHGGILDRFDSIIFIAPVIYYLTVMISGGAI"
FT   CDS             complement(263383..264090)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02900"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37380"
FT                   /db_xref="GOA:D4MXN5"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXN5"
FT                   /protein_id="CBL37380.1"
FT                   /translation="MENLNIPQHVAIILDGNGRWAKKRHLPRNMGHRQGSKVVEKIIED
FT                   AHDLGIKYLTVYAFSTENWKRPQDEVNALMKLLRDYLKTCIKRANKNNMKVRVIGDITG
FT                   LSEDLQEKIVELEKASKDNTGINFTIALNYGSRDEMVRAMRHMADDLSSGNLSKDEITE
FT                   EVFNGYLDTKELPDPDLMIRTSGEERLSNFMLWQLAYTEFYFTDVLWPDFNKKELIKAI
FT                   EYYNGRDRRFGGI"
FT   CDS             complement(264180..264725)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02910"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37381"
FT                   /db_xref="GOA:D4MXN6"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXN6"
FT                   /protein_id="CBL37381.1"
FT                   /translation="MLKQFEDKMQKSLDSMANDFMTIRAGRANPHVLDKVKVDYYGVAT
FT                   PVAQVGNVSVPEARTIMIQPWEPNLLKEIEKAILVSDIGITPTNDGKAIRLNFPDLTEE
FT                   RRKELAKDVKKRGEEAKVAVRNIRRDANDFVKKQNKAGDLNDDQAKDEEDKVQKMTDKY
FT                   IKQIDEAVDAKSKEIMTV"
FT   CDS             complement(264749..265462)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02920"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37382"
FT                   /db_xref="GOA:D4MXN7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXN7"
FT                   /protein_id="CBL37382.1"
FT                   /translation="MKDLKDMKRVLLKLSGEALAGDKKTGFDEATCADAARQVKTLVDE
FT                   GLQVAIVIGGGNFWRGRTSESMERTKADQIGMLATVMNCIYVSDAFRTAGMETEVYTPF
FT                   VCGAFTELFSKDKAVKALDEGKVVFFAGGTGHPYFSTDTATALRAIEIEADAILLAKSI
FT                   DGVYDSDPAVNENAVKYDSITMEEVLDQKLGVIDLTATIMCLENKMPLAVFGLNEENSI
FT                   ENLMKGEFNGTYVTV"
FT   CDS             complement(265581..265967)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37383"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXN8"
FT                   /protein_id="CBL37383.1"
FT                   /translation="MQNKTKNIFFKIISGLVLIQGVLQLLNLLGLVGYGRTTTSATKFY
FT                   LGLVLIGGYAVAAMVGGYTGLKDGNTQEGCKRCFYVSLVLIAITIATIILNVVFKAYSV
FT                   TQFEALIIPVLFMLFTILNGRKNL"
FT   CDS             complement(266059..266409)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02940"
FT                   /product="Hpt domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37384"
FT                   /db_xref="GOA:D4MXN9"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXN9"
FT                   /protein_id="CBL37384.1"
FT                   /translation="MNIQEFYDSIDESYENVSSRMMGNQKLVEKFVRKFLDDPTYEQIK
FT                   EAVDKMDYDEILRTTHTMKGIASNLEFTHLQQKSAKAVDMIRAGQREEVLPVIGEIEKE
FT                   YQKVIEQIQKLD"
FT   CDS             complement(266495..270988)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02950"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37385"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXP0"
FT                   /protein_id="CBL37385.1"
FT                   /translation="MMNNEMTKSNEQNILVGIDVGSTTTKIVAVDANDRHQLLFSDYAR
FT                   HHANQIASVIRSIKKFCGHIRDKKIRLCLTGSGAKPVASILKVPFVQEVAANAIALQDQ
FT                   FDQVGTAIELGGQDAKMIFFKDSENGQSQSVSDMRMNGSCAGGTGAFIDEIASVLKVPV
FT                   EQFNELAQKGTHLYDISGRCGVYAKTDIQPLLNQGAAKEDLALSAFHAIAKQTIGGLAQ
FT                   GLEIKKPVAFEGGPLTFHPTLVKVFAERLDLKEDEILCPKHSELMIAYGAALSLDKMFA
FT                   DSKPKDVNKMLVILEDAQKDHSHVSGEIAKPFFESKEEENAFKEAHKKKQVTWKKPQKG
FT                   EVVRCFLGIDAGSTTTKFVLLDEQEEILDSFYAPNEGDPLKVAKEALICLRKRYEEAGA
FT                   ELEILSAGTTGYGEMLFSKAFEIPCHTVETVAHARASEKYVKDASFILDIGGQDMKAIW
FT                   LEDGVITNILLNEACSSGCGSFLENFASSLHIPTKEIAKKAFASKNPAVLGSRCTVFMN
FT                   SSIITEQRNGKNPEDIMAGLCRSIIQNVFTKVIRVSNLDSLGTKIVVQGGTFENDAVLR
FT                   AMEEYVGREVIRAPYPGIMGAIGVGLIAKEQYEKNPKEVSTWDLRDLDTFSYEQQANAP
FT                   CPFCTNHCQRTIVQFSNGNSWVTNNRCEKGEIIGDPRNDEVGKQLKETIRKTQSVPDLF
FT                   QERKKLLFKEYPYPVPKTERDITIGIPRVLSYWDTMPFWTTFFKSLGYKVQLSDESTRE
FT                   IYESGLSAVTSDTVCFPAKLVHGHLRNLVKKYHVDRIFMPSITTVPPENMEKTSESMCA
FT                   VVKGYPIVIRNSDNPQDKWNVPFDAPLFHWHTKKDRQHQLVKYMEEVYHVSKEEVMNAM
FT                   HTADQAQKSFDQQLKKRGEEILNEVKEKNEFAVVLASRPYQNDTLVNHDLSKMFTKAGI
FT                   AVLTADSLPEVNQTELSKSRLDIVNNYHARMLSSAILCAQSEHLEYVQLVSFGCGHDAY
FT                   LSDEITRMMKEISGKTPLILKVDESDNQGPLGIRVRSFLETVKMGREKHQKLEVKELQE
FT                   PYPVKFTKENRKEKIALVPNTSHAFCRIMTAALRGQGIRAVALDIGREEAIRLGKKYVH
FT                   NDICFPAQIVIGEALAALESGKYDDKDVAIVMGKYVGDCRLTHYGALLRKALDDAGYDH
FT                   IPILTNDDADSHNMHPGFKLNLASSVKIAFALPMIDVLEELLRKIRPYETVKGSADEAF
FT                   DKALDLVIDGLEKSGVLGARKGFKKAISIMKNISYDRTNLKPQILIVGEYLLNFHPGAN
FT                   HDIEKYLEENGFEIIEARMTDVIRKTYFYQDSQIREYHLNKPMDQKIWFRTADMFFDLA
FT                   HSLTDSIAKGHPLYKPAIRMDDLVKDSDPIIHHTFDAGEGVLIPGEIIHHAKHGCKYFL
FT                   ILQPFGCLPNHVVGRGISKKLKEMYPNAQILPLDYDPDVSFANIENRLQMLVMNAKQEI
FT                   LEENEERDRRRSHHYMESDKKTYRRKKYGVEKTSGV"
FT   CDS             complement(271085..271621)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02960"
FT                   /product="Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37386"
FT                   /db_xref="GOA:D4MXP1"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXP1"
FT                   /protein_id="CBL37386.1"
FT                   /translation="MIKQIGTLNIEIERRKIKNINIYVKPPNGDVLVTVPMRVSNEEVF
FT                   RFLKKKEEWILKNHEKVKNRQNSSQQEINLEQRKWLEDKIIEYAMRWESIMKVHANGFT
FT                   IRDMKTRWGSCSIHSKKIRMNLQLAVKPEECVEYVLVHELCHLLEPSHNQRFYDLMSHI
FT                   LPDWRERKQKLNEKV"
FT   CDS             complement(271627..273201)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02970"
FT                   /product="Predicted unusual protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37387"
FT                   /db_xref="GOA:D4MXP2"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXP2"
FT                   /protein_id="CBL37387.1"
FT                   /translation="MKQETGRLKEILHVLNQHNVTHGINPEKLCSILEDLGPTYVKLGQ
FT                   IMSMRSDILPEKYCHELARLRTDVKPMSFNEIWKILNKELHNDPGQLFQKINQIPVGCA
FT                   SIAQVHEAVLGDGSKVVLKIQRPQIKQIMAEDIALLKKASGFLNFATGTGELIDFRKVI
FT                   DELWETSKEEMDFEKEAQHLERFYENQKDVAYVTCPKVYKEYSNEHLLVMSYVDGIQID
FT                   HIEELDRNGYDRKEIAQKTAQNYCKQILADGFFHADPHPGNLWISGGQIVWLDLGMAGD
FT                   LSEHYRAIMKRAITAILKNDIYELKNAFLSFGKPTEKIDHASLYTDLDDMVGKYMNMDF
FT                   GTMDLGELMEDAIGLLKKHKIAIEPDITLLARSMVTMEGTLKLCSPEVNMIQILTSYMS
FT                   ANMFHEIDIKKEIRHALRDIYGSSKKSLEIPAQVSDLLNITKNGQVRVNIESAQIEKAG
FT                   RELKKGFDHLLLVLIVMALWFSSAILCLSDVTPRVLGMPYLSVAGFISGFLIVLYVLIH
FT                   MLIQRKK"
FT   CDS             complement(273211..273609)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37388"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXP3"
FT                   /protein_id="CBL37388.1"
FT                   /translation="MDFTNGMKKVFLASVGAAATTAEVTKDILEKMIEKGERTVEHGKV
FT                   LNQELKHNAKQKVKEHVSIQVTKKYDKAFECVDEMSPEDLALLKERIAKAEALQKEKQE
FT                   AEEDVEVEESEATTDSETSQVQEDETEQ"
FT   CDS             complement(273665..274105)
FT                   /transl_table=11
FT                   /locus_tag="CL2_02990"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_02990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37389"
FT                   /db_xref="GOA:D4MXP4"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXP4"
FT                   /protein_id="CBL37389.1"
FT                   /translation="MKFVIQRVKEASVKVDDEYTGKIKKGYLVLIGVGQEDTKEEADKY
FT                   IRKMINLRIFEDENGKTNCSLKDVDGELLLVSQFTLYASCRKGNRPSFTQAGDPKKAEE
FT                   LYEYIIKECNKEIDVVQTGIFGAHMEVALINDGPFTVVLEDL"
FT   CDS             complement(274217..275233)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03000"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37390"
FT                   /db_xref="GOA:D4MXP5"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXP5"
FT                   /protein_id="CBL37390.1"
FT                   /translation="MAKIYYQEDCNLSLLDGKTIAIIGYGSQGHAHALNLKESGCNVII
FT                   GLYEGSRSWKRAEEQGFEVYTSAEAAKKADIIMILINDEKQAKLYKESIEPNLEPGNML
FT                   MFAHGFNIHFGCITPPKDVDVTMIAPKAPGHTVRSEYQAGKGTPCLVAVEQDATGKALD
FT                   LALAYSLGIGGARAGVLETTFRTETETDLFGEQAVLCGGVCALMQAGFETLVEAGYDPR
FT                   NAYFECIHEMKLIVDLIYQSGFEGMRYSISNTAEYGDYITGPKIITEDTKKAMKQVLTD
FT                   IQDGTFAKDFLLDMSDAGSQVHFKAMRKLAAEHQSEVVGKEIRSLYSWSNEDKLINN"
FT   CDS             complement(275289..275786)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03010"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37391"
FT                   /db_xref="GOA:D4MXP6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXP6"
FT                   /protein_id="CBL37391.1"
FT                   /translation="MRQIVLSILVENTPGVLSRISGLFTRRGYNIDSITACTTQDQKFS
FT                   RITIAVSGDDMILKQIKNQLSKLEDVVKIFELENSKSVCRELILAKIRANKTEKQEVIT
FT                   IADIFRAKVVDVSKDNLMIELTGNVNKIEAFINLISDFGVIEIVRTGITGLSRGEDNSN
FT                   IF"
FT   CDS             complement(275949..277241)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03020"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator common domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37392"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXP7"
FT                   /protein_id="CBL37392.1"
FT                   /translation="MKIKKFKIILSLFLIIGIAAGGVLGYYDARLEAAVNNKNGSTLTD
FT                   VKVDDNLTFNKNVINILLVGSDHGAIKGDHGRSDSIMIATVNFKTKELKLTSLMRDMYV
FT                   EIPGHGHNKLNAAYAFGGVELLYQTIAKNFGIKIDKYCVVDFSTFEKVINKVGGVEISL
FT                   EEKEAKYLNTTNYISKKKYRNVKVGKQTLNGNQALGYARVRYVVSKKYGDGDFGRTGRQ
FT                   RAVLQAALNKVLQQSPTKIADIALDSLADVSTDMSAKYLKSLVLKVVQMGTTEIDQMRV
FT                   PLEGTYKMGRAQSNMFVFFINFSANKAAMNYFLFDKGSEKDWAKEYGGISSVETFGYSG
FT                   TSSSDSTSSSSSYSTSSTRSSYQQESYSTTSSSHTTYSTRSTTTRSTEERVTESTTSQP
FT                   QTSAPRPTTAHHTTTAAATESTPSGDSVEEE"
FT   CDS             complement(277329..278243)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03030"
FT                   /product="Glycosyltransferases, probably involved in cell
FT                   wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37393"
FT                   /db_xref="GOA:D4MXP8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXP8"
FT                   /protein_id="CBL37393.1"
FT                   /translation="MVIDLIIPTYKPGDKFQESLKRLALQTRKPDRIILVNTEAEFFDE
FT                   EMITPYDNVEVHHIKKEEFDHGKTRDYGASLAKEADILMFMTDDAIPKDKYMVENLIKA
FT                   FDDPIVTAAYGRQMADPEKNYIEYYTRIFNYPLESRVKTKEDLDTLGIKTFFCSNVCSA
FT                   YRRSEYDAMGGFEHKTIFNEDMIMASKMIEDGKAVAYQADARVWHWHDYKAIQQLHRNF
FT                   DLAVSQVDHGGLFLKVRSESEGVKMVIATIKHLFKKGKIYLIPKYVIDTGFKLIGYKLG
FT                   RNYKKLPKWMVLKLTMNQTYWKA"
FT   CDS             complement(278267..280519)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03040"
FT                   /product="Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37394"
FT                   /db_xref="GOA:D4MXP9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXP9"
FT                   /protein_id="CBL37394.1"
FT                   /translation="MSEHIIKAEFSEVMQKSYIDYAMSVICARALPDARDGLKPVQRRV
FT                   LYSMDELGLRYDRPHRKSARIVGDTMGKYHPHGDSSIYESLVVMSQDFKKGVPLVDGHG
FT                   NFGSIEGDGAAAMRYTEARLQKITQEAYLADLDKNVVDFVSNFDETEKEPEVLPVKVPN
FT                   LLVNGADGIAVGMTTSIPPHNLGEVVDAVKAYMRKESITNEELMEYIKGPDFPTGGLVI
FT                   NKKDLLNIYSSGTGKLKLRGKVTFEPAKKRGEKDKLVISEIPYTMIGNNISKFLSDTVA
FT                   LIENKVTTDILDISNESSKDGIRIVLELRKGADVERLKNLLYKKTKLEDTFGVNMLAIV
FT                   DGRPETLDLKGIIENHTQFYYEVTRRKYKTLLSKLYEQREIKEGLIKACDMIDLIIEII
FT                   RGSKSQKEVKACLTKGDVGNINFKSSDSMIEATKLSFTDKQASAILDLKLYRLIGLEIL
FT                   MLKEEYEEILAKIEEYEDILNNEKSLKNVIRKELDKIKKEFGRERRTVVEDGKEAVYVA
FT                   APVKEETVYFVMDRFGYSKTMDKATYQRNKENILKEYKFIVPCMNTDKICIFTNLGVMH
FT                   QIKVLDIPAGKFRDKGVPIDNLCNYDSTKEYIIQVLDAESMIHSSLLFATAKSMLKVMD
FT                   GELLNAAKRTVQATKLSEDELIEVIPIDWMEGSEDKVVLQTKEGVFLKFLLSEIPKKKK
FT                   SALGVRGMKLSKDDSLTNIYVMAAQNISSIVYKEKELEFHRLKLSKRDSKGTKVRR"
FT   CDS             complement(280541..282454)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03050"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37395"
FT                   /db_xref="GOA:D4MXQ0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXQ0"
FT                   /protein_id="CBL37395.1"
FT                   /translation="MANKTYDANSISVLEGLEAVRKRPGMYIGSVSTKGLNHLIYEIVD
FT                   NSVDEFLAGYCDEITVSLNKDGTATITDNGRGIPVGINERTGKTAVEMVFTMLHAGGKF
FT                   GDGGYKISGGLHGVGASVVNALSTWLTVTVKQGGKVYQQRYERGKIITPLEVIGTCRKS
FT                   DTGTNVQFLPDPEIFDKTYFKAAMVRNRLHETAYLNPKLTIHYVNEREGEETTVDYHEP
FT                   EGICAYVKKLNEGKQMLHEPVYFKRMIDGIEAEVAFQYTEDFGENILGFCNNIYTIEGG
FT                   THITGFKTKFTTIMNQYAREIGVLKEKDSNFTGTDVRNGMTAIVSVKHPEPRFEGQTKT
FT                   KLDNPDAAKAVGEIAGEELVLYFDKNLDTLKKVLACAEKSAKIRKAEEKAKTNMLVKQK
FT                   LSIDSNGKLANCESRKAQDCEIFIVEGDSAGGSAKTARNRKTQAILPIRGKILNVEKAT
FT                   MDKVLANAEIKTMINAFGCGFSEGYGNDFDISKLRYHKIIIMTDADVDGAHIATLLLTF
FT                   FYRFMPELITHGHVFLATPPLYKAMPQKGEETYLFDDAALTRYRAEHKGNFTLQRYKGL
FT                   GEMDAQQLWETTLNPESRTLKQIEIEDARMASDITSMLMGSDVPPRRQFIYENANEAML
FT                   DI"
FT   CDS             282618..283283
FT                   /transl_table=11
FT                   /locus_tag="CL2_03060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37396"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXQ1"
FT                   /protein_id="CBL37396.1"
FT                   /translation="MKRRIFKQFLSGILGIILLLSLAGCGQSTSNSKPDDTMEAFYDLI
FT                   IKQDTTSMTDLGIDDSEASDTLKTYQTSMISTLQKSFKNAGVTITKKQANEIYKAISSK
FT                   LSSLDHKITVTGQDKKNATVKVSSQYINYLDIFKQAKQTTLDELKPLHIENLSDAKKQL
FT                   VSNVIEAFNSTDVSSDMHTQTFKLKLQKIKSGKNTLHIFFPDNYEEVGSKLMKNATNQ"
FT   CDS             complement(283338..283883)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03070"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37397"
FT                   /db_xref="GOA:D4MXQ2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXQ2"
FT                   /protein_id="CBL37397.1"
FT                   /translation="MRIRKRKPIGKKTIKYIEKLYEAYSRKLFCIAKNHVKDNDLAQDV
FT                   VQSVFEKALVYPESILKVPEEEVFYFLTAITKNESFTLLKNEKNNEHESLTYEDGSEGD
FT                   FVEDPRDNYLQMIDLESLKQNLAALPRRHRDTILFRYVYGLKCKEIADLFRITERSVKN
FT                   RCKEARELLRQMMEADEL"
FT   CDS             complement(283971..284978)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37398"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXQ3"
FT                   /protein_id="CBL37398.1"
FT                   /translation="MKEYIPDYYKDFQCIADKCKDSCCIGWEIMIDSKSYKKYQNVKGE
FT                   FRDRLMKGIDHEGTPAFHLDDRDRCVFLNQKNLCDIYIELGEDALCEICTQHPRFHNEY
FT                   GNIRQTGLGMACEEATRLMFETKEFGLCQIQGTNTESTDDFDESVLEIQLWILDLLKKK
FT                   ENPVEQRIEQIFDVVQGIQDHLNQTGEILNTWKNDPIKKNHILSQMREETYIKNWISIY
FT                   QELDFMEPKIQKMFCKMEPMPCMIKEQGIDESYMEHLMSYFIYRYFMKSCEDNNLIDKV
FT                   KFAILSCLIIEQMNEYCKRNHILKTPQEIARIYSKEIEYSQENMEIIFEELLFG"
FT   CDS             complement(285004..285819)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03090"
FT                   /product="Response regulator containing a CheY-like
FT                   receiver domain and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37399"
FT                   /db_xref="GOA:D4MXQ4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012052"
FT                   /db_xref="InterPro:IPR014879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXQ4"
FT                   /protein_id="CBL37399.1"
FT                   /translation="MDERHRVLIADSYPDEAEQLKKELSGKYNVISVRDNGVDTLDDII
FT                   KLKPDLVVIDLMLSEIDGIGVIEKCRELIEPDKIPAFIALTMLENRELMECIRRLKVDY
FT                   CMMKPFQAGILAERISQMIRIRSVNNDIQKNEKALHGRSKRMCSMCGTNDVRRQISFLV
FT                   RNLGVPAHIKGCRYMKYAILMAIEDCNRINYITKLLYPEIAKKCKTTTSSVERAIRHAI
FT                   DIVWIKGNQELLKEIFGTFVMEGQERPTNSQFIAAVADWMRLEHQIKVS"
FT   CDS             complement(286748..287569)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03110"
FT                   /product="sporulation transcription factor Spo0A"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37400"
FT                   /db_xref="GOA:D4MXQ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012052"
FT                   /db_xref="InterPro:IPR014879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXQ5"
FT                   /protein_id="CBL37400.1"
FT                   /translation="MGGLKMNKINVAIADDNQRTVEMMTELLEQESDIEVIASADDGEE
FT                   ALRIIKEKQPDVVLLDIIMPKLDGIGVLERLQTEDLSKRPIIIMVSAMGQENVCEEAME
FT                   LGASYFILKPFDLRTIIKQIKQAKIKQQIPERPFVSVPEKIHGLTENQLEIIITNMIHE
FT                   IGVPAHIKGYQYLRDSIMMAVCDMDILNSITKQLYPSIAQKFDTTPSRVERAIRHAIEV
FT                   AWGRGNMDTIDALFGYTIHAGKGKPTNSEFIALIADKIRLEYGDEVLIEEK"
FT   CDS             complement(287727..287816)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37401"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXQ6"
FT                   /protein_id="CBL37401.1"
FT                   /translation="MHAEADQIVVTTTELLDVIWNHRSEKLYI"
FT   CDS             complement(290712..291851)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03140"
FT                   /product="exonuclease SbcD"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37402"
FT                   /db_xref="GOA:D4MXQ7"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXQ7"
FT                   /protein_id="CBL37402.1"
FT                   /translation="MKILHLGDLHLGKRVNEISMIEDQKFILDQIVTLVKEEKIDVILL
FT                   CGDIYDKAIPTIEAIHLLDEFLEELSDLKVKVLMISGNHDSSERLSFGRNLFKRSNLYI
FT                   ASQFNQEIEKITIKEDGYNINFYMLPFVKPAYINHVLKIQTETYEECFKHLMEQVKINE
FT                   DETNILLAHQFVTVGKNSPELSDSETSSLGGIDNIDYRLFDAFDYVALGHIHKPQAMGR
FT                   EMVRYAGSILKYSFSEIYKDKQATILTISKNKQISLSHHLLKPLRDMREMECSLESLLK
FT                   RKCEIGNEEDYMHVILTDEEQILDAIGKVRTVYPNVMQISFKNRRHMMQYETIQMKENQ
FT                   IADQNPMELFEQFYKMQNHIDLDEKRAQMAISIFEEVIR"
FT   CDS             complement(291922..293139)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03150"
FT                   /product="stage IV sporulation protein B"
FT                   /EC_number="3.4.21.116"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37403"
FT                   /db_xref="GOA:D4MXQ8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008763"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR014219"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXQ8"
FT                   /protein_id="CBL37403.1"
FT                   /translation="MKKYTYRKFLILLFMINLIAITAVYIKYCNARLPDTIHINKGETV
FT                   SLCYDVPVSATIDHQTIRLNQPIVFKQCHMGQYEMKTNLFGAIPLKKIKVKVVDDQKIT
FT                   PSGEVIGVYVETDGLFVLDTDQFTGENSMEYAPSKNKLYRGDYIKKIDGKDIVSKKQFI
FT                   EKINQGQGESVILTVQRKAKMMQIKIKPERSKTDHMYKIGTWIRDNTQGIGTMTYVKGT
FT                   SFGGLGHGIYDMDTGTLLKIKGGLLLDPQIYSIKKGKSGTPGEIVGSIEYKEENILGSI
FT                   KKNTEKGIYGTIPKKQQKAYKIGYRQDIKPGKAYILSNVSGTMKQYEIQINKIVPSDKD
FT                   VLKSMEIEVTDKELLKLTNGIIQGMSGSPILQNGKLIGAVTHVFVNDPMKGYAILMETM
FT                   LYEMEN"
FT   CDS             complement(293214..294896)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03160"
FT                   /product="DNA replication and repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37404"
FT                   /db_xref="GOA:D4MXQ9"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXQ9"
FT                   /protein_id="CBL37404.1"
FT                   /translation="MLQNLHVKNLALINELEITFDEHLNILTGETGAGKSVLIGSIESA
FT                   LGKKISKDMIRPGAKEAVIELLFWIEDQKLIKEIEALDLEVEDGQIFIKRVINEKRSIN
FT                   KINDSTVTLNTLREVSRRLFDLHGQQEHQVLLKEKNHLSMMDHFLPENARYSLEQCKNL
FT                   AGEYHEISTKIKEISIDDQQRLREMDFLKHEISEIENANLVKGEDEELETVYQKIVHSR
FT                   DIIISCQAARMLTGYEEETSIGNQLSESIRRMQEISHLDPQISEFYEQLLSVEDLLNGF
FT                   HQELTTYMENMEFDEQTYQEVEERLNVINSLKDKYGPSIEDVTAYGQKAEKRYNMLCDA
FT                   EHEIEILKNEQERIRERYLKEAKNLSEQRCKVAKTLGSNITKALEDLNFLDVRFEIEVT
FT                   KKDQISADGMDQIRFMISTNPGLPMRPVQEVASGGELSRIMLALKSVAAQADGVDTLIF
FT                   DEIDTGISGETANRVAKKMAVISKDHQVIAITHLPQIAAMADSHYFIRKQTDQKNTQTM
FT                   IRKLNESESLKEISRMISGDQWSETSMEHAKEMKSLADETKLY"
FT   CDS             complement(294916..295374)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03170"
FT                   /product="transcriptional regulator, ArgR family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37405"
FT                   /db_xref="GOA:D4MXR0"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXR0"
FT                   /protein_id="CBL37405.1"
FT                   /translation="MKKNRQEAIIELIQQYPIETQEELLSRLNQIGFKTTQATISRDIR
FT                   ELALIKKPDADGKQIYCLIDQEDETSRKYQRILAEAIISMELAENMLVVKTVSGMAMAS
FT                   AAALDSLNIIGMVGTIAGDDTIMCVMKDKNIGRTAIAEIDHMIKKLKE"
FT   CDS             complement(295361..296221)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03180"
FT                   /product="Predicted sugar kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37406"
FT                   /db_xref="GOA:D4MXR1"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXR1"
FT                   /protein_id="CBL37406.1"
FT                   /translation="MKNFLILTNEKKDPGLRISKKIQDYIEKQGGISQRMCDFTRHVQK
FT                   DMNCITKDTECVIVLGGDGTMLHAARLIVDHDIPMVGVNLGTLGFLTEIELSKLYDGLD
FT                   GLLNDTFQIEERMMLDGRVIHADHETDHLPALNDVVIARSGFSRIISFRIMVNGKLLDV
FT                   YEADGIIVSTPTGSTGYNLSAGGPVVNPKANVILITPICPHSLQSNSLVLSPEDEIDIY
FT                   IENVRESQLEEAYVTFDGQVARKLQPGDVLQVRKSKKIARIIKVKGDSFYRILRIKVGG
FT                   QNEEK"
FT   CDS             complement(296223..297044)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03190"
FT                   /product="hemolysin TlyA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37407"
FT                   /db_xref="GOA:D4MXR2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXR2"
FT                   /protein_id="CBL37407.1"
FT                   /translation="MKKERLDVLLVKKGLASSREKAKAIIMSGIVFVDGQREDKAGSTF
FT                   DEKQEIIVKGKTLKYVSRGGLKLEKAMKNFDIVLKDKVCMDVGASTGGFTDCMLQNGAV
FT                   KVYSVDVGHGQLDWKLRNDERVVCMERTNMRYMTEDDIDEKASFVSIDVSFISLTKILP
FT                   AVYRILNTGGEVVALIKPQFEAGREKVGKKGVVRDPKVHEEVIEKICDFASTNGFELLH
FT                   LDYSPIKGPEGNIEYLLHMRKTETMENGHTMTDQIKEVVDASHADLAKNKE"
FT   CDS             complement(297049..298920)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03200"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37408"
FT                   /db_xref="GOA:D4MXR3"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXR3"
FT                   /protein_id="CBL37408.1"
FT                   /translation="MLEYINDPNDIKQIQPEDYKLLAKDIRRFLLRNVSRTGGHLASNL
FT                   GIVELTMALHLVLDFPKDQLIFDVGHQSYVHKILTGRKNGFENLRQFHGMSGFPKRKES
FT                   DCDAFHSGHSSMSLSAALGMVTARDINHTDETIVAVIGDGALSGGMAYEALNNMARLRK
FT                   EKKNLIIILNDNKMSIAENVGGMFAYLNKVRTRKEYVEFKGNVEQSLLRIPGIGKELTT
FT                   ILKKSKDSIKQLFVPGMYFEDMGITYIGPIDGHNVPLMVDTLNRAKQLDEPIIIHVVTK
FT                   KGKGYRPAEQNPAKFHGISPFSLKTGEVLKKSDNPSNTAVFSDTLIKEAKKDKKIVAVT
FT                   AAMPDGTGLGKFKNHFPDRFFDVGIAEQHAVTFCAGMASRGLKPVFAVYSTFLQRGFDQ
FT                   ILHDVAIGNYPVIFGLDRSGLVGADGETHQGIFDIPYLSIIPNMTVMAPINGRELSEML
FT                   KHTLHHAKGPTAIKYSRGEASSLYEDQFEELHYGKGQILKEGKEAVIIAVGNIFEEADK
FT                   AEKILKEEGYEIGLVNPRYIKPFDQELIMKLSQTYDKIMIAEEGVLNGGFGMMVNEFLS
FT                   EHDYKGEVRCLGIDDQFVEHGSVSELRRMLKIDGESIADSIRQWMKE"
FT   CDS             complement(298944..299837)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03210"
FT                   /product="Geranylgeranyl pyrophosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37409"
FT                   /db_xref="GOA:D4MXR4"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXR4"
FT                   /protein_id="CBL37409.1"
FT                   /translation="MNFKDEMKQKVAQIEIILDEYLPAQEGLQKTVLTAMNTTVKAGGK
FT                   RLRPMLINETYQMFGGKEDIVKPFMAAIEMIHTYSLIHDDLPALDNDDYRRGQKTCHIV
FT                   YGEDMAILAGDALLNYAYEVATKAFDLAEKDKIMNVVEAIKILASKPGIYGMIGGQVAD
FT                   VELEGTPLSMEQILFIHKNKTSALIEACMMIGAVLAGASKEDVLKMEECGEYIGLAFQI
FT                   QDDILDLTGDEEEIGKPVGSDEKNHKTTYVTLKGLERSQRDVEDISKKAIDILEKYDKG
FT                   DCYLTNLTRFLIHRTH"
FT   CDS             complement(299827..300036)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03220"
FT                   /product="Exonuclease VII small subunit."
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37410"
FT                   /db_xref="GOA:D4MXR5"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXR5"
FT                   /protein_id="CBL37410.1"
FT                   /translation="MAKKKFDIDQGFHQLDEILTKLSSEEIKLPEAVKLYTEGVNLVKQ
FT                   CKDSLDKVEKELIVLEENGEEHEL"
FT   CDS             complement(300054..301274)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03230"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37411"
FT                   /db_xref="GOA:D4MXR6"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXR6"
FT                   /protein_id="CBL37411.1"
FT                   /translation="MKSKVFSVTQINTYIKRMFQSDYALRRISIKGQVSNCKYHSSGHI
FT                   YFSLKDEESQISCVMFASARYNGLQFELEDGQEVIVDGNVSVYERGGSYQLYAQEIRLN
FT                   GIGELYVAYEMLKQKLYEEGLFDHEIKKPIPKNPKKIGVVTARTGAAIHDIISTAKRRN
FT                   PYVQLVLYPAKVQGEGASDTIVSGIRTLDQYGVDTIIIGRGGGSIEDLWAFNEENVARA
FT                   IYEAKTPIISGTGHEVDTTIADYAADLRAATPTAACELAVPDITEVMEGIANREYTMAA
FT                   LLKQIIRRYQMKLQKYQITIANYDPRFQLQEQKMHLSELEEQIQQVMKNKMTGYKHKLE
FT                   LYAKELHGLSPTAKLINGFGYLEDQNGEPVTSVHKVKEGDQISLTISDGTILAMAKQIR
FT                   TMDEKGK"
FT   CDS             complement(301264..301677)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03240"
FT                   /product="transcription antitermination factor NusB"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37412"
FT                   /db_xref="GOA:D4MXR7"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXR7"
FT                   /protein_id="CBL37412.1"
FT                   /translation="MKRSEVREHIFRILFCVEFCEKEEFEDQVELYFHGHENINEKTQK
FT                   EITEKTENLIEHLDEIDEQISAHTNAWNLERLGKAELSILRLATYEILLDEQVPRKVAI
FT                   NEAVELAKKYCNEKAAPFINGVLSKIGQDMDEE"
FT   CDS             complement(301748..302122)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03250"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37413"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXR8"
FT                   /protein_id="CBL37413.1"
FT                   /translation="MENKSSYQINEQGVLGEVKIADDVIAVIAGIAATEVTGVARMCGN
FT                   ITNELVSKLGVNNLSKGVKVVVENHHVRVNLALELDYGVSIPEISKKVQDRVKAAIENM
FT                   TGLKVREVNVRVTGVAAEEE"
FT   CDS             302328..302594
FT                   /transl_table=11
FT                   /locus_tag="CL2_03260"
FT                   /product="Protein of unknown function (DUF997)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37414"
FT                   /db_xref="InterPro:IPR010398"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXR9"
FT                   /protein_id="CBL37414.1"
FT                   /translation="MKKLTRQEKHEQCMREIRGTLIVVLICCAWHIASAFLLNGTGLYF
FT                   LGMPAWFSVSTFGTIILSLIGVWYLLKHVFINFEYDDEEEGEE"
FT   CDS             302595..304082
FT                   /transl_table=11
FT                   /locus_tag="CL2_03270"
FT                   /product="sodium/pantothenate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37415"
FT                   /db_xref="GOA:D4MXS0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011849"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXS0"
FT                   /protein_id="CBL37415.1"
FT                   /translation="MSANQKIILAIFIVYLALNAAIGIIFSNRQNKKQHTSSEKKFFIG
FT                   GRNMNGLLLAMTTMATYTSVSSFISGPGAAGLTYGYAQAWIATVQVPITFLVLGVLGNK
FT                   LALVPRRTGAVTVVGYLKARYKSDVLVIVTSLLMVAFFMAQMIGQFTGGATLISSITGL
FT                   DHVVSLLIFGAVVIIYTSFGGFSAVAITDTIQGIIMCVGTFLLLFFVLKAGGGLAGIDA
FT                   GLAQNLPGVYDDLFSKYSPGTLLSFWILVGFGTLGLPQTAVRSMGFKNTKSLHSAMWIG
FT                   AVTCSFIIVGMHMAGTWAGALVDTKNLPTSDYFIPYIVQKIMPVGLAGTFLAAPMAAVM
FT                   STADSLLILASAAIVKDLWRNYVVKDDPVKIQSYNKNVGKMSTLVTFAFGVIVILLTIN
FT                   PPDIIFFLNLFALGGLECSFFWPLVGGLFWKKGTKQAAVFSSLGAAITYVFCYYNVQIA
FT                   GINAVVWGLLAGGILYFVIGNITCKNGLDEDIIKNCF"
FT   CDS             complement(304195..304362)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03280"
FT                   /product="Protein of unknown function C-terminus
FT                   (DUF2399)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37416"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXS1"
FT                   /protein_id="CBL37416.1"
FT                   /translation="MDLYEQNLSDVTLNKRRLKQLDQIFIEELQEIKEDMKYQKKAAYQ
FT                   EIMLENYILQ"
FT   CDS             complement(304400..304516)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXS2"
FT                   /protein_id="CBL37417.1"
FT                   /translation="MKQENLKKLKQQQDRRCILKCSDGTFKMPAYTIVFNEE"
FT   CDS             complement(304838..307366)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03300"
FT                   /product="Bacterial surface proteins containing Ig-like
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37418"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXS3"
FT                   /protein_id="CBL37418.1"
FT                   /translation="MIKDKKNMKKRWKRIISNMIAIALVIISSIPTISIPVKAEASVDG
FT                   KLITVGGKTVTKNMKIDDVKKMFGEPKLTTPSYWDGYAYTFYGKDYSDYLYLETDSDGK
FT                   IVCYGSVSPGFETNKYSYGEKVNPYARAGCEAKDDDGKLYAVIYYTKFHLDAYKRFTEN
FT                   LTENNRNLCKHAVEMWNAISYLYGYKTATYFDEKLFNIGAQLADNHSDLYDYCKSTNQS
FT                   SCYQLMTGRKATFLEYFYPNPLEFAKNARNYECPKGNAIGFMYYPAGEENDDYWIMEGF
FT                   VNKELLVDWKSVAYTEREKELLENSRKYYTNSVNTVNSMKSYYEIKPSYDSIKNIEGGK
FT                   LSKEVAKGAVDYLNAIRVGAGLNPLEYSEQLSMDAQCKSTYTVYLAKNNIKNSSPHNPP
FT                   KVEGLSDEYYSKCQSGNGENLYSCGIISTSIIDSISSALDDSQGTGQYYNRGHRYNLLN
FT                   PEWKYIGVGNTLQQACHKLSGTQSSNVDVVAWPPKGITISESGFSPSGMWTCQFYNKLK
FT                   PTADTTITIECLNSNKKWKIDPNNLLENQHYNYKRSGDLISYSDDSIVFKIGGVYQITY
FT                   DHLTDANGNETSYSYRTVYEKAYIGSEEEKVPQSIKLDKTSEKVLIGTTSKLIAKVSPD
FT                   NIKNKRIYFASNNKEVATVNECGEITAHSLGTADITATSENGNITATCKIIVVKTLDQT
FT                   DDQPEKEPTKEPTGAITNGNVNNSNNKSDLSQGHKTNNSKKENITISKAKIKSAKKKKS
FT                   SKSLTIILSKAVPKVTGYQIKIYSSKKKAKKNKGAIWTKVVQTNSKKIVIKNKKLKNKK
FT                   TLYIRIRAYKRINRKNKYSTWSEIKKVIVN"
FT   CDS             complement(307455..308570)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03310"
FT                   /product="Endonuclease/Exonuclease/phosphatase family."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37419"
FT                   /db_xref="GOA:D4MXS4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXS4"
FT                   /protein_id="CBL37419.1"
FT                   /translation="MKIAKKVLKTIGVLLGFIVVIVLGYIIYLYASYHRIEDNKSLSVE
FT                   SHTETKQTLTTGKQYSAITYNIGFGAYTPDFSFFMDGGKSSWAKSKKSVLKTVKNAGNL
FT                   TKSYDPDFALIEEIDLNSTRSYHVNEYSILKKCLKNYDTVFAQNYDSAFLFYPFTQPHG
FT                   SSKAGLALFSRYPIKDSLRRSLPISTSYNKFFDLDRCYSISRIPVDNGKYLVIFQLHMS
FT                   AYGNSDKIRKGQIRMLSADMKKEYEAGNYVLCGGDFNHDLKAAEDDDSTDRESWAYPFP
FT                   RNMLPEHFSFCMDQLPKKENLWNSSRNADMKYIPGKTYTVTLDGFIISDNVKCDMYKNI
FT                   NTGYSYSDHDPVYVKFELNKESVLNKFKLKN"
FT   CDS             complement(308657..308860)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37420"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXS5"
FT                   /protein_id="CBL37420.1"
FT                   /translation="MFKDHVEVPGLDKEKSKLDDLINQMRYFKDFIKKLNRMDVTSNQS
FT                   QHQIKNGEMLLANKIYLINQMY"
FT   CDS             complement(309360..309569)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37421"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXS6"
FT                   /protein_id="CBL37421.1"
FT                   /translation="MKSHKYWSIGALITMLGTFYTGYKGSKEGHKYFAASSLLCMIMAI
FT                   YTGHKMISGKSRKKKEVSVESVED"
FT   CDS             309919..310158
FT                   /transl_table=11
FT                   /locus_tag="CL2_03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37422"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXS7"
FT                   /protein_id="CBL37422.1"
FT                   /translation="MRTIFAEYNPKRNSIDVYTSVGYMLRIDCWEAEKNLKTTPGSDCA
FT                   LNALAIDEPLEYAKLYLDGNLQMWVDAEDSLDIF"
FT   gap             310350..310673
FT                   /estimated_length=324
FT   CDS             complement(311746..312633)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03370"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37423"
FT                   /db_xref="GOA:D4MXS8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXS8"
FT                   /protein_id="CBL37423.1"
FT                   /translation="MELKIEHLSKQFKDKTAVNDVNLTLTPGVWGLLGANGAGKTTLMR
FT                   MIADIMTPTNGAVYYDGKDIRELGEVYRSKFGFLPQDFGYHRDFTVKDYLEYMAALKDI
FT                   PTRATTQKINHLLDILSLSDVKKKKISNLSGGMKRRVGIAQAMLNDPEILVMDEPTAGL
FT                   DPGERVRLRNFISEFSHDRIVLISTHIVSDIEYISTRNAIMKAGEIVDVGTTAELVKRI
FT                   EGKVWNCIIPTSKLPECEMRLRIINQRGEDHNQVSIRYLSEHSEIDGAVTTEPRLEDLY
FT                   LWLFPQTDLEKEDR"
FT   CDS             complement(312774..313838)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03390"
FT                   /product="His Kinase A (phosphoacceptor) domain./Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37424"
FT                   /db_xref="GOA:D4MXS9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXS9"
FT                   /protein_id="CBL37424.1"
FT                   /translation="MSNKEMTTEKRLKVRLYLSLLVYTVVGYGLTLILDYIFSKFDNGI
FT                   FAWLYWRLDLLFILYLMLGFICIFNYYWKKPWGYLDEVIDATQTVYEQNNHTVSLSEPL
FT                   KELEEQLNQIKMSVLLSKQAAKQAEEKKNEIIMYLAHDIRTPLTTVIGYLSLLHEAPDM
FT                   PEQQKEKYVKVALNKAERLEKLINELFEITKYNAHTVIIKKETVDLHCLIAQVIDEIYP
FT                   TLSANGNTAVFTAEDNLSVNADPEKLARVFSNLLRNAASYSYPQTEITISAKRLEHDIQ
FT                   ITFENHGKTIPQEQLNSIFEKFNRLDDARLSNTGGAGLGLSIAEEIIHLHGGKITASSQ
FT                   NETIDFVITLPLSA"
FT   CDS             complement(313852..314361)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03400"
FT                   /product="Glycopeptide antibiotics resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37425"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXT0"
FT                   /protein_id="CBL37425.1"
FT                   /translation="MKRKSNCLATILFLIYLALLVWIILFKLQFSISDLDKVRSINLIP
FT                   FHYDKEVGAAFHLTEVLENFLIFVPMGIYLQMLLPRTKLYVKFMLIAGTSFLLETMQYI
FT                   LAVGRSDITDVLTNTAGGLLGLAVYSMAARLIGNRIKANRLFSILAGIVSVVVIGLLGF
FT                   LLFANR"
FT   CDS             complement(314378..315073)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03410"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37426"
FT                   /db_xref="GOA:D4MXT1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXT1"
FT                   /protein_id="CBL37426.1"
FT                   /translation="MSEKILIIDDEQDIADLLEVYLKNENYVVYKFYCATDAMSCIESG
FT                   DIDLAILDIMLPDMNGFSLCQLIRKKYTYPIIMLTAKIEETDKITGLTLGADDYVTKPF
FT                   RPLEVVARVKAQLRRYKKYSPGIITEKIPSELSYNKLCLNVQTHECLLDGEPVSLTPTE
FT                   FSILHVILSSAGNVVSIEELFHAVWKDEYYSKNSSTITVHIRHLREKLNDTSDTPQYIK
FT                   TIWGVGYKI"
FT   CDS             complement(315222..316085)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03420"
FT                   /product="Domain of unknown function (DUF1814)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37427"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXT2"
FT                   /protein_id="CBL37427.1"
FT                   /translation="MITTARQLKDLIRNMSKKKSADAQILMRNYMMERFLERISLSEYK
FT                   NQFILKGGMLVAAMVGLDARATMDLDATIKGTNVSVEDVEMIISQIISIPLDDGVSFRV
FT                   KRISEIMEEADYPGVRVSMETKFDGVITPLKIDISTGDVITPREIKYKFNLMLEDRTIE
FT                   VWAYNLETVLAEKLETVVSRNVTNTRMRDFYDIYILQKLYGEQLQKQVLWTALVATAKK
FT                   RGTLDLIEAEDIREIFDEIESSPVMETLWKTYQKNYSYAADISWHAIVKSICALYGSIL
FT                   ENMYDT"
FT   CDS             complement(316086..316679)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37428"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXT3"
FT                   /protein_id="CBL37428.1"
FT                   /translation="MTQFEKLDLLLRECGGTIQTFQVLNNGISKSVFYAYVKERGLEQA
FT                   AHGVYVSPDTWTDAMYLLHLRCGQAVFSHETALFFHDLTDREPLKYTITVRTGYNPSRL
FT                   QEDGFQVYTVKKDLHEIGIIAMQTSFGHSVPVYDMERTICDLLRSRKNVEMQVFQDALK
FT                   QYAKRKDKNLRMLMKYAAMFHVENILRPYLEVLL"
FT   CDS             complement(316768..317478)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37429"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXT4"
FT                   /protein_id="CBL37429.1"
FT                   /translation="MTEECQDKLRQAEQERDYALSHQKKVEIPVEKPVLYQKCGNCNLT
FT                   AYLKAKEKYDTQREKLAGRYKTKTAMYEALMFLLIWYSVSTTLFQMIRSKIFISDCVVF
FT                   FDTIATFIQTIAGWIILTGKNMAQISNGISNPVVAGIVYWLIRILICGGCLVGAGILVA
FT                   FIEIKIAELYKKCCWDMITIMVILISMATAIYFGKWIKTTLPINLLFLLLFVQLVYVGI
FT                   RWYVKGWRETRGYH"
FT   CDS             complement(317456..319177)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03450"
FT                   /product="plasmid mobilization system relaxase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37430"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXT5"
FT                   /protein_id="CBL37430.1"
FT                   /translation="MAIFHFTVKIVGRSKGKSIISASAYLNGDVMKNEETGRISYYTSK
FT                   KEVVYTSLIMCENAPPEWLHVPEENIKRFQQSIRYKRADDKEAVLEKFKITFQKQRLWN
FT                   EVLKIEKNADAQLGRSFEFSLPKEWSRQEQIDYTTEYIQKTFVDKGMCADWSIHDKGDG
FT                   NPHVHLLVTMRPFNPNHSWGNKEVKDWDFVRDTDGNIVVDESHPDWWQDKKNPDRHGIR
FT                   IPVLDENGVQKVGARNRKQWKRVLTDATGWNNPKNCELWRSEWARMCNQHLSVDNQIDH
FT                   RSYERQGKLKVPTIHEGPDARKIEEKYLTGQIWNGSWKVEENQMIKKQNALLQKVIETF
FT                   GKVSGALSIWKEWLNDIRRKQRSNSHDGSNDYTDRGTAEYHGRDASGNTGKGREADVLS
FT                   GEGRTIAAIRERIIRTASNLAGYRRTVDTSGRKDRPDTEAYRRKSAMAGIGTEIKQREP
FT                   AIAETEQRITELEQQLEKGRSIDERIKKLKERRSTGRVASADRADAGRTRPERQDYPGT
FT                   ENAARRIADLEREVKQREQSREHSSLKERLEENKRIVAERERENARCRNHDRGMSR"
FT   CDS             complement(319153..319458)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37431"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXT6"
FT                   /protein_id="CBL37431.1"
FT                   /translation="MAEGVGFPFPSLPLNEGRTYGQPEVVLISLPQVATGLRLRLPGSF
FT                   RRRAFHADLLMPQGALLCRGRSDSFTPAKSEEDAVGNQCRIRQKGGIVSWRYFTLQ"
FT   CDS             complement(319917..320147)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03480"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37432"
FT                   /db_xref="GOA:D4MXT7"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXT7"
FT                   /protein_id="CBL37432.1"
FT                   /translation="MTERKIALSIEEVADYTGIGRNTLRKLVEWKKLPVLKVGRKVLIK
FT                   TDILEKFMEANEGRDLRDKGNVKAVTRNVAT"
FT   CDS             320322..320951
FT                   /transl_table=11
FT                   /locus_tag="CL2_03490"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37433"
FT                   /db_xref="GOA:D4MXT8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXT8"
FT                   /protein_id="CBL37433.1"
FT                   /translation="MKDKELRKLIGSRAKQRRLELNLTQPYVAEKMGVTASTILRYENG
FT                   SIDNTKKMVLEGLSEALHVSIEWLRGETDEYETDITDKKELQIRDAMGDILKQLPLDLS
FT                   KKEDAFSKDLLLLMLKQYNLFLESFQFACKNYKGNTNEADIAKVMGFESNDEYNEIMFL
FT                   REITHTVNAFNDMADIVRLYSKKPEMAEQRLENLLSEVLYEDSDSV"
FT   CDS             321038..322333
FT                   /transl_table=11
FT                   /locus_tag="CL2_03500"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37434"
FT                   /db_xref="GOA:D4MXT9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXT9"
FT                   /protein_id="CBL37434.1"
FT                   /translation="MAKGSVRKKGKKWYYRFYVEDASGNLVQKEYAGTESKSETEKLLR
FT                   QAMDDYESKKFIAKSENITVGELLDIWAEEELKTGTLSNGTVQNYLGAITNIKKHPISE
FT                   RKLKNVTSEHLQAFFDLLSFGGTYPDGSERKGYSKDYIRSFSAVLQQSFRFAVSPKQYI
FT                   TFNPMQYIKLKYQTDEVDLFSDDDMDGDIQPIPREDYERLIEFLQDYNPPAILPIQIAY
FT                   YAGLRIGEACGLAWQDVNLEEQCLTIRRSIRYDGSRHKNIIGPTKRKKVRIVDFGDTLA
FT                   EILRNARKEQLKNRMQYGELYHKNYYREVKDKNRVYYEFYHLDGTENVPEDYKEISFVC
FT                   LRPDGSLELPSTLGIVCRKIAQKLDGFEGFHFHQLRHTYTSNLLANGAAPKDVQELLGH
FT                   SDVSTTMNVYAHSTRKAKRESARLLDKVAGND"
FT   CDS             complement(322492..322908)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03510"
FT                   /product="Protein of unknown function (DUF2992)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37435"
FT                   /db_xref="InterPro:IPR016787"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXU0"
FT                   /protein_id="CBL37435.1"
FT                   /translation="MDKASGKLTVYFEEPFWVGVFERIEDGKLSVAKVTFGAEPKDYEV
FT                   QEYIQKYYFSLKFSPAVDTVVKDIKRNPKRMQREAKKQMQETGIGTKSQQALKLQQEQN
FT                   KQERKVRSREKKEADELRMFELKQQKKREKHRGH"
FT   CDS             complement(323966..324151)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37436"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXU1"
FT                   /protein_id="CBL37436.1"
FT                   /translation="MAKKEERFEVTFRDGSQLKDEGVRQILVDKETGVNYLCWKSGYGA
FT                   AITPLLDSEGKVIVIK"
FT   CDS             complement(324214..324543)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03540"
FT                   /product="DNA alkylation repair enzyme."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37437"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXU2"
FT                   /protein_id="CBL37437.1"
FT                   /translation="MVLKRKKKELYPIIDEWLENDNPNTRRAVTEGLRIWTSRPYFKDN
FT                   PNEAIRRIVALKEDPSQYVRKSVGNALRDISKKFPELIKDELNNWKLESKEINQIYKLA
FT                   SKLIN"
FT   CDS             324908..325147
FT                   /transl_table=11
FT                   /locus_tag="CL2_03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37438"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXU3"
FT                   /protein_id="CBL37438.1"
FT                   /translation="MRTIFAEYNPKRNSIDVYTYVGYMLRIDCWEAEKDLKTTSGSDCA
FT                   LNALAIDDPLEYARLYLDGNLQMWVDAEDSLDIF"
FT   gap             325313..325715
FT                   /estimated_length=403
FT   CDS             complement(326004..326303)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03560"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37439"
FT                   /db_xref="GOA:D4MXU4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXU4"
FT                   /protein_id="CBL37439.1"
FT                   /translation="MNAMDVALICKALGDANRLEIVQMLSDGEKCGCKLLERFEITQPT
FT                   LSHHMKILVGCGLVNDRKEGKWHHYSLNCETLMNYKHFIESLTCLGCGDGDCCK"
FT   CDS             complement(327111..328655)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03580"
FT                   /product="Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37440"
FT                   /db_xref="GOA:D4MXU5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXU5"
FT                   /protein_id="CBL37440.1"
FT                   /translation="MSKTIIIIGAGLAGLSAALQAAENGCNVKLVSSLPSERAQSVMAE
FT                   GGINAALNTKDENDSPEEHFTDTIKAACGLADPNAVWGMTQAAPELVHWLLKLGVKFNM
FT                   SGYDDVDLRNFGGQKKKRTAFAQSDTGKQIMTAMIDAVRRKEASGMVERFSHHSFLTLR
FT                   LCGNICCGCVIRDEYSQETVELPGDAVIVATGGMHGLFGNTTGSLSNTGEVTAELFRLG
FT                   VPLANGEMIQYHPTTVKCGGKRMLISEAARGEGGRLFAMKDGKQWYFMEEKYPELGNLM
FT                   PRDITAREIWKVSHESEVFLDMTEISEEIISNKLSGLADDCMTYLHKDIRKEPVSVLPG
FT                   IHYFMGGILVDEQHRTPIQNLYAAGECCAQYHGANRLGGNSLLGALYGGRVAAKSACEQ
FT                   ADVVDLSCATQIDFPPASQISEIKQLNKVMQDTMGVVRNENTLLNGIQTVQALTGNLPL
FT                   LGMAVLKSALARKESRGAHWREDYPKNNDDDYLKTTVARFDGKQIQISFVPVPERR"
FT   CDS             complement(328652..329191)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37441"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXU6"
FT                   /protein_id="CBL37441.1"
FT                   /translation="MRKWNTILSVLMLLIFMIHGIMGSFMLNGVGSSAGKLLAWIGVGI
FT                   LVVHTVMGTVLTVQSLRAAKQSGKMYLKQNAIFWARRASGLAILILLFFHIGLFGKVQN
FT                   GTYILFPFTTVKMVTQLLFVAAIFVHIFINIRPLLVSLGIISYKERRSDIYLILSVLLL
FT                   FIAGAVILYYIGWQYL"
FT   CDS             complement(329737..332091)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03610"
FT                   /product="heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type
FT                   ATPase"
FT                   /EC_number="3.6.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37442"
FT                   /db_xref="GOA:D4MXU7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXU7"
FT                   /protein_id="CBL37442.1"
FT                   /translation="MKRIFLLKGLDCPNCSAKIEKEVGELDGVQSSVVNLMKQTLTINV
FT                   TQTAADTIASQIETIVYSHEPDVEVQEETVMNVTKSYSLKGLDCPNCSAKIEKEVGELD
FT                   GVQSSVVNLMKQTLTINVAQTAADTIASQIETIVHGHEPDVEVSEIVQESYIPEKKQEA
FT                   NESYNNEDKKLTVRLATGAAIYAIGMALTVFAKVPLPIELAFLIVSYVILGGDVVWQAV
FT                   RNISKGRVFDEHFLMSVSTIGAFVIGEYPEAVAVMLFYQVGEFFQSLAVKRSRKSISDL
FT                   MDIRPDSATVRRNGELITISPENVSIGEIIIVKPGEKIPLDGVVLDGDSMLDTRALTGE
FT                   SVPRSVHKGDEALSGCMNQTGVLMIKTTKAFGESTASKIIDLVENASSRKAPTENFITT
FT                   FARYYTPVVVILAAFLAILPPIILGGGWTEWIRRGFVFLVVSCPCALVISIPLTFFGGI
FT                   GAASKRGVLVKGSNYLEALNNVSVIVFDKTGTLTKGVFNVTDILPANGFSKEQVLEYAA
FT                   EAESFSNHPIAKSILAAYEKEIDQSVISDYKEISGYGISVMAGEKKVFAGNTKLMDTEC
FT                   IEYTTCEKAGTKVYLAVDGQYAGCILITDEVKPDSKKAISDLKHIGVEKTVMLTGDDEK
FT                   IGKSVAEELQLDEYYAQLLPDQKVEKVELLDGKKRPGSKLAFVGDGINDAPVLARADVG
FT                   IAMGGLGSDAAIEAADVVLMTDEPSKLVDAIEVAKATKQIVMQNIVIALGIKSVFLILG
FT                   ALGIAGMWEAVFGDVGVTIIAVLNAMRILKK"
FT   CDS             complement(332151..332510)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03620"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37443"
FT                   /db_xref="GOA:D4MXU8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXU8"
FT                   /protein_id="CBL37443.1"
FT                   /translation="MPKTSYICNCNVIHEDIVNDVKSKMQPKDDYIQLASLFKLFGDGT
FT                   RVQILHALEQSEMCVCDLAVLLGVTKSAISHQLKALRLANLVKFRKEAQIVYYSLADDH
FT                   VKEIIDKGFEHLWQK"
FT   CDS             complement(332925..333035)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37444"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXU9"
FT                   /protein_id="CBL37444.1"
FT                   /translation="MIRDKKEMLNFEEVDKIETFFGLNKGMILGRELIES"
FT   CDS             complement(333499..333969)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03640"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37445"
FT                   /db_xref="GOA:D4MXV0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXV0"
FT                   /protein_id="CBL37445.1"
FT                   /translation="MDINSLAHTKWNCKYHIVFAPKYRRKVAYGKMKQDIANILSMLCK
FT                   RKGVEIVEAEICPDHVHMLVKIPPSLSVSSFVGHLKGKSTLMIFERHANLKYKYGNRHF
FT                   WCRGYYVDTVGKNAKKIQEYIQNQLQNDLEYDQMTLKEYIDPFTGEPVNPNK"
FT   CDS             334603..335841
FT                   /transl_table=11
FT                   /locus_tag="CL2_03650"
FT                   /product="Phage integrase family."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37446"
FT                   /db_xref="GOA:D4MXV1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXV1"
FT                   /protein_id="CBL37446.1"
FT                   /translation="MLIKCPECNLQVSNHAIACPHCGYPLQTTTAKKQRTKQRRRKKLP
FT                   NGFGQISEIKTGNLYKPFRAMITVGKDFYGRPIRKLLKPVAFFKTYNEAYAALVEYNKN
FT                   PYDLDDDLTVEELYEKWTKEYFKTLTSHSSERTIKSAWNYCSSIYKMRAKDLRPRHIKG
FT                   CMEEGTYEVDGKEKHPSPTTKTKIKSLFNLMLDYANENDIVAKNYARTFKLSDDIMKDV
FT                   EEEKKDHIDFTDEEMKKLWNNLYDVDYVDVLLIQCYSGWRPQELGLLKMENVDLENWFI
FT                   TGGMKTDAGKNRVVPIHPKIRSLVKYRYQEAQKLGSEYLINCTDTKTHRSSLKLTYDKY
FT                   RHRIDKIVNKLELNPEHRAHDGRIQFATMAKAAEVNEYAIKRIMGHKIKDITENTYTKR
FT                   KREWLMEEILKIK"
FT   CDS             complement(336002..337012)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37447"
FT                   /db_xref="InterPro:IPR025964"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXV2"
FT                   /protein_id="CBL37447.1"
FT                   /translation="MALFESYERREKQILAVLKEYGINSIEEAGEITKAAGLDVYAQVE
FT                   GIQPICFENAKWAYTVGAAIAIKKGCKRAADAAAAIGEGLQAFCIPGSVADQRKVGLGH
FT                   GNLGKMLLEEETECFAFLAGHESFAAAEGAIGIAEKANKVRQKPLRVILNGLGKDAAQI
FT                   ISRINGFTYVETEMDYYTGEVKEVFRKSYSEGLRAKVNCYGANDVTEGVAIMHKEGVDV
FT                   SITGNSTNPTRFQHPVAGTYKKECIEQGKKYFSVASGGGTGRTLHPDNMAAGPASYGMT
FT                   DTMGRMHSDAQFAGSSSVPAHVEMMGLIGMGNNPMVGATVAVAVSIEEAAKAGKF"
FT   CDS             complement(337026..337718)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37448"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXV3"
FT                   /protein_id="CBL37448.1"
FT                   /translation="MIYSHEVEQMCTVAQGVNHGAAPIPEEAKWVKAKDVTDISGLTHG
FT                   IGWCAPQQGGCKLTLNVKEGIIQEALVETIGCSGMTHSAAMASEILPGRTILEALNTDL
FT                   VCDAINTAMRELFLQIVYGRTQSAFSEEGLPIGAGLEDLGKGLRSQVGTMYGTLKKGPR
FT                   YLEMAEGYVTGIALDADDEIIGYQFVNFGRMMDFIKAGDDAQTALDKAKGQYGRVDDAV
FT                   KIIDPRKE"
FT   CDS             338008..339291
FT                   /transl_table=11
FT                   /locus_tag="CL2_03680"
FT                   /product="O-acetylhomoserine sulfhydrolase"
FT                   /EC_number="2.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37449"
FT                   /db_xref="GOA:D4MXV4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXV4"
FT                   /protein_id="CBL37449.1"
FT                   /translation="MSHYDLETKCLHSGYTPKKGEPCALPIYQSTTFKYDTTDEMGQLF
FT                   DLKAEGYFYTRLQNPTNDAVAAKIADLEGGVAGLLTSSGQAANFYAIFNICEAGDHVVA
FT                   ASTIYGGTFNLLGVTLKKLGIDCTFVDTDASAEEIAAAFKPNTKVLFAETIANPALVIL
FT                   DIEKFAKVAHEHEVPLIVDNTFATPINCRPFEWGADIVTHSTTKYMDGHAVQVGGAIID
FT                   SGNFDWDAYGHKYHGLTEPDESYHGVVYTKQFGKKAYITKATTQLMRDLGSIPSPENCF
FT                   LLNLGLETLPLRVERHCENAQKVAEFLDAHEKVSHVIYAGLPDDKYHELAQKYMDEGRT
FT                   CGVISFELTGGRDAAVRFMDSLKLANIATHVAASKTMVLHPASHTHRQMNDEQLREAGV
FT                   SPGMIRLSVGIESAKDIINDLKEALENA"
FT   CDS             complement(339447..340175)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03690"
FT                   /product="conserved hypothetical protein TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37450"
FT                   /db_xref="GOA:D4MXV5"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026563"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXV5"
FT                   /protein_id="CBL37450.1"
FT                   /translation="MSGHSKFANIKHKKEKNDAKKGKIFTVIGREIAVAVKEGGPDPDN
FT                   NSRLRDVIAKAKANNMPNDTIERGIKKAAGDADSVNYEQITYEGYGPSGVAIIVDTLTD
FT                   NKNRTASNVRNAFTKGNGNVGTPGCVSYMFEKKGQIIISKEECEMDADDLMMMALDAGA
FT                   EDFNEEDDSFEVLTTPEDFSAVREALEKEEIPMADASVTMIPGTMVELTSEEDIKSIQK
FT                   TLDLLDEDDDVQEVYTNWDE"
FT   CDS             complement(340159..341109)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03700"
FT                   /product="Hemolysins and related proteins containing CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37451"
FT                   /db_xref="GOA:D4MXV6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXV6"
FT                   /protein_id="CBL37451.1"
FT                   /translation="MEGFTPSVLMMIILAVIIGFAVGCFFMKQREKIKEAKKKLHTSEQ
FT                   EHEEDEDNEYEEEIMNIVNEGHEQGAIMEGEARMITNIFEFGDKDVTDVMTSRKKIDAI
FT                   DVNMSVEKALNYMLDEPYSRYPLYEDDIDNIVGVLYLKDVIDAYLNQKEATLSDIAREP
FT                   FFVHQTMNLSVLFQEMQTKKIHMAIVIDEYSQTEGIVSMEDMLEVIVGNILDEYDVEDR
FT                   NITKIGWADIYLVRGSTRLEELEDTLGIEFDVEDIETLNGFLIDQLGHLPEDNEEIEII
FT                   YQGYSFKSVDIHDNMIRQVKVEKRKRKEEEDVRTQ"
FT   CDS             complement(341207..341560)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03710"
FT                   /product="Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37452"
FT                   /db_xref="GOA:D4MXV7"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXV7"
FT                   /protein_id="CBL37452.1"
FT                   /translation="MLMVIKRGDIFYADLRPVVGSEQGGIRPVIVLQNDAGNKYSPTII
FT                   CAAITSKMNKAKLPTHVPIDCHRCELEKDSVILLEQIRTIDKSRLREKVCHLNCTFLKQ
FT                   VDHALKISLSLDT"
FT   CDS             complement(341626..342789)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03720"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37453"
FT                   /db_xref="GOA:D4MXV8"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXV8"
FT                   /protein_id="CBL37453.1"
FT                   /translation="MNQYYRVHAVIDLDAICHNIREVKRVVGEGVKVMPVIKADGYGHG
FT                   AVPIAKELNKIGVDAFAVAILEEGITLRNNGIRQPILILGYTSEYQYSSLIQYEIEPTV
FT                   FCYEMAESLSKIAQALGKDAKIHIKLDTGMNRIGFKPTKESVDIIEKIAKLPNIKIQGI
FT                   FTHFACADEADKTETYEQERKYDQFITWLEERDIYIPIKHVSNSASIIDLDGFRKDMVR
FT                   SGIITYGLYPSEEVSKDVLDLRPAMELKTHIVYIKEVEAGEGISYNHTYVTDKKTKIAT
FT                   IPVGYADGYPRSLSSKGKVLIRGQYAPIIGRICMDQFMVDVTDVEGVSVMDEVTLVGHD
FT                   GNKMLTVEEVANEAGSFNYEFVCGIGKRVPRVYIRNGEMKETEYFEK"
FT   CDS             complement(342773..344254)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03730"
FT                   /product="yjeF C-terminal region, hydroxyethylthiazole
FT                   kinase-related/yjeF N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37454"
FT                   /db_xref="GOA:D4MXV9"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXV9"
FT                   /protein_id="CBL37454.1"
FT                   /translation="MRYVLKNQEMQTVDHETIHGIGIPGLVLMERASKAVADKAAQIAD
FT                   HSQRILIISGIGNNGGDALACTRILLEQDYLVDYMIVGNIEKASADLKLQLQILKNLGY
FT                   FPIDCEDVNFHEYDLLIEGIFGVGLSREVGGVYKEVIERINACGKPVIAIDIPSGISGD
FT                   SGKILGCAVHASSTVTFGGYKRGHLLYPGREYCGDIKLVSIGFHNQTIKKYATGYILEE
FT                   SDHLMPERKAYSNKGSYGKILIIAGNETMSGAACFAAEAALRMGAGLVKVLSDAGNRQI
FT                   LQTRLPEILFGERKDLEESLEWCDCILFGPGVGVSEEMKEMLEMVLKKGKKPLVIDADG
FT                   LNIISRFNMKIDYPYGTIMTPHLMEAARLMSCDITQIKEDLCQSAQDLAEKYHCTAVLK
FT                   DATTIVAREDDLVYINQSGNDGMATGGSGDVLAGMITGLLGEGLSVHEAAVHGVYLHGL
FT                   AGDHAKHDLGAYSMIASDIIAHIKDVTGGNYEPVL"
FT   CDS             complement(344251..344613)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03740"
FT                   /product="phosphopantethiene--protein transferase domain"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37455"
FT                   /db_xref="GOA:D4MXW0"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXW0"
FT                   /protein_id="CBL37455.1"
FT                   /translation="MIAGIGTDLVEIYRIEEMILRGRHLSRIFTTTELAYAKDNATTLA
FT                   GNFAVKEAVSKVFGTGFFGVEPYEIEVLRNESGAPYVKLYGKAKEIAKDKQVSRIHVSI
FT                   TNTREFAQAFAIGECV"
FT   CDS             complement(344625..345278)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03750"
FT                   /product="AT-rich DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37456"
FT                   /db_xref="GOA:D4MXW1"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXW1"
FT                   /protein_id="CBL37456.1"
FT                   /translation="MANSDKNISSAVIKRLPRYFRYLGALKAKNITRISSKELSEQMMV
FT                   TASQIRQDLNNFGGFGQQGYGYNVDNLYTEIGKILGLDKRNDMIIVGAGNLGQALANYQ
FT                   SFNEDYGYKVMALFDVNPKLIGISVRGVKVLDTDELENFIKTHGIKIAALTIPKDQAPA
FT                   IAKKMAEWGIKGFWNFAPIDLHLPDNVTVENVHLAESLMTLTYNVHNREESENE"
FT   CDS             345431..347332
FT                   /transl_table=11
FT                   /locus_tag="CL2_03760"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37457"
FT                   /db_xref="GOA:D4MXW2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXW2"
FT                   /protein_id="CBL37457.1"
FT                   /translation="MILSCQNICKTFVEKPVLQNISFHLNENDRLAIIGYNGAGKSTLL
FT                   KILIGEISYDEGEISLKKDASIGYLAQHQDHTFHHTIFDELLSVKKEVIELDEQMRTYE
FT                   QEMKHLTGDALEQKMNQYTNATHRFEQLNGFAYKSEITGILKGLGFSEEDFTKEINTLS
FT                   GGQRTRVALGKLLLKNPDILLLDEPTNHLDVDSIRWLENYLSHYKGAVIIVSHDRYFLD
FT                   KIVNKVMEIDQGHSMLFDGNYTTFIEKRDQIKAIRLKEYKNQQQEIKHQQEVIKKLKQF
FT                   NREKSIKRAESREKALNKIDVLEKPTEYNADMRLSIEPEIISGNDVLTLKDVSKSFGNK
FT                   SLFHGLSADIFREERVALIGPNGTGKTTLLKIICKKISNNGGTISLGAGVSIGYYDQAQ
FT                   DNLDDSKTIFDEISDAYPDLNNTKIRNTLAAFLFYGEDVFRPISSLSGGEKGRVSLAKL
FT                   MLSHANFLILDEPTNHLDIQSKEILESAMNAYTGTILYVSHDRYFINKTATRILEISDH
FT                   GLTSYPGNYQDYIAQKEKEKASLTSSTASSVSVDTESKLDWKQQKEEQAKQRKKENRLK
FT                   KVEEQITELETKQEELSEAMSLPENASDPAKLMELSNEQASIASSLEELYEEWETLC"
FT   CDS             347391..348407
FT                   /transl_table=11
FT                   /locus_tag="CL2_03770"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37458"
FT                   /db_xref="GOA:D4MXW3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXW3"
FT                   /protein_id="CBL37458.1"
FT                   /translation="MKLISFVVPCYNSQEYMRHCIDTLLPGGDQVEILIVNDGSSDNTA
FT                   AIADEYEKKYPDICRAIHQENKGHGGAVNTGIKNATGIYLKVVDSDDWVNEYAYGEILD
FT                   TLANFYKQGTVLDMLLSNYVYEKQGAKKKTVIHYRHAIPKDQIFCWDDVGRFPVSQYIL
FT                   MHSVIYRTALLRECDLELPEHTFYVDNIYVFKPLPYVKTMYYLDVNFYRYFIGRDDQSV
FT                   NETNMIKRIDQQFKVTYIMIDYMTQFNLVSKPLERYMRHYLSIIMCISSVISVKSGQKE
FT                   HLKMRKELWKYLYDSDKRLYRKIRHNITSCAVNLPGYVGRKATIAMYKAARRFIGFN"
FT   CDS             348509..349408
FT                   /transl_table=11
FT                   /locus_tag="CL2_03780"
FT                   /product="Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37459"
FT                   /db_xref="GOA:D4MXW4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXW4"
FT                   /protein_id="CBL37459.1"
FT                   /translation="MQISVSKQIHADLAHQHGFLGEGIGIAYLDTGLFPHKDFSPHSTR
FT                   IAKFVDFVHSKSFSYDDNGHGTHITGIAASSATFGSDYLGIAPKSHIVSLKVLDASGNG
FT                   VQSAFLQGLDWIHEYHRSYQIRIVNISIGSPGSEDSSASKELLKHVNALWDDGLVVCIA
FT                   GGNHGPKPYSISIPGNSPKIITVGSSDDNFQMIGRKHFSSGYSGRGPTTSCVMKPDVVA
FT                   PGTNIFSCSLNNRYTIKSGTSMATPVVSGSFALLLEKYPFYTNKDIKMKLRKNCDKLKT
FT                   PRHHQGWGQINLKKLMDL"
FT   CDS             complement(349422..350570)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03790"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37460"
FT                   /db_xref="GOA:D4MXW5"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXW5"
FT                   /protein_id="CBL37460.1"
FT                   /translation="MKTNTIELYIHIPFCKSKCKYCDFCSFRAEEETIHAYLGKLKEEL
FT                   IFWGKKLAARDVVTVFIGGGTPSYLRREDIQMICETIFEHFHICEDAEITIEANPGTVD
FT                   LKKLCTYRENGINRISFGLQSTVKEELEYLGRIHTYEEFLQSFDWARQAGFLNINVDLM
FT                   SAVPKQTLTSYEENLRKIAKLSPEHISAYSLIIEEGTPFYEDNKLEELLPSEEDEVLMY
FT                   RMTEKILNEYGYDKYEISNYAKPGFESRHNLGYWSHIPYLGVGLNASSYLDEKRFENPS
FT                   DMKDYLEIQSFGDAYEGARSLSVYEQMEEFMFLGLRKTKGISKKEFIERFGCSMDSVYG
FT                   KPLIESMKQGMMKEQGDRVFLTQDGTLVSNQVLCEFLFDEEV"
FT   CDS             complement(350560..352371)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03800"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37461"
FT                   /db_xref="GOA:D4MXW6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXW6"
FT                   /protein_id="CBL37461.1"
FT                   /translation="MAIDQSKIRNFCIIAHIDHGKSTLADRIIQMTGTLTDREMQEQVL
FT                   DNMDLERERGITIKSQAVRIVYKADDGEEYIFNLIDTPGHVDFNYEVSRSLAACEGAIL
FT                   VVDAAQGIEAQTLANVYLAIDHDLEVMPVINKIDLPSADPERVKAEIEDVIGIDAEDAP
FT                   QISAKSGLNVEQVLKQIVEKIPSPEGDKNAPLQGLIFDSMYDAYKGVIIFTRIKEGTIK
FT                   VGTKMKMMATGESAEVVEVGTFGAGRFNPCDELTAGMVGYVTASLKNVQGTRVGDTITD
FT                   ADDPCAEPLPGYKKVNPMVYCGLYPTDGAKYPDLRDALEKLQLNDAALQFEAETSVALG
FT                   FGFRCGFLGLLHLEIIQERLEREYNLDLVTTAPGVIYRVYKTDGSMIELTNPSNLPDPS
FT                   EIDHMEEPIVTAEIMVTSEFVGAIMGLCQERRGVYLGMEYMEETRALLRYELPLNEIIY
FT                   DFFDALKSRSRGYASLDYEMKGYQTSRLVKLDILINKEEVDALSFIVHEDTAYERGRKM
FT                   CTKLKEEIPRHMFEVPIQAAIGSKVIARETVKAMRKDVLAKCYGGDISRKRKLLEKQKK
FT                   GKKRMRQVGNVEIPQEAFMSVLKLDED"
FT   CDS             complement(352424..353497)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03810"
FT                   /product="stage II sporulation protein P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37462"
FT                   /db_xref="InterPro:IPR010897"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXW7"
FT                   /protein_id="CBL37462.1"
FT                   /translation="MIGCFLIIFFSQKINAQGMVLEFMDHYYHGIMTGFFPAVSKKEMT
FT                   FSGNILSDMVRMYYQETVPILQYRTDYKDKKEEDLVQQDYYFQDDETTDEVVEEVKKEE
FT                   KLFHAKKWENSKYLRKYIYQIDSTTMATENELNGKVLLNTNLKLRKSDEPQILIYHTHG
FT                   SEAYRGSRKGRKSDTVIGVGDVLTKRLEQKNIKVVHDRNIYDVKNGKEERSKAYNYAAT
FT                   AIEKNLKKYPSIQVVIDLHRDGVNESTKLVTRQNGKRMAQIMFFNGMSRTATNGNIKYL
FT                   KNPNKQTNLAFSLQLQAQAALKYPGFTRKIYVKGYRYNLHYRGRSLLVEVGAQNNTLSE
FT                   AKASMSLLAELLNNVLY"
FT   CDS             complement(353555..354400)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03820"
FT                   /product="Germination protease."
FT                   /EC_number="3.4.24.78"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37463"
FT                   /db_xref="GOA:D4MXW8"
FT                   /db_xref="InterPro:IPR005080"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXW8"
FT                   /protein_id="CBL37463.1"
FT                   /translation="MQNRTDLALELKEEKNIGSAQSGIIVKTRIDTTNHIKETKIIIKN
FT                   KKGEDSLGKPKGTYITIEAKDLSTNDGSFHKEMSEALFLNLKEMLNKKKKILIAGLGNA
FT                   DVTADSLGPKVVNNLYITRHLQKEGIGNYQFELSAIAPGVMAQTGIETSEILESLADRI
FT                   KPDVVIVIDALAARSYSRLNKTIQISDTGIAPGSGVGNHRNEITQHTIGVPVLAIGVPT
FT                   VISVPAIIHDVFGEKSLENVSENIDEEFISMHVTPKNIDESMKRISYTISEGINHLLHN
FT                   "
FT   CDS             complement(356016..358205)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03850"
FT                   /product="DNA internalization-related competence protein
FT                   ComEC/Rec2"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37464"
FT                   /db_xref="GOA:D4MXW9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXW9"
FT                   /protein_id="CBL37464.1"
FT                   /translation="MKQRPMVLIFAGVLSGTAVVWNIMSMTAAFYLLTGICLLASLIFS
FT                   DRRYGWVVVGILAGILLSLGFKTSMKLDLIQVKEKATEYTMGRVLEVSKTKKGKLAVLL
FT                   KNKNLEGKILLYTPEDEKIIPGDILRFQGELEEWEDAANPGQFSSRHYYFSKGIYYHVY
FT                   SKNIEIEGHQNIYFQEKILQCREYMKHQLEIQYKNEVSDFLKGMLIGDKNGLSDEVKDD
FT                   FKESGLIHLLAVSGLHISLAGRRVYKLVRKWCGNFVVGSLAGMTGAVFYCILTGGSGSS
FT                   LRAVMMLGVYFLSEILGEHYDMMSAGAFAGIVLLIMCPYRIYDTGFLYSFTAVFVIAIY
FT                   QLVKPKMKGKYYKLKESLSFCIFIQIGMLPLIIYFQYEAPAFSFLANVAAVPLATCAFT
FT                   LAFLLIFLPYTVFHEAISWMIQGVLWISRQSYGMLTIGHVPFLWVLLFYFMTGLWIWKK
FT                   NGQNRHIRISLAYVIMIILIWIPMARRKSLAFLDVGQGDCFVADTKSGAIIFDGGSSSE
FT                   DQVGRYRILPYMKYLGYQKIQIAVISHMDIDHYSGIKELLEMGKIKYLGLPEIPKDETM
FT                   KKIIGIAKKRGTTIFYLSRGRQITTKDGSLKVLHPQKNSQMEKNAASLVMQGKILGYRV
FT                   LLTGDVEKEGEEELLSEELERADILKAAHHGSKNSTSNEFLQKVQPKQTVISCGKQNRY
FT                   GHPHLETIHRLQTYRTKIYRTDRSGAIIFFKRRDG"
FT   CDS             complement(358209..358727)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03860"
FT                   /product="Sporulation and spore germination."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37465"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXX0"
FT                   /protein_id="CBL37465.1"
FT                   /translation="MKKRKLCMIFLLCLALMTLVAGCRSKKETNDQGNQKGTAIYYTNN
FT                   DVTKLIMKKENVELEGNQQQKVKILLKKLQQTPKSDKIRSVIPKRIMINGVSVNTNIVE
FT                   IDFSTGYKRISENRDLICRAGIVYTLTQLKDINYVSFSISGEPMLDTDGTAIGALGRDS
FT                   FVFGKLPMK"
FT   CDS             complement(360166..360855)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03880"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37466"
FT                   /db_xref="GOA:D4MXX1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXX1"
FT                   /protein_id="CBL37466.1"
FT                   /translation="MRKVLVVDDEKLIVKGIKFSLEQDEMQVDCAYDGEEALEKAKENQ
FT                   YDIILLDVMLPGLTGFEVCQAIREFSSVPIIMLTAKGEDMDKILGLEYGADDYITKPFN
FT                   ILEVKARIKAILRRSAHHDVKEEESAKVVECRGLKIDCESRRVHIHGKEVNLTAKEFDL
FT                   LELLVFHPNKVYSREDLLNTVWGYDYPGDARTVDVHIRRLREKIEVNPGVPDYVHTKWG
FT                   VGYYFQS"
FT   CDS             complement(360872..361438)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03890"
FT                   /product="competence protein ComEA helix-hairpin-helix
FT                   repeat region"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37467"
FT                   /db_xref="GOA:D4MXX2"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXX2"
FT                   /protein_id="CBL37467.1"
FT                   /translation="MLFRRVKVITILLMVFMMSIGCSRRKEVSIEPKKETKTTAEKSSS
FT                   KETIYVYVCGEVKHPGVYRFSKDERIVSAVKAAGGLTKKASAESINQAEKMKDGQQITI
FT                   PSKKQTAKNEGSDSKAVQSSSGKININTAGVKELMTLSGIGEAKASDIISYREEHGPFS
FT                   DISDIMKIQGIKEGIYHKIKDKITI"
FT   CDS             complement(361525..362028)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03900"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37468"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXX3"
FT                   /protein_id="CBL37468.1"
FT                   /translation="MYKKDLYGKTIRKKIVFHGGFYMFGLIIALISGALMSIQGVFNTE
FT                   VTKQSSTWTTSTFVQATGFLACLLIWLIAERDQSFTMLLKVSPRYLLLGGVIGAAITFT
FT                   VIKSVASLGPAQSAMLIVASQSVVSYLIEVFGLFGVEKTAFAWVKLLGVVLFVTGLIIF
FT                   KWKS"
FT   CDS             complement(362030..363223)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03910"
FT                   /product="acetylornithine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37469"
FT                   /db_xref="GOA:D4MXX4"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXX4"
FT                   /protein_id="CBL37469.1"
FT                   /translation="MKTQQEYIEQGEQYILKTYNRFPVVLEKGEGVYLYDADQKKYLDF
FT                   GAGIAVFALGYGNEAYNQALKDQIDKLIHTSNLYYNIPAVEAAKKIVDASGLKKVFFTN
FT                   SGTEAIEGALKVARKYAYNKDDSKDYEFIAMNHSFHGRSQGALSVTGNSHYQDGFVPKE
FT                   FRAVFAEFNNLEDVVSKITDKTCGIICEVVQGEGGIFPADKEFLEGLRKVCDEKDILLI
FT                   FDEIQCGMGRCGSLFAHDLYGVKPDVLTLAKALGCGVPVGAFVVGEKADGALVPGDHGT
FT                   TYGGNPFAAAAINAVFDQFEKLQVPEHAKEIGTYLWDKLEELKEKHDCITGHRGIALMQ
FT                   GLEFNADHPVGDIVKKALEKGLIIISAGNNVIRFVPPLVIEKEHVDEMISILEDCIA"
FT   CDS             complement(363225..364166)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03920"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37470"
FT                   /db_xref="GOA:D4MXX5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXX5"
FT                   /protein_id="CBL37470.1"
FT                   /translation="MEQMRNEINELIEQSKQKAKVLTEALPYIRRFNNCYVVVKYGGSA
FT                   MKDKNLQKSVIRDVALLKLVGMKPIIVHGGGKEISKWVRMSGKEPEFYHGLRVTDKETM
FT                   EVAEMVLFKVNQELVAMMAEVGVKAVGLSGKDAEMIRVKKKEMPGKDLGYVGEVKSVDT
FT                   TLLEALIEDDFVPVISPIGLGDNYEPYNINADDTACAVAEALNAEKLVFLTDIEGVFVD
FT                   PEDKSTLISEMDLKQAKEFIDNGVVGGGMLPKLKNCIEAIEGGVSRVHILDGRLTNCLL
FT                   LEFFTEKGIGTAILKEPLFDKPLFNEEDEEGC"
FT   CDS             complement(364237..365463)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03930"
FT                   /product="glutamate N-acetyltransferase/amino-acid
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.35"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37471"
FT                   /db_xref="GOA:D4MXX6"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXX6"
FT                   /protein_id="CBL37471.1"
FT                   /translation="MKIINAGVTAPKGFKCAGLRAGVKSGKTNKDMAMIVSEVPAKIAG
FT                   TFTKNIVKAAPVLWGKKIVEEQEAVRAVVINTGIANACTGAQGYENVVTEAKEVAKLLD
FT                   IKPEEVVVGSTGVIGQQLPMDVIKEGIKKLVPELKADRQSEEDASWAILTTDTKPKEAA
FT                   VEVEINGKTVTIAGMCKGSGMIHPNMGTMLGFITTDAAIDKALLLELQRELIEDTFNMV
FT                   SVDGDTSTNDTVFVFANGMAENKEITEKDADYEAFREGLLYVNQSLAKQIAGDGEGCTR
FT                   LFEVHVAGADSKENAKILSKSVVTSSLTKAAIYGKDANWGRILCALGYAGVDFDPVKVD
FT                   ISLKSADGVIEIVKDGIATDYSEDEATKVLSADAVTADIDVHNGVFEATAWGCDLTHDY
FT                   VTINADYRS"
FT   CDS             complement(365490..366530)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03940"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase,
FT                   common form"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37472"
FT                   /db_xref="GOA:D4MXX7"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXX7"
FT                   /protein_id="CBL37472.1"
FT                   /translation="MIKAGIIGSTGYAGQELVRILTQHKDAEVVWYGSRSYIDQKYYEV
FT                   FRNMFQIVDDKCLDDNMDELASKVDVIFTATPQGLCSSLVSEEILSKVKIIDLSADFRI
FT                   KDVNRYEEWYGIKHQSPEFIDEAVYGLCEINREDIKKARLIANPGCYPTCSTLSIYPMA
FT                   KEGLIEMNSVIIDAKSGTSGAGRGAKVNNLYCEVNENIKAYGVATHRHTPEIEDQLSYA
FT                   SGEEVLLNFTPHLIPMNRGILVTAYATLKKDVSYEEVKAIYDSYYKNEKFVRVLDKDVC
FT                   PETRWVEGSNYVDVNFKIDKRTNRIIMMGAMDNLVKGAAGQAVQNMNLMFGLKETEGLE
FT                   LVPMFP"
FT   CDS             366831..368060
FT                   /transl_table=11
FT                   /locus_tag="CL2_03950"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37473"
FT                   /db_xref="GOA:D4MXX8"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXX8"
FT                   /protein_id="CBL37473.1"
FT                   /translation="MKEKVVLAYSGGLDTTALIPWLKETFDYEVICCCVNCGQGNELDG
FT                   LDERAKLSGASKLYIEDIVDDFCDNYIMPCVQAGAVYEHQYLLGTSMARPAIAKKLVEI
FT                   ARKENAVAICHGATGKGNDQIRFELGIKALAPDIKIIAPWRMTDVWTMQSREDEIEFCE
FT                   AHGIHLPFDASHSYSRDRNLWHISHEGLELEDPSLAPNYDNMLVLGVAPENAPDKDTEV
FT                   TMTFEAGVPKTLNGKEMKVSEIITELNRLGGENGIGIVDIVENRVVGMKSRGVYETPGG
FT                   TILMAAHDQLEELILDRETMEAKKKLGSQMAQVVYEGKWFTPLREAIQAFVTSTQQYVT
FT                   GEVKFKLYKGNIIKAGTTSPYSLYNESLASFTTGDMYDHHDADGFITLFGLPLKVRAMK
FT                   MQEAEKNNNK"
FT   gap             368170..368736
FT                   /estimated_length=567
FT   CDS             complement(368851..369372)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03960"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37474"
FT                   /db_xref="GOA:D4MXX9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXX9"
FT                   /protein_id="CBL37474.1"
FT                   /translation="MSELLDMIKTRRSIRKYKSDMVPKEIIDKIVEAGTYAATGMGQQS
FT                   PIILAVTNKEVRDKLSKWNADIMGTDTDPFYGAPVVLVVLADKNRPTAVYDGSLVMANL
FT                   MLEAHDLGIGSCWIHRAKEEFESEEGKELLKSLGIEGDYVGIGHCVLGYVDGEYPGIPE
FT                   RKDNWVYYVE"
FT   CDS             complement(369410..369943)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37475"
FT                   /db_xref="InterPro:IPR024539"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXY0"
FT                   /protein_id="CBL37475.1"
FT                   /translation="MGYKRLYKNLIDIIKEEQAKLGFRRESIRLYYPLSSLNHFFETQD
FT                   TEEQMKNRLHGIPDFIKETLGDIKVTSKKERFCFYIPEEGSNYVHENTNPNEFIKELVE
FT                   IVGKHGCKMEDIIALFKKHDKNVFVEEIHNGEFDYLIRFSEENEDPYYYCFHDEGCHII
FT                   YHRFLPEDYEDFGF"
FT   CDS             complement(369965..370423)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37476"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXY1"
FT                   /protein_id="CBL37476.1"
FT                   /translation="MKFTMGRTMKILVAILIVAIIAIVMLSPYSFEKYTASSKMIQVTS
FT                   TDTVTKDANGKKKQQVYSYKKDDKKYTEIVNVLDQYSYHFTTKTLTNSSQMSDSSKPQM
FT                   IMLFGNKMLVISDSGEILLDNHVYRMGYSGGKDAKKMMKSINKILKSE"
FT   CDS             complement(370526..370951)
FT                   /transl_table=11
FT                   /locus_tag="CL2_03990"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_03990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37477"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXY2"
FT                   /protein_id="CBL37477.1"
FT                   /translation="MKKRYQIEKYTILFAIGGMAYFLLEVLVRGYSHYSMFLCGGACFL
FT                   CCGLLNENVKIKISFISQMVLSSVIITVLELITGFIVNIWLKMDIWDYSHLPYNFKGQI
FT                   CLLYSVFWFLISSVAIVLDDFLRYKLFNEEKPRYKIF"
FT   CDS             371180..372562
FT                   /transl_table=11
FT                   /locus_tag="CL2_04000"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37478"
FT                   /db_xref="GOA:D4MXY3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXY3"
FT                   /protein_id="CBL37478.1"
FT                   /translation="MAQLWGGRFTKETDQLVYNFNASISFDQKFYKQDIRGSIAHVTML
FT                   ASVGVLTEEERDQIIDGLKGISKDIQTGAVEITSEYEDIHSFVEANLIDRIGDVGKKLH
FT                   TGRSRNDQVALDMKLYTRDEIVDIKYLLKELMETLHRIMKEHIDTFMPGFTHLQKAQPV
FT                   TLAHHVGAYMEMFKRDYSRLTDIYDRMNYCPLGAGALAGTTYPLDREQTASLLNFYGPT
FT                   LNSMDSVSDRDYVIELLSALSTIMMHLSRFSEEVIIWNSNEYKFVSIDDGFSTGSSIMP
FT                   QKKNPDIAELVRGKTGRVYGALTSILTTMKGIPLAYNKDMQEDKELTFDAIDTVKGCIS
FT                   LFNGMMNTMTFNKPQMEKSAKHGFTNATDAADYLVNHGVPFRDAHGIVGQLVLLCLDKH
FT                   ISLDELPLDEYQKISPAFEEDIYDAISMKTCVEKRNTIGAPGRDAMKKVIAINDTYLAN
FT                   LK"
FT   CDS             372576..374297
FT                   /transl_table=11
FT                   /locus_tag="CL2_04010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37479"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXY4"
FT                   /protein_id="CBL37479.1"
FT                   /translation="MKKKVFLFGLLFSLLLLCGCGVNLTSTVKLNKDFSGTRVMSCTFS
FT                   SRDFHSYFKGSKEDLNKLIKESCPDALTYTSSSSDGNDTYTFYLRFSSLDDYKKKVRDL
FT                   LNFSPEITYEYGDSPFVSGLIYKENFTSKDLMTWLYTALYEGKYIDKDSSSDLWDLKST
FT                   EISFLGTTYETKDKINIDEMAYVPLSSIHIDTKTKKSGKLARVIEFDLPQQTLDQNAGK
FT                   IRSYFAGNDITWENTSDGKTLCISFDANNFSDLAQKTRTVLHSKNSFGTYSSTCSKDNP
FT                   FTLKINYEESLDLSHFIQKNQKIPVTYTFDEKQMFSDSIKQKEISFTSSVTQPISTYEI
FT                   ATVWNTSKDIRRKVSFSFEKAVTDHQLSVIKKQFKGQTIDSVNLDGDQNVTLSFVQKGS
FT                   VSDCNKDFSALFPNSLMKSQAHFSFAGGKKVTFSDKISLPANQNGEKLHGHYVFASVNS
FT                   KESVTVAVMPEKIVTNTVKQNTSTKAVSALIKSDENIHDLCDFELTGNRLELSYRGSTA
FT                   ASFWMGALRWMLPVVVLIVIGLFLIRKKVAIREMFGDLKKELAESVNSLIDRINKR"
FT   CDS             complement(374702..374857)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37480"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXY5"
FT                   /protein_id="CBL37480.1"
FT                   /translation="MSTKNNKLRFIDEEKTKELQKDWKGYGKSQVLFGIVVFVIFVLSA
FT                   LYYYIL"
FT   CDS             complement(374883..375431)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37481"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXY6"
FT                   /protein_id="CBL37481.1"
FT                   /translation="MIKSKPKMIVAFLLMSAILMMSIQTSMATEKDIMSNDVIKQAFDN
FT                   NVNKISCIPETIETIEVYDSRLDEKEIIKPQSAKASYDYYKTYRTGVTCKGSGAASSYL
FT                   LNANITFYVNVFFKSTKAVGHEKPVVTGVSGAYGATGYSKPSVTVSSWSANKMKFKGTC
FT                   KLTAGGTYTMTGTKTISLP"
FT   gap             376032..376940
FT                   /estimated_length=909
FT   CDS             377068..377310
FT                   /transl_table=11
FT                   /locus_tag="CL2_04050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37482"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXY7"
FT                   /protein_id="CBL37482.1"
FT                   /translation="MTITRKYIRQCRTLFPVYGNSERTFLNRLKVQINEHLDLFPDLSY
FT                   EELVKQFGTPKEVIMEYYANADDDYLLKKLMYQKN"
FT   CDS             complement(378042..378605)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04060"
FT                   /product="pyridoxal phosphate synthase yaaE subunit"
FT                   /EC_number="2.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37483"
FT                   /db_xref="GOA:D4MXY8"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXY8"
FT                   /protein_id="CBL37483.1"
FT                   /translation="MKQVGVLALQGAFIEHEKMLEQLGVSCIELRNKEDLEKPYDGIIL
FT                   PGGESTVQGKLLKELDMFDTIKKQIEAGMPVLATCAGLILLAKDIKDQEETYFGTIPMC
FT                   VKRNAYGRQLGSFFTTKEVDGVGEVPMTFIRAPYVESVEDGVKVLAEVDGNIVGVEYGK
FT                   QMGFAFHPELDGDLRIHQRYVDKI"
FT   CDS             complement(378607..379485)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04070"
FT                   /product="pyridoxal phosphate synthase yaaD subunit"
FT                   /EC_number="4.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37484"
FT                   /db_xref="GOA:D4MXY9"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXY9"
FT                   /protein_id="CBL37484.1"
FT                   /translation="METTKRYELNKELAQMLKGGVIMDVTTPEQAKIAQEAGACAVMAL
FT                   ERIPADIRAAGGVSRMSDPKMIAGIQEAVTIPVMAKCRIGHFAEAQVLEAIEIDYIDES
FT                   EVLSPADDVYHINKRNFKVPFVCGAKDLGEALRRINEGASMIRTKGEPGTGDIVQAVRH
FT                   MRKMNSQIAQLVSMREDELFEAAKQLRVPYDLVVYVHENGKLPVVNFAAGGVATPADAA
FT                   LMMQLGAEGVFVGSGIFKSGNPAKRAAAIVQAVTNFTDAKRIAELSKDLGEAMVGINEQ
FT                   EIELLMAERGK"
FT   CDS             379633..381045
FT                   /transl_table=11
FT                   /locus_tag="CL2_04080"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37485"
FT                   /db_xref="GOA:D4MXZ0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXZ0"
FT                   /protein_id="CBL37485.1"
FT                   /translation="MLTYNFANKGSDSLYEYLYKCIKNDIILENLDVHEKLPSKRSFAK
FT                   NLGISVITVENAYEQLMAEGYIYSIPKKGFYVADLRELNLTKTHSVGPDNALLSIKEKV
FT                   PYLADFTSNQTDSEIFPFTIWARTMRELLNENQQQLMENPPCGGIMALRQAIADYLHAF
FT                   RGMVVNPEQIIVGAGTEYLYGLLIQLLGDDKIYGIENPGYPKIAKIYDSMHVSYSAIDL
FT                   DKHGVCIDSLENHQIDIMHLSPSHHFPTGIITPISRRYELLGWASKDENRYIIEDDYDS
FT                   ELRLGGKPIPTLQSIDISDKVIYMNTFTKTLSSTVRISYMVLPASLTELFYKNLSFYSC
FT                   TVSNFEQYTLARFMESGSFEKHINRLRNYYQNKRDAILEIFKTAPLDQYITIKEEDSGV
FT                   HFMMKLKTERTEMDMMSDSKSKGIKLAPLSKYFVGQTSNVNFQNVYVMNYSSIDLEQLP
FT                   LIFDALCQVLIK"
FT   gap             381167..381682
FT                   /estimated_length=516
FT   CDS             complement(381872..382255)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37486"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXZ1"
FT                   /protein_id="CBL37486.1"
FT                   /translation="MKNFKNVICGFILPILLLIVLPYIGFWLYNQNYIHNYIEQSIMNG
FT                   KYMQEIFVRLVWGILIGIYMLWLNKSSTFMAICSTVVMIIILVCSVLLFMMEKILINND
FT                   MLFIWSVLPGILIGIWIYKIKQK"
FT   CDS             complement(382270..382362)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37487"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXZ2"
FT                   /protein_id="CBL37487.1"
FT                   /translation="MTAVARVSGMTAKTTVQMVMKVDDILDDVK"
FT   CDS             383192..383584
FT                   /transl_table=11
FT                   /locus_tag="CL2_04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37488"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXZ3"
FT                   /protein_id="CBL37488.1"
FT                   /translation="MSKTTLVMQQVQLQEWFHMMQESKGRPQQIPLDEWCKENYGISAA
FT                   GYYYRVRKVKEAYLDQVSEEKHQENLAIVPKELFHEDQGVQKNPSKLQTTDSFLDIFQD
FT                   DLRIRIYENTDEQLLFCVLRNLKNAE"
FT   CDS             383574..383852
FT                   /transl_table=11
FT                   /locus_tag="CL2_04140"
FT                   /product="IS66 Orf2 like protein."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37489"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXZ4"
FT                   /protein_id="CBL37489.1"
FT                   /translation="MLNDAKDLQAVYIVCGYTDLRKGIDSLSNIISQTYGMDPFQPGTL
FT                   FMFCGRKTDRIKALIWEGDGFLLCYKVNGKSVLPFTYLKNKKHKNRG"
FT   CDS             384005..384220
FT                   /transl_table=11
FT                   /locus_tag="CL2_04150"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37490"
FT                   /db_xref="GOA:D4MXZ5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXZ5"
FT                   /protein_id="CBL37490.1"
FT                   /translation="MSENQVKITYKPLWKLLIDRDMTKTELRKKTQIAPSTFTKMNNGQ
FT                   QVSLDILARICVELKCGFDDIVEIEQ"
FT   CDS             384543..384932
FT                   /transl_table=11
FT                   /locus_tag="CL2_04160"
FT                   /product="Protein involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37491"
FT                   /db_xref="GOA:D4MXZ6"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXZ6"
FT                   /protein_id="CBL37491.1"
FT                   /translation="MALENKLNIMDSIELARMEEKISKKKAVELFENGYLDKYKADSFE
FT                   MLAAIHEYLFGEIYDFAGKVRNVNIAKGNFRFAPVMYLQVAIENVEKMPQSTFDEIIEK
FT                   YVEMNIAHPFRDGNVPSRYQQQIAA"
FT   CDS             385077..388121
FT                   /transl_table=11
FT                   /locus_tag="CL2_04170"
FT                   /product="Cna protein B-type domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37492"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXZ7"
FT                   /protein_id="CBL37492.1"
FT                   /translation="MNKILKRLLTGVLTLATVFTALPTTAVHAAETQYWTESSERVGIV
FT                   EKVMNDGSIGSTFNEGHMTVEGEDAYCVDINTNFKNGYKTRSDASTCLSDDQIADIALS
FT                   LEYVKQYTASHSGISSQHAYLLRQLVVWQRLSAHLGWSCDNVRASYDEISKAVQDEVFA
FT                   GAKAFVAANKGRYDCYGYIYTGEGQDLGQFFAELAVGNGKIQKSSSNTTVTNGNDCYSL
FT                   SGATYGVYSDKGCTKSVAILTTNANGNTDTVELRAATYYVKETKAPKGFQLDKNVYTMT
FT                   VKVNETTTLKVSDKPKVTDTLVELFKIDMEISKATPQGNASLEGAEFVWKYYDGYYTKD
FT                   NLPSEPTRTWTTKTTTEKDSNNEVHYITRLADSYKVLGDSFYTQNGTICLPLGTITVKE
FT                   KTAPNGYLLEGAYMQAAGSSEQIKGVYVAQITEDGELAALSGSNQYSVLDKVIRGGVKI
FT                   QKRDLETKDTKAQGGATLKDTAFEIISLNDNAVLVDGKLYNKNEAVKTIHTGVDGIATT
FT                   AADTLPYGKYRIEESNAPEGYLTDGAKPIEFEITEDGKIVDLTDEAHSIYNQIKRGDIE
FT                   GVKIGAGTHKRLANVPFRITGKTTGESHIIVTDANGQFSTSSDWVSHKQNTNAGKTSED
FT                   GIWFGTSTPDDSKGALLYDTYTIEELRCDSNKGMTLIPAFDVVVSRNKVVVDLGTLTDE
FT                   YEPEIIIHTTATDKVTGGKSIVAGKSVTIVDTVTLDGLTKGTKYQLKGWQMVKSENAQL
FT                   LIDGEPVENDYTFTAKKSEMEVEVSYTFNASALGGKDLVTFEELYDLSNPDEPTKVAEH
FT                   KDIEDEGQTVTITERIITMHTTATDKATGEKTIEADDKVTIVDTVTLDGLEKGVKYTLK
FT                   GWEMVKSENAELLMNGKRVENDLTFTAEDSKMEVQIEFTFNASELGGKELVTFEELYDV
FT                   TNPDEPIKVAEHKDIKDKGQTVTVKENLESPTAPEEPSTPTKTSDSPKTGDNTPFVALF
FT                   AMMGISAAGLIFAGYKRFRRVKKSK"
FT   CDS             388140..388217
FT                   /transl_table=11
FT                   /locus_tag="CL2_04180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37493"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXZ8"
FT                   /protein_id="CBL37493.1"
FT                   /translation="MKATPRSPPIIKKVSPWLATQLNSA"
FT   CDS             388367..388681
FT                   /transl_table=11
FT                   /locus_tag="CL2_04190"
FT                   /product="Bacterial protein of unknown function (DUF961)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37494"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="UniProtKB/TrEMBL:D4MXZ9"
FT                   /protein_id="CBL37494.1"
FT                   /translation="MELKHVIPNMEKTFGTLEFAGENKVEQRRINGRMTVVSRSFNLYS
FT                   DVQRADDIIVVLPASAGEKNFESEEKVKLINPKITAEGYKIGTRGFTNYILSADDMVKA
FT                   "
FT   CDS             388697..389086
FT                   /transl_table=11
FT                   /locus_tag="CL2_04200"
FT                   /product="Bacterial protein of unknown function (DUF961)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37495"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY00"
FT                   /protein_id="CBL37495.1"
FT                   /translation="MRLANGIIIDKEKTFGVLKFSALRREVHIQNEDGTVSEEIKERTY
FT                   DLKCKEQGRMIQVSIPASVPLKEFDYNAEVEIINPVADTVATATFQGADVDWYIKADDI
FT                   VLKNKHSVSNTMTNPSQTVTKINKQ"
FT   CDS             389157..389867
FT                   /transl_table=11
FT                   /locus_tag="CL2_04210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37496"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY01"
FT                   /protein_id="CBL37496.1"
FT                   /translation="MLRKNILIFIKRNTLISAFFIISIVIITSYYLTLDLPELFRGAEQ
FT                   WFNLLFQLSVGYIINFMFYITQVYVPNNKRDSIARRNVSMRLKQIIKNMRNSLSSLAEI
FT                   YLDGHTGTDYTAEELSSLLQLRFSDKVKVLNANRTTRENMVYFSVREWLGECIRKTEDE
FT                   IDKLYKYYPTDISVELMKVLEDILNSTYHSMMKTLLVVPNDVDFSQCNNNFFAEYYKLI
FT                   CELEKINQKEYFSE"
FT   CDS             389926..391329
FT                   /transl_table=11
FT                   /locus_tag="CL2_04220"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37497"
FT                   /db_xref="GOA:D4MY02"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY02"
FT                   /protein_id="CBL37497.1"
FT                   /translation="MRLQTYRGYRIRASDKSLVFRFSAGLLLLLFLAVVMLLNLKSIIT
FT                   TDWKAISLFEDGSVYLPITPYRIVTIIVATLVCVLSALFYRRFQYDRVKQLFHRQKLAR
FT                   MILENGWYESESTQDSGFFKDLPASGKKEKINYFPKLYYRMEHGLLYIRTEITLGKYQD
FT                   QLLHLEKKLETGLYCELVSKELHDSYVEYVLLYDTIANRITINEVQAEHGSLRLMKNVW
FT                   WEYDKLPHMLIAGGTGGGKTYFILTLIEAMLRSNAVMYILDPKNADLADLSVVMPEVRY
FT                   KKDDITACIDRFYDGMMARSEAMKLMENYRTGENYAYLGLSPHFLIFDEYVAFMEMLTT
FT                   KENAAVLNKLKQIVMLGRQAGYFLILACQRPDAKYLGDGIRDQFNFRVALGRMSELGYS
FT                   MMFGEVDKDFFLKQIKGRGYVDTGNSVISEFYTPLVPKGHDFLKEIGRLSRNRQDGQAA
FT                   CGAKDAGTD"
FT   CDS             392722..392811
FT                   /transl_table=11
FT                   /locus_tag="CL2_04240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37498"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY03"
FT                   /protein_id="CBL37498.1"
FT                   /translation="MKHILFDLFLFSLGAAAEREIEMMERSRK"
FT   CDS             392811..393032
FT                   /transl_table=11
FT                   /locus_tag="CL2_04250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37499"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY04"
FT                   /protein_id="CBL37499.1"
FT                   /translation="MNFGQNLYNWFLSNAQSLVLMAIAVIGVYLGFKREFSKLIGFLVI
FT                   ALIAVGLVFNASGVKDVLLQLFNKIIGA"
FT   CDS             393092..393688
FT                   /transl_table=11
FT                   /locus_tag="CL2_04260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37500"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY05"
FT                   /protein_id="CBL37500.1"
FT                   /translation="MKESTKAYLVDIYNSIPKKTKATCLKFYYQYHNVNVNVYFDAFDN
FT                   QSVVLSIVLSAKKKYYYTPLNILNTGMITEYLSEIPPQILEKILVDNHLDDFYENMEKH
FT                   LLEDKPYFNYYNEDTYFVNTIKYAKSKLDLPFWWYLRKVPMSDDTLYKLNARADITFDI
FT                   LRKIQQEGYTLVRTPDPEKRKELTLILKQIGIKLS"
FT   CDS             393756..394001
FT                   /transl_table=11
FT                   /locus_tag="CL2_04270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37501"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY06"
FT                   /protein_id="CBL37501.1"
FT                   /translation="MKTDIFEDMKERVGCENISDLPYRKRMVWEIIKQHSPLDYPKEQL
FT                   EKFSHYVFGVDYAVIMGILDMMKGSDRPCRKCESTC"
FT   CDS             393974..394477
FT                   /transl_table=11
FT                   /locus_tag="CL2_04280"
FT                   /product="Antirestriction protein (ArdA)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37502"
FT                   /db_xref="InterPro:IPR009899"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY07"
FT                   /protein_id="CBL37502.1"
FT                   /translation="MQEMRIYLLNNTKPYREGDEEYSGAWFNCPVDFEEVREKIGVEHE
FT                   EQIEIADYELPFDLHSNMPLWEINANCRMVLELEGTPIGNEMKAIQQKWFSSFEEFIDH
FT                   KDEIRYYDVGDGAALAEYLIREEYVFGEIPHELLKHIDYHSYGSELEMDDRYLFTTSGV
FT                   FRYQ"
FT   CDS             394501..394989
FT                   /transl_table=11
FT                   /locus_tag="CL2_04290"
FT                   /product="Antirestriction protein (ArdA)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37503"
FT                   /db_xref="InterPro:IPR009899"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY08"
FT                   /protein_id="CBL37503.1"
FT                   /translation="MRIYIANLGKYNEGELVGAWFTPPVDYDEMAERIGLNDRYEEYAI
FT                   HDYELPFEIDEYTPIEEVNRLCEMVEDLPEDIQDELSELLGYYSSLEDLCEHADDIIHY
FT                   PDCDDMTDVAYYFIDECQSLGEIPDRIRSYIDYEAYGRDLDLEGRFVVTNHGVFECSY"
FT   CDS             395481..397931
FT                   /transl_table=11
FT                   /locus_tag="CL2_04310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37504"
FT                   /db_xref="InterPro:IPR016628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY09"
FT                   /protein_id="CBL37504.1"
FT                   /translation="MFPIKYIENNLVFNHDGECFAYYELTPYNYSFLSPEEKYMVHDNF
FT                   RQLIAQNRDGKIHALQIATEDSLRAVQERSKKGITGRLKEIACKKVDEQTEALVEMIGE
FT                   NQIDYRFFLGFKLLVNEEEISFKGMRKSAAMTFTDFIYEVNHKLMGDFVSMSNDEINRF
FT                   LKMEKLLESKISRRFQFRRLDKNDFGYLLEHIYGNTGVAYSDYSYDLPIKKLKRETLVK
FT                   RYDLIRPTRCMIEENQRYLKIEREDQTTFVAYFTINNIVGELDFPSSEIFYYQQQQFTF
FT                   PVSTSMNVEIVTNKKALTTVRNKKKELKDLDNHAWESNNETGSNVMDALDSVNELETNL
FT                   DQSKESMYKLSYVIRVAADSLDELKRRCDEVKDFYDDLNVKLVRPFGDMLGLHGEFIPS
FT                   SKRYINDYIQYVTSDFLAGLGFGATQQLGETDGIYIGYNLDTGKNVYLKPSLAAQGVKG
FT                   SVTNALAAAFLGSLGGGKSFCNNLIIYYAVLFGGKAVIVDPKSERGNWQETLPDIAHEI
FT                   KIVNLTSENKNKGLLDPYVIMKRTKDAESLAIDILTFLTGISSRDGEKFPVLRRAIRSV
FT                   TQSKKRGLLRVIDELRKDGSLVAENIADHIESMTDYDFAHLLFSDGDVEQSISLDRQLN
FT                   IIQVADLVLPDKDTKFEEYTTMELLSVAMLIVISTFALDFIHSDRSIFKMVDLDEAWTF
FT                   LQVAQGKALSNKLIRAGRSMNAAVYFVTQNSGDVDDEKMKNNIGLKFAFRSTDIKEIKN
FT                   TLEFFGVDKEDEGNQKRLRDLENGQCLFQDLYGRVGVIQIHPVFSDLFHAFDTRPPVQT
FT                   EETR"
FT   CDS             397937..400066
FT                   /transl_table=11
FT                   /locus_tag="CL2_04320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37505"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY10"
FT                   /protein_id="CBL37505.1"
FT                   /translation="MRKKKIIRWLLITLAVILGVLVILSITGTVAYAAGLVDNTVSDSN
FT                   EYSKYPLENYQLDFYVDSSWDWLPWNWLDGIGKSIQYGLYAITNFVWTVSLYISNATGY
FT                   VVQEAYKLDFISDTASSIGKNIQTLAGVTSSGFSNEGFYVGFLLILILVTGIYVAYTGL
FT                   LKRETTKAIHAIINFLVVFILSASFIAYAPNYISKINDFSADISSSALSLGTKIVLPDS
FT                   SSKGKDSVDLIRDSLFSIQVKQPWLLLQYGESDIETLGSDRVESLLSGSPDTDDREDVV
FT                   IEEIEDKDNDYLSVTKTMTRLGMVVFLFIFNIGISGFVFLLTGMMIFSQVLFIIYAMFL
FT                   PISFILSMIPTYEGMAKKALTKLFNTIMMRAGITLIITTAFSISTMFYSISSGYPFFMV
FT                   AFLQIVTFAGIYFKLGDLMAMFSLQSSDTQQVSRRIMRHPYMFLNRRARRLERKIGRTM
FT                   AAGAAGGVAGAAAASASTKKADNTKQTGNTHTRANHNTSASSSGGNSKPPALPDSKSQK
FT                   PLALPDKKSQTDSSQTVHSSQSNTQESQSTSKRGIVDKKSVSKQPQSDKKNPQRPIVDK
FT                   ERQSNGSATKRAAPVHERPATTPVPVKSDSQAAALKPEQKVKERPVTVTKEQPQSSKSK
FT                   EPVTKSQENVRTQVVRESRPADKQTSSAVNKHSQATTDISRQTVQRQKQTKTVQKKTTN
FT                   QSTMKKSTSKKGGKK"
FT   CDS             400063..401067
FT                   /transl_table=11
FT                   /locus_tag="CL2_04330"
FT                   /product="Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37506"
FT                   /db_xref="GOA:D4MY11"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY11"
FT                   /protein_id="CBL37506.1"
FT                   /translation="MKLRHFAVFGGIFTVIICLLLFLFIVTADDEESGSSSLDFSGLNL
FT                   SAEVLKHQPTVEKYAKEYGISDYVNYLLAIMQVESGGTGTTDVMQASESLGLPLNSLSV
FT                   EDSIKQGCKYFSELLKSAEAKGCDINTVVQSYNYGGGFIDYVSSHGKKYTFELAVSFAK
FT                   DKSGGVKVTYKNEIAIKENGGWRYRYGNMFYVKLVSQYLAVPSFSDATAQAIFNEALKY
FT                   QGWKYVYGGSNPNTSFDCSGLVQWCYGKAGISLPRTAQAQYDATQHIPLSQAKAGDLVF
FT                   FHSTYNAGTYVTHVGIYAGNNRMYHAGDPIGYADLTSSYWQQHLIGAGRVKTN"
FT   CDS             401082..401987
FT                   /transl_table=11
FT                   /locus_tag="CL2_04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37507"
FT                   /db_xref="InterPro:IPR024735"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY12"
FT                   /protein_id="CBL37507.1"
FT                   /translation="MLFKKKDKESKPKKEKKVPVMKVGTHKKTVIALWLVLIASVSFGV
FT                   YKNFTAIDMHTVHEKEVIEQRIVDTNKIENFVKAFAKSYYSWSNTQESIEKRTAAINQY
FT                   LTKSLQDLNVDTVRQDIPTSSTVTDVKIWEVEAAGTDDFTVVYSVDQTVTEGETSIGYT
FT                   SAYVVVVHVDGDGNLVITQNPTISSIPTKSGYEPKTKESDGTVDAATTKEVTEFLETFF
FT                   KLYPTATEKELAYYVSGNVLEPVNCEYVFSELVNPIFTQDGEQVKVSVSVKYLDQRTKA
FT                   TQISQFDLTLEKDSNWKIVK"
FT   CDS             403193..405007
FT                   /transl_table=11
FT                   /locus_tag="CL2_04360"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37508"
FT                   /db_xref="GOA:D4MY13"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY13"
FT                   /protein_id="CBL37508.1"
FT                   /translation="MANKKPKQNKPKTGLARCLELASNKKGLVFLSAILSSLAAIASFV
FT                   PYIAVYFIISSILKVYPNLELLDMSKVMNYGWIALAGIIANILLYFLAIFSSHMAAFGT
FT                   LYELKLHFAEHITKIPLGYHLTIGSGRLRKIMDENIESIEGFIAHQFPDFVASVTAPIV
FT                   MVIILLAIDWRFGIASLVGIVLAFVVQFSGFGSGAMKENMGKYQIALEDMNNASVEYVR
FT                   GMPVVKAFNQTASSFARLEHAIKEYTEWVLKFSLGWQNYMPAFTTIINNIYLVIVPVGI
FT                   LLGANAQDYKSFTMTFIFYLLFVPAIAGILNKIMYISESFMQIDGNVARMDEIFNIPVL
FT                   PETTSPKKPQKDDVVFDNVSFTYTGKKEEMAIENVSFKANQGQITAIVGLSGGGKSTIA
FT                   NLISRFWDVTEGSVKIGGVDIRDISEKDLMNHVSFVFQDIFLFKQSILDNIRMGNPNAT
FT                   EEQVIEAAKAAQCHEFISKLPNGYKTVFGTKGIHLSGGERQRIAIARAIIKDSPIIVLD
FT                   EATAFSDPENEYLIQKAFEKLMQNKTVIIIAHRLSTIRNADKIIVMEKGHLVEEGKHNE
FT                   LVAAGGRYSQMWNHYTEAVDWKISGKAV"
FT   CDS             405013..406746
FT                   /transl_table=11
FT                   /locus_tag="CL2_04370"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37509"
FT                   /db_xref="GOA:D4MY14"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY14"
FT                   /protein_id="CBL37509.1"
FT                   /translation="MKKLKEFLFLSDKGYKDLKKAIVACTITNLALMLPFCVTVMLFSE
FT                   LLNPYVGKQIAWNHIWLLWGIGVVSAVLVFLAARNDYKKTYIASYQESNKTRLNIAEYL
FT                   RKLPMSFFNTKDLSELTTNMMSDCSSMESMLSSTIPPLIANGITVTLTCILLAFFDWRL
FT                   ALCMYITLPVAFLIIWLSKNYQKKLFERQVQAKLDASSQVQEYLEGMKIIKSCNLSGSH
FT                   FSALNKALLSMKKIAVKVEMICGVFMSSASMILQAGIGIVIFVGTMLLVKGEIELLPLL
FT                   MFFLMVTRIYGPILAILSQLTTLLNLNVVTERMRTLLSTPVMQGNDKEIENCDIELEHV
FT                   TFRYNTKDVIKDVTCKIPQGSITALVGSSGSGKSTISKLIARFWDIQKGTIRVGGKDIR
FT                   TMEPESLMRKMAFVFQDVTLFNDTVFNNISIGNPNATEEEVMAAAKAAYCDEFVRNMPD
FT                   GYQTVLGENGSTLSGGERQRISIARALLKNASIILLDEATASLDPENEVLVQKAIAQLV
FT                   ENKTVIMIAHRLRTVVDADQILVLDDGKLVEYGTHNELMKKKGVYQKLYHIQQESLGWT
FT                   I"
FT   CDS             complement(407165..407521)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04390"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37510"
FT                   /db_xref="GOA:D4MY15"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY15"
FT                   /protein_id="CBL37510.1"
FT                   /translation="MRKKEDKYDFRAFGLAIKEARMKQGLTREQVGAMIEIDPRYLTNI
FT                   ENKGQHPSLQVLYDLVHLLNVSADAFFLPASDLAKSTRRIQLEKQLDNLSDKDLVIMGS
FT                   VADGIIKSREVEED"
FT   CDS             complement(407656..407865)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37511"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY16"
FT                   /protein_id="CBL37511.1"
FT                   /translation="MVISVFLTIKGMSKNVDYEILSMQLPPRAAKQKTLYDLSTELRKK
FT                   KNGGFILTAIKSEIFLDMQKGYCR"
FT   CDS             408102..408518
FT                   /transl_table=11
FT                   /locus_tag="CL2_04410"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37512"
FT                   /db_xref="GOA:D4MY17"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY17"
FT                   /protein_id="CBL37512.1"
FT                   /translation="MKSSSFQQAIQAQFDCLTKKVIKRAAMKYNRDISRRLKHEVPFSE
FT                   ISDLELNKAGVYDKYSSDYTAFNVLGMEVQVSDDQLSKTLKCLPERKRNIILLSYFMDM
FT                   SDAEIGELMNVVRTTVYRHRTSTLEELRKMMEEE"
FT   CDS             408521..408757
FT                   /transl_table=11
FT                   /locus_tag="CL2_04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37513"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY18"
FT                   /protein_id="CBL37513.1"
FT                   /translation="MDKDQKHIPFAVIVAATNGDEAAIQEILDFYDGYISKLSLRKLYD
FT                   EYGNVYMVVDSELKGRIQAAVMDMIANFEIVVI"
FT   CDS             409253..410104
FT                   /transl_table=11
FT                   /locus_tag="CL2_04430"
FT                   /product="Predicted phosphoesterases, related to the Icc
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37514"
FT                   /db_xref="GOA:D4MY19"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY19"
FT                   /protein_id="CBL37514.1"
FT                   /translation="MKILYVTDLHGDKKKYRKILDVAIEKEIKVIVNGGDMLPKQCDRH
FT                   SEQSFFINGFLDEYFEELKKQDITYLAMLGNDDLLAADEMFDNLCDRFENVCNIAGRKF
FT                   SVNGYEFIGMNYILDHPFGCKDRVVTETHYIPQRQLSPVAGISNAVDYDRIYNWLEYSR
FT                   TELPHMCDVLKKLPLPDDRQKAVYVMHMPPAGLRLGQLRYQDLDIGSVDIYEFLKEKQP
FT                   LLSLHGHIHESPDTEKGKWINQIHQTTCIQTGQTELNDKYMVYAEIDLQEKKYERKVIS
FT                   VD"
FT   CDS             410402..412015
FT                   /transl_table=11
FT                   /locus_tag="CL2_04440"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37515"
FT                   /db_xref="GOA:D4MY20"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025378"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY20"
FT                   /protein_id="CBL37515.1"
FT                   /translation="MTKQQARLRVRLYARLSKDDGDADKESNSITNQLQMLRYYSKEKG
FT                   FEIIDEYVDDGYSGTTFNRPDLNRMIEDAMEDTQPSGIMVKDMSRFGRNNAMFMYYVEE
FT                   IFPNNDILFIALNDDVDTRYEDNEMMPFKSIMNEYYARDTSKKIRSVKKTTALSGGFCG
FT                   SFAPYGYRVDPNNKRKLLIDPETAPIVKRIFEMSKQGNSVHQIARTLCEEKILIPRAYR
FT                   AMKNGTLETSTGFRFPTDWVGKNVKMILENQVYLGHMVSHKTQTKSFKNRKLVAVPKED
FT                   WIVVKNTHEAIIDEETFELVQKFISVKKRPNKTGRPNMFVGLVKCPDCGRNMAFSNPNG
FT                   REPRFRCRTYARNSNLCTTHAISYDALVKIVMDDIQKHIKNMETLGDQFIEEMRVLSES
FT                   GGGKKIKQFKQELELAEKRIAEIDSIIMKLFEQNVAGKISDGRFEKMSVTYENEQRELE
FT                   ERRKALKEKIEAEDYKTKNTNQFLETIRKYENVTELNRSMLVELIDSIYVYQAEGTGKE
FT                   RTQKVEINYRFLCESQCGIA"
FT   CDS             412419..412742
FT                   /transl_table=11
FT                   /locus_tag="CL2_04460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37516"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY21"
FT                   /protein_id="CBL37516.1"
FT                   /translation="MDISKKDWKLFRERLADWQEKYMEGLIKEYINFLNDDTKPVSEKL
FT                   WGLEKRIKEDKHHPGVIMEMRKSEAIWDIVRLMRLKVITYDDLSEFSGELQQEVKRIIE
FT                   MSR"
FT   CDS             412797..413096
FT                   /transl_table=11
FT                   /locus_tag="CL2_04470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37517"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY22"
FT                   /protein_id="CBL37517.1"
FT                   /translation="MEVRVQNGDVWLTKKAISQLFDVDRSVVTKHLSNIFKEGELDENS
FT                   TCANFAQVADNGKTYKYKFYSLAAIIAVGYRIDSERAYKWLIEGDVSVKGESPH"
FT   gap             413110..413998
FT                   /estimated_length=889
FT   CDS             complement(414006..415040)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04480"
FT                   /product="Archaeal ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37518"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY23"
FT                   /protein_id="CBL37518.1"
FT                   /translation="MENPFTLTFGQKPTEFISRTNQIGKIIHTFDMENPSNKVYMVAGV
FT                   RGSGKTVSLAEIADHYSSNDQWIVLRLSADTDLIAGAVSELTRVSQFHDLDLGLNLNLG
FT                   IAELSVNKTNDSLEKEAMLRNILEKLKNKGKKVLFIIDEIINNSYVKVFASNFQIYITQ
FT                   NYPVYLVMAGLFDNISNLQNEKSLTFLYRAPKIFLEPLSIPAITTSYRSVFDISPSEAV
FT                   EMAKLTKGYPFAFQILGYLKWETNDDLEKLLPKFDEELIIYAYEKIWSELSELDRKIVY
FT                   VISTGVYKTGEIREKLSISPQLLNTYRKRLMERGVVNGSVRGELTLALPRFEEYIEMYC
FT                   EVNL"
FT   CDS             415231..416190
FT                   /transl_table=11
FT                   /locus_tag="CL2_04490"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37519"
FT                   /db_xref="GOA:D4MY24"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY24"
FT                   /protein_id="CBL37519.1"
FT                   /translation="MNIKKVAVLGAGAVGSYVIWGLSNNKNITLGVVADGERNERLKTQ
FT                   GLMINGTKYTPQVWTPEEAHNVDLLIVSLKYGSLRGALQDIQTIVGENTTVMSLMNGVD
FT                   SEEIIAEKIDKSHILYSFIKVASQKKEDGYHFDPETTVGIYFGELQQPYESERVKAVND
FT                   IFENTGLHWIITDDIQAEIWGKFKLNVCNNLPQAILGVGVGCYEDSEHMAAIREGLRAE
FT                   VEAVAKAKGIDLSTINAKSGRGSAVKASARYSTLQDIDSGRHTEIDMFSGAMMRMGKEL
FT                   GIPTPYNEYTYHMIKALEEKNDGVFEYQGENDRVSWSK"
FT   CDS             416214..417665
FT                   /transl_table=11
FT                   /locus_tag="CL2_04500"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37520"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY25"
FT                   /protein_id="CBL37520.1"
FT                   /translation="MYNKKKKIKHKTLKIFCLLIGMIVTAVFLEAGILYIVNSKNVYKT
FT                   SKVLLDQTIEIVEKNKQSEVGTVVADIPVYKGIALYVADKETGRIYGATDASKIGVKLD
FT                   DMGFRKQRKTVAKEKIVSGIIRVDGKKNYYILKKTQKYIVGVTYWIAVDNKSNLIAILI
FT                   MVVYLSIAAIGILFMVLRLSKVKKKNKEQSVMISSISEMSNIDKMTGCFNRKAYDEDIS
FT                   EIRMDSQFIYVSMDVNGLKIINDRQGHAAGDELICVAASCMKTRFDRYGKVYRMGGDEF
FT                   AAILFVKREQFEWIRRQFDGDIKYWSCNRIKELSISYGYVSSSECQWGSMKEISDVADI
FT                   RMYEEKAMYYKKNGVDRQGQPASYVALYRLYTQILRINLEKDCYKILNWEETKNKKKQD
FT                   SIGALSEWFHNFEDIRLIHSDDLVKYLKKTKIEYLKKQFANKKKFVTITYRRKEGDGYK
FT                   RITLEIIPEDENSQNTYEGFLYVKE"
FT   CDS             417844..418359
FT                   /transl_table=11
FT                   /locus_tag="CL2_04510"
FT                   /product="Mannitol/fructose-specific phosphotransferase
FT                   system, IIA domain"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37521"
FT                   /db_xref="GOA:D4MY26"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY26"
FT                   /protein_id="CBL37521.1"
FT                   /translation="MGFFFKNKKKNKEEETVTPVVETTPEVPAKEGMILVREGIKLGLP
FT                   TVSMEEAIVAAGELLRDLGYVDDDYIPAMIRRNEEASVYMGLGLAIPHGTEDAKRDVKR
FT                   SGIIVMQYPDGVEFNGGTAQLVIGIAGVGDEHLEILGQITEAVTEEEILEELKKTTDVD
FT                   YVLNTFTN"
FT   CDS             complement(418490..419374)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04520"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37522"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY27"
FT                   /protein_id="CBL37522.1"
FT                   /translation="MTYYDILFSFFIYGFLGWCSEVAFAAFKQHSFVNRGFLNGPICPI
FT                   YGIGVTVVVASLQPYVGNLILLYITSTILVTFLEWLTGFLLEKMFHHRWWDYSEMPLNI
FT                   GGYVCPLFSAIWGVACVLIVKLIYPFTDKLVSFFPIWLGKFLLVLLSIALIVDICITVQ
FT                   GILKFNKRLALMEDIAKELRNISDQIGENIYDSMMDGLEAQDRLKARADVIREKVDEAK
FT                   QENADELKARMDSLKQRAEELRSKYEKMAKLPTFTSRRILRAFPKMMPREHIKEFGQLR
FT                   RILKKKRDELKKS"
FT   CDS             complement(419399..421801)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04530"
FT                   /product="MutS2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37523"
FT                   /db_xref="GOA:D4MY28"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY28"
FT                   /protein_id="CBL37523.1"
FT                   /translation="MNQKVLQTLEFDKIINILTGYATTELGKLMCANLKPMTEEADILN
FT                   AQDQTQDALTRIYKRGNVSFFGVSDLSPSLARLKMRGTLGTGELLDIARVLESVKNAVS
FT                   YGVRMEDDLEADSLDELFESLVPLDDLLHEIRRCIISEEEISDDASSTLKHIRRAMKQT
FT                   NQKIHTQLTTLVSSVSNQDKLQDAIVTMRNGRYCIPVKQEYRSSFQGMIHDQSASGNTL
FT                   FIEPMSVVTLNNELKELEGKEQSEIEHILSILSEQASYGVDDLAHNQKTLVLLDFIFAK
FT                   AKYAKDIDASKPIFREDGIINIKQGCHPLLDRKKVVPINVSLGKDFSMLIVTGPNTGGK
FT                   TVSLKTVGLLSLMGQAGLHIPAFQGSSLGIFREIFADIGDEQSIEQNLSTFSSHMTNIV
FT                   SIVQQAHRDSLVLLDELCGGTDPIEGAALAISILSDLHGRGIKTMATTHYSELKMFALS
FT                   TDDIENASCEFDVETLSPTYRLMIGIPGKSNAFAISRKLGLDEHIIEGAADQIDESVKD
FT                   FETILADLEKSKQTIEKEQEEILEYRKEIETLRRSLKSRQDNIKEKRDKMLRDAREEAH
FT                   NIISEAKEIADSTIREYNKLKKQNKNPDTNKKMEHMRSDLRGRMTKLEGQMAYKSKKKN
FT                   KKRHEANDFHVGDEVYVTSLSLAGTVSTLPNAKGDLYVQMGMMRSLVNIKDLEITKTAK
FT                   DVKRENQRNESRNRGRTAINKSASIRPEINVMGMTVDEAIAQLDKYIDDACLANLAQIT
FT                   VVHGKGTGALRKGLHNYFKQLKKQKRISGYRDGEYGEGDLGVTVVIL"
FT   CDS             421992..424052
FT                   /transl_table=11
FT                   /locus_tag="CL2_04540"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37524"
FT                   /db_xref="GOA:D4MY29"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY29"
FT                   /protein_id="CBL37524.1"
FT                   /translation="MKTQQKIFMNRELSWLKFNERVLEEAENREVPLCERLTFASIYQS
FT                   NLDEFFMVRVGSLIDQMLLDKNMKENKTKMTPQEQIDAIIPQVQKLNRRKDSVYEEMMD
FT                   SLKEHNIHLVNFQKISKKESEYLRAYFQAEIAPLISPTIIGKRQPFPFLKNKEIYAVAV
FT                   LETKNGKEKLGIIPCGNETFDRLINISGKDAYMLSEEMILHYVPRIFKGYHVKAKTLIR
FT                   ITRNADIDADSMYDEDLDYRDFMVELIKKRKKLAPVRMELSREMDGEIIDLLCEYLELE
FT                   RKYVFYTQTPLDLSFVFKIQDILRRETDLFFEKRVPQRSPQFNEEMPIMDQIEKEDKLL
FT                   SYPYESMRPFLKMLQEAAEDKDVVSIKMTLYRVAKQSKIIASLIEAAENGKDVTILVEL
FT                   KARFDEENNIEWSRQLEDAGCRVIYGLDGYKVHSKLCLITRKKKGKVSYITQIGTGNYN
FT                   EKTSRLYTDLSLMTANVDIALEAAEVFQALSMGETVEETDHLLVAPHCLQNKVIHMIDR
FT                   EIEHAKAGEPAYIGLKMNSLTDKKIMEKLIKASKAGVKIDMVIRGICCLIPGVKGETDN
FT                   IQVRSIVGRYLEHSRIYIFGTKGREKVYIASADFMTRNTLRRVEVAVPIYNTDIKMQLI
FT                   EMFITMLSDNVKAREEDHNGNYKIPKNQDTPLNSQEFFYKQAYLNAKNVNS"
FT   CDS             424212..425153
FT                   /transl_table=11
FT                   /locus_tag="CL2_04550"
FT                   /product="uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37525"
FT                   /db_xref="GOA:D4MY30"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY30"
FT                   /protein_id="CBL37525.1"
FT                   /translation="MRYISDLHEGDQVSEIYLCKTKSPGTSKFGKSYYSLTLQDKTGMI
FT                   DGKVWELTNAIGHFEAMDYILVRGQVTSYQGSNQLNIQQIRKAQEGEFDMADYMPSTKK
FT                   DIDGMFKELLAMISKTKNQYLKQLAEKIFIEDKNFAREFKVHSAAKSVHHGYIGGLLEH
FT                   SLSVAKICESYANLYPQLNRDLIVMCALWHDMGKVEELSSFPENDYTDEGQLVGHIVMG
FT                   AIKLDRLIREIPGFPPKLANEVKHCMLAHHGELEFGSPKKPALLEAIALSQADNLDAKM
FT                   ETFAEIMEKQKEDQEWSGFQRLLDTRIRKTSI"
FT   CDS             425217..426590
FT                   /transl_table=11
FT                   /locus_tag="CL2_04560"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37526"
FT                   /db_xref="GOA:D4MY31"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY31"
FT                   /protein_id="CBL37526.1"
FT                   /translation="MEFKKNQIVELYIDDIGNEGEGIGHIDGYALFLKDAVIGDKVRAK
FT                   IIKTKKNYGFARVEEVIEASKDRVSPRCSKARQCGGCTLQHLAYEKQLEYKFNKVKNCL
FT                   ERIGGLENIEEKMEPILGMEEPFYYRNKAQFPVGYDKEGNLITGFYAGRTHHIIDCTHC
FT                   MIQHPVNEQILLKVLDYMKKNNITAYDEKTHKGLVRHIVTRVGFKTGEIMVCLVVNGSK
FT                   KNLRNLEMLIDSLTEVEGMTSICVNINKEKTNRILGSKIEEVYGKPYIYDYIGNVKYQI
FT                   GPLSFFQVNPTQTKVLYEKAMEYADLKGEETVWDLYCGIGTISLFLAQKAKKVYGVEIV
FT                   KEAIDDARLNAKMNGFDNAEFFVGKAEEVLPREYEKNGVYADTIVVDPPRKGCDSKLLE
FT                   TMVKMAPKRIVYVSCDPATLARDLKVLSEQGYEVEKVCAVDQFSHSSHVETVVRLKRK"
FT   CDS             complement(426908..427789)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04570"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37527"
FT                   /db_xref="GOA:D4MY32"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY32"
FT                   /protein_id="CBL37527.1"
FT                   /translation="MIKLISSDMDGTLLDSYRQITPINVEAIKRAQENGINFIINTGRE
FT                   YPNARGLVEAAGLKCDLICSNGACAFDKDGNLLFEHILDKETVRTIFDAFNKYGMEPAL
FT                   FTTEGRISLLPLEEREIYTRDVFIPAIQVNHPDMKYTLDDYRELVDDVIFVDGQEALLN
FT                   SDHRILKITSNSPDHESLKKLRVELEKIPGLAVVSTVPTDIEITSINAQKGSSLLDYAK
FT                   KDGLKPEEIIAIGDSENDYSMLSIPGIHSVAMENACDMIRNICVYQTRANTRDGIAYII
FT                   NCILADRENFKL"
FT   CDS             complement(427891..428763)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04580"
FT                   /product="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37528"
FT                   /db_xref="GOA:D4MY33"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY33"
FT                   /protein_id="CBL37528.1"
FT                   /translation="MIKLIVSDLDGTLLNSKQQISDRTLRAIKQIQRKGLRLLINTEQN
FT                   YFDAKKLLDAYDISCDIACFGGSCIFDTSGHQLHASYIPTKRIPEMLRIFGSCRTFYEI
FT                   HSTHGLCVLGSKEGYANYLSSEVVPALREEFPSQTLDEESYICERLENAHFYDNGQLLL
FT                   SENPQIIKITTQSLDQQKLEQLTNSLHTQVPHFAVSHQSPYRLDITAVNALKGAAVHFY
FT                   TEKYQISLKDTMVIGDSENDYSMLGLPYIESIAMGNADDIIQEICLHHTTDNDHDGVAI
FT                   VLEQILSKQ"
FT   CDS             428950..429657
FT                   /transl_table=11
FT                   /locus_tag="CL2_04590"
FT                   /product="exonuclease, DNA polymerase III, epsilon subunit
FT                   family"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37529"
FT                   /db_xref="GOA:D4MY34"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY34"
FT                   /protein_id="CBL37529.1"
FT                   /translation="MKDYVAFDLETTGLSPDSDQIIEIGAVKIRDGKISGKYNCIIHPE
FT                   IEVSDFIINLTGISRDMLRKGIPLKEGVEEFLEFSGDLPILGHNVMFDYKFMKMAAASF
FT                   KYPFEKTGVDTLKVARKLLTGLENKKLETLCAHYHYVNQAAHRAYDDALATAVVFEQMK
FT                   KEFPTEEEIFQPQQLQFKVKKERPATAKQKKYLENLMKYHAIGECLDIDQMTQREASKK
FT                   IDHIILNYGVMKK"
FT   CDS             429654..429746
FT                   /transl_table=11
FT                   /locus_tag="CL2_04600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37530"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY35"
FT                   /protein_id="CBL37530.1"
FT                   /translation="MKKKRFFVSVIAVLLIIVMVGTMVAGYLMM"
FT   CDS             429779..431275
FT                   /transl_table=11
FT                   /locus_tag="CL2_04610"
FT                   /product="Uncharacterized vancomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37531"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY36"
FT                   /protein_id="CBL37531.1"
FT                   /translation="MKKKIIIAVAVIVILVAGGTFYLNHKVSSAVKDGKIIEGVSCEGI
FT                   SIGGMTRSEAKDAIESHMKEIHQEKITLYVDDERSSAKIEDLGAFAEADKTVEEAYALG
FT                   RSGSIFTKYSDVKEKKHKLPVYRKYDKAKFEKNVKKATKKIVAEPRNASVKRKDGKFVV
FT                   IKEKTGYTLNMNETFANFKKAIESGKHQFELDVVKKKAKYTSKDMAEIKDVLGTYTTEY
FT                   GGSPYGRKVNVANGASKINGSIVYPGETLSVYKTVSPFTKENGYALAGSYENGQTVQTY
FT                   GGGICQVSTTLYNAVIRAELKIVERFPHSMTVHYVPRSADAAIAGTHKDMKFKNTFDTP
FT                   IYIEGKANGSTITFTVYGKKKDPKRTVEFLSETTQVKESSESTVSDNTLAEGQKVLESY
FT                   GHTGYSARLWKIVKINGKQVSKKVFNTSTYMSTPTVYRVGTKKAEDKKDDKKDKKKDSK
FT                   ETTAQKSETTTAAQKSTTAAQKSTTAKRSAAVKSQGSTGN"
FT   CDS             431278..432276
FT                   /transl_table=11
FT                   /locus_tag="CL2_04620"
FT                   /product="Hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37532"
FT                   /db_xref="GOA:D4MY37"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY37"
FT                   /protein_id="CBL37532.1"
FT                   /translation="MKIGKLSESALQKVVFEQLHTRRDEVLVGPGIGEDCAALKLQEGE
FT                   VFVTSTDPITGTVKEIGRLAVHVTANDLASAGAETIGLMVTVLLPPMIKEAQIKKMMQQ
FT                   INAECEKLNIMVLGGHTEITAAVTQPVLSVTGIGKVKEDELILSGGAKPGQDIVVTKYL
FT                   GMEGTGIIANEKEDELKEWFSDTFIDDAKAFLEDISVVPEGLIARKYASCMHDITESGV
FT                   YGALWEISKASGVGVEVCIEDIPLRQHTIEFCERYDLNPYQLISSGSMLITTDHGRTLV
FT                   NELEQAGIKATIIGHTTDSRDKVIYRQGKAANLEAPRQDELYKIYSENNRR"
FT   CDS             432306..432800
FT                   /transl_table=11
FT                   /locus_tag="CL2_04630"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37533"
FT                   /db_xref="GOA:D4MY38"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY38"
FT                   /protein_id="CBL37533.1"
FT                   /translation="MNTELRELILKLIEKNSRLAIHDLAVMLDVAETEVANEIADMEKE
FT                   HIICGYHTLINWDNTSKDQLTAMIEVKVTPQRGQGFDRIAERIYNFPEVKAVYLMSGGY
FT                   DFMVMLEGKTMKEISMFTSSKLAPLESVVSTVTHFVLKKYKDHGTVLEAKKVDERQAVT
FT                   P"
FT   CDS             432800..433969
FT                   /transl_table=11
FT                   /locus_tag="CL2_04640"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37534"
FT                   /db_xref="GOA:D4MY39"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY39"
FT                   /protein_id="CBL37534.1"
FT                   /translation="MRDFLSKRVVSLEPSGIRKFFDIVSEMPDAISLGVGEPDFDTPWR
FT                   VREEGIYSLERGRTFYTSNAGLKELRYEISEYLERKYELVYDPNHEIIVTVGGSEGIDI
FT                   AMRTILDPGDEVIVVQPCFVSYVACVVMAGGTPVIVSLKEEDKFKLKKEQLEAAVTDKT
FT                   KAMIISFPNNPTGAIMTREELEPIAEFAKEHDIVVISDEIYSELTYGGDHVSIASLPEM
FT                   KDRSIVINGFSKAFAMTGWRLGYVAAPRYMMKQMVKVHQFCIMAAPTTSQYAAIEAMRS
FT                   CDDEVEEMRTAYNQRRRFLVHEFQRMGIECFEPEGAFYIFPSIKKFGMTSEEFATKLLN
FT                   EEKVAIVPGSAFGACGEGYLRVSYAYSIEELKEALGRLERFINHLPKKQ"
FT   CDS             434000..434497
FT                   /transl_table=11
FT                   /locus_tag="CL2_04650"
FT                   /product="Predicted rRNA methylase (SpoU class)"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37535"
FT                   /db_xref="GOA:D4MY40"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY40"
FT                   /protein_id="CBL37535.1"
FT                   /translation="MLHIVLHEPEMPANTGNIGRTCVACGAVLHLIEPLGFRLNEKMIK
FT                   RAGLDYWDKLDVRTYINFEDFLEKNNDPKIYMATTKAKHVYSAPAYEDDEDVYIMFGKE
FT                   SAGIPEEILLNYEETSIRIPMLPHIRSLNLSNSVAIVAYEVLRHQGFKAFQMEGQLHHY
FT                   KW"
FT   gap             434721..435509
FT                   /estimated_length=789
FT   CDS             435553..435618
FT                   /transl_table=11
FT                   /locus_tag="CL2_04660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37536"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY41"
FT                   /protein_id="CBL37536.1"
FT                   /translation="MDRDRNAAINIREEARRMLTA"
FT   CDS             435784..436806
FT                   /transl_table=11
FT                   /locus_tag="CL2_04670"
FT                   /product="Predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37537"
FT                   /db_xref="GOA:D4MY42"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY42"
FT                   /protein_id="CBL37537.1"
FT                   /translation="MKVMNVAVVGAGIYGINHVNAYTWNPNTNLVAVCDLNKEITDRIA
FT                   EQYNVKTYNDVNEMLDNEEIDAVSIATPDAFHMDPALEAIRHGKPILVEKPLATTSEDA
FT                   KRILAEAEKYNVRVAVDYHKRWDPAAINVRNELQNEESGAPIRGYMCMDDIIDVPTEWF
FT                   NWADKSSPVHFLGTHCYDQVRWYMGCEVEEVYAVGTKKVLKARGVDTYDSIQATLKMEN
FT                   GCYWTVENSWILPKGFAKNNDGRTQILCENAMFRIDSQNRGVEIYNNSKLRTPNSYFIL
FT                   NNCGRPSGFGIEPINDFIYCLQNDLPFIADGNDGLQAELIAEAVHESLEKGVAVKLKRD
FT                   "
FT   gap             436843..437148
FT                   /estimated_length=306
FT   CDS             complement(437181..438578)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04680"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37538"
FT                   /db_xref="GOA:D4MY43"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY43"
FT                   /protein_id="CBL37538.1"
FT                   /translation="MLKKGFGNFIMNNDKEFLATEPIGKLLLRLAIPTLAAQMINMLYN
FT                   IIDRIYIGHIPGSGALALTGVGVCMPLIMIISAFAALVGNGGAPRASILMGKKDLDSAE
FT                   NILGNCFTMQIIISVILTLIMFFGNRTFLMAFGASENTIEYAVSYMNIYSLGTIFVQLT
FT                   LGMNAFITAQGFAKTGMYSVLIGAVINIILDPIFIFACHMGVRGAALATIISQACSCIW
FT                   VLSFLFGTRSTLRIKKQNLTLKAPVILPCLALGLSLFIMQASESIISVCFNSSLLKYGG
FT                   DVAVGAMTILTSVMQFAMLPLQGLGQGAQPIMSYNYGAKNTDRVKGTFFLLLKASLTYS
FT                   IILWGLVMLFPQVFAGIFTSNPALVIFTKKALRVYMAVMFMFGIQISCQMAFNSLGKAI
FT                   SSIVVAVMRKFVLLIPLIYIMPHIFTTDQTMAVYMAEPVADFIAVTFTAILFSVQFKTA
FT                   LAAIRLS"
FT   CDS             438710..439996
FT                   /transl_table=11
FT                   /locus_tag="CL2_04690"
FT                   /product="Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA
FT                   dehydratase subunit, BcrC/BadD/HgdB"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37539"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY44"
FT                   /protein_id="CBL37539.1"
FT                   /translation="MQIIETYGKYIEKWANTNPDRARVLLKLGWEVQNLKYKFTPDKRL
FT                   LPADRYLAHLMMNTMLMPLKNPQECAIVSIFTPCEILHEAGLHPYNVEAFSCYLSASNA
FT                   ERAFLQQAENTGISETLCSYHKTFLGAAQKKILPKPKCIVYTNLTCDANLLTFKTLAKL
FT                   YDVPAFAIDVPMQQNEDNVKYVADQIRDLKVFLEKCTGKTITEDGLKERMRRSKRTMDK
FT                   FIECQKKSADKDIKTDLVTPLFAGMTNNILLGTKEEEKYVDQLLKDIEKAPKKKGKNIY
FT                   WMHTIPFWSGAVQEALAFNENAQIAGCELSRTFEPDFDPEDPYDAMARRMVYHGLNGSA
FT                   VRRIEAGIRHAKDVKADGAVWFGHWGCKHTLGAAQLAKKKFEEAGIPMLLLDGDGCDRS
FT                   HGGEGQTSTRLGAFLEMLGAEEMEGGQDE"
FT   CDS             439989..441647
FT                   /transl_table=11
FT                   /locus_tag="CL2_04700"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37540"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY45"
FT                   /protein_id="CBL37540.1"
FT                   /translation="MSKTYYVCKYTPIELLQAFGGECENLNQMPEGFDLADQIAHPNIC
FT                   GFGKAVLEAVMTGKVKELVLVNCCDTIRSVYDILEDSGKLDFLYMIDMLHCDGECSRER
FT                   TVLQLKGLARAYGAYKGSEFDQKKFVEAFKEPEKQKEPYISVLGARMGNELYEMVKESM
FT                   PYSVENDTCVNNRSVGEVKPPKTDDFNELMEWYAAELLGQTPCMRMMDNSGRKRLYNDP
FT                   NLKGIIYHTVKFCDFYSFEYAQVKQNITVPLLKIESDYTVQSSGQLLTRLEAFAESMNM
FT                   DNLESGEKKMGKGYFAGIDSGSTSTDVVILNKDGEIVTGIILPTGAGAAMGAERALEEA
FT                   LKQAKLQREDIDAMVTTGYGRTAITDGDKSITEITCHARGAHFLNPEVRTVIDIGGQDS
FT                   KVIRLDENGAVANFVMNDKCAAGTGRFLEMMARTMEMDLDQMSEAGLTYKEDITISSMC
FT                   TVFAESEVVSLIAQNKETDDIVHGLNKAVASKTAALAKRVGGEERYMMTGGVSKNKGLV
FT                   KTLEEKLGTTLVISDKAQLCGALGAALFAMDMVQK"
FT   CDS             441703..442500
FT                   /transl_table=11
FT                   /locus_tag="CL2_04710"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37541"
FT                   /db_xref="GOA:D4MY46"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY46"
FT                   /protein_id="CBL37541.1"
FT                   /translation="MKEYYRIGETASLMGITTQTLRFYDKIGLVKPIKIDPRTGYRYYA
FT                   YEQFHFIDRIKYLQSLGMPLDDIKEVMLSKKVERLLPFLDQQKKVLEEEEKKIRHQIEM
FT                   VDWYKDYFTYMERNEDAPCVMHLKERYYLQVPCYKRDLLADMEIRLAKEKSEQGIDNAM
FT                   YLRQYGYKISYDAFCKQKFRPDYYFIYLNEKVKDAPNILKLPEGDYLCFRERILEEAWN
FT                   PQRIISYFQGKAKPELMLAMEYEDNLDNYAHANYEIQILLEKN"
FT   CDS             442654..444093
FT                   /transl_table=11
FT                   /locus_tag="CL2_04720"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37542"
FT                   /db_xref="GOA:D4MY47"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY47"
FT                   /protein_id="CBL37542.1"
FT                   /translation="MNGLLLVIQTISDFLWGTPMTIALIGTGLYLSIKFKFRYITKIKF
FT                   HFQNTFGKMFKGKGEGEGTVSGFAAACTAMANTIGVGNIGGVATAITMGGPGAIFWMWI
FT                   SALLGMSTKACEIILGQRYRVKYENSMDEYMCDRSFVMKNALGWKKGAFILAICCFVLG
FT                   PWTCCVQTESVVNSLKEAFGIKPLFAIIVLGITCFLTIAGGLKRISSVMERIVPFMAML
FT                   YILGGIGILLMNINAVPGAVALIFKSAFTPMAGVGGFAGATVKEAMRYGIARGLYSNDA
FT                   GTGYGIVAHAAGITDHPVRQSSWGWGEVFLDTIVVCSVTALSLILTNSYIDYPNVTSAQ
FT                   LTTVAFKVAYGNIGGYFLSLAITAFAWTTIIGMYYSCAKSVNYAFGDSNANKIATPIYM
FT                   VYYMLPCLLFYNIKADLLWAATDLLSAVYVIVTLIFIYSKRKEIMRLYNDFWDRFIPAL
FT                   KRGEYPEKVSYETVEEKGDVL"
FT   CDS             444093..445049
FT                   /transl_table=11
FT                   /locus_tag="CL2_04730"
FT                   /product="homocysteine S-methyltransferase"
FT                   /EC_number="2.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37543"
FT                   /db_xref="GOA:D4MY48"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY48"
FT                   /protein_id="CBL37543.1"
FT                   /translation="MKNSIENIIKENKIMVIDGSMSTPLENRGVSLNSKLWTAKILAEQ
FT                   PELIKQVHKNYFKAGADCGITCSYQASIPGLMENGYTLEEAENLIRSAVKIFCEARDEW
FT                   WEEEGREARRAWPLCLGAAGPYGAYLADGSEYRGNYGITDEQLKEFHKRRVELLHEAGA
FT                   DIILFETVPSLKEAKVEAEIAEEYGYDYWISFSCLSENIICEGTPIAECATTFAKGYPH
FT                   LKMIGVNCTKPEYITGLIHKIKENCDIPIGVYPNSGEEYDAVKKVWFGKQSALSFEQYA
FT                   YNYMKSGASAVGGCCTTVAKHVEEVVRAKKRFSEEQK"
FT   CDS             445165..446628
FT                   /transl_table=11
FT                   /locus_tag="CL2_04740"
FT                   /product="FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37544"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY49"
FT                   /protein_id="CBL37544.1"
FT                   /translation="MDKKKRLIQLTEGILLCCVIVVMTLLCIGIIKKEVKNTKGKLTET
FT                   TGWYRIQDNKKVQVDLNQKIKTDTQGKLVLYNDTIAQKYKGYLMTTKAAKYSVRIYAGD
FT                   QLIYQYSDSNFHRNDQMKSKLSCDARIPEQGKKGTVIKIIYQNGSNGIYDLDDILVGRG
FT                   DVVMGFHVQQEIVGIVMIAIMFFLSFVALTTGIYLKHFKLNSTRFLNIAAFLALSGIWF
FT                   LSDSALAQEYTSFPALTGMISFYAFMLMSVPMVHFVKNTLKFEKYKVLDVINLLFYANA
FT                   LIQGILNKCLKIHMVHMLFVTHVLLFIAVITIVVLMIEEYRRTKDSELKIIMNAFGIMA
FT                   VAGVLSLCMYWKLEIPFYGTIFEVGVLIFEQLLLTSIFVNLVEQAKTRSELEVYERLLK
FT                   EDRMTGINNRTAFEEQLQDIEDHAQDYDNAALIFMDVDGLKNTNDLYGHNAGDELIISA
FT                   ALCIKNVFATYGKCYRIGGMNFVCLFLIQ"
FT   CDS             446821..448740
FT                   /transl_table=11
FT                   /locus_tag="CL2_04760"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37545"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY50"
FT                   /protein_id="CBL37545.1"
FT                   /translation="MTDYNIDFLIAGLVFLIFLLIHFQRYKKLNNISGRTFWFLIIAGI
FT                   FDITFDLLSSILLVKSNPAYNSWMIFFSTMLYILQMIVVYIFYNYTQALRHCDEDIRTR
FT                   NIKIMAVPILCMEVAIVTNVLHKQFFYCNEQGQYVHGKAYLVTYIFTLICIAAVIINCF
FT                   INQEKYQKNELRAIKEFLGVALVCVTIQMKFQSVLMTGFGLSLGITILFWALYNPQLYI
FT                   DSLTGLYSKGYFRRWFPEQIKRKKELHLLMIDLWKLKQVNKLYGVTTGDELLIQIAEYL
FT                   HKINEANHVFRIHGNRFFVFTTSLMDYETNKDAIMKLFKRPFKVKGERISFSAAICGII
FT                   NVQEVKEIDVLIDYLEYLVQLKPKSDRTILIQNDQHTKEGFLYEQEVKKYMATAIEEDL
FT                   FEVYYQPLYDLKEKRYRTMKALSRLRHPSLGMISPEVFIGIAEKHGQIAKLGYLQFRKV
FT                   CKFIKEHPQIMEKIESIKYNLSPLELLKSGYSKKLLRTIEEFDIPFSYFQFEITETVAT
FT                   EYSEALYQTIADFKKSGIQICLDDFGSGYANLNTVLKLPFSTIKLDRSLLNGICYDDQV
FT                   ALLYKNIVAVMQNLGHKVVAEGVETQEEIDLLKQWGVDLVQGYYYTKPLDSEQIIHKLE
FT                   KDVC"
FT   CDS             448939..449076
FT                   /transl_table=11
FT                   /locus_tag="CL2_04770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37546"
FT                   /db_xref="GOA:D4MY51"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY51"
FT                   /protein_id="CBL37546.1"
FT                   /translation="MYKKLMTCLESVQKKIDFKPEVALILGSGLGDFADGIKIEQMIEM
FT                   "
FT   CDS             449119..449607
FT                   /transl_table=11
FT                   /locus_tag="CL2_04780"
FT                   /product="Cyclic nucleotide-binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37547"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY52"
FT                   /protein_id="CBL37547.1"
FT                   /translation="METKQQFLEEINKVKGSKRDYLNKLFQYVSEAVIRAAIHKNVKKD
FT                   EFIIRAGEPCDTVYIILKGDVVGVDYQKLGKVYYFMDFAKMYIVGDFEIFSEDTNYNVS
FT                   ICASKDSELLAIPASIYWKWIKHDENALLLRIKNIMTILTSEKASDRKYMFMSCKSVL"
FT   CDS             450170..450688
FT                   /transl_table=11
FT                   /locus_tag="CL2_04800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37548"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY53"
FT                   /protein_id="CBL37548.1"
FT                   /translation="MSTALMIEIFGYIGCIFVIISMLMTSVVRLRVINIYNLIKLSKAD
FT                   GNHYDMIRGDKEDSYLTYFIKHYKEDMKKYFLENTLKLSAADTIYTVCCEGVPAGVLAG
FT                   KKEGDALEISFDYTTPTYRDCSAGRFLYAKLAEEGYKKFICKKATEGHKSYLEKMGFVK
FT                   ENGVYVKNA"
FT   gap             450779..451037
FT                   /estimated_length=259
FT   CDS             complement(451066..452019)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04810"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37549"
FT                   /db_xref="GOA:D4MY54"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY54"
FT                   /protein_id="CBL37549.1"
FT                   /translation="MNSEQNLTREEAITILNTPDEQLNELIERAGALRKKYKGNHVSIH
FT                   LLTNARSGNCSQNCAYCAQSCRSHADIEKYKWVDDEKLYGDNTFVHDHKLSRHCIGLSG
FT                   MKFSDDEIEELASKIRKMKEEGTHLCCSIGFLTKKQALMLKEAGLDRINHNLNTSRSNY
FT                   PNICTTHTYEQRVNNIHMLQDLGFEICSGGIIGMGESKEDVVDMLLDLKEINPEALPIN
FT                   FLIPIKGTPLQDRDTSNLTPEYCLKVLCLARLLVPTSDIRCAAGREIYFKGREKELLTV
FT                   VNSIFASGYLTADGQGIQDTIKTITDAGFTCEVESD"
FT   CDS             452223..452705
FT                   /transl_table=11
FT                   /locus_tag="CL2_04820"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37550"
FT                   /db_xref="GOA:D4MY55"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY55"
FT                   /protein_id="CBL37550.1"
FT                   /translation="MQDINDKINNMHMGKLIHMLSHEMKRNQPIDKVIKADLTIMQKHI
FT                   LKFILLETMHKDLYQKDIEEEFQIRKSTVTGYVQLMEKNGYLTRESVKGDARKKRLVPT
FT                   EKAEGLRQAILEDIKLSEKRMEKGIPEEDVITCKHVLYQVLQNLIEKHKEEGKKDE"
FT   CDS             452698..454431
FT                   /transl_table=11
FT                   /locus_tag="CL2_04830"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37551"
FT                   /db_xref="GOA:D4MY56"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY56"
FT                   /protein_id="CBL37551.1"
FT                   /translation="MNKTLLKSVREYKKQSILAPILVILEVLMEVLIPMEMANIIDIGM
FT                   TSGDLHYIIQRGVILVVMAMLSLFFGISAGNMAAVAGAGYAKNLRHDIFYKVQEFSFKN
FT                   IDHFATSGLVTRMTTDITNIQMAYMMSIRLLARAPIMIILSWVMTLKYSVKVAILFLIV
FT                   IPLLGGTLIFIAKKAHPHFIKVFDEYDILNNSVQENVNASRVVKAFVREDYEIDKFHGI
FT                   SKYVYTLFTKAEKIVAWNSPVMQFTMYVVILLLVAIGGTGIIHGTMGTGELTSIIVYAL
FT                   QIIGSLMMVTFVFVMIMIAEASTDRITEVLEEVPEMQDKADAVTEVKDGEIIFDHVNFS
FT                   YAGEGGNLSLKDVDLHIRSGQTIGIIGGTGSAKSTLVQLIPRLYDVTEGCVKVGGIDVR
FT                   DYNLEALRDQVSMVLQKNVLFTGTIYDNIRWGDENASDEEVQRMCKLAQADGFVNEFPA
FT                   GYNTQIVQGGNNVSGGQKQRLCIARALLKKPKILILDDSTSAVDTKTDALIRKAFREEI
FT                   PNTTKIIIAQRVSSIEDADQIIVLDDGKIMGVGTSEELLKTNDIYREVYESQVKGGEDD
FT                   E"
FT   CDS             454424..456313
FT                   /transl_table=11
FT                   /locus_tag="CL2_04840"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37552"
FT                   /db_xref="GOA:D4MY57"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY57"
FT                   /protein_id="CBL37552.1"
FT                   /translation="MSKRPEKTINKNTAKTAKRLLKYVTDTYKLQFILVFVCIFISAAA
FT                   SVSVSLSLKFMLDDFILPLVGQSNPDFTNFYHAMIVLGCIFAAGVIATFIYTRMMVFIG
FT                   QGVLKRVRDDMFEHMQTLPIRYFDQNTNGSIMSLYTNDTDTLRQMISQAIPQALMSFFT
FT                   IIVTFISMLVLSPILTILAVVVIGIMITVTKAIGGNSGKYFIRQQKSLADVTGFIEERM
FT                   NGQRVVKVFNHERKSEEEFDKLNESLFESAANANKYANIMGPVVGNIGNLQFVLTAVLG
FT                   GVLAIEGIGGITLGVMASYLQFTKSFTQPFMQVAQQFNSIVMALAGAERIFALIDEEPE
FT                   TDEGYVRLVNAKKDENGNIIECEERTGMWAWKHPHSADGSVTYTELTGDVRFEDVTFGY
FT                   NEDKTILHDISLFAKPGQKLAFVGSTGAGKTTITNLINRFYDIQDGKIRYDGINIKKIK
FT                   KDDLRRSLGIVLQDTHLFTGTIKDNIRYGNLGATDEQIYEAAKLAHADQFIKMLPDGYD
FT                   TVISGDGEGLSQGQRQLLSIARAAVANPPVLILDEATSSIDTRTESIVQRGMDNLMKGR
FT                   TVFVIAHRLSTIRNSDAIIVLEHGKIIERGDHEDLIKNKGTYYQLYTGKLELS"
FT   CDS             456837..458165
FT                   /transl_table=11
FT                   /locus_tag="CL2_04850"
FT                   /product="Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37553"
FT                   /db_xref="GOA:D4MY58"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY58"
FT                   /protein_id="CBL37553.1"
FT                   /translation="MSINTADFAALAVTIVLFAVIYYLDYKKGVDFGLLTLLGTVFGIA
FT                   VGLGFGNHFTYVEIFGRIYTNVLTALVVPMLLFSIIASITNLSESIHLKKIGGKSIFYL
FT                   ILNTAIASTITVIAAVILKVGDGFAYKVADGYQKVEVPSVVDTIVNLFPSNFATNWSEG
FT                   QIIPIVVFAIIIALSYNAISKENESVKPFKAFIDAGNQVIGQAIDWIIGFTPYAVLSFL
FT                   ARAVGRSSVTELLPLLSTLVLSYILCAVQAFGVEGLLIKFVAKLSPVKFFKGIAPAQYV
FT                   AFTTQSSVGTIPVTLRQLKEALGVDGDVASFTAGLGANVGMPACAGIWPALTAVFSVHM
FT                   LGYHYGIAQYAFLILITLVVSVGTVGVPGTATITSTAVFAALGLPIELVVVFAPISTIV
FT                   DMARTMTNVTGAATAAVITAATEGLVDEEVYNSDQAKHVAVNN"
FT   CDS             458371..459936
FT                   /transl_table=11
FT                   /locus_tag="CL2_04860"
FT                   /product="Protein of unknown function (DUF1703)./Predicted
FT                   AAA-ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37554"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY59"
FT                   /protein_id="CBL37554.1"
FT                   /translation="MGNYLNPGNEKFRRMIQSEIYVDKTGMIKYTNSVLDTAQNYVCVS
FT                   RPRRFGKSMAANMLTAYYSRGCNSKELFGKFEIAKDKDFEKYLNQYNTIFLNMQEFLSR
FT                   SHNVEELIDRVKKLVIRDLKMEYPEVDYFDDTDLIECMQDIYAQMQYPFVVIIDEWDCI
FT                   FREYKQDKEAQEKYLDFLRDLLKDKACIYLSYMTGILPIKKYGTHSALNMFDEFSMIAP
FT                   GPLACYVGFTEQEVKKLCEQYGMDMEEVKNWYDGYSFDGVLSVYSPRSVVNSMRFRKIS
FT                   NYWNQTETFEALQMYIDMNFEHLKDDVLSMIAGESVAVNTESFTNDMATFRTEDDVLTL
FT                   LIHLGYLAYDDKTKTVKIPNSEIRAEYVNTVSVSDWGSVSKALKDSADTLNAIWQGREE
FT                   QVSKAIEQAHFETSHIQYNDENALSYTISLALYAARNFYTIHRELAGGKGFADLVFIPK
FT                   KQFAEKPALVVELKWDKSAEGAIKQIKDKKYFESLEEYQDNLLLIGINYDKKTKEHVCK
FT                   IEKY"
FT   CDS             459970..461559
FT                   /transl_table=11
FT                   /locus_tag="CL2_04870"
FT                   /product="Protein of unknown function (DUF1703)./Predicted
FT                   AAA-ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37555"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY60"
FT                   /protein_id="CBL37555.1"
FT                   /translation="MGRFVNPDNSAFQAALNSRIYVDKTGLIVCMNEVLDSTDAYICNS
FT                   RPRRFGKSYAANMLAAYYSKGAESEKMFSDLEIGQSEDFKKHLNKYDVIHIDVQWFLIN
FT                   CKDADNVVPYITKVVLDELREVYPEILRQEVVSLPDALSLVKDKTGQKFIIIIDEWDVL
FT                   IRDESANKKVQDEYIRFLRGMFKGTEPTKYIQLAYLTGILPIKKEKTQSALNNFREYSM
FT                   LNAGCLASYIGFTEDEVKALCETYKKDFTEVKRWYDGYQLGKYHVYNPNAVVNLMADGN
FT                   FQSYWSGTASYDSIVPLINMAFDGLKTAIIEMVSGASVEVDVGSFQNDVENIVNKDDVL
FT                   TYLIHMGYLAYSSVNRMAFVPNEEIRQELIRATKRKEWNEMLKFQQESEDLLDATLDMD
FT                   GEIVAAQIEKIHEEYVSAIQYNNENSLSSVLALAYLSAMQYYFKPVREFPTGRGFADFV
FT                   FIPKTEYRNDYPALVVELKWNKSAVSALQQIKDKKYPDSIQKYAGNILLVGINYSKKEK
FT                   KHECMIEEYLKK"
FT   CDS             461843..463180
FT                   /transl_table=11
FT                   /locus_tag="CL2_04880"
FT                   /product="Trk-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37556"
FT                   /db_xref="GOA:D4MY61"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY61"
FT                   /protein_id="CBL37556.1"
FT                   /translation="MPWKIHKKRHLTSFQVIILGFAGVILFGALILMLPISSVQGIITP
FT                   FHKALFTSTSAVCVTGLAVLDTGSYWSVFGQTVIMFLIQIGGLGVITTATAVFILSGRK
FT                   ISIMQRSTMQNAISAPKVGGIVRLMSFILKGTLLIELIGALFMMPVFCHDFGLRGIWMS
FT                   IFHSVSAFCNAGFDLLGTKWHPFVSLTSYAVNPVINIVIMLLIIIGGIGFFTWEDIYLH
FT                   KFHFKHYHMQSKVILTTTLCLILLPAVFFFFQDYGNLSGIHRLLASLFQAVTPRTAGFN
FT                   TTDLSMLTGASKAMMILLMLIGGSPSSTAGGMKTTTFALLLLNVLATFQSCDDVTAFGR
FT                   RIDASVIKNATTIAMMYFILFFAGGMTISVYEGLPLSSCLFEAASAVGTVGLTLGITPK
FT                   LHILSQIILIILMYLGRVGGLTLIYAVFSDKNKRKAKLPLDKIIVG"
FT   CDS             463200..463847
FT                   /transl_table=11
FT                   /locus_tag="CL2_04890"
FT                   /product="K+ transport systems, NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37557"
FT                   /db_xref="GOA:D4MY62"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY62"
FT                   /protein_id="CBL37557.1"
FT                   /translation="MKNILLIGLGRFGKHIAIQSSQLGHEIMAVDLDEERVNEALPYVT
FT                   NAQIGDSTNEEFLKSLGIANYDICFVTIGGNFQNSLETTCLLKELGGKMVISRAERDVQ
FT                   EKFLLRNGADKVVYPEKMVAKWATIRYTDDHILDYMEVDASHAIFEVEVPKEWIGKTVG
FT                   KLDIRKKYDINIMAVKDDGKVSMAISADTCFKEDVTLLVLGEYKAIKKCFCI"
FT   CDS             463873..464007
FT                   /transl_table=11
FT                   /locus_tag="CL2_04900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37558"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY63"
FT                   /protein_id="CBL37558.1"
FT                   /translation="MSDFILALAVILMFAFVLFFLKKVNYFLGENWKVIDREQDDDDD"
FT   CDS             464071..466047
FT                   /transl_table=11
FT                   /locus_tag="CL2_04910"
FT                   /product="Osmosensitive K+ channel histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37559"
FT                   /db_xref="GOA:D4MY64"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY64"
FT                   /protein_id="CBL37559.1"
FT                   /translation="MSTGEFVELNKENEHILVCLSSSPSNEKIIRTAAKMARDMRARFT
FT                   ALYVQTGKRERESDKRRLEAHVQFAKESGAEIVMTHGENVPVQIAEYAHLSNVTKIVIG
FT                   QSSAKRNHFFSKQTLTEKLIEAVPDIDIHIIPDAMNLDNYRKPHGAVYVGKPTMKDSLL
FT                   TLFIFAVCTLIGLFIQKLQFTDTNIVTIYILGVLLTSILTDGYLYSIGGSVLSVFLFCF
FT                   FLTEPRMSFQTYAVGYPVTFVIMLISSVITGTLAAKLKTHARLSAQSAFRTQILFDTDR
FT                   LLQKAKNDTDILSITCTQLIKLLDRSIVAYVVEGDELSAPHIFSNKKKEQIEDLLTSRE
FT                   QEIAKWVYENKQRAGATTERFKDAQCLYLAICIEDNVYGVIAIPVDEYTLDSFEYSILL
FT                   SVINECALAMENKKNIMEKEKISVLAKNEQLRADLLRAISHDLRTPLCSISGNADMLLN
FT                   SGERLDDITKHQIYTDIYDDSEWLINIVENLLSITRLNDGRLKLKFTDQLLDEVIAESL
FT                   RHISRKHEEYQIVTECDELILAHMDVRLILQVLINLVDNAIKYTPKGSTIRICAMNENG
FT                   KAKIQVEDNGPGICDEMKPHIFEMFYTGKNTIADSHRSLGLGLALCRSIIEVHNGKLVL
FT                   EDNTPHGCIFSFTLPLSEVTLNE"
FT   CDS             466040..466738
FT                   /transl_table=11
FT                   /locus_tag="CL2_04920"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37560"
FT                   /db_xref="GOA:D4MY65"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY65"
FT                   /protein_id="CBL37560.1"
FT                   /translation="MNKALILVVEDDRPIRNLIVTTLKTHDYKYITAENGSSAILEASS
FT                   HKPEIILLDLGLPDMEGVDVIKKVRTWSNVPIIVISARSEDVDKIEALDAGADDYITKP
FT                   FSVDELLARIRVTQRRLALIQSGEEQEQAVFVNGELKIDYTAGSTYLKDKELHLTPIEY
FT                   KLLCLLSHNVGKVLTHTYITQQIWGSSLENDVASLRVFMATLRKKLQPDKDGMQYIQTH
FT                   IGIGYRMLKI"
FT   CDS             complement(466871..467740)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04930"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37561"
FT                   /db_xref="GOA:D4MY66"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY66"
FT                   /protein_id="CBL37561.1"
FT                   /translation="MDFKNANELLDLCKKHDLPISEVMRQREIVEGEKEADTVHDAMAR
FT                   VLEIMKNAAFTPIKEPVRSMGGLIGGEAKKIASRYHSGIGICGDLLEKSMIYAMATLET
FT                   NASMGLIVASPTAGSAGIVPGLLLGLQEVHKLDDEQIIQALFNASAIGYLAMRNATVAG
FT                   AVGGCQAEVGVASSMAASATVELLGGNPKQCLGAASTVLMNMLGLVCDPVGGLVEYPCQ
FT                   NRNAAGVANAIIAAEISLSGIHQLIPFDEMLNAMYIVGKRLPAELRETAQGGCAATPSA
FT                   CAACGGCA"
FT   CDS             complement(467759..468427)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04940"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37562"
FT                   /db_xref="GOA:D4MY67"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY67"
FT                   /protein_id="CBL37562.1"
FT                   /translation="MSFISAFDVMGPNMIGPSSSHTAGAARIAFLARKMLNGTLKKVQF
FT                   TLYGSFAKTYHGHGTDRALLGGIMGFGTDDMRIRDSFEIAKDIGLDFSFVPNEIETDVH
FT                   PNTVDILMANENGDHIMIRGESLGGGKARICRINDVEVDFTGEYSTLIVIQKDKPGVVT
FT                   YITKCLSDQDVNIAFMRLFRESKGNTAYSIVESDGLLPENIAEEIRKSPNVSDVMIIQL
FT                   "
FT   CDS             complement(468431..469654)
FT                   /transl_table=11
FT                   /locus_tag="CL2_04950"
FT                   /product="Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37563"
FT                   /db_xref="GOA:D4MY68"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY68"
FT                   /protein_id="CBL37563.1"
FT                   /translation="MEKKKFKLGLVPKLIIAIIIGILFGQFLPTGFCRFVVTLSGFFST
FT                   YLKFIIPLMILAYVTMGIADLSQGAGQLLLITVALAYGSTLLAGTASYLVSSNLFPHFM
FT                   TSGALDQIAATADASLKPYFSLTITPLFDTLSAVVLAFILGLCLSTMKSKEIGNSLYNG
FT                   MSDFSTIIDKVLHKTIIPLLPLYICGTFTDMTKSGKTFAILGILWKVFLVVIIMHFVCI
FT                   TIQFIIAGSVSKKNPFSLIKNQVPGYTTALGTQSSAATIPVNLECAKNDGVSAQIRNFV
FT                   VPLCANIHMAGSMITITACATAVCLMNQLPISLATVIPFIMTLGVAMVASPGAPGGSIM
FT                   TALPFLYMVFGTTAGDTNGPICALMVALYITQDSFGTACNISGDNAIGIVVDSIYKKFI
FT                   LKEDTVEA"
FT   CDS             469827..470702
FT                   /transl_table=11
FT                   /locus_tag="CL2_04960"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37564"
FT                   /db_xref="GOA:D4MY69"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY69"
FT                   /protein_id="CBL37564.1"
FT                   /translation="MEFRQIQTFMQIAQVKNFSKTAELLGYSQSAVTVQIRQLETELGV
FT                   RLFDRTGKKVILTPKGKEFLIHANKIIDEMHKAKDAMNDTAELKNPLHIGTIESLCTVK
FT                   LQEIVQRFRKEHPQVRIQITIGSPERLIQKMEHNELDVIYILDTPRWNKNWVKVMEKAE
FT                   PVIFVSAPNYKLAGKKNIEVEEILNAPFYLTERNANYRQALEQELALHKQTLSPVLECS
FT                   DTAFIKKMLKTGKGLSYLPLFVVEKDIEEGKIAKLDVKDIDITMYRQVFYHANKYMTKE
FT                   MEKFVEYCRL"
FT   CDS             470960..471406
FT                   /transl_table=11
FT                   /locus_tag="CL2_04970"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37565"
FT                   /db_xref="GOA:D4MY70"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY70"
FT                   /protein_id="CBL37565.1"
FT                   /translation="MMMMPSIFGGNLFNDDWMDFSFPDIDKELYGKHAKNLMKTDVKEK
FT                   DGNYEVAIDLPGFKKDEITAELKDGYLTISAAKGLDKDEKDKEGKYIRRERYAGNMSRS
FT                   FYVGKDITEKDIHGKYENGILMLDIPKKAPEKKVEEKKFVTIEG"
FT   CDS             471488..472504
FT                   /transl_table=11
FT                   /locus_tag="CL2_04980"
FT                   /product="DnaJ-class molecular chaperone with C-terminal Zn
FT                   finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37566"
FT                   /db_xref="GOA:D4MY71"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY71"
FT                   /protein_id="CBL37566.1"
FT                   /translation="MAAKRDLYEVLGISKTADEKTIKKAYRKLAKKYHPDMNPGDKTAE
FT                   QKFKEATDAYNILSDPEKRKLYDQYGHAAFDGTGAESEFYKNYQNYGGAHGGYQEFHFE
FT                   GGDGDDIFGDIFGSMFGGGRNNKGFHRSSFHQGGFGSSDGFGGGGFGSGSFRQKGSDAH
FT                   ADISISFDEAVTGCDKVIHLQDQNGAMQSLQVHIPAGIDTGKSVRLRGKGNPGIGGGEA
FT                   GDLFLKVTVGEKQGFERKGNDVYTTINVPFSTAVCGGEAVIKTLYGNVICKIKEGTQSG
FT                   SKIRLRGKGMPLMKNPSQKGDQYAVVQIQVPRNVSQQAKNKLKEFEALCGQRGNASY"
FT   CDS             472708..473256
FT                   /transl_table=11
FT                   /locus_tag="CL2_04990"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_04990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37567"
FT                   /db_xref="GOA:D4MY72"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY72"
FT                   /protein_id="CBL37567.1"
FT                   /translation="MDVSEKMKYKLANAMKELLVHTPVDKITVKQIVDQCDVTRPTFYR
FT                   HFKDKYDLINWYFDVLAQMSFKQMGISLTLREGLLKKFEFIKGEGQFFAAAFSSESQNC
FT                   LMEYDYQCIYQFYCDIIHKQGVDKIPEELEFLLRMYCRGSIAMTVEWATTGMKMSPEQL
FT                   ADQLIDAMPPKLYDLFKDI"
FT   CDS             473392..474540
FT                   /transl_table=11
FT                   /locus_tag="CL2_05000"
FT                   /product="lactaldehyde reductase"
FT                   /EC_number="1.1.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37568"
FT                   /db_xref="GOA:D4MY73"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR013460"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY73"
FT                   /protein_id="CBL37568.1"
FT                   /translation="MVNRIVLNETSYHGAGAIQEIATEVTKRGFKKAFVCSDPDLVKFG
FT                   VTKKVTDVLDNAGLAYEVYSQIKPNPTIENVQTGVAAFKAAGADYLIAIGGGSSMDTAK
FT                   AVGIIINNPEFEDVRSLEGVADTKKPCVPIIAVPTTAGTAAEVTINYVITDVEKKRKFV
FT                   CVDPHDIPVIAVIDPEMMSSMPKGLTAATGMDALTHAIEGYTTKAAWEMTDMFHIKAIE
FT                   LISDSLRGAVENTPEGREGMAMGQYIAGMGFSNVGLGIVHSMAHALGAVYDTPHGVANA
FT                   ILLPTVMEYNADATGDKYKYIAKAMGVKGVEDMTQEEYRKAAVDAVKKLSADVGIPADL
FT                   KEIVKEEDIQFLAESAYADACAPGNPKDASVEDIIGLYKSLL"
FT   CDS             complement(474664..475998)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05010"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37569"
FT                   /db_xref="GOA:D4MY74"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY74"
FT                   /protein_id="CBL37569.1"
FT                   /translation="MANENKMGYLPIKKLILQMSLPPMCSMFLQYSYNLVDSMFVANIN
FT                   ENALAAVSLSFPITTLMISLSIWIGVGINVLIAGYLGEKEQDLADCATTLGLLVALIVG
FT                   ICINILALLIMKPYFSAFTNNPAIFDYAMQYMSVCAFMQVPNMVHIAIQKVFQGTGNMI
FT                   TPMWFQIAGVIFNFVFDPLLIFGIGPFPKMGIRGAALATVLGYALSMVIAFLLLVFTKQ
FT                   KVRIKIKGFHVDSHMLKNLFSYGFPSFVMNALGSFMLTFTNLFLTAYSDTVVAFFGAYF
FT                   KVQQMIFMTVNGLIQGCLPVMRFNYSAKQPERLKEAFHFGTQAATVMMIGGTCLLLFLP
FT                   KQILFLFAASESMIKIGVPAMRILSIGLVFCGFSIMIATYQQAIEKIQSSMLIHILRQG
FT                   ILLVPLMWLFNHMFGINGIWISFPVTEILVFIVAVLLQTVIPKPQ"
FT   CDS             476131..477567
FT                   /transl_table=11
FT                   /locus_tag="CL2_05020"
FT                   /product="prolyl-tRNA synthetase, family I"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37570"
FT                   /db_xref="GOA:D4MY75"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY75"
FT                   /protein_id="CBL37570.1"
FT                   /translation="MAKDKKLVEAITAMEDDFAQWYTDVVKKAELADYSSVRGCMILRP
FT                   NGYAIWENIQKVLDAKFKETGVENVAMPMFIPESLLKKEEDHVEGFAPEVAWVTHGGDK
FT                   ELQERLCVRPTSETLFCDFYSKIIQSHRDLPKLYNQWVSVVRWEKTTRPFLRTSEFFWQ
FT                   EGHTAHATEEEAEARTVQMLNMYADFCEQYLAIPVVKGQKTEKEKFAGAHSTYTIEALM
FT                   HDGKALQSGTSHNFGDGFAKAFDIQYTDKDNKLQYVHQTSWGMSTRIIGAIIMVHGDDS
FT                   GLVLPPRIAPVQTMIVPIMQKKEGVLDKAEEIRKRLVSSYKVKVDDSDKSPGWKFSEQE
FT                   VRGIPTRIEIGPKDIEKNQAVIVRRDTREKIIVSLDEIETKLGEVLEQMQNDMLERAKK
FT                   HLEEHTVEARNWDEFKAHIEKQDGFVKAMWCGETECEEAIKDETTATTRCMPFEQEHLS
FT                   DVCVHCGKPAKKMVYFGKAY"
FT   CDS             477704..479050
FT                   /transl_table=11
FT                   /locus_tag="CL2_05030"
FT                   /product="uncharacterized domain HDIG"
FT                   /EC_number="2.7.7.25"
FT                   /EC_number="2.7.7.21"
FT                   /EC_number="3.1.3.-"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37571"
FT                   /db_xref="GOA:D4MY76"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY76"
FT                   /protein_id="CBL37571.1"
FT                   /translation="MKIKMPAQAAKVIQTLEQHGFEAYIVGGCVRDSILGRTPGDWDIT
FT                   TSASPQEVKEIFDHTVDTGIEHGTVTVLMNHEPYEVTTYRVDGKYEDHRRPKEVHFTKS
FT                   LREDLLRRDFTINAMAYNDSEGIIDMYDGMTDLKNQIIRCVGEAKKRFDEDALRILRAL
FT                   RFQAQLGFQIEEKTEEAIKNQAKFLKDISAERIQVELEKLITSAHPEVLVNAYKLGVTK
FT                   IIFPEFDIMMETPQNNPHHKYNVGIHTIEAMKQIKAEHIYRWTMLLHDVGKPTARVEGP
FT                   DKDHFKMHPVIGEEMARKILRRLKFDNQTIKQVTTLVRWHDRRFASIEEVNKKTVRRWV
FT                   SQLTPELFTRLMEVQKADISAQSDYQRDKKEQVLQETKKLFEEIIEEKNCLSIKELKIN
FT                   GKDLMDMGVPQGKEIGQILSWLLDQVLEDPQLNECETLTRMAEEKRDAK"
FT   CDS             479047..479853
FT                   /transl_table=11
FT                   /locus_tag="CL2_05040"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37572"
FT                   /db_xref="GOA:D4MY77"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY77"
FT                   /protein_id="CBL37572.1"
FT                   /translation="MILLWIPVLIFAYIKMIDPGKKRKHPVLNVKYYAHRGFHGEEGIP
FT                   ENSMAAFKKARESGYGIELDVQLTKDGVMVVHHDYDLKRTCGVNKKIADLTYRELCRYR
FT                   LMGTRERIPRFVEVLREVDGKVPLLVELKMETCNRKLCKKVAKALDQYKGLYCMECFHP
FT                   YALYWFKKNRPEVIRGQLSEQFLKEKEEGTFTRKIGYFIVKNLLTNFITKPDFIAYHYK
FT                   YKDCLPLKICRRFYKIPIYGWTFRDKKAYKENEPYFEGFIFEKFVL"
FT   CDS             479905..480966
FT                   /transl_table=11
FT                   /locus_tag="CL2_05050"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37573"
FT                   /db_xref="GOA:D4MY78"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY78"
FT                   /protein_id="CBL37573.1"
FT                   /translation="MKKNVVVIFGGDSSEHDVSCLSATTVIKNMDTEKYNVILVGITKE
FT                   GKWLLVDGVKDIEDGSWREGEVKAFISPDTTTRSLVILAEGTYKLQKVDVIFPVLHGMN
FT                   GEDGTVQGLFELSKIPYVGCGVLASAVSMDKVYTKIIVDHIGIDQAKFVHVRESDFEHL
FT                   EEAMDRVEKEIPYPIFVKPSCAGSSKGVSKAENRKELEAALYEAVKHDRNILCEETIVG
FT                   REVECAVLGDRTQVKSTCVGEILAAEEAAFYDFDAKYNNAESKTVVDPEMPEESKRKIK
FT                   EDAEAIFRAVDGFGLSRVDFFLEESGRVVFNEINTLPGFTSISMYPMLWKACGLDIPEL
FT                   LDTLIDQAMTRYR"
FT   CDS             480979..481782
FT                   /transl_table=11
FT                   /locus_tag="CL2_05060"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37574"
FT                   /db_xref="GOA:D4MY79"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY79"
FT                   /protein_id="CBL37574.1"
FT                   /translation="MNAPIGVFDSGVGGLTVAREIMRQLPEESMIYFGDTARVPYGTKS
FT                   KDTIVRYSRQIVNFLLSKGVKAVVIACNTASALALADLQELYNVPIIGMVQPGAIAAMN
FT                   ATKNKNIGIIGTNATIKSGQYGQYLRKLDPSVTVVTKACPLFVPLVEEGLIDDRITEDM
FT                   VSRYLREFKQYDIDSLILGCTHYPLLINPIQRFVGDKVTLVNPAYEVAKTLKQMLAQRD
FT                   MAASEDHTAKYEYYVSDMADQFLSFADKVLPCRVDQVQPVDIENY"
FT   CDS             481797..482219
FT                   /transl_table=11
FT                   /locus_tag="CL2_05070"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37575"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY80"
FT                   /protein_id="CBL37575.1"
FT                   /translation="MTKDILINISGLQMDVDPNDPIEMMTTGAYYLRNGKHYILYDELS
FT                   EDNEIVKNVIKIGPKSVELTRKGGQSSHMVFEEGKENLSYYDTPFGSLLMGVNTSNIDW
FT                   IEEEEQMHLKVDYDLSMNSDHVSKCKIDVNIRPNGE"
FT   CDS             482222..483373
FT                   /transl_table=11
FT                   /locus_tag="CL2_05080"
FT                   /product="His Kinase A (phosphoacceptor) domain./Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase."
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37576"
FT                   /db_xref="GOA:D4MY81"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY81"
FT                   /protein_id="CBL37576.1"
FT                   /translation="MEQNEKGLMQWEKDFLISITILIIATIIAHIFFYQTAHNINVPMI
FT                   YTLATFFISRYTKGYGWGIVSSLLSVIFINWRFTFPYFKINFMIDGYPMTFLGILVIAI
FT                   ITNMTTTSLNREKEAAVKREKELAKLNEYNKQINELQIEKEKEKMRSNLLRAISHDLRT
FT                   PLTGMIGASSTYLEAKDQLDEEAKDQLVMGIKEDANWLLNMVENLLSITRIQSNGSDTQ
FT                   PHVKKVPEPLEEVVAEAIQRYQKRYPDSELKVKIPEDFLMVPMDPTLIEQVIMNLLENA
FT                   WVHSGSDAPIELDIKEEGNKVVFYIRDHGNGIAPERLDQLFDGCAGALDHESRKGMGIG
FT                   LSICKSIVMAHQGDVYARNYEDGAEFSFSLPMDEKELTEEKEL"
FT   CDS             483370..484083
FT                   /transl_table=11
FT                   /locus_tag="CL2_05090"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37577"
FT                   /db_xref="GOA:D4MY82"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY82"
FT                   /protein_id="CBL37577.1"
FT                   /translation="MTEIKFNVLIAEDEENIGNFISAILKTNGYKPIIATTGNQAIQCA
FT                   ESYCPDVILLDLGLPDMDGIDVISEIRKWAVTPIIVISARNRESEKVKALDAGADDYIT
FT                   KPFGNQELLARIRTALRHRRQPMGAETKTPMYHAGQLKIDFDKRRVFLGEEEIRLTQIE
FT                   YKLVSLLAENAGKVITYESIIKDIWGPHADTNNRILRVNMANIRRKIEKNPAVPKYVFT
FT                   EVGVGYRMLENELNS"
FT   gap             485830..486754
FT                   /estimated_length=925
FT   CDS             486761..487012
FT                   /transl_table=11
FT                   /locus_tag="CL2_05110"
FT                   /product="Nitrogen regulatory protein PII"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37578"
FT                   /db_xref="GOA:D4MY83"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY83"
FT                   /protein_id="CBL37578.1"
FT                   /translation="MGCGIQKGAGERYRGAEVDATLLPKVKVEVIVGNIPVENIIEAAK
FT                   KALYTGHIGDGKIFVYNVDKVIKIRTGEENLAALADVE"
FT   CDS             487688..488926
FT                   /transl_table=11
FT                   /locus_tag="CL2_05120"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37579"
FT                   /db_xref="GOA:D4MY84"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY84"
FT                   /protein_id="CBL37579.1"
FT                   /translation="MNAGDTAFILLCAAFVFIMTPGLAFFYGGMVRRKNVGNTMMQCVF
FT                   IMGVSVIMWVLVGYALSFGGNHAGIIGGAKWFGFNGVGMKPGPYAATIPNLAFAAFQMM
FT                   FAMITPALITGSVAGRMKFKALVLFIILWSLIVYYPMAHMVWGEGGFLAEIGSVDFAGG
FT                   NVVHITSGVSGLVLALTLGKRRGYDQGVYHVHNTPFVFLGAALLWFGWYGFNAGSALAA
FT                   NGLAAHAFMTTSVSAAAALVSWMLIEVFSEGKTTLVGASTGLVIGLVAITPGAGFVPMW
FT                   AAVICGLLVSPICYFGVKLIKGKLKIDDALDAFGCHGIGGIWGGIATGLFGMTSINGVA
FT                   KWNGLVFGETRLFVAQIIGILVSIAVAVVGSLICIAIVRIFTPLRVEERAEKVGLDVSE
FT                   HGENAYPSFNGLD"
FT   CDS             488942..489292
FT                   /transl_table=11
FT                   /locus_tag="CL2_05130"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37580"
FT                   /db_xref="GOA:D4MY85"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY85"
FT                   /protein_id="CBL37580.1"
FT                   /translation="MLIKINAIVREEKFEDVKEALNKIGVNGITVSQVMGCGAQKGFTE
FT                   VIRGTKVDMMMRPKIKFEIVVSSEEWERKTIEAIQKSAFTGEVGDGKIFSYEVRNVVKI
FT                   RTGERDVDALQD"
FT   CDS             489512..489937
FT                   /transl_table=11
FT                   /locus_tag="CL2_05140"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37581"
FT                   /db_xref="GOA:D4MY86"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY86"
FT                   /protein_id="CBL37581.1"
FT                   /translation="MKLVTLVSNNVGVDTYLELRKAVNFKPLSRTQAKKALDNSLYIVC
FT                   AYIDAKIVGMGRLVGDGAVICYIQDLMIHPDYQHYGIGSAIIEDLIEYVENLCEEGTEI
FT                   MLDLMCAIGREPFYHKHEFISRPTDKLGPGMIRYIRK"
FT   CDS             489949..490413
FT                   /transl_table=11
FT                   /locus_tag="CL2_05150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37582"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY87"
FT                   /protein_id="CBL37582.1"
FT                   /translation="MEDKRYDPYTGYEIKDEDSTQEYHTQDDDPYRRYRYEDDHIEQPQ
FT                   QEQTSGIAIATMILGIIAVVCMVSCCCTPIAIIIGIAAVICFAVTPKVRGTRGNKAKAG
FT                   LICGIIGIIGSVILITVFVVNILLSSDFQNEMKEFNTHYDTYIDENDDSI"
FT   CDS             490391..490759
FT                   /transl_table=11
FT                   /locus_tag="CL2_05160"
FT                   /product="Protein of unknown function (DUF2752)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37583"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY88"
FT                   /protein_id="CBL37583.1"
FT                   /translation="MKMMTLYKIIRSMPCFFKEVTHFYCPACGGTRSVIALLHLDIERA
FT                   FLCNPTVVYTGVMFLWCIAGWMVKKLTAREMKSMKPRLWMLILGVCIFFGYAVIRNILV
FT                   YQFGYDYLGDLIHYTKFN"
FT   CDS             490900..491655
FT                   /transl_table=11
FT                   /locus_tag="CL2_05170"
FT                   /product="Panthothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37584"
FT                   /db_xref="GOA:D4MY89"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY89"
FT                   /protein_id="CBL37584.1"
FT                   /translation="MKEWKEYLFKVNGFEMTAVYNEDTIQKVFLPLLKQLQQLQKEKKE
FT                   RIIVFMAAPPAVGKTTLCEFLEYLSKQDQEFTDIQALGLDGFHYHSDYINSHDAIVLGK
FT                   KVPMKQVKGCPETYDTEKLRQKLEKIKIEDILWPIYDRNLHDVVEDQIKVTKDIILIEG
FT                   NWLLLKQEPWKSMQQYVDYKILILAEEEMLKERLISRKEKGGLTREEAVAWYQNSDSKN
FT                   VTRVLKNSCRKHLNLLLQVEQDNDYLQVK"
FT   CDS             491778..492647
FT                   /transl_table=11
FT                   /locus_tag="CL2_05180"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II,
FT                   various bacterial and amitochondriate protist"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37585"
FT                   /db_xref="GOA:D4MY90"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY90"
FT                   /protein_id="CBL37585.1"
FT                   /translation="MLVSAKEMLNKAKAGHYAVGQFNINNLEWTKSILLAAEETRSPVI
FT                   LGVSEGAGKYMTGYKTVVGMVNGMLEELNISVPVALHLDHGSYEGCYKCIEAGFSSIMF
FT                   DGSHYPIEENIEKTKELVKVAKGKGMSIEAEVGSIGGEEDGVIGRGECADPKECKSVAD
FT                   LGVTMLAAGIGNIHGKYPENWEGLSFETLDAIQQLTGDMPLVLHGGTGIPDDMIKKAIS
FT                   LGVAKINVNTECQLAFAEATRKYIEDGKDLEGKGFDPRKLLAPGAEAIKDMVITKIKLF
FT                   GSEGKADE"
FT   CDS             complement(492736..493665)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37586"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY91"
FT                   /protein_id="CBL37586.1"
FT                   /translation="MSKNKKSLQDLTLLDRFLFAEVMEDPKTFENILSIILGEDISIKG
FT                   RPQSEHESRTSPLKRQVRLDVWAEDETDAVYNVEAQKENTKNLPHRSRFYQALIDSKLL
FT                   DPGEVDFSNMKDCYSIIIAPFDLFGRGLYQYTFQMTCAETGQPLEDGATRIFLNTHGKN
FT                   SEDISPELKELLYYMEHTTEEISCSTSRLQEIKNHVNIVKSSEEIGVKYMQEWEEKILE
FT                   KRKARAEGLAEGRAEGRVKGRAEGETFQLIQLIKKKIQKSKSFIQIADELEEEPDNIQS
FT                   LYECISQNINLTTEEIYKIYISPDKTED"
FT   CDS             493819..494247
FT                   /transl_table=11
FT                   /locus_tag="CL2_05200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37587"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY92"
FT                   /protein_id="CBL37587.1"
FT                   /translation="MQAIKKQWFTLLLMIIQAVIIIFIQTEIGSVSLCNLMFIAIFAED
FT                   ERNVFLKLAWEDKFYFYVQYIVMYLMTLIFGLILALDHGSGSITVTTKAFNALQMINII
FT                   LRFIMTYGLIAQEEDRRKLYFHSVLMLVFFVLTAIAYS"
FT   CDS             494277..495002
FT                   /transl_table=11
FT                   /locus_tag="CL2_05210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37588"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY93"
FT                   /protein_id="CBL37588.1"
FT                   /translation="MKQNKKTVMIIGCIITICTFIAAVLIGWNHMVKITKGPKNEKEIG
FT                   YYQWNHDQMDSFLDITTFTYYGDRYETADGGGDGAMSFGYLEASMKGRKPAFWLKETMN
FT                   QTDKKIVKTISWWKVAAEPVYALSSNSGCDMVFLDPSDKAMMQTVFWKVKDRQKLEAYY
FT                   TNFDNYNFKLTESKTNERKTISSKEAKQYARLQQIRKDAQNVKKQYTIYGESKDHIAYV
FT                   EFDIMTVGGKQYLGKDEEW"
FT   CDS             495100..495786
FT                   /transl_table=11
FT                   /locus_tag="CL2_05220"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37589"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021586"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY94"
FT                   /protein_id="CBL37589.1"
FT                   /translation="MDNVERLMEFGLTRHEASLYILLTLEGSLNGYEAAKQSGISRSNA
FT                   YNALAGLVDKGAAYIQEEDTVRYTPVAIEEFCSNKIRHLEQKKTELIAELPGKRKNEGG
FT                   YLTIKGEEHICDKIIDMLLCAEERAYISVYNERLEMFREHLEKMVSEGKKVVIITNEPF
FT                   DLQGATVYLTECKKEQIRLITDSKDVLTGAITNRYEATSLYSSNNNLVEVFKDALANEI
FT                   QLLKMK"
FT   CDS             495823..497073
FT                   /transl_table=11
FT                   /locus_tag="CL2_05230"
FT                   /product="Diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37590"
FT                   /db_xref="GOA:D4MY95"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY95"
FT                   /protein_id="CBL37590.1"
FT                   /translation="MAKVPFVTKEQLDEIVKKYPTPFHLYDEKGIRETARGLYKAFSWN
FT                   KGFKEYFAVKATPNPTILKILKEEGCGTDCSSLTELMMSDRCGFDGSEIMFSSNDTPAE
FT                   EFILAKQLGATINLDDITHIEFLKECAGIPEKISCRYNPGGVFALGTDIMDNPGDAKYG
FT                   MTTEQIFEAFKQLKELGVKEFGIHSFLASNTVTNEYYPTLAKQLFELAVKLKEEVGVHI
FT                   GFINLSGGVGIPYLPDQEGNDIAVIGEGVHKVYDEVLVPAGMGDVKIFTELGRYMLAPN
FT                   GHLVTKAIHEKHTHKEYIGVDACAVNLMRPAMYGAYHHITVMGKENEPADHVYDITGSL
FT                   CENNDKFAIDRKLPKIDMGDLLVIHDTGAHGFAMGYNYNGKLKSAEILLKEDGTTEMIR
FT                   RAETPEDYFATIKGFNF"
FT   CDS             497241..497909
FT                   /transl_table=11
FT                   /locus_tag="CL2_05250"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent, beta
FT                   subunit"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37591"
FT                   /db_xref="GOA:D4MY96"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY96"
FT                   /protein_id="CBL37591.1"
FT                   /translation="MNLFDIVGPVMVGPSSSHTAGAVRIGQVSRHLLGESVKEAKILLH
FT                   GSFLATGKGHGTDKALVAGLLGMAADDIRIPDSFDIAKESGVKFEIGKIQLKNAHPNSV
FT                   KLLLVGESGRNLEIVACSLGGGRIKICTIDGLEANFSGEYTTLVVHNDDQPGHVAEVTS
FT                   MLAHKSVNIATMQLYRDHRGGSAVMVIECDKEIPEEGLNFLERLEGIQKVTYIAKMKED
FT                   "
FT   CDS             497913..498776
FT                   /transl_table=11
FT                   /locus_tag="CL2_05260"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37592"
FT                   /db_xref="GOA:D4MY97"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY97"
FT                   /protein_id="CBL37592.1"
FT                   /translation="MGFASVEEIETRAKEQECQLWETILHDDMTERQVDRLESIGKMSS
FT                   MYLAMKDANESYDKDLKSQSGLSGGDGEKMMEEVRKMQNLTGEFVGTVMANALKMGESN
FT                   ACMKRIVAAPTAGACGVLPAVLITYEQFHKVPEAKMLEGMYIAAGVGQVIAERACIAGA
FT                   QGGCQAEIGSASCMAATAITYIRGGSTKQIFDAGAFALKSLLGLVCDPLGGLVEVPCIK
FT                   RNVIGSVNAITASDMAMAGIESKVPLDEVIDAMAEVGDLLPCSLKETSQAGLAQTETGK
FT                   KYMPES"
FT   CDS             498805..499536
FT                   /transl_table=11
FT                   /locus_tag="CL2_05270"
FT                   /product="Uncharacterized protein involved in copper
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37593"
FT                   /db_xref="GOA:D4MY98"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY98"
FT                   /protein_id="CBL37593.1"
FT                   /translation="MIEVCCGSFEDAMMASECGIKRVELNSALSLGGLTPSLGSLIMIK
FT                   QYSDIEIVSMVRARAGGFCYTNYQYEQMLENLKLLLAYGTDGVSFGFLNEDRTIDKNRC
FT                   QEFLENVKNEGRKATFHRAFDCTRDPYEAIETLIDLGFDRLLTSGQEATAEEGIHLLAD
FT                   LQKKYGNQIEIIAGCGVNENNAQKIIDKTGIKQLHSTCRGWGVDATGMGERVSFQVSDE
FT                   DGDRYRSVSVDRIKKFVQICG"
FT   gap             499549..499904
FT                   /estimated_length=356
FT   CDS             500698..501717
FT                   /transl_table=11
FT                   /locus_tag="CL2_05280"
FT                   /product="Predicted Na+-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37594"
FT                   /db_xref="GOA:D4MY99"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="UniProtKB/TrEMBL:D4MY99"
FT                   /protein_id="CBL37594.1"
FT                   /translation="MKQLQKLSKFLSDYTSIVVIAIAVITFFLPSLMGWVNFQLFTDPV
FT                   ANKFTSQSIIIGVIMFSMGLTLTTEDFKILAQRPFDICIGAIAQYLIMPFLAFAITKLL
FT                   NLPDGIALGLILVGCCPGGVSSNIMSYLCGGDVAFSVGMTTVSTILSPVMTPLMVSFLA
FT                   SGAKITIHGLPMFVSIIETVIVPVAIGFALNYALGKNEAFKEVQKVMPGVAVLGLACVV
FT                   GGVISSQGSKFFQSGIVIFVAVLLHNGFGYFLGYCAGKLTGMNTAKKRTISIEVGMQNA
FT                   GLATNLATTTAQFASTPESAIICAVSCVWHSISGTLLAGMFAQYDKIKSGHKETATAK"
FT   gap             501920..502423
FT                   /estimated_length=504
FT   CDS             complement(502457..503410)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05290"
FT                   /product="NTP pyrophosphohydrolases containing a Zn-finger,
FT                   probably nucleic-acid-binding"
FT                   /EC_number="3.6.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37595"
FT                   /db_xref="GOA:D4MYA0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYA0"
FT                   /protein_id="CBL37595.1"
FT                   /translation="MIQDIYPHKLNNQYHPDQKPDADSIILYFTQEGLLHRLLKKEDLE
FT                   EMGQEDLFSLDEMIYTGDGKKLARPTLLNEEHLFLSFPRLSDFVNDTHVTEETLTYLFS
FT                   VDDDNYFLLNEAPEEIPEDYEFNTVRELRNLQIGPKYRTFAAITGLHLYNWYRTNRFCG
FT                   CCGHKTVHSSTERALKCPSCGHLIYPRIVPAVIVGVKNGDKILLTKYRKGFTPFALIAG
FT                   FTEIGETLEETVAREVMEEAGIRVKNIQYYKSQPWGVVDDLLAGFYCEVDGDTEIHMDA
FT                   SELKLAEWKSRDEIELQPNDFSLTNEMMRAFKEGKF"
FT   CDS             503666..506461
FT                   /transl_table=11
FT                   /locus_tag="CL2_05300"
FT                   /product="YhgE/Pip N-terminal domain/YhgE/Pip C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37596"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYA1"
FT                   /protein_id="CBL37596.1"
FT                   /translation="MLKREWQKISKNPWMIIILIAIITIPAIYTSVFLGSMWDPYGDAD
FT                   QLPVAVVNHDKKVNYEGKTLQVGDDLAKNLKDSGSLDFHFVSDKKAEEGLKSGEYYMII
FT                   SIPENFSKNATTLMDKNPKQMKLTYKTNPGTNYVASKMDDSAIARIEKSVREKVTETYV
FT                   KTVFDQIKTAGSGFQKAADGSKKIESGAKKLKAGNDTIEQNLKKLASSTLTFQNGAKSL
FT                   SVGLKTYTAGVAKVDSGAKSLKSGTKTLKNGVAALQTGATQLSNGSKSLKLGISQYTNG
FT                   VSTAQAGSKQLAENNKVLNAGVEKLSSGSKDLKDGTGTLSAGLKNLLGQTKETSNGLGT
FT                   QLKENEAKKDGIISKRSNFDTQLEAFNTKLNELNQMLSAGSTASETSTQTANNETAKKA
FT                   ASSAANAKSSVSDLNSKVSKLKNSSVLDKLSEEDKKALLAEIDEVDSAASDVENNVDET
FT                   YTNAQKAADTKTTAKTQSASSEQQLATVKAYVSSLAKSSKQLAESSQTLSGYEKAMMNG
FT                   LYEGLNEVKTTLDRQGTTQDTMGMIQALTQLSEGATKVQTGMTTLESGINDSTSGLKIG
FT                   IANYTAGVESLNTGLTTLTNNSKALNSGATQLNSGIGQVSSKLPTFKSGTAKLYKGTKT
FT                   LKSGTAALVANNNTLNSGAGQLASGAGQIASGSSQLAAGSTTLGNGIGTLQSGSKTLKD
FT                   SLQKGADQVNSIKATKKTNKMFAAPVKAKNVEYSHVDNNGHAMAPYMMSVGLFVACMAF
FT                   TLMYPLMEKNEEVKSGLQWWLSKVTVMAAVSIAQAVIMVAVLMGINGLEPHYVGKTFGM
FT                   AVLASMAFMSLICFGEMLLNRVGSYVMLVFMVVQLGAAGGTYPLDMAPHFYTVLHKYMP
FT                   FSYTVHAFRHTLSMDGRIGQDIAVFVGILVVSTLATIIFYRFRMKKQVGGTLEPNGAPQ
FT                   H"
FT   CDS             506700..506771
FT                   /transl_table=11
FT                   /locus_tag="CL2_05310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37597"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYA2"
FT                   /protein_id="CBL37597.1"
FT                   /translation="MKKTKIPRKKVRGKKATVTIKIK"
FT   CDS             506894..509590
FT                   /transl_table=11
FT                   /locus_tag="CL2_05320"
FT                   /product="Bacterial surface proteins containing Ig-like
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37598"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYA3"
FT                   /protein_id="CBL37598.1"
FT                   /translation="MQKGWKVFSHLNGKSRKKLLACLLSISMIPVNGFTVMAATADQGN
FT                   QAAVTQEGTTTPTVTSGISFAAESQNVTVGNFKYYEFQGTQAKDFDKVNFNISDQTALK
FT                   IEQKTFKQADGTEVVKYMPIALKDSGKVTVIATFEKNKKPLDGVSAQLEFNLSKDDNII
FT                   PFTSQTMYQVFSGKEEGALTKADLAAKTEINLSDKGLTDAEVAYLQYATGCEKLDLSKN
FT                   TNVSKIDALKSMTNLKEINLEGTKVSIADRIALIKKDSITVEKGAKTNDPIRPKGILKG
FT                   CKYVKYSEEVAAGTTAKLKSIQVQSDGSISLEAVDTAEVGTTNLKVESTTTPTVSATIP
FT                   VNVTAKSATTPEFDKNDPNVSVGAFKKQIKLNNLEKDDVVTITSKDAKILNIRTETAQD
FT                   GTKTYYLEPKAAGKATVEAVVARAGKTYTATIEIQVAAVGKDIIPLTSYKVYDALEADA
FT                   NNDGMISTEEIKNVKSINLENKDLTNADLAGLSEAVNCEKIDLENNKNITDISFIKNLK
FT                   QLKTLYLRGTSVTDFTALNDLKAQLESLYLPTTASTATRMSFLSDSLYLKEGQELTIQQ
FT                   FTKGVFVDSKEACTITSSNLAAVSITGDKIKAGTKGQMATLTLKAGTTTKTIKVYTTDE
FT                   TGKIPTQAVVLNKTFVTLNPGKTEQLKITYLPDYATASIGTVKWTSSNEAVVTVDAAGK
FT                   LTAKAAGKAIITAITSDGNVMYCIVTVENIKVSKITITTTTSNKIATGKKVTLKATVTP
FT                   SNAYNKGVTWKSSNTKVATVSSSGVVTTKKKMGGKTVTITATAKDGSGKKASYKIYVKK
FT                   GIVKKVYISGVKSVKAGKKLYLKGKTSASSGANRTLKWSSSNTKYAKVSSKGTVTTYKA
FT                   GKKKSVKITARAVDGSGKSKTVTIKIK"
FT   CDS             complement(509712..510389)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05330"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37599"
FT                   /db_xref="GOA:D4MYA4"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYA4"
FT                   /protein_id="CBL37599.1"
FT                   /translation="MSENNKLIFLDVDATLYSKEQRLVPESTIKAIHEAQENGHKVLIN
FT                   TGRPLVYFEKEILDIGCDGYLCSNGVHILLDGETIYHKTVPETVVEQIKRICEENNIYG
FT                   TFEGEKCSYFRDHNVDFHPHYGFMITAFDLAPYMAHEFTWDHVENPDKGTGLTYVADHL
FT                   NISTDDCYAFGDSNNDISMFKAAGHGIAMGNACDELKEIAEYVTDSVNDDGIYHAFEHY
FT                   HLI"
FT   CDS             complement(510483..510968)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05340"
FT                   /product="Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37600"
FT                   /db_xref="GOA:D4MYA5"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYA5"
FT                   /protein_id="CBL37600.1"
FT                   /translation="MANPIVTITMENGDVMKAELYPEIAPITVENFVNLVKDGFYDGLT
FT                   FHRIINGFMIQGGCPLGTGTGGPGHTIKGEFSQNGVINNLKHTPGVLSMARSMMPDSAG
FT                   SQFFIMHKAAPHLDGQYAAFGKIIEGMDVVNKIAEVATDYSDKPLEPQVMKTVTVEE"
FT   CDS             511237..512199
FT                   /transl_table=11
FT                   /locus_tag="CL2_05350"
FT                   /product="Predicted periplasmic solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37601"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYA6"
FT                   /protein_id="CBL37601.1"
FT                   /translation="MDLYLDFDHNSRRRRRGRRRGRRNRSRAPFVIGVIILLVIIVAGG
FT                   IFAGRKYMAYRQQKAEEARKLAEARRVVTVMIPEGYSIDMIAKRLEKQGVFKADEFIKA
FT                   AKNTNQYKNDFIKDIDPKKGTKYKLEGYLYPDTYKIYKSSKPEDLIQKMLDNFDKKYSA
FT                   LAKSYKGKRSMAEIMTIASMIEREASNMSERPMIAGVIENRLAAKMRLQIDPTVLYTTT
FT                   NGLYNAKKVYYKDLKVKTVYNTYVMKGLPAGPICNPSDTAIKAAMHPKKHDYLYYRTDG
FT                   SKKGTHVFTKTFDEHKNAKSTSTKDKNSTNSTNTTNSKS"
FT   CDS             512464..515985
FT                   /transl_table=11
FT                   /locus_tag="CL2_05360"
FT                   /product="pyruvate:ferredoxin (flavodoxin) oxidoreductase,
FT                   homodimeric"
FT                   /EC_number="1.2.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37602"
FT                   /db_xref="GOA:D4MYA7"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYA7"
FT                   /protein_id="CBL37602.1"
FT                   /translation="MARKMKTMDGNTAAAHVSYAFTEAAAIYPITPSSPMAESTDQWAT
FT                   QGKKNIFGHPVKLVEMQSEGGAAGTVHGSLAAGALTTTYTASQGLLLMIPNMYKIAGEQ
FT                   MPCVFDVSARALASHALNIFGDHSDVYACRQTGFAMLCSSSVQEVMDLGAVAHLATIKG
FT                   RVPVLHFFDGFRTSHEIQKIEMWDYDDLADMVDYEAIDKFRAECLNPEHPVLRGSAQNP
FT                   DIFFQAREAANSTYNAFPAIVEDYMNQVNAKIGTDYKLFNYYGAEDAESVIIAMGSVCE
FT                   TIDETIDYLMKQGKKVGVVKVRLYRPFVAEKLVEAIPDTAKVINVLDRSKEPGAREPLY
FT                   LDVVNALRGTKFESCTINGGRYGLGSKDTTPADIIATFENVDKNEFTLSIVDDVTNLSL
FT                   ERGETPVTAPDSIVACKFWGLGADGTVGANKNSIKIIGDHTDKYAQAYFDYDSKKSGGV
FT                   TMSHLRFGDDPIKSTYLINKADFVACHCAPYLTKYNMVQDLKDGGTFLLNCSWTPEEVG
FT                   EHLPGQVKAYLAKHNIKFYIIDGIKIGKEIGLGGRINTVLQSAFFKLSGIIPEEDAIKY
FT                   MKDAATASYSKKGEAIVKMNHDAIDAGAKAIVEVPVPAEWADAETESLFVEAKGDNKPL
FT                   VDYINNVQNYVNGQEGNALKVSDLVPYVDGHMPLGASAFEKRGVAVDVPSWNPDNCIQC
FT                   NFCAYVCPHATIRPVAMTEEEAKAAPAATKTADMTGMPGYKFAMTVTVLDCLGCGSCVN
FT                   ICPGKKGEKALTMQGLDSQRDQQEVYDYGQKLPAKEEVLAKFKADSVKGSQFRQPMLEF
FT                   SGACAGCGETPYAKLITQLFGERMYIANATGCSSIWGGSAPATPYTTNAKGQGPAWANS
FT                   LFEDNAEFGLGMFTGQNTLREQTKEKVVALAESTDNADVKAAAAEYLDTYADGSKNGAA
FT                   TDKLVAALEACGCDAAKEILAKKEFLSKKSQWIFGGDGWAYDIGFGGVDHVLASGEDVN
FT                   VFVFDTEVYSNTGGQASKSTNLGAIAQFQAAGKGTKKKDLAAIAMSYGYVYVAQIAMGA
FT                   DYNQTVKAIAEAEAYPGPSLVIGYAPCINHGIKGGMKIAQTEEKKAVTSGYWNLFRFNP
FT                   ALAAEGKNPFHLDSKAPTTEYEDFIMGEVRYNALSRQNPERAKELFAEAKANAEAKYNR
FT                   LKEMSDK"
FT   CDS             516131..516463
FT                   /transl_table=11
FT                   /locus_tag="CL2_05370"
FT                   /product="Aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37603"
FT                   /db_xref="GOA:D4MYA8"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYA8"
FT                   /protein_id="CBL37603.1"
FT                   /translation="MCSVFDNEEVGSGTKQGAGSTFGADVLKYNVAQKYTTDARSAAPE
FT                   KAAYIYAGQIRDELGSRLDLLEKNAYRFCYINDFPMSGTAQDLMYGAPSEITEQQLREV
FT                   HIKVRD"
FT   CDS             complement(516869..518173)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05380"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN/SigL"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37604"
FT                   /db_xref="GOA:D4MYA9"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYA9"
FT                   /protein_id="CBL37604.1"
FT                   /translation="MNFSPKTTLVQTQTLSQTQLQSLKILSLDNFELNNFLQNEYIENP
FT                   LLDYNENSNLPSWNQYVSYSSAKEDEDIYKEIPDFSENGIKEFLLDQLNQRNFSDLQWT
FT                   AMQTMIDCLDDCGYFKLSLKDFSQWFGIDISTVKYCLDILSSLEPLGIFSKDLPHCLLR
FT                   QLEARQELTPELNQIIRYHLDDIAAGKINTITQKLSMSTQDVRKCIAKIRELNPRPISG
FT                   FLTNSTDYIVPDILIDYQDSSWIIRLNDQWIGNYSLCDYYLNMMHTSQSPELKEYFRKK
FT                   YNRVQLIMHSIEQRRETILKITSAVLERQKDYFTGNSTLKPMTLADIASDISMHTSTIS
FT                   RGIKNKYLQYPFGVVYLKDLFTSSAGKKDNNSPITVKKQLKAIIASENPNKPYSDSTLS
FT                   NLLKQKGIKISRRTVAKYREEIGIKSTYNRKIYNE"
FT   CDS             complement(518195..518614)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05390"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37605"
FT                   /db_xref="GOA:D4MYB0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYB0"
FT                   /protein_id="CBL37605.1"
FT                   /translation="MKKKLLIATHSVFADGIKNAMELVTGEQNSVSTLCAYTNDMTEVE
FT                   TPIKEIIDALCDDEELIVTTDIFGGSVNNEFMKYLSKSNIHLIAGVNLPLLFELIMNLE
FT                   SENTVQMIENAIQNAKEQLQYCNPLIQCSITEENF"
FT   CDS             521687..522556
FT                   /transl_table=11
FT                   /locus_tag="CL2_05410"
FT                   /product="ketose-bisphosphate aldolases"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37606"
FT                   /db_xref="GOA:D4MYB1"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYB1"
FT                   /protein_id="CBL37606.1"
FT                   /translation="MMIPMGELLAKAKKEGYGVAAPNVFNRETIEACFLAAKKLRAPII
FT                   LDVAAVHGIYECADIARYYEKQYPEVPFALNLDHGGAYEDIVKAIHAGFSSVMIDRSTC
FT                   AYEKNVEEVKEIVKIAHAVGTSVEAELGHVGQGAEYEETRDAGLTKLEEALKYVEETGV
FT                   DCLAVAVGTSHGVYKGEPHLEFELLDHLSKEVPVPLVLHGGSGTGDENLAKAVRTGIQK
FT                   VNLNTDVSEAGKQALREALASTEVHGSGKDEFTPKKMNLQQTIAAGVAGFQAELEHYMK
FT                   LFGSENRW"
FT   CDS             522550..523392
FT                   /transl_table=11
FT                   /locus_tag="CL2_05420"
FT                   /product="Sugar phosphate isomerases/epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37607"
FT                   /db_xref="GOA:D4MYB2"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYB2"
FT                   /protein_id="CBL37607.1"
FT                   /translation="MVKTLGIEQFAPMNHIYRFYELNDYMKSIAEIGYHSMDLWTCGSH
FT                   YFVDSNNYEDTKYIKKLMSQYDIRIVSITPRQSCPNPFHMAVKKTELREKAKQYFQNMI
FT                   LAAHELSCPKLLITSGWQSYSETRQEAWDRSVWMVGELCRFAEKYGVSLTMETLSRQST
FT                   TLVNTISDLKQMMKEVNSKAFTITADIHTIYNAKESIQDYFDTFGKKLNHCHFMDYKNG
FT                   IRSHLAWGDGEADIKEILDIFDRNRFSGHFVLEYTDSKYFLEPFKVYEKTYHIIRQNL"
FT   CDS             523412..524467
FT                   /transl_table=11
FT                   /locus_tag="CL2_05430"
FT                   /product="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37608"
FT                   /db_xref="GOA:D4MYB3"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYB3"
FT                   /protein_id="CBL37608.1"
FT                   /translation="MSERKTTRFAVLEAERVVKVHEREIPALKADEVLIKNGACNICTT
FT                   DYGQYTGARKNLMFPMAWGHEFAGTIVDMGSDVKEFEVGEMVGIGYDNCGECEFCKKGL
FT                   TSECVTLGAGRNKLSPDGYHGGFGCSEYVIKPYRSLFKLNQNMDPSEAAFVEPVGTVCQ
FT                   GIRKLRVQQGEKIVVIGAGTMGVLNALVAKAEGCEVMITEMMDKKIEVAKELGLNVVDV
FT                   KEKDPVEAVKEWTDGRGVDAVILAVGVTAANDQALEMIKRLHGRILMFAAGYPAPELHV
FT                   DSNLIHYRKMELIGTFSADKCDFERAAELMREKKIDLSKLVEAKYKLDDVEQAFEAAIV
FT                   PGAYRVSVVFD"
FT   CDS             524484..524963
FT                   /transl_table=11
FT                   /locus_tag="CL2_05440"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37609"
FT                   /db_xref="GOA:D4MYB4"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYB4"
FT                   /protein_id="CBL37609.1"
FT                   /translation="MIKLLRVDYRLVHGQVAISWSRHIGADCILVANDEVAKDEMRQSM
FT                   LRLSKPQGMKLVIKSIEDSVKSIKSGVTDKYKMFIVVNNIQDVERLAKEIPELNYVNLG
FT                   VLPANENTKALSKAINVTSEDVKTLKKLLAKNIEIDIQQVPTEAITHVDEKLLES"
FT   CDS             524975..525745
FT                   /transl_table=11
FT                   /locus_tag="CL2_05450"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37610"
FT                   /db_xref="GOA:D4MYB5"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYB5"
FT                   /protein_id="CBL37610.1"
FT                   /translation="MLIKAILVGLVLGLCKSEWIYGFPQVGRPIVVSTLTGLFLGDPVQ
FT                   GVIMGSVLELMFIGSFPIGAAVSPDYTSAGAICTAFAILTGGGKAVATAMALPIALLGG
FT                   FIFIGCKLMNAAFGQIMMKYLEKDDSKGASRIYIMGSVFTCFVVYFAYAFVCIFAGSAA
FT                   VEAAVNAIPKVIINGLAASANLLPAVGFALLLQMVITKKMSPYFFIGFILAAYLSMPTI
FT                   AVTLLGIMFVLVMVTSQNNQLAAEENAGGDENEF"
FT   CDS             525735..526547
FT                   /transl_table=11
FT                   /locus_tag="CL2_05460"
FT                   /product="PTS system IID component, Man family (TC 4.A.6)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37611"
FT                   /db_xref="GOA:D4MYB6"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYB6"
FT                   /protein_id="CBL37611.1"
FT                   /translation="MSSKIEKKDLKTIYRRYLALNCMNDYPGQMHNGYTFSLLPVLDKI
FT                   YKDNKEERIKAKKRHMEYFNITPNIAGFALGISTAMEEENAKNPEFDDTTINTVKTALM
FT                   GPLSAIGDTLFPATLRILATSLVITMAAAGNVFAPILFLLIYNIPNYLARWYSLKYGYS
FT                   MGMEFMVKSQKSGIMDKVSYACTVVGLMAIGAMIFYTVNISTPITIGNVKNGGIVLQTT
FT                   LDTVMPGMLKIALVGIEYWLLKKGVKVVPLLIGTMAVGVLLFAIGAIA"
FT   CDS             526564..527745
FT                   /transl_table=11
FT                   /locus_tag="CL2_05470"
FT                   /product="Mannitol-1-phosphate/altronate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37612"
FT                   /db_xref="GOA:D4MYB7"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYB7"
FT                   /protein_id="CBL37612.1"
FT                   /translation="MKKELLVIGAGNIGRGVIGGLFFESGYHLYIYDIMEERMKQLKEQ
FT                   GTYLIERVGANNKRRVLVDDFDVLDCSDTVDLIEHMKKVDLIACCVYEGAFQSICQNLK
FT                   EAIEYRTEQEAAPLNILLCVNALGAPDYFETELAKLLQNNPAASRYLKEKIGICQVMVG
FT                   MAAMPSSEELIAEDAFAVTTKLDGHIGIDEEPFKGELPQVKQTGGVQKGKAQIYRKVYT
FT                   GNMKHCMLAFLGKAKGYTYIRDTYDDGWIEDCVLGAFFEADAAIQAEYQFDETDHQEWI
FT                   DFIVEAPKNRNLKDAFTRVAADPKTKLSRDNRFVGPALLCMKHHILPFYLAKGIAYGFL
FT                   YRDESDIASIEITNYVKEHGIEKAIEVYCGLTENEWELKQLIMAQYKEAEKIR"
FT   CDS             527760..528725
FT                   /transl_table=11
FT                   /locus_tag="CL2_05480"
FT                   /product="Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37613"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYB8"
FT                   /protein_id="CBL37613.1"
FT                   /translation="MRYKHFKNADADISALTVGTWGIAGANSAGVTWGDVDTEESIAAI
FT                   RQMIDNGVNMVDTAPIYGDGHSETVVGQALKDGYREKVYLATKFGSYISHYTGKSVRDN
FT                   KYNSVEREIDESLARLQTDYIDFYIMHWPDENTPIEETMAVCNMLKKKGKIRYIGMSNS
FT                   SKELIQEAQKYAKIDVIQPPFSIVNQSERELMEWAETQGIGTMTYGSLGGGILTGAIRE
FT                   LPKPDPKDMRQVFYPFFKEPVFSNVMELLKTLDKIAEAHNVPVAQVSINWSTQKSFVGT
FT                   ALTGVNTPAQADENCSAFEWQLNNEEIALIDSEIDRLNIG"
FT   CDS             complement(529575..529739)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37614"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYB9"
FT                   /protein_id="CBL37614.1"
FT                   /translation="MNIYIRQSKKNTKNIIIQSLHFVNLVMFLEQLIINGYTEKFLKVN
FT                   KRISLLPTR"
FT   CDS             complement(529752..530429)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05510"
FT                   /product="Transposase."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37615"
FT                   /db_xref="GOA:D4MYC0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYC0"
FT                   /protein_id="CBL37615.1"
FT                   /translation="MSKRKVSVENKIYAVNLYLDGKESQQRIAHMFDVSLASVQQWIRN
FT                   YESMGANAFTLKGNKKYSKELKQQAVLDYLAGYGSQDDICKKYGIRSKGKLQSWIKKYN
FT                   GHEELKSSGTGGSIIMTKGRKTTFEERVEIVQYCIAHDRNYAQTAEQYQVSYQQARNYI
FT                   VKYEAGGVEALRDNRGKRKCPDEMSELEKLRAEVKILKAEKERAEMEASFLKKLEEIER
FT                   RRG"
FT   CDS             complement(530529..531851)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05520"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37616"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYC1"
FT                   /protein_id="CBL37616.1"
FT                   /translation="MEEEFHNHMRIPWHDYTRKSIGRPITEASLSEKASIIGRTGIMLL
FT                   SCGTGAWRVRSSMNTLARELGITCTADIGLLSIEYTCIDGGNCYTESLCLFNTGVNTSK
FT                   LYRMELFVNKFSKNCKKMSGDELHTLLDQIHEIHGFYSPPFLGLAAAVACSAFTFLLGG
FT                   GPIEMFCAFLGAGAGNFLRAKMNQHHLTLFLCTAASVALACIVYTIAFMALKSGFHISI
FT                   HHQAGYICSMLFIIPGFPFITSGIDLAKLDMRSGLERLAYALIIIAVATLAAWMLALVL
FT                   HLKPMDFLPLNLSKSEYLIFRLIASFFGVLGFSVMFNSPLQLAATAGIIGAIANTTRLE
FT                   LVDLASFPPAAAAFLGALLAGLLASMIKTSIGYPRISLTVPSIVIMVPGLYLYRAIYNI
FT                   GITSINTGAFWFTEALLIIMALPLGLIFARIITDKTFRRCS"
FT   CDS             complement(531857..532744)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05530"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37617"
FT                   /db_xref="GOA:D4MYC2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYC2"
FT                   /protein_id="CBL37617.1"
FT                   /translation="MPFDYYRIFYYVAKYKSFSKAAKFLHNNQPNITRCMNIMESELGC
FT                   TLFIRSHRGIKLTPEGEQLYAHVAIAIQQISSGNDELNRTKNLKSGTVTIGVSETALHL
FT                   FLLPKLEKFHKLYPHIKLKISNHSTPQAIKALRKGFVDFSIVTTPLYCEHPLQSQRLCS
FT                   FRDILIGGPSYRDIGFSPKRLRDLQDFPFISLNEGTATRNFYEKYFYQNQLVFSPDMET
FT                   ATTNQILSLVQHDLGIGFCPEALAKDYLDRGEIIEIPVKEHANPRDICLLTDSTRPIGI
FT                   AGKKLLEILMDSEG"
FT   CDS             532854..533645
FT                   /transl_table=11
FT                   /locus_tag="CL2_05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37618"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYC3"
FT                   /protein_id="CBL37618.1"
FT                   /translation="MISVETIFPREENAEHIFKKILENNDACERLRELFYEEFANSGDR
FT                   DLSEKQFVKALFDAYQNRDLSAFLMEICGNSMFDLLRNAFLIPMRFNDKGVTNPVRLTD
FT                   AEGELIKQTSVNKQISQKQYKMFQQISDQADDIPDYEICLAYGFREKHDYRNKNEINTM
FT                   KIGEHIGILLLFKLPKEVKEMIEDNEVYSIVWDFMMRLEEQLPRAFMYYGVMDENKFEQ
FT                   QSSEIGIFLPFRHFEHQLEKNIEQANGIGLGCRERILTMIK"
FT   CDS             533862..534224
FT                   /transl_table=11
FT                   /locus_tag="CL2_05550"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37619"
FT                   /db_xref="GOA:D4MYC4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYC4"
FT                   /protein_id="CBL37619.1"
FT                   /translation="MGWKIDDGRPIWTQLKEQMIKRIVSGTYSSGEKLPSVRDLAGEAG
FT                   VNPNTMQRALSALDQDGLTITNRTSGRCVTEDVTKIEECRKDIGHKIVKQYIRDLEELG
FT                   YNKEDAVALIGKEEEE"
FT   CDS             534221..534955
FT                   /transl_table=11
FT                   /locus_tag="CL2_05560"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37620"
FT                   /db_xref="GOA:D4MYC5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYC5"
FT                   /protein_id="CBL37620.1"
FT                   /translation="MKDLNLIELTDLEKRYGKKEALTGINLTIGRGKIIGLLGPNGSGK
FT                   TTLIKLLNGLLQPTSGEIKVNGKAPGVDSKKIISYLPDKMYFADWMKIADLMDFFEDFY
FT                   EDFDRKKAEGMCETLKINTEAKIKSLSKGNKEKVQLVLVMCRKAQLYLLDEPIAGVDPA
FT                   ARDFILDTILNNYNEEGTVIISTHLIADIEKIMDEVIFIKEGNIVTYKSADDLREESGK
FT                   SIDALFREIFHTDVYRGGDEAC"
FT   CDS             534949..535710
FT                   /transl_table=11
FT                   /locus_tag="CL2_05570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37621"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYC6"
FT                   /protein_id="CBL37621.1"
FT                   /translation="MLGKLIKYDLKALAKILAPLWGVLLVMGLIFGISIRSNLDGIGNT
FT                   MIVFSLVVIVAVIVAIFVMNVIIVIQRFWNGLLQEEGYLMFTLPVTTRSLILSKVISAL
FT                   IISCGTVLVISLLGVEIIAISPVKLMDTVTYFGNWVIKVHAGPWIGYGAVIAVVGLLNG
FT                   IYHIYAAMVIGQLSNGNRFLFAFVAYAGLSIIVSLIGIPSMTNLDNMGSSLQNTFGFDG
FT                   DLWIYLVENIVIIIVYHIVTEVILTKKLNLE"
FT   CDS             535746..536498
FT                   /transl_table=11
FT                   /locus_tag="CL2_05580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37622"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYC7"
FT                   /protein_id="CBL37622.1"
FT                   /translation="MLRKLMKYDLKYYRKIMLPLWAVLIIYGIVHGINTVFNYETFYDH
FT                   IPIKAQAIVVVTGIYFIFCVNIILVIQRFWKSMYGKESYLTHTLPVTERKLILSKVFSA
FT                   IIISFTTVFIFFAENDILIYIQSIVYHGEASLQGIPIRHFQDFTKTKVVLTILYMIIYG
FT                   IIWTMHLIYQAYTAICIGQMRSKNRFATMIIVGAFLFLVGYEMQVVLLQHNRYYSWFYL
FT                   PCLIVFLVEIVLCHLVIEFILTRKLNIN"
FT   CDS             538804..539460
FT                   /transl_table=11
FT                   /locus_tag="CL2_05600"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37623"
FT                   /db_xref="GOA:D4MYC8"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYC8"
FT                   /protein_id="CBL37623.1"
FT                   /translation="MDYILSPSILSADFANLGADVKEAVKAGAKWVHIDVMDGMFVPNI
FT                   SLGLPVIKSLRKETEALFDVHLMIEEPGRYIDDFAEAGADLITLHAEATKHLHRAIQQV
FT                   KAKGLKVGVALNPATPLSALDYVLEELDMVLIMTVNPGYGGQSYIAKMDDKIKELRAII
FT                   NEKGLDIDIEVDGGISAKNVAHVKECGANVFVAGSAVFNGDIASSAKDILEAMEA"
FT   CDS             539463..540287
FT                   /transl_table=11
FT                   /locus_tag="CL2_05610"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37624"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYC9"
FT                   /protein_id="CBL37624.1"
FT                   /translation="MSECSHDCSSCSANCGSRTQEKTDFLEPLYRESKVKKVIGIVSGK
FT                   GGVGKSMTTSLLGVAAMRKGLHTAILDADVTGPSIPQAFGLHERLLGNAEGIILPAMTN
FT                   FGIEVVSLNLMLEEETQPVIWRGPVVADVVKQFWGKTLWKDIDVMFVDMPPGTGEVPLT
FT                   VFQSIPLDGIVVVATPQELVGMIVEKAVNMANMMNVPVLGLIENMSYIKCPDCGKEIKV
FT                   FGDSHIEEISEKFNIPVLGKLPIDPKLTQACDAGLIEDVENIYLDGVMDIIL"
FT   CDS             540566..540967
FT                   /transl_table=11
FT                   /locus_tag="CL2_05620"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37625"
FT                   /db_xref="GOA:D4MYD0"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYD0"
FT                   /protein_id="CBL37625.1"
FT                   /translation="MLKVMKKKLLVVIAMLVVASGIIFTGSTSTKAEDNEVQYLGKYKL
FT                   TAYCGCKKCSGKWGARTASGKKAKQGRTIAVDKRKIKLGSKVQINGKTYVAEDVGGGVK
FT                   GKHIDVFFKSHKQTKKFGKKTGVKVYKVN"
FT   CDS             complement(541081..541992)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05630"
FT                   /product="dTDP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37626"
FT                   /db_xref="GOA:D4MYD1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYD1"
FT                   /protein_id="CBL37626.1"
FT                   /translation="MKKPALVILAAGMGSRYGGLKQMDPMDPMGHAIIDYSIYDAKRAG
FT                   FGKVVFVIKKAIEKDFKETVGARVPEGMEVCYAYQEVDALPEGYNVPEGRVKPWGTAHA
FT                   VLCAKPFINEPFAVINADDYYGVDGYKVMADFLTSHEEKDGKAPFAMVGYHLGNTVTEN
FT                   GYVSRGVCEVDDNHQLLSITERTHIEKREDHAEFTEDDGATWASLPFDTLVSMNFFGFQ
FT                   PMIMDELEKGFPAFLNQAIKENPLKGEYFIPSVASDLLHDGKASLEVLVSKDQWYGVTY
FT                   PEDKQSVIDALAALRENGTYKF"
FT   CDS             542040..542123
FT                   /transl_table=11
FT                   /locus_tag="CL2_05640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37627"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYD2"
FT                   /protein_id="CBL37627.1"
FT                   /translation="MEQMERERKNKELELIKIYFGQPEFIV"
FT   CDS             542271..543101
FT                   /transl_table=11
FT                   /locus_tag="CL2_05650"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37628"
FT                   /db_xref="GOA:D4MYD3"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYD3"
FT                   /protein_id="CBL37628.1"
FT                   /translation="MTEIQHELIMTNEDLPFKMFLFEGRDGNYIREKHWHRSIEIFAVF
FT                   QGTLGFYLNDQEYLLECGDFIIVNSNEVHSIHAPKENMTVVLQMPLNMFEKYYTGDQFI
FT                   CFAHAPQAQDEQLMEMICEMYMAYSDKHCGYDLKIQSLFYDMLYLMVTRYREINVHPDI
FT                   LHQHKQLTKLSVITDYMKEHYKEELSLSKLAEIFGYSPSYLSRMFQKYAGINYKDYMQA
FT                   IRTEHGYRQLVETDMTISDISMENGFPNNKAFSKAFYKKYGIMPAEFRKRQKMP"
FT   CDS             543302..543409
FT                   /transl_table=11
FT                   /locus_tag="CL2_05670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37629"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYD4"
FT                   /protein_id="CBL37629.1"
FT                   /translation="MSNMPKVKIGIVAVSRDCFPESLSVNRRNITCQTF"
FT   CDS             543420..543548
FT                   /transl_table=11
FT                   /locus_tag="CL2_05680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37630"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYD5"
FT                   /protein_id="CBL37630.1"
FT                   /translation="MFFAAAEERGDNLLDGRGDAYCGMLNASYNLKLYQSQELSLD"
FT   CDS             543811..545280
FT                   /transl_table=11
FT                   /locus_tag="CL2_05690"
FT                   /product="xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37631"
FT                   /db_xref="GOA:D4MYD6"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYD6"
FT                   /protein_id="CBL37631.1"
FT                   /translation="MLYIGVDLGTSAVKLLLMDEKGEIKKIVSKEYELYFPHPGWSEQK
FT                   PEDWYSQSMEGIKELISECDKSQVAGISFGGQMHGLVVLDEDDDVIRPAILWNDGRTQK
FT                   ETDYLNNEIGKDKLSEYTANIAFAGFTAPKILWMRENEPDNFNKIKKIMLPKDYLAYKL
FT                   SGTFCTDYSDASGMLLLDVKNKCWSKQMMEICGVSEEQLPKLFESYEVVGTLKEDIAEE
FT                   LGLSKEVKIIAGAGDNAAAAVGTGTVGDGMCNISLGTSGTIFISSKTFGVDSNNALHSF
FT                   DHADGYYHLMGCMLSAASCNKWWMDEILKTKEYSKEQEGITKLGENHVFYLPYLMGERS
FT                   PHNDPKARATFIGMSMDTTREEMTQAVLEGVAFGLRDSLEVARSLGIKIERTKICGGGA
FT                   KSPLWKKIIANVMNLKVDVIESEEGPGYGGAMLAAVGCGEYDSVQEAADQLVKVVDTVE
FT                   PDDKLVAKYEAKYQQFREIYPALKGVFQKFD"
FT   CDS             complement(545393..545752)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37632"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYD7"
FT                   /protein_id="CBL37632.1"
FT                   /translation="MEDKITKIFNAADQIQAEMIHDHLKQNGIETMSKQPGTGEYMSIA
FT                   MGYSVYGTDIYVREDQKAKAEALINELLYDNDYDTSEDEDIKLPWWQNKVIAAKCILGF
FT                   FILVIIIMIAMQILQ"
FT   CDS             546018..546173
FT                   /transl_table=11
FT                   /locus_tag="CL2_05710"
FT                   /product="Rubredoxin"
FT                   /EC_number="1.18.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37633"
FT                   /db_xref="GOA:D4MYD8"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYD8"
FT                   /protein_id="CBL37633.1"
FT                   /translation="MKYVCDVCGWEYDEEKGYPEGGIAPGTKWEDVPEDFECPLCFVGK
FT                   DQFSKE"
FT   CDS             546212..546574
FT                   /transl_table=11
FT                   /locus_tag="CL2_05720"
FT                   /product="Desulfoferrodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37634"
FT                   /db_xref="GOA:D4MYD9"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYD9"
FT                   /protein_id="CBL37634.1"
FT                   /translation="MAKFYRSEDKTVLLEVFGAGSSIENLKNLKANTTDAAVEKHLPVV
FT                   TQEGNKITVAVSSVEHPMLPEHYIMGVYIETKNGGQLHKFAPGDKPEAVFMLADGDEFI
FT                   AAYEYCNLHGLWKSEV"
FT   CDS             546638..547180
FT                   /transl_table=11
FT                   /locus_tag="CL2_05730"
FT                   /product="Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37635"
FT                   /db_xref="GOA:D4MYE0"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYE0"
FT                   /protein_id="CBL37635.1"
FT                   /translation="MGSNRYVGTQTEKNLLEAFSGESQARNKYTYFASVAKKEGYEQMS
FT                   ALFLKTANNEKEHAKMWFKELAGIGDTKENLAAAAEGENYEWTDMYEGFAKTAEEEGFP
FT                   ELAAKFRAVGEIEKHHEERYRALLKNIETSQVFEKSEVKVWECRNCGHIVVGTKAPEVC
FT                   PVCAHPQSYFEVHEENY"
FT   CDS             547406..548722
FT                   /transl_table=11
FT                   /locus_tag="CL2_05740"
FT                   /product="Predicted transcriptional regulator containing an
FT                   HTH domain and an uncharacterized domain shared with the
FT                   mammalian protein Schlafen"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37636"
FT                   /db_xref="GOA:D4MYE1"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYE1"
FT                   /protein_id="CBL37636.1"
FT                   /translation="MKLQESERTEFKSIVVTDIKKEIIAFANCDGGKIYIGIEDDGTVI
FT                   GVEDSDSVALQVSNMVRDAIKPDLTMFLHYETKEIEQKQVVIIDIQRGTERPYYIAKKG
FT                   LRPEGVYVRQGYSSVPATDTAIRKMIKETDGDHFEDMRSLDQELTFCETKKEFQKRNIT
FT                   LEQPQMKTLGIINQDGIYTNLALLLSDQCVHTIKTAVFEGKNQNIFKDRKEFTGSLFAQ
FT                   MEAVYDYIDFRNQTHSTFEKLYRIDNRDYPEVAVREALLNCLVHRDYGYSSSILISMYE
FT                   DRLEFTSIGGLVTGVTLEDVMMGISVCRNKKLANVFYRLELIEAYGTGIQKIMNAYQDQ
FT                   FIKPEIKVSNNVFKIILPNTNAQAELREELQYHTHIQPEDEETQIMQMIDQEKRIQRKQ
FT                   VQERLGISQTTSGRILKQMVKKGLIMQRGRGKNTCYVKK"
FT   CDS             548942..549850
FT                   /transl_table=11
FT                   /locus_tag="CL2_05750"
FT                   /product="quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37637"
FT                   /db_xref="GOA:D4MYE2"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYE2"
FT                   /protein_id="CBL37637.1"
FT                   /translation="MENLKKEIEQLKQEKNAVLLAHYYVDDAVQEIADYVGDSYYLAKV
FT                   ALKESKDVICFAGVNFMGESAKILNPDRTVIMPDQKADCPMAHMVDVEKIEEMRKKYDD
FT                   LAVVCYINSTAEIKAHSDVCVTSSNALKVVTALPQKNIFFVPDENLGRYIGSKLPEKNF
FT                   IYNDGFCHVHRSITAENVKKAKEVHPEAEVLVHPECTPDVVALGDYVGSTSGIIDYATA
FT                   SDKDVFIICTEMGVLYELKQKNPGKTFYSVGHRQFCPNMKRISLENVRDTLRDMKNQVE
FT                   LPEELRLNAKKALDEMLRIAQ"
FT   CDS             549885..551186
FT                   /transl_table=11
FT                   /locus_tag="CL2_05760"
FT                   /product="Aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37638"
FT                   /db_xref="GOA:D4MYE3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYE3"
FT                   /protein_id="CBL37638.1"
FT                   /translation="MKTADVIIVGSGASGLFNALFLPQDYKVIVITKKEVEESDSFLAQ
FT                   GGISALKNPEDYDSYFEDTMKAGHYENDKGAVEKMIKESPQIIQDLKDFGVRFDLKDGE
FT                   IEFTREGGHSTFRILHHEDLTGKEITSHLYEEAKKRDNITIMENCTMIDIIEKDGECKG
FT                   IVYKDADGNLDTIEAPDTVLATGGLGGLFKHSTNFRHLTADSLAICLRHNVELENINYI
FT                   QIHPTTFYSKKPGRRFLISESVRGEGAYLLNKDGERFTDELKPRDVVTGEICKQMKKDG
FT                   SDHVYLSVTHLDGERIKHRFPNIYKQCLDEGYDMTKEPIPVTPAQHYFMGGIKVNLDSK
FT                   TSMEHLYAVGETSCNGVHGKNRLASNSLLEALVFAKAAAKDITEHPSKAETVEVDLSKY
FT                   QNEEQREKENEQLVLDEIKRKDRSFYDQWCNDEN"
FT   CDS             551158..552015
FT                   /transl_table=11
FT                   /locus_tag="CL2_05770"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37639"
FT                   /db_xref="GOA:D4MYE4"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYE4"
FT                   /protein_id="CBL37639.1"
FT                   /translation="MISGVTMRINIDEYLMNALKEDITQEDVSTNAVMPEPKQGEVNLI
FT                   CKQDGVICGLEVFERVFKLLDETVVFETELKDGDKVTKGQLMGVVKGDIRALLSGERVA
FT                   LNYLQRMSGIATMTSELSKELEGYKTKLLDTRKTTPNMRPFEKYAVTVGGGHNHRYNLS
FT                   DGVMLKDNHIGAAGGIKEAVAMAKDYAPFVRKIEVETENLDMVKEAVEAGADIIMLDNM
FT                   DDETMKEAVKLIDGRAETECSGNVTKERLKTIREIGVDYVSCGALTHSAPIMDISLKNL
FT                   HPVE"
FT   CDS             552160..553818
FT                   /transl_table=11
FT                   /locus_tag="CL2_05780"
FT                   /product="Protein of unknown function (DUF1703)./Predicted
FT                   AAA-ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37640"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYE5"
FT                   /protein_id="CBL37640.1"
FT                   /translation="MKNINVPVGISNFEKIRQDGYYYVDKTGLIKDMLKNKIPEVTLIT
FT                   RPRRFGKTLAMSMLASFFDIRRDSKKLFQGLNISKEQQLCNDWMNQYPTLFLSFKDVDG
FT                   TIFENALGLLQFTIAELCKKHTYLIESDVVDQDDKETFRKLKSMGSNLPELQGSIIMLM
FT                   NMMKAYYNKPVILLIDEYDVPIAKASSNGYYKEMLEVMKAMLSTALKDNEALKFAVVTG
FT                   CLKIAKESVFTGTNNFVSDTISSERYNEYYGFTQKDVDQILQDAQIEEKASDIKEWYDG
FT                   YRFGEFDVYCPWDVMNYLWDLTNNQNAKPVSYWKNTSDNAIIRSFIDYSGAAIKKKLEI
FT                   LISGGSIRQQIEENLTYDYLHSSEENLWSILYLTGYLTNASEQDTDGTIELKIPNKEIK
FT                   EIFETTVKKWFEDNAKTIDRKELFDAVWTGNADILTKEIGTLLRMTISYHDYKEDFYHA
FT                   FLAGIFAGAGYVVESNKEHGEGRSDIVIYDDYEGKVAIFEAKKSQNPEDMILDCEKAIK
FT                   QINEKMYANEFEDAYDEILCYGISFFKKRCLVKKK"
FT   CDS             554315..555721
FT                   /transl_table=11
FT                   /locus_tag="CL2_05800"
FT                   /product="Stage II sporulation protein E (SpoIIE)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37641"
FT                   /db_xref="GOA:D4MYE6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYE6"
FT                   /protein_id="CBL37641.1"
FT                   /translation="MEILRKKEFEEDRLFQNFHEMILYHMRQMQQCLTTAGKMFCDHND
FT                   EEETCEKRGRDVVESVILKECVGCRENQKCQFTLADKDRLGQIIEKQGGLSYADLKRCH
FT                   PCKNGQDFIEEANQIYERELFLRAMRNQMKQLRKIVGEQYIRAGNTLGDFFQGKVSLTA
FT                   DNKKLYEKITKGFAKSQLRLKEIYFYDNPEKGKQIYLYLKKKKGREISTRQAAVLLSSM
FT                   TMEKMKPLPDQKKMIGNYYEIYGFTPEEKFHVIAGIHTSPMIAGDENGDSFSMGKVREG
FT                   SFVSMISDGMGTGQEAKKESRKIIEVMEELLGAGINESQSVQLLRSMMILQPEKEKYAT
FT                   LDFFQLDLFAGIGTFFKIGACPCLLKRKNDVEIIQVDTIPVNLLLHTEKIPIYRKKMES
FT                   EDILVMLSDGAFDGFSQNGLEMAARYLKEMDVVRPQAIADGLYERITTNKEFEKRDDMT
FT                   IMVLGIWDRY"
FT   CDS             557084..557605
FT                   /transl_table=11
FT                   /locus_tag="CL2_05820"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37642"
FT                   /db_xref="GOA:D4MYE7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYE7"
FT                   /protein_id="CBL37642.1"
FT                   /translation="MENIRVMISEEDVNKRIAEMGAQISEDYAGKEIHLIAILKGSVFF
FT                   ACELAKRITIPVTIDFMSVSSYGNSRESSGIVKIAKDLDEPILDKEVLVVEDIIDSGKT
FT                   LNHLKPMLESRNPASLHLCTLLSKPDRREVEVPVRYIGFEVPDEFVVGYGLDYAQKYRN
FT                   LPYIGVAEEE"
FT   tRNA            559549..559633
FT                   /locus_tag="CL2_T_31600"
FT   tRNA            559635..559720
FT                   /locus_tag="CL2_T_31610"
FT   CDS             complement(559898..560782)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37643"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYE8"
FT                   /protein_id="CBL37643.1"
FT                   /translation="MKQKKTLQILLLVFAGLIVLYTGVNLYQKQQSSKEDSDQTMISDL
FT                   KSLTSISYNNNGTTLSFIKQSGKWYYTKNKKYPITQSSLESLASTFQKVEAVRELKNAD
FT                   VLSDYGLDKPTYTVSVKDKTGKSMTYYIGNATGENYYVTYGDKSKIYTVSSDITSSLSY
FT                   SLDNLIETDTFPTLSTGNLKKVLVTQNGKTKTYTSKKKNLDGISGGLGVFTFGDCQNYY
FT                   ASQTDLVKYGLNKDSRITVDITYKDTDTKKTKNVVLYIGKKDSDQKNYYVKLKGSHMVY
FT                   LSDKDVVKNILNP"
FT   CDS             complement(562217..563083)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05860"
FT                   /product="ABC-2 type transporter."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37644"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYE9"
FT                   /protein_id="CBL37644.1"
FT                   /translation="MLAIYKREVRSYFNSMIGCVFAAFLTIIGGVYFMVYNLYSGYPFF
FT                   AYSLAGVIFMLLISVPVLSMKSFAEDRKNKTDQLLLTSPVSLVEIVLGKYLAMVTVFAI
FT                   PCVIYCIFPLIIKLQGTAHFLVDYSSILAFFLLGCVFIAIGMFLSSLTESPVIAAITTC
FT                   AALFFFYLLDNLLQYFPSSAISNLVIWIIIFALIGLLIYHITKNQMIAGIVTGIGCIAG
FT                   IVVYFVKKTLLESLFSALLGHLVLTDIFYNFSQNYIFDLGGLLTYLSLIILLVFLTVQT
FT                   FEKRRWS"
FT   CDS             564341..564574
FT                   /transl_table=11
FT                   /locus_tag="CL2_05880"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37645"
FT                   /db_xref="GOA:D4MYF0"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYF0"
FT                   /protein_id="CBL37645.1"
FT                   /translation="MLEKMKEIIADQLGVSEDEVTLEASFKEDLDADSLDLFELVMALE
FT                   EEYDVEIPSDDLAELNTVGDVINYLKDKGVED"
FT   CDS             564688..565608
FT                   /transl_table=11
FT                   /locus_tag="CL2_05890"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37646"
FT                   /db_xref="GOA:D4MYF1"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYF1"
FT                   /protein_id="CBL37646.1"
FT                   /translation="MGKIVFMFPGQGAQYVGMGKDFYDSFACSKEIFDKANEVLDIDVK
FT                   KLCFEENEDINITEYTQAAMVTASVAILKKIEEMGLKPDLTAGLSLGEYCALVASDVMS
FT                   FEDAVKVVRQRGILMQDTVPVGEGAMSAVLGMKKEAIEAVLPDVEGIVTIANYNCPGQI
FT                   VISGESKAVAEAGEALKEAGAKRVLPLKVSGPFHSPMLKPAGEKLLDVLADVEVDDPTV
FT                   PYVSNTTAEFITSKDEVKELLGRQVYSSVCWEQSIEKMIADGADTFVEIGPGRTLCGFM
FT                   RKIDRNVKAINIAKVEDLEKLKEIM"
FT   CDS             565611..566351
FT                   /transl_table=11
FT                   /locus_tag="CL2_05900"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37647"
FT                   /db_xref="GOA:D4MYF2"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYF2"
FT                   /protein_id="CBL37647.1"
FT                   /translation="MLSGKVAIVTGASRGIGRETALTLAGYGATVIVNYCGSKDKAEAV
FT                   VEEIIAAGGTAKAYQGDVSDFDVAKEMITSVKKEFGSIDILVNNAGITKDNLIMKMSEE
FT                   EFDKVIEVNLKGAFNCMKHVSRIMLKQRSGHIINMSSVSGVMGNAGQVNYCASKAGIIG
FT                   MTKSLARELGSRGITVNAIAPGFIETEMTDVLSEDVKENLLGSIPLKRMGQTKDIAETV
FT                   AFLASDKAAYITGQTISVDGGMGM"
FT   CDS             566364..567608
FT                   /transl_table=11
FT                   /locus_tag="CL2_05910"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase 2"
FT                   /EC_number="2.3.1.179"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37648"
FT                   /db_xref="GOA:D4MYF3"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYF3"
FT                   /protein_id="CBL37648.1"
FT                   /translation="MKSMKRVVVTGMGAITPIGNSVEEFWNGIKEQKIGFAPITYFDAT
FT                   EYKAHLAAEVKGFNAKDYMSPKAARRMELFSQYAVAATKEAIEDAGLDLEKEDTTRIGV
FT                   SVGCGVGSLQMIETTTRTLDKKGPNRVKPLAVPMMISNMAAGNVSIAFGLRGKSINVVT
FT                   ACATGTQSIGEAYRSIQVGEADVMVAGGTEAAVSEVAVGGFAALTALSGSDDPKRASIP
FT                   FDKERDGFVIGEGSGIVVLESLEHAQARGADILAEVVGYGATSDAFHITSPCEDGEGAA
FT                   RAMVFAMDEAGITPDKVDYINAHGTSTHANDLFETKAIKKALGEHAYDVKISSTKSMIG
FT                   HGLGAAGAIEFITCVKSIEEDYIHPTVGLKVPDEECDLDYTLEPVTDRKVNYVMSNSLG
FT                   FGGHNATLLVKKFED"
FT   CDS             567626..568069
FT                   /transl_table=11
FT                   /locus_tag="CL2_05920"
FT                   /product="biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37649"
FT                   /db_xref="GOA:D4MYF4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYF4"
FT                   /protein_id="CBL37649.1"
FT                   /translation="MEVKEMKELIAAVSSANVDEFEYNNEEFSIRIAKKKAKIATVDAS
FT                   VAGVPVQSAAIMPEQNEEQPEELLYGDEIKAPLVGTFYVAPSEGAEPFVSVGDKVKKGQ
FT                   VIGIVEAMKLMNEVESEYDGTVAAILVENGEMVEYGQPLMVIQ"
FT   CDS             568089..568514
FT                   /transl_table=11
FT                   /locus_tag="CL2_05930"
FT                   /product="beta-hydroxyacyl-[acyl carrier protein]
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37650"
FT                   /db_xref="GOA:D4MYF5"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYF5"
FT                   /protein_id="CBL37650.1"
FT                   /translation="MVMDIKDIMNTIPHRSPFLLVDRIEEMEEGKRIVGKKCVTYNEPF
FT                   FAGHFPQEPVMPGVLIIEALAQTGAVCALSADEYKGKIAFLGGVNKAKFRGKVVPGDVL
FT                   TLEVEMIKVKGPVGVAQGTATVDGKKVASAEITFMIG"
FT   CDS             568530..569897
FT                   /transl_table=11
FT                   /locus_tag="CL2_05940"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37651"
FT                   /db_xref="GOA:D4MYF6"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYF6"
FT                   /protein_id="CBL37651.1"
FT                   /translation="MFKKILIANRGEIAVRIIRACREMDIMSVAICSEADKDALHAQLA
FT                   DQTICIGPAPAKDSYLDMERVLGAAMAVGADAIHPGFGFLSENSKFVRMCEKCNITFIG
FT                   PSAEIIDRMGNKSAARKTMMDAGVPVVPGTKDAVYEAEAGQKIADDMGYPVMIKASAGG
FT                   GGKGMRVCYDSEDFVHTFETAKLEAENAFGDGTMYIEKYIEDPRHIEFQILADKYGNTI
FT                   HLGERDCSIQRRHQKLIEESPSPAISDEQRKKMGEIAVKAAKAAEYYSAGTIEFLRDKH
FT                   GDFYFIEMNTRIQVEHPVTEWVTGIDLIREQIRIAAGEHLTYTQEDVHVHGHAIEVRIN
FT                   AEDTEHDFRPSPGTVTNVHFPGGKGVRIDSALFAGYQIPPYYDSMIAKLIVYDKNRKLA
FT                   LRKLRNALGELVLEGVKTNIDYQYEIINDEDFIEGNVDTGFIERFQKKHQSENEAE"
FT   CDS             569918..570802
FT                   /transl_table=11
FT                   /locus_tag="CL2_05950"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37652"
FT                   /db_xref="GOA:D4MYF7"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYF7"
FT                   /protein_id="CBL37652.1"
FT                   /translation="MSLKDMFKKRTLSPQEIKQAERVRKAKDTLLEFQAPEGLFQKCNC
FT                   CGKPVYNEDLIENDYVCPVCGNYFRIRPKTRIAMVLDKDTFEEWDVKMDTSDPLNFPGY
FT                   KNKLERQRSVTNLDEAVITGKGKILGKDVVIAVMGADFMMGSMGEVVGEKITRAVERAT
FT                   QMRLPIIIFTCSGGARMQEGIVSLMQMAKTSAALKRHDEAGLLYITVLTDPTTGGVTAS
FT                   FAMLGDVILAEPGALIGFAGPRVIEQTIGQKLPEGFQRAEFLLEHGFVDKIVERKKLRK
FT                   VLVTIIRSCEYEQ"
FT   CDS             570792..571583
FT                   /transl_table=11
FT                   /locus_tag="CL2_05960"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37653"
FT                   /db_xref="GOA:D4MYF8"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYF8"
FT                   /protein_id="CBL37653.1"
FT                   /translation="MSSNYTPWERVQISRSAERPTSLDYISTIFERYMSLHGDRYFGDD
FT                   KAIVGGLASIGGRPVTVIGQQKGRSTKENIKRNFGMPSPEGYRKSLRLMKQAEKFHRPI
FT                   ILFVDTPGAFCGLEAEEGGVGEAIARNLFEMSNIKVPILSIMIGEGGSGGALAMAVGNE
FT                   VWSLENSTYSILSPEGFAAILWKDGNRASEAAKVMKITAEDLKELGVIEQVIEEPEPVS
FT                   IDNILEISEQMKEMILGFIEKYDKMTPEELVEQRYQRFRKF"
FT   gap             571597..572061
FT                   /estimated_length=465
FT   CDS             complement(573035..573358)
FT                   /transl_table=11
FT                   /locus_tag="CL2_05980"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37654"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYF9"
FT                   /protein_id="CBL37654.1"
FT                   /translation="MSTRNSPYKLDMLVLSTLSKHDCYGYQLTQIFDECSNGIIKPKVS
FT                   SLYPILYRLIDQGYISSYEEIIKNNRRRVYYHLEPKGFELLQQLIDDYQKYTASIQSIL
FT                   NYK"
FT   CDS             573495..573788
FT                   /transl_table=11
FT                   /locus_tag="CL2_05990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37655"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYG0"
FT                   /protein_id="CBL37655.1"
FT                   /translation="MKRKVKKMCTGLVMSMAFVIATVGTVYGMTQYGHYDISTITETGI
FT                   RAWAYKKSPYKSASAKVTEAGRSSGWKTGRDVKATLTNLPFYVSKTYYKYNK"
FT   CDS             575519..576079
FT                   /transl_table=11
FT                   /locus_tag="CL2_06020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37656"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYG1"
FT                   /protein_id="CBL37656.1"
FT                   /translation="MKIYRYCGVFLLTLFLSVQLCTNVSAAESVQNSIGISELSGLTED
FT                   NEEIYEIPIETQINTDDLEKIDMNERSTNAIATCSLSLVRNGNSKNVHVYIKYKSNQLM
FT                   NHIKFKQLKIMTPNLLSPLTYKTYEDKSYKFTARKSGYVNIGDASIPKTVKYVRVVSSK
FT                   LYVYFLSKGWVAATHNWGTANIN"
FT   CDS             576101..576655
FT                   /transl_table=11
FT                   /locus_tag="CL2_06030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37657"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYG2"
FT                   /protein_id="CBL37657.1"
FT                   /translation="MNQFVKTLIKKYKDPSIIGERSAEEVIHYLKQKFIIKDIKQSISD
FT                   DQMKVFIFNVIHSMDGENALPKDIKLRAYSIEYSTSSKIYYEEMNDDMKIYVYIDEYTG
FT                   CIESNSVRLFTELELYKRISQYDYDNNTDKLIEYLHNCKEWEELNSHERKWMSSNFLLQ
FT                   IFVLIFSLMLITMVYKDKNVS"
FT   CDS             complement(577380..578024)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06050"
FT                   /product="TraX protein."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37658"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYG3"
FT                   /protein_id="CBL37658.1"
FT                   /translation="MLIDHTNKALIYPNLNGGRLNTVSDIFDIIGRIAFPIFAFLLVEG
FT                   FFKTRSRAKYLVTLLVFGVISEVPFDLFTTKQFFEPNWNNIMFTLALVLVTIWMIDVLK
FT                   KKMEKFPKILWFLLSFVILAVMCLIAAILSLDYDCHAILIGYFYYIFHGRELIAIPFNF
FT                   LSMYKEPWALLGFGLVLTYNGERGKQNKLINYLFYPVHLLILGLLRIYLGI"
FT   CDS             578647..578967
FT                   /transl_table=11
FT                   /locus_tag="CL2_06060"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37659"
FT                   /db_xref="GOA:D4MYG4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYG4"
FT                   /protein_id="CBL37659.1"
FT                   /translation="MAASQVMRITLKAYDHQLIDASAKSIIETVKKTGSKVSGPVPMPT
FT                   KKEIITILRATHKYKDSREQFEQRTHKRLIDIITPSQKTVDALSKLEVPAGVYIDIKMK
FT                   NK"
FT   CDS             579084..579713
FT                   /transl_table=11
FT                   /locus_tag="CL2_06070"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37660"
FT                   /db_xref="GOA:D4MYG5"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYG5"
FT                   /protein_id="CBL37660.1"
FT                   /translation="MKKAILTTKVGMTQIFNEDGVLTPVTVLQAGPCVVTQVKTEENDG
FT                   YSAVQVGFVDKKEKGINKPQKGHFDKAGVAPKRFVREFRFENAEEYTVGQEIKADIFAA
FT                   GDKIDATATSKGKGYAGGIKRHGLKSGPSAHGSKYHRHAGSNGMASDPSKVFKGKKMPG
FT                   QMGAERVTIQNLEIVKVDADQNIILVKGAVPGPKKSLVMLKESVKA"
FT   CDS             579743..580363
FT                   /transl_table=11
FT                   /locus_tag="CL2_06080"
FT                   /product="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37661"
FT                   /db_xref="GOA:D4MYG6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYG6"
FT                   /protein_id="CBL37661.1"
FT                   /translation="MATVSVLNMEGKEVEKLELNDNIFGVEINEHLVHLAVVSQLANNR
FT                   QGTQKAKTRSEVRGGGRKPWRQKGTGHARQGSIRAPQWKGGGVVFAPTPREYTKKLNKK
FT                   ERRIALKSALTSRVQADKFVVIDEFKFDEIKTKNVKAMLDSVGAKKALVVMGSKNDNLV
FT                   LSARNLPGVKTALTSTINVYDILKYDTVVVSKEAVANIEEVYA"
FT   CDS             580363..580662
FT                   /transl_table=11
FT                   /locus_tag="CL2_06090"
FT                   /product="Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37662"
FT                   /db_xref="GOA:D4MYG7"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYG7"
FT                   /protein_id="CBL37662.1"
FT                   /translation="MADIKYYDVILKPVVTEKSMNAMAEKKYTFLVHPSATKNQIKEAV
FT                   EKMFEGTKVAKVNTMNNDGKTKRRGMTFGKTAKTKKAIVQLTEESADIEIFEGL"
FT   CDS             580752..581597
FT                   /transl_table=11
FT                   /locus_tag="CL2_06100"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37663"
FT                   /db_xref="GOA:D4MYG8"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYG8"
FT                   /protein_id="CBL37663.1"
FT                   /translation="MGIKSYNPYTPSRRHMTGLDFDVITKSTPEKSLVVSLKKNAGRNN
FT                   QGKITVRHRGGGSRRKYRLIDFKRNDKDGIPATVAAIEYDPNRTANIALLVYADGEKRY
FT                   IIAPNKLAVGTTVMNGPEAEIKVGNCLPLANIPVGTEIHNIEMHPGKGGQLVRSAGNSA
FT                   QLMAKEGKYATLRLPSGEMRMVPVVCRATIGQVGNIEHDLVNIGKAGRKRNMGIRPTVR
FT                   GSVMNPNDHPHGGGEGKTGIGRPGPCTPWGKPALGLKTRKKNKQSNKMIVRRRDGKTVK
FT                   "
FT   CDS             581614..581895
FT                   /transl_table=11
FT                   /locus_tag="CL2_06110"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37664"
FT                   /db_xref="GOA:D4MYG9"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYG9"
FT                   /protein_id="CBL37664.1"
FT                   /translation="MARSLKKGPFADKSLLNKVDAMNEAGDKSVIKTWSRRSTIFPSFV
FT                   GHTIAVHDGRKHVPVYVTEDMVGHKLGEFVATRTFRGHKKTEKKTGMK"
FT   CDS             581923..582312
FT                   /transl_table=11
FT                   /locus_tag="CL2_06120"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37665"
FT                   /db_xref="GOA:D4MYH0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYH0"
FT                   /protein_id="CBL37665.1"
FT                   /translation="MAKKYSRSQYKKERNANKDTRPKATLRNARVSTTKAAFVLDAIRG
FT                   KDVETALGILLYNPRYASTLIEKLLKSAIANAENNNGMDPENLYIAECYANKGPTMKRI
FT                   KPRAQGRAYRIEHRMSHITLVLDER"
FT   CDS             582329..582979
FT                   /transl_table=11
FT                   /locus_tag="CL2_06130"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37666"
FT                   /db_xref="GOA:D4MYH1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYH1"
FT                   /protein_id="CBL37666.1"
FT                   /translation="MGQKVNPHGLRVGIIKDWDSRWYAEDAFADNLVEDDKIRKYVKKR
FT                   LYNAGISKIEIERASDRVKLIVYTAKPGVVIGKGGSSIEELKKDLQKMTDKKLLIDVKE
FT                   VKRPDKDAQLVAENIAQQLENRISFRRAMKSCMQRTMRSGALGIKTSVSGRLGGADMAR
FT                   TEFYSEGTIPLQTLRANIDYGFAEADTTYGKVGVKTWIYHGEVLPSKKEGGNK"
FT   CDS             582979..583416
FT                   /transl_table=11
FT                   /locus_tag="CL2_06140"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37667"
FT                   /db_xref="GOA:D4MYH2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYH2"
FT                   /protein_id="CBL37667.1"
FT                   /translation="MLMPKRVKRRKQFRGSMRGKALRGNKITYGEYGIVATEPAWITAN
FT                   QIEAARVAMTRYIKRGGKVWIKIFPDKPVTAQPAETRMGKGKGNLEYWVAVVKPGRVMF
FT                   EISGVSEEIAKEALRLAVHKLPIKCKIVSREALEGGDNSEN"
FT   CDS             583922..584290
FT                   /transl_table=11
FT                   /locus_tag="CL2_06170"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37668"
FT                   /db_xref="GOA:D4MYH3"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR023571"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYH3"
FT                   /protein_id="CBL37668.1"
FT                   /translation="MIQQESRLRVADNTGAKEILCIRVLGGSTRRYANIGDVIVATVKD
FT                   ATPGGVVKKGDVVRAVVVRTKKGARRKDGSYIKFDENAAVIIKDDMNPRGTRIFGPVAR
FT                   ELRDKKFMKIVSLAPEVL"
FT   CDS             585191..585376
FT                   /transl_table=11
FT                   /locus_tag="CL2_06200"
FT                   /product="Ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37669"
FT                   /db_xref="GOA:D4MYH4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYH4"
FT                   /protein_id="CBL37669.1"
FT                   /translation="MAKKSMVAKQKRKAKFSTREYSRCRICGRPHAYLRKYGICRVCFR
FT                   ELAYKGQIPGVKKASW"
FT   CDS             585401..585802
FT                   /transl_table=11
FT                   /locus_tag="CL2_06210"
FT                   /product="Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37670"
FT                   /db_xref="GOA:D4MYH5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYH5"
FT                   /protein_id="CBL37670.1"
FT                   /translation="MTMSDPIADMLTRIRNANTAKHDTVEIPASKMKTAIAEILLKEGF
FT                   IKAYDIKEEGSFSTIVITLKYGADKNEKIITGLKRISKPGLRVYAGAEELPKVLGGLGI
FT                   AIISTNKGLLTDKEARKQNVGGEVLAFVW"
FT   CDS             585890..586432
FT                   /transl_table=11
FT                   /locus_tag="CL2_06220"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37671"
FT                   /db_xref="GOA:D4MYH6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYH6"
FT                   /protein_id="CBL37671.1"
FT                   /translation="MSRIGRLPIDIPAGVEVKIEEGNKVTVKGPKGTLEKCLPVEMTIK
FT                   QEDNQVVVTRPNDLKKMKSLHGLTRSLIANMITGVSEGYEKKLEINGVGYRAQKKGKEI
FT                   TFNLGFSHPVVMTDPEGIETEMDGQNIIIVKGIDKEKVGQYAAEIRELRKPEPYKGKGI
FT                   KYADEVIRRKVGKTGAK"
FT   CDS             586447..586815
FT                   /transl_table=11
FT                   /locus_tag="CL2_06230"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37672"
FT                   /db_xref="GOA:D4MYH7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYH7"
FT                   /protein_id="CBL37672.1"
FT                   /translation="MIRKESRSKIRAKKHYKLRNRINGTSERPRLSVFRSNDHMYAQII
FT                   DDTVGNTLVSASTTQKDVKAELEKTNDVAAASYLGKVIAERALAKGITEVVFDRGGFIY
FT                   HGKIEALADAAREAGLKF"
FT   CDS             586830..587339
FT                   /transl_table=11
FT                   /locus_tag="CL2_06240"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37673"
FT                   /db_xref="GOA:D4MYH8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYH8"
FT                   /protein_id="CBL37673.1"
FT                   /translation="MKHTLIDPSQLELEERVVSIKRVTKVVKGGRNMRFAALVVVGDKN
FT                   GHVGAGLGKAAEIPEAIRKGKEAAMKSLVEVPIDEKGTTPHDFTGNFGGASVLLKTSPE
FT                   GTGIIAGGPSRIVLELAGYKNIRSKSLGSNNKQNVVLATIEGLKNLKTPEQVAKLRGKS
FT                   VEELLG"
FT   CDS             587353..587535
FT                   /transl_table=11
FT                   /locus_tag="CL2_06250"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37674"
FT                   /db_xref="GOA:D4MYH9"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYH9"
FT                   /protein_id="CBL37674.1"
FT                   /translation="MADKLKITLVKSTIGAIPKHKKTVEALGLKKLHKTVELPDNAATR
FT                   GMIHQVKHLVKVEEI"
FT   CDS             587563..588006
FT                   /transl_table=11
FT                   /locus_tag="CL2_06260"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37675"
FT                   /db_xref="GOA:D4MYI0"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYI0"
FT                   /protein_id="CBL37675.1"
FT                   /translation="MELSNLRPAEGSKHSDAFRRGRGHGSGNGKTAGKGHKGQKARSGG
FT                   GVRPGFEGGQMPLYRRIPKRGFKCRNSKEIVGINLSALERFEDGAEVSVEALIEAGIVK
FT                   NPRDGVKILGNGELTKKLNVKANAFSASAKEKIEALGGKAEVI"
FT   CDS             588209..589324
FT                   /transl_table=11
FT                   /locus_tag="CL2_06270"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37676"
FT                   /db_xref="GOA:D4MYI1"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYI1"
FT                   /protein_id="CBL37676.1"
FT                   /translation="MQMSVFALSVTPYITSSIIMQLMTIVIPALEEMQKDGEDGRKRMA
FT                   KITRYVTVVLAIIEGAGLAIGFANQGALGTDYTTFTIVTMIIALTAGAVLVMWLGERIT
FT                   ESGIGNGISIILLVNIVSGMPGDFTSLYNQFMKGKQIGPALIAGCVIVGVVLAVVVFVI
FT                   VLSDAERHIPVQYSKKMQGRKLVGGQQSKIPLKVNTAGVIPIIFASSIMQFPIMLQNVL
FT                   KYENNGFIGKALTSLNSSTWFDASHPKRSIGLLIYIVLVVLFAYFYTSITFNPLEISNN
FT                   MKKQGGFIPGIRPGKPTVDYLNKILKYIIFIGAAGLTIVAVVPFFFNGVFGASVSFGGT
FT                   SIIIIVGVILETIKQIQSQLLVQNYSGFLSE"
FT   CDS             589436..590119
FT                   /transl_table=11
FT                   /locus_tag="CL2_06280"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37677"
FT                   /db_xref="GOA:D4MYI2"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYI2"
FT                   /protein_id="CBL37677.1"
FT                   /translation="MVTKNKRETKGGFVMKIIMLGAPGAGKGTQAKQIAQAYDIPHIST
FT                   GDIFRANIKEGTELGKKAQEYMDKGLLVPDELVCDLVVDRIHKDDCEKGYILDGFPRTI
FT                   PQANALDEALAKDGEKIEFAIDIEVPDENIINRMSGRRSCKDCGAIFHVQYNPPKKENC
FT                   CDVCGGELILRDDDKAETVKKRLDVYHEQTAPLIAHYKEAGSLHEIDGTQDIKVVFEEI
FT                   KSILG"
FT   CDS             590130..590885
FT                   /transl_table=11
FT                   /locus_tag="CL2_06290"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37678"
FT                   /db_xref="GOA:D4MYI3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYI3"
FT                   /protein_id="CBL37678.1"
FT                   /translation="MAVTIKSKKEIELMREAGKMLEEVHNKLADFVKPGISTLEIDQFG
FT                   EKAIRDLGCVPNFLNYNGYPASICVSVNDEVVHGIPSKDRILQDGDIVSLDAGLIHEGY
FT                   HSDAARTHAVGNISEEAKRLIEVTKQSFFEGIKLAVPGNHLFDISEAIQKYVESNGYSV
FT                   VRDLVGHGIGTHLHEDPQIPNFKQRRKGMKLRPGMTLAIEPMVNEGSYDVVWLDDDWTV
FT                   VTEDGSLAAHYENTIVITEDGCEILTLSE"
FT   CDS             590896..591114
FT                   /transl_table=11
FT                   /locus_tag="CL2_06300"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37679"
FT                   /db_xref="GOA:D4MYI4"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYI4"
FT                   /protein_id="CBL37679.1"
FT                   /translation="MAKSEAIEVEGVVLEKLPNAMFKVEIEGGHVILAHISGKLRMNYI
FT                   KILPGDKVTLALSPYDLSKGRIIWRDK"
FT   CDS             591601..591969
FT                   /transl_table=11
FT                   /locus_tag="CL2_06320"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37680"
FT                   /db_xref="GOA:D4MYI5"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYI5"
FT                   /protein_id="CBL37680.1"
FT                   /translation="MARISGVDLPREKRVEIGLTYIYGIGLSSAKRILAEANVDPDTRV
FT                   RDLTDDEVKRISAVINDTQVVEGDLRREIALNIKRLKEIGCYRGKRHRQGLPCRGQKTK
FT                   TNARTRKGPKKTVANKKK"
FT   CDS             592092..592484
FT                   /transl_table=11
FT                   /locus_tag="CL2_06330"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37681"
FT                   /db_xref="GOA:D4MYI6"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYI6"
FT                   /protein_id="CBL37681.1"
FT                   /translation="MAKVTKKSAKKRVKKNVQHGQAHIQSSFNNTIVTLTDAQGNALSW
FT                   ASAGGLGFRGSKKSTPYAAQMAAETATKAALVHGLKSVDVMVKGPGSGREAAIRALSAA
FT                   GLEVTSISDVTPVPHNGCRPPKRRRV"
FT   CDS             592504..593097
FT                   /transl_table=11
FT                   /locus_tag="CL2_06340"
FT                   /product="SSU ribosomal protein S4P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37682"
FT                   /db_xref="GOA:D4MYI7"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYI7"
FT                   /protein_id="CBL37682.1"
FT                   /translation="MAVDRTPVLKRCRSLGLDPVFLGIDKKSNRSLNRANRKKSEYGLQ
FT                   LCEKQKAKFIYGVLEKPFRNYYAKAERMKGQTGTNLMTLLELRLDNVLFRLGYGRTRKE
FT                   CRQIVDHKHVLVNGKQVNIPSYQVKAGDVIEIKEKHRTSPRYKEILEVTEGRMIPSWLE
FT                   ADHDNFTGTVKELPSRDEIDVPVNETLIVELYSK"
FT   CDS             593137..594093
FT                   /transl_table=11
FT                   /locus_tag="CL2_06350"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37683"
FT                   /db_xref="GOA:D4MYI8"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYI8"
FT                   /protein_id="CBL37683.1"
FT                   /translation="MFEFEKPNIEINEISEDNRFGRFVVEPLERGYGTTLGNSLRRIML
FT                   SSLPGAAVSSVKIKGVLHEFSSIPGVKEDVPEIIMNIKSLAIKNNSSSAETKQAYIEFS
FT                   GKGVVTAGDIKADSDIEILNPELVIATLSDDSSKLDMELTITNGRGYVGADKADKEGKA
FT                   IDEIAVDAIYTPVERVNLKVENTRVGQITDYDKLTLDVFTNGTLTPDESVSLAAKVLCE
FT                   HLNLFVDLSENAKTAEVMVEKEDDEKEKVLEMSIDELELSVRSYNCLKRAGINTVEELT
FT                   NKTSEDMMKVRNLGRKSLEEVLAKLSELGLSLSSGEE"
FT   CDS             594159..594695
FT                   /transl_table=11
FT                   /locus_tag="CL2_06360"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37684"
FT                   /db_xref="GOA:D4MYI9"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYI9"
FT                   /protein_id="CBL37684.1"
FT                   /translation="MAKYRKLGRTASQRKALIRAEVTNLLHHGKIITTEAKAKEIRKVA
FT                   EKLIALAVKEKDNFETVTVDAKVAKKDENGKRVKEVVDGKKVTVYETVQKEIKKDLPSR
FT                   LHARRQMLKVLYPVTEVPTEAAGKKANTKKVDLTAKLFDEYAPKYAERNGGYTRIVKIA
FT                   QRKGDAALKVVLELV"
FT   CDS             594841..595692
FT                   /transl_table=11
FT                   /locus_tag="CL2_06370"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37685"
FT                   /db_xref="GOA:D4MYJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYJ0"
FT                   /protein_id="CBL37685.1"
FT                   /translation="MSILKIKDLVHKYVTYGDTEEDKQEIAAINHIDINVEKGEFVAIL
FT                   GKNGSGKSSLAKHINGLLMPTEGTVYIKGMDTKDESTLLKVRQSAGIVFQNPDNQIVGT
FT                   TVEEDTAFGPENLGIASKDIWTRITAALTGVGMIAYKEASPNHLSGGQKQRVAIAGIMA
FT                   MEPECIVLDEPTAMLDPEGRRHVLSLVKALNKEKNITILMVTHHMEEVILADRIIVMDQ
FT                   GKIVMDGKPKEIFSRVDEMKTLGLEVPYATELAWELKKEGVNLSDTITTKEELVEELCQ
FT                   FV"
FT   CDS             595677..596537
FT                   /transl_table=11
FT                   /locus_tag="CL2_06380"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37686"
FT                   /db_xref="GOA:D4MYJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYJ1"
FT                   /protein_id="CBL37686.1"
FT                   /translation="MSIRLEHVSYAYEDNSSKKNYALKDVNLEIKKEEFIAVIGHTGSG
FT                   KSTLIQHLNGLIKPTSGTIYFDDEDIYSEGYPLRELRGKVGICFQYPEHQLFETTILDD
FT                   VCFGPMNFGKTKEEATEIAVKCLKDVGLSEKLYQKSPFELSGGQKRRVAIAGILAMEPE
FT                   YFILDEPTAGLDPVGKDQILNLLKKLHEEKKITIILVSHSMEDVADYAQRVIVMNGGQV
FT                   MYEGDKKEVFSHKKELEEAGLAVPFYRQVCEELADRGFPIQRDLLTLEETKEAILEGLK
FT                   GLRGK"
FT   CDS             596539..597348
FT                   /transl_table=11
FT                   /locus_tag="CL2_06390"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37687"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYJ2"
FT                   /protein_id="CBL37687.1"
FT                   /translation="MLKDITIGQYYKEDSLIHRLDPRVKLFAVLIYVITLFMHKAPATY
FT                   VMSLLFLIITIKISKVPVKYILRGLKAIAVILLFSVMINMLFIPGKPVIQFWIISISAE
FT                   GIRTTIYLGSRLIMLVLGTSLLTFTTTPNELTDGLDKSLGFLNKVGVPVHEIAMMMSIA
FT                   LRFIPILTEELEKIMKAQTARGIDFESGGLLKRVKSMVPIIVPLFVAAIRRANDLAMAM
FT                   ESRCYHGGVGRTKLKPLKYEKRDKIAYIVLFVFLAVMIYLSFFSPWR"
FT   CDS             597355..598113
FT                   /transl_table=11
FT                   /locus_tag="CL2_06400"
FT                   /product="pseudouridylate synthase I"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37688"
FT                   /db_xref="GOA:D4MYJ3"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYJ3"
FT                   /protein_id="CBL37688.1"
FT                   /translation="MKRVKLIVAYDGTGYCGWQVQPNEITVEGVLNKHISELTGEDIKV
FT                   IGASRTDSGVHALGNVAVFDTESRIPGEKMAKALNARLPEDIIIQDSKEVPLDYHPRFQ
FT                   DTRKTYEYTFYNARYDNPVTSRHHHFVYVPLDVEKMKEAASYFLGEHCFISMCSSKAQV
FT                   TSYVREIYECDVTQNGRYIKMRVTGSGFLYNMVRLMAGTLLEVGRGKQEPQWVKEILAS
FT                   KERVTPGPKLPAKGLTLIQIEYPEDRENAE"
FT   CDS             598103..599044
FT                   /transl_table=11
FT                   /locus_tag="CL2_06410"
FT                   /product="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37689"
FT                   /db_xref="GOA:D4MYJ4"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYJ4"
FT                   /protein_id="CBL37689.1"
FT                   /translation="MQNSFIIFQKLLVLFGFMLIGYLSYKKKWISDDTSSQISGLIVNI
FT                   FNPALIISGVIGSVGNGNWNLVIMDLILAVILFVVLILISPAFVRILGVKKDERNIYAV
FT                   MLIFSNLGFMGIPIIEELYGREAIFYVALYTLVYNILFYTYGIYLFEKERAMQTGQKAK
FT                   IIFHWKKMINPGMVACLAALLIFAFQIDAPAPAVSFVQYLGNAAIPLSMIITGVSLAKM
FT                   PLIEVFKDIKMYQFTFLKMLVIPMIAAFAIRLFHLDPVLSGIMVLMFGMPNGSMAVMMA
FT                   IDYGLDSSICSRGIVLTTLLSIITLPIVAYLI"
FT   CDS             599302..599736
FT                   /transl_table=11
FT                   /locus_tag="CL2_06420"
FT                   /product="LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37690"
FT                   /db_xref="GOA:D4MYJ5"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR023564"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYJ5"
FT                   /protein_id="CBL37690.1"
FT                   /translation="MKSFMASPSTIEREWYVVDATGHTLGRLASEIATILRGKNKPTYT
FT                   PHIDTGDNVIVINAEKIKVTGKKLDQKIYYHHSDYVGGMKEQTLKEKLAKKPEDVIYLA
FT                   VKGMLPKGPLGRQMIKKLHVYAGAEHNHAAQQPKALEIKY"
FT   CDS             600273..600401
FT                   /transl_table=11
FT                   /locus_tag="CL2_06440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37691"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYJ6"
FT                   /protein_id="CBL37691.1"
FT                   /translation="MLSYISKARSGSGIFNAEKMSVYVPLGTQQMLSDYGYHIVTE"
FT   CDS             600419..601114
FT                   /transl_table=11
FT                   /locus_tag="CL2_06450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37692"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYJ7"
FT                   /protein_id="CBL37692.1"
FT                   /translation="MKLKNLTKKLTTLAITALMATTLVSTQNVLAASKKAQKKANKAYA
FT                   QAIKKNKVAKFTSYSLIEVTGGGTKELVTVNLNSNAEGKARNLNIYTYNKGKVKKIWST
FT                   SDQIIAYNKKQKTIAGLQYSVLSENGSESEKYYIYKYDGKKVVKKASYFFEREGHFEDK
FT                   DGNKVTTNLEKSEKTVHRVIDKEIYSKKEKGKLTYISERQYRSATKNDVRVWAYNNTTK
FT                   KELIKKLRK"
FT   CDS             601321..601473
FT                   /transl_table=11
FT                   /locus_tag="CL2_06460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37693"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYJ8"
FT                   /protein_id="CBL37693.1"
FT                   /translation="MSHEFVMPGKVITGKGALQDAENEFQTAGKKALIVSGKVMERVGN
FT                   VKVSS"
FT   CDS             601663..601824
FT                   /transl_table=11
FT                   /locus_tag="CL2_06470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37694"
FT                   /db_xref="GOA:D4MYJ9"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYJ9"
FT                   /protein_id="CBL37694.1"
FT                   /translation="MGGIIGALKKKGFSTYSHENNIIVAPPLIITETELRDAMAIMDEV
FT                   LADVDAMI"
FT   CDS             602139..604118
FT                   /transl_table=11
FT                   /locus_tag="CL2_06480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37695"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYK0"
FT                   /protein_id="CBL37695.1"
FT                   /translation="MKKLKKMLSLMIVFSLVLAMMSGHKIKASEPLKIEKFEVEKSEIR
FT                   CGEKIKLNIEISGAHKTYTIYEEDINGTKKTIVDNSYSSSLIWTPTDPGQKTLYLEVED
FT                   MSGNIVTASKEVNVKKGIIPDINRKLEYCYATGDQYAGVDIVMCLMDYNIPDLADKNCK
FT                   ASVEELGDRKVITSIDNKFYYGCINFCVTDQGKIGDSAILHVTIKSKSYEDIHINYTIT
FT                   LKDQEEIFPDEESQPAIEGNDTLIYGQKLGELKLNSESAFFLPKGGMTYIDGTLKFENE
FT                   NEILPVGTQDAKYVFIPDNKEYKEYHGTVKVKIKKATPTLNDIKVGMIAYADKKTLDNV
FT                   KLKTGKAVVMYDGKEKEISGNWKWKNPEQNLEVGSKKYSIIFTPDDTENYETVEGEVDV
FT                   KGIAGPLKVYLKNNESIIKQLKDGDMVKEIAFVEKKINFVNEDGEKVNGTIQWEEPNKI
FT                   LTEGKQQVKYIFIPENKDYQSYNGTIEVLVNKEAPKIEEIKPEPIKVIKVKDENNVKVN
FT                   QTTITNGITYKITKIVNKKNAEVKITNLDKKKTSIIIPDYIMINGVKCKVTSIEKKALY
FT                   KGKKLKKITIGKNVQIIADNAFNGCKNLKSITIKSTILKKVGKNAIKGIHKKATIKVPK
FT                   KQYKQYKKLFSKKTGFKKSMKIKK"
FT   CDS             604348..605646
FT                   /transl_table=11
FT                   /locus_tag="CL2_06490"
FT                   /product="phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37696"
FT                   /db_xref="GOA:D4MYK1"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYK1"
FT                   /protein_id="CBL37696.1"
FT                   /translation="MNYLEIEKVVGREILDSRGNPTVEAEITLVDGTVARGTAPSGAST
FT                   GEFEALELRDGDKERYLGKGVTKAVENINTKISEAIIGLDASDTYAVDKAMIDADGTAD
FT                   KSNFGANAILAVSIAAARAAATSLEVPLYRFLGGVSGNRLPVPMMNIVNGGCHALSSGL
FT                   DVQEFMIMPVGAPSFKECLRWCAEVFHALAAILKERGLATSVGDEGGFAPALKSDEEAI
FT                   ETILEAVKKAGYEPGKDFKIAMDAASSEWKSEKGKGYYKLPKAGTEYTAEELIEHWAAL
FT                   CEKYPIISIEDGLDEEDWEGWKKLTERLGDKVQLVGDDLFVTNTERLSKGIEMGAGNSI
FT                   LIKLNQIGSISETLEAIKMAHKAGYTAVTSHRSGETADTTIADLAVALNTCQIKTGAPS
FT                   RSERVAKYNQLLRIEEALGDSAVYPGIKAFNVK"
FT   CDS             605812..606120
FT                   /transl_table=11
FT                   /locus_tag="CL2_06500"
FT                   /product="Nucleotidyltransferase domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37697"
FT                   /db_xref="GOA:D4MYK2"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYK2"
FT                   /protein_id="CBL37697.1"
FT                   /translation="MDKIIIDQTGIKQQVINEICELAQKYNVEQVLLFGSRSRGDYKRT
FT                   SDIDLAVRGGDIDRFALDVEEETTTLLEYDIVDLDEPMQPELLESIQKEGKIIYEIM"
FT   CDS             complement(606310..607416)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06510"
FT                   /product="Methionine synthase II (cobalamin-independent)"
FT                   /EC_number="2.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37698"
FT                   /db_xref="GOA:D4MYK3"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYK3"
FT                   /protein_id="CBL37698.1"
FT                   /translation="MRPYRYDIVGSFLRPDYLKDARAEYAEGTLSADQLREVEDKAIKE
FT                   LVEKEKAVGLKAVTDGELRRRYWHLDFLASLVGVEEIKADHWSVAFKGHQPKAATLEIV
FT                   DKIDFDENSEFLDHFSYLKEIAGDVDCKMTIPSPAMLHLICCVRGSETYKAIDRYKNED
FT                   DLYHETALAYQKAIKAFYARGCRYLQFDDTSWGEFCDQNKRDDYASRGLDLDQIAKNYV
FT                   KMINEALEAKPEDMTITMHICRGNFRSTWFSSGGYEPVAETLFGGCKIDGFFLEYDSDR
FT                   SGDFKPLRFIKDQKVVLGLVTSKDPELEDKTEIKERIKEAAQYVALDQLCLSPQCGFSS
FT                   TEEGNILTDEDQWKKMTLIKEIAEEVWG"
FT   CDS             607778..609223
FT                   /transl_table=11
FT                   /locus_tag="CL2_06520"
FT                   /product="Iron only hydrogenase large subunit, C-terminal
FT                   domain"
FT                   /EC_number="1.12.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37699"
FT                   /db_xref="GOA:D4MYK4"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027631"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYK4"
FT                   /protein_id="CBL37699.1"
FT                   /translation="MYDVTSIQNLKKDVLYFVAKASFEGTLEEERDLIPEKMIEGPEPT
FT                   FRCCIYKEREIVRQRIRLAEGKAPGAEDDGNIVQVIKSACADCPISSYVVTNNCQNCLG
FT                   KDCIKACRFGAIEPGHTRSRIDPQKCKECGMCAKACPYNAIAHVSRPCKDSCPVDAISY
FT                   DEYGVSVIDEEKCIRCGQCAAKCPFGAIGTKTWITNVIADLKAGKKVYAILAPATEGQF
FT                   GKDITMESWRQAVKKVGFEDLIEAGLGGDMTTCSEAEEWLEAYRNGEKKTTSCCPGFVN
FT                   MIRKHYPDLADMISTTVSPMCAVSRMIKAKDPDAVTVFVGPCVAKKSEVADQKIEGNAD
FT                   YALNYNEILAIMKAKDVELEPAENTYQDSTIFGKFYGNSGGVTDSVLEYMKETEQNEDI
FT                   KVCKANGAAECKKALMFLQRGRLPEDFIEGMACEGGCVGGPSRNEEIIKARKVRETMIK
FT                   SADDRKITDNLKRYDMDSFSMHR"
FT   CDS             609420..610580
FT                   /transl_table=11
FT                   /locus_tag="CL2_06530"
FT                   /product="Uncharacterized flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37700"
FT                   /db_xref="GOA:D4MYK5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYK5"
FT                   /protein_id="CBL37700.1"
FT                   /translation="MKDIKVTDSVKYIGVDDHDIDLFESQYVVPNGVSYNSYVILDEKV
FT                   AVMDTVDACKTDEWLVNLEEALDGRNVDYIVVSHMEPDHAASLQVLAEKYPEAKVVGNA
FT                   KTFNMIPQFFTFDLEGRKVVVKEGDTLSLGSHTLQFVMAPMVHWPEVMVAYETSEKILF
FT                   SADGFGKFGALDADEDWACEARRYYFNICGKYGVQVQNLLKKAAGLDIEIICPLHGPIL
FT                   KENLGYYIGLYDTWSKYEPENEGILIAYASIHGNTAAAAKKLAEILEAKGAPKVVVADL
FT                   SRDDMAEVIEDAFRYDRLVLAAATYDAGIFPCMEDFLHHLKAKNYQKRKVAFMENGSWA
FT                   PMAAKIMKGIVEGFKNIEMVDPVVTIKSTMNDENIKTMEELADNLL"
FT   gap             610617..611017
FT                   /estimated_length=401
FT   CDS             complement(611238..612203)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06540"
FT                   /product="Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37701"
FT                   /db_xref="GOA:D4MYK6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYK6"
FT                   /protein_id="CBL37701.1"
FT                   /translation="MKKDKNILVVMPVKDEHKKTLEQHSQGNKFIYSSYDNVTQEMVQE
FT                   ANVIIGNVDPFYLQEAKNLEWLQLNSAGADPYVKKGVLPEDVILTNATGAYGPSVAEHM
FT                   LAVLFSLQKKLHLYRDNQNQCEWQDEGGVMSLCGGTLLIVGLGDIGLYFARLMKNFDYH
FT                   IIGIKRRPGQVPQDIDELHTMDDLDKLLPKADVVLSVLPDSKATRNIFNKDRFEKMKNT
FT                   SILLNAGRGSAVNTEDLCEALIQGQIYGAGLDVTDPEPLQTQHKLWNVENVIITPHVAG
FT                   DFHHPATLYRIVDIIAGNLQRYLEGEQLTNIVDTTTGCKL"
FT   CDS             612381..613307
FT                   /transl_table=11
FT                   /locus_tag="CL2_06550"
FT                   /product="Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37702"
FT                   /db_xref="GOA:D4MYK7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYK7"
FT                   /protein_id="CBL37702.1"
FT                   /translation="MNDFKYVFGPIPSRRLGRSLGISPLPKKTCNYSCIYCQLGRTDKM
FT                   TNKRQEFYKTEDIIAEFKQYLKDSDKFDIVTVVGEGEPTLAANLGELVVALKALTDKPV
FT                   AVITNGALLSDPQVREELCHADMVLPSLDAYNQEISKKIDRPYGTIKFEEEFEGLKKFT
FT                   HMYEGELWLEIMLVDGINDDEQSILKFQELLKELKYDRLYLNTPVRPPAEADVNVVSEE
FT                   RMRYAVETLGGISIEMMSSGAFFSEIEDDYEAVKSIIGRHPMNQFEVRGFLESRDVKDP
FT                   EAMMEQMKKDEAIHVIDYKGILTFRLK"
FT   CDS             613341..614213
FT                   /transl_table=11
FT                   /locus_tag="CL2_06560"
FT                   /product="Pyridoxal/pyridoxine/pyridoxamine kinase"
FT                   /EC_number="2.7.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37703"
FT                   /db_xref="GOA:D4MYK8"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYK8"
FT                   /protein_id="CBL37703.1"
FT                   /translation="MKHSVKRVAAIHDLSGFGRASLTAIIPILSSMGVQVCPLPTAILS
FT                   NHTGGFDTFSFVDFTDHMQDYIDHWKELNIDFDCIYSGFLGSERQIEIVSGFIDDFGTE
FT                   DNMVVIDPVLGDNGNLYSTMDQGLVEGMKRLVTKADIITPNFTEVSLLLGEEYKQTTTD
FT                   EEIKEWVKRLSDMGPDIIVVTSVPDKEKDKDSNVIAYDRTCNTYWKIKCRYIPTFYPGT
FT                   GDAYTSVMIGSLLDGDSLPIALDKGVQFITQAIKASYGFDYPNREGVLLERVLEVLKMP
FT                   VVLGGYEMI"
FT   CDS             614244..614891
FT                   /transl_table=11
FT                   /locus_tag="CL2_06570"
FT                   /product="Chloramphenicol O-acetyltransferase"
FT                   /EC_number="2.3.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37704"
FT                   /db_xref="GOA:D4MYK9"
FT                   /db_xref="InterPro:IPR001707"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYK9"
FT                   /protein_id="CBL37704.1"
FT                   /translation="MFYLLDPEKWERQKHFEYYMQMIPCGYTVTVRLDVENLYQQVKKC
FT                   GLKFYPAFIYCTGKVVNEKREFKMGVDQEGRPGYFDVMHPNFTIFHKDDHTFSDIWSYY
FT                   DDDFQTCYQNIINDMETYKDVKGPKGKEGQPPNFFCISCVPWMDFTGYSTWVPTGRPNL
FT                   FPIITFGKYVEEEGRRKLSAALTISHASADGYHASMFFERLQEVLDEFVIDQ"
FT   gap             616159..616715
FT                   /estimated_length=557
FT   CDS             complement(616745..616999)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37705"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYL0"
FT                   /protein_id="CBL37705.1"
FT                   /translation="MKQLFKKPSYYLISSAMDGNEKAIEKLLAFYDPYISKCCLRSLYD
FT                   EYGNVYIVVDMELKGRIREALIKMILGFDIEDMDLEPEE"
FT   CDS             complement(617003..617710)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06600"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37706"
FT                   /db_xref="GOA:D4MYL1"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYL1"
FT                   /protein_id="CBL37706.1"
FT                   /translation="MILENNFDMQIKKYVSWNVLKKSIGYKWKKQSIKSLIRYINSFAR
FT                   ANILFCAGFFHTRKKFKNFSKEVIKSHLAVLIWCGKRDKHFSNHKGKGVRLMKPSDFQK
FT                   TVQCRFESCLKKVVRSVVKDYYKELNRRKNKEISFSELPDVLVDKMAVWDDYETDYTIF
FT                   SVCGIDIRVLDDELAEALKKLPERKRNTLLMYYFLEMTESEIANLQKITQSGVFRNRHH
FT                   ALETMKKILKEEH"
FT   CDS             617818..618483
FT                   /transl_table=11
FT                   /locus_tag="CL2_06610"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37707"
FT                   /db_xref="GOA:D4MYL2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYL2"
FT                   /protein_id="CBL37707.1"
FT                   /translation="MNKIAIIEDDIDICNMIAKFLENNKYIVHYALNGAEGIELCKSLV
FT                   PDLIILDIMLPRLNGNDVLQRLRKFTNAPVIVVSAKTMVQTKIDLLKLGADDYMTKPFD
FT                   LHELLARIEANLKRTSNTSCQNDTLTYRDIEINNSLVYIKEVLVPFTSTELKILRLLLQ
FT                   YPQKIFSKQNLYESIWNETYAYDDDTINTHISHIRKKIKAITNEDYIQTIWGIGYKIK"
FT   CDS             618539..619456
FT                   /transl_table=11
FT                   /locus_tag="CL2_06620"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37708"
FT                   /db_xref="GOA:D4MYL3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYL3"
FT                   /protein_id="CBL37708.1"
FT                   /translation="MKKFICETKNLSKKYKDFYALKNVNLTIPKGEIYGLVGENGAGKT
FT                   TLIRLLTGLNFKSEGEIILFGHTDNLQYERAKIGCTIEMPALYKDMTASQNLEVQRIQR
FT                   GIPNKKCIADTLELIGLSNAGKKRVANFSLGMKQRLALGVALLGEPEFLILDEPVNGLD
FT                   PTGIIELRELLKKLVKEREVTILISSHILSELHQLATCYGFLHKGELLKQISAEELNEE
FT                   CKRHICLRTDNIQKTTLLLEQKGNINNYSVYPDNSIRIYECLDNVRMISKLLSSNGVII
FT                   DEISVQGENLETYFENLIGGRKNV"
FT   CDS             619449..620270
FT                   /transl_table=11
FT                   /locus_tag="CL2_06630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37709"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYL4"
FT                   /protein_id="CBL37709.1"
FT                   /translation="MFNQIRAEFYKLFHTKALYLTFALILAVFGIFSIGGQQQFVVSSS
FT                   SLDETCKIGETVGFLARAYSDTAHPLIEEIIRTATSYTVFFWLIVLIFSVIFFSREYTD
FT                   STIKIAIASGQSRIKFFVAKYIVISITSIFLYFSFIMIAFIIECAKFNIPIQLFPMLKI
FT                   AGLNCMIMGAFIGITLMLCVIFKHTAIVVGAMSLFTFSGPLIYMMTWDNMSTQSWRVLT
FT                   YLKINPMYYWMNTCSYNMINNLEINILIYFVGTVIITFLVSALILRKQEIR"
FT   CDS             620297..621175
FT                   /transl_table=11
FT                   /locus_tag="CL2_06640"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37710"
FT                   /db_xref="GOA:D4MYL5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYL5"
FT                   /protein_id="CBL37710.1"
FT                   /translation="MLYFLLICSIFILAFSLFSIIRTIRNINKQIKQQQKIRVSLSNRD
FT                   IEELAYAINQKDNLHKKLQVQIKQEEEQLKQSISNISHDLRTPLTSIQGYLTLLQECED
FT                   KQEQGQYIKIIKAKTDYLTDLVQEFYDLSVLENEQSDVECERIDINRIVTDCLIEKYYE
FT                   FGEIQPIIQTENSPVWIYGNNLICKRIIENLIVNALRYSDNYIEVSINQKGVFTIKNST
FT                   KSLDNIDVNLLFNKFYTPDKSRNKGSSGLGLYIVKELLKKIDGKIENVSYEGNILSISI
FT                   CFPLYNDKKLL"
FT   CDS             complement(621210..621572)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37711"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYL6"
FT                   /protein_id="CBL37711.1"
FT                   /translation="MKKAEMQEQEFLEICSSYDYDLLTNKIEMTLKDYQRITYLVGSLG
FT                   YSQYLQFLIGKYMDLAQADEEQEEREHEIYLEYPEYYEDEGILEEEEKWLEEFLNQLPE
FT                   NKREYFERLIKESQSY"
FT   CDS             complement(621592..621816)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37712"
FT                   /db_xref="GOA:D4MYL7"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYL7"
FT                   /protein_id="CBL37712.1"
FT                   /translation="MLRFRKKDSKELIKRMAKTNGCSVSEIRREMQYAIDEARNSDDPD
FT                   KQAEFQRLFGNKIPSPEEFICVVGKNLKF"
FT   CDS             complement(622383..623285)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37713"
FT                   /db_xref="InterPro:IPR024735"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYL8"
FT                   /protein_id="CBL37713.1"
FT                   /translation="MFKKNKKSTENVKEKKVRTVKVGTHKKTVIALWVVLIASVSFGVY
FT                   KNFTAIDQHTTHEKEIIELRLQDTNGIENFVKNFAKSYYTWDNSKEAIEARTQAISGYL
FT                   TKELQDLNVDTIRTDIPTSSTVTDVIVWHIEQSGTDTFSATYEVDQQIKEGEQTSNVTA
FT                   TYTVKVHVDADGDMVIVQNPTLAPAIEKSDYEPKTPETDTSVDADTVNDATAFLETFFK
FT                   LYPTATEKELAYYVSGNVIEPIGRDYLYSELVNPIFTKDGDNVKVKVAVKFIDNQTKAT
FT                   QVSQYELVLQKDSNWKIVE"
FT   CDS             complement(623302..624309)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06690"
FT                   /product="Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37714"
FT                   /db_xref="GOA:D4MYL9"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYL9"
FT                   /protein_id="CBL37714.1"
FT                   /translation="MKLKHIALIGSLFPILFSLVLFFGVLISADSDDENSNFSSGITGM
FT                   NLSAEVLKHQPMVEKYAREYGISEYVNVLLAIIQVESGGTAEDVMQSSESLGLPPNSLD
FT                   TESSIKQGCKYFASLLSSCKNQGIDDLDVAIQSYNYGGGYVGYVAGKGKKHTFNLAENF
FT                   AREKSGGKKVTYTNPIAVAKNGGWRYGYGNMFYVELVNQYLTVAHFDNATAQAIMNEAL
FT                   KYQGWKYVYGGSSPTTSFDCSGLTQWCYGKAGISLPRTAQAQYDATQHLPFSQAKAGDL
FT                   VFFHSTYNAGTYVTHVAIYVGNNQMYHAGDPIGYADLSSSYWQQHLIGAGRVKQ"
FT   gap             626254..626569
FT                   /estimated_length=316
FT   CDS             complement(626615..629065)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37715"
FT                   /db_xref="InterPro:IPR016628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYM0"
FT                   /protein_id="CBL37715.1"
FT                   /translation="MFPIKYIDNNLVWNKDNEVFAYYELIPYNYSFLSAEQKFIVHDSF
FT                   RQLIAQSREGKIHALQIATESSIRSMQEQSKKLVTGKLKEVAYQKIDEQTEALVSMIGD
FT                   NQVDYRFFLGFKLMVTEEQLNLKNIKKSAWLTFTEFLHEVNHTLMNDFVSMPNDEINRY
FT                   MKMEKLLENKISRRFKVRRLEINDFGYLMEHLYGRDGIAYEDYEYQLPKKKLQKETLIK
FT                   YYDLIRPTRCVIEESQRYLRLEHEDKESYVSYFIVNAIVGELDFPSSEIFYFQQQQFTF
FT                   PVDTSMNVEIVENRKALTTVRNKKKELKDLDNHAYQAGSETSSNVVDALDSVDELETDL
FT                   DQSKESMYKLSYVIRVSAPDLDELKRRCDEVKDFYDDLNVKLVRPAGDMLGLHSEFLPA
FT                   SKRYINDYVQYVKSDFLAGLGFGATQQLGETTGIYMGYSVDTGRNVYLQPSLASQGVKG
FT                   TVTNALASAFVGSLGGGKSFCNNLLVYYAVLFGGQALLLDPKSERGNWKETLPEIAHEI
FT                   NIVNLTSDKDNAGLLDPFVIMKNVKDAESLAIDILTFLTGISSRDGEKFPVLRKAVRSV
FT                   TQSDSRGLLHVIDELRREDTPISRNIADHIDSFTDYDFAHLLFSDGTVENAISLDNQLN
FT                   IIQVADLVLPDKDTTFNEYTTIELLSVAMLIVISTFALDFIHSDRSIFKIVDLDEAWAF
FT                   LNVAQGETLSNKLVRAGRAMQAGVYFVTQSAYDVSKESLKNNIGLKFAFRSTDINEIKQ
FT                   TLEFFGIDKDDENNQKRLRDLENGQCLLQDLYGRVGVVQIHPVFEELLHAFDTRPPVQR
FT                   NEVE"
FT   gap             629467..629874
FT                   /estimated_length=408
FT   CDS             complement(630307..630810)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06740"
FT                   /product="Antirestriction protein (ArdA)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37716"
FT                   /db_xref="InterPro:IPR009899"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYM1"
FT                   /protein_id="CBL37716.1"
FT                   /translation="MQETRVLVETRGTTGKETTSYWFDLPIDVAEFEEKLGVGAESQDY
FT                   RIIEKVLPFADEVHEHTSVYQLNELDFMYRQLSSDMQEEYTALLTVYENLEALYICRNV
FT                   ITVYPDCKSMIDVARQKLMNDPTFKHLSEDCQEYYFDFEAYASHLQEHGKFLVTEHGIF
FT                   ELPE"
FT   CDS             complement(631113..631421)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37717"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYM2"
FT                   /protein_id="CBL37717.1"
FT                   /translation="MLGFSIMMWFVSAILIFVSISLLKGNYSFVHGKVFDTTDNKKGYA
FT                   KELGKPVLFVGIGILVSGVIAIIVKNHSIPTAVFFLAIIAGIAGLWLHKIQKNFRKF"
FT   gap             631555..632444
FT                   /estimated_length=890
FT   CDS             complement(633110..634504)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06770"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37718"
FT                   /db_xref="GOA:D4MYM3"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYM3"
FT                   /protein_id="CBL37718.1"
FT                   /translation="MRKIWNKGHRIRASDKHLVYNFSIGTLLFVFVAVLLLLNMKQLMR
FT                   TDWENFSLLENGLTLSTYNFITILIATGVCALVAFLYYRFCYDNFKKLLHRQKLARMIL
FT                   ENKWYEADTVQDSGFFTDLQSRSREKIVWFPKIYYQMEKGLLHIRCEITLGKYQDQLLR
FT                   LEDKLESGLYCELTDKTLHDGYIEYILLYDMIANRITIDEVRAENGCLRLMKNLVWEYD
FT                   ALPHALIAGGTGGGKTYFLLTLIEALLHTDAVLYILDPKNADLADLGTVMGNVYHTKEE
FT                   MIDCVNAFYEGMVQRSEEMKRHPNYKTGENYAYLGLAPCFLIFDEYVAFFEMLGTKESV
FT                   SLLSQLKKIVMLGRQAGYFLIVACQRPDAKYFSDGIRDNFNFRVGLGRISELGYGMLFG
FT                   SDVKKQFFQKRIKGRGYCDVGTSVISEFYTPLVPKEHDFLQTIGSLAQARQDGTATGEA
FT                   KGDGTD"
FT   CDS             complement(634569..635327)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06780"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37719"
FT                   /db_xref="GOA:D4MYM4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYM4"
FT                   /protein_id="CBL37719.1"
FT                   /translation="MYQINNEKFGHFLAEVRKEKQMTQKDLADKLFVSDKTVSKWERGN
FT                   SMPNVTLLIPIADVLGITVTELLQGEKLKENKTLNSDVVETLVVNSLDLSLRDTIRQRK
FT                   KNWIFAFLISIGVVVIEAILLTVSGISIEQMGDSLYISLLMLLFASWLCIFAKELLPTY
FT                   YDTNKVNFVSQGIFRIHMAGLSFNNANWGYVLTVFRVFTLGTAILYPIICYISFLVGGI
FT                   SLWNTVKYPAIIILLIGMLVTTYIVGKKYE"
FT   CDS             complement(635426..635809)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06790"
FT                   /product="Bacterial protein of unknown function (DUF961)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37720"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYM5"
FT                   /protein_id="CBL37720.1"
FT                   /translation="MRLSNGFVIDKEKTFGELKFTAVRDVFLQNEDGTPSTQLKKRIYD
FT                   LKCSLHGGIIPVSVPPEVPLREFPYNAVVELVNPVADTVSRKTYTGADVDWYVKAEDIV
FT                   LKNKGNQNAGSPQSPTPQGQPKK"
FT   CDS             complement(635825..636151)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06800"
FT                   /product="Bacterial protein of unknown function (DUF961)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37721"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYM6"
FT                   /protein_id="CBL37721.1"
FT                   /translation="MEMKYVVPDMAQSFGTLEFAGESEPVFERDKNNRRVLTRRSYNLY
FT                   SDVQKGENVVVEIPVQAGEKHFKYEQKVKLVNPKLYGRGYAIGDMGHTDYVLVADDIVA
FT                   VEEK"
FT   CDS             complement(636390..639434)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37722"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYM7"
FT                   /protein_id="CBL37722.1"
FT                   /translation="MKKTWKRLCTGFLALATVVTALPTTPVHAESKQYWTESKERVGIV
FT                   EKVMNDGSIGSTFNEGHLTVEGEDAYCIDINTDFKNGYKTRADASSRMSADQISDVALS
FT                   IEYVKQYTDSHSGISKNHAYLLRQLVVWQRLSVHLGWQCDNVRASYDEIPKATQDEVFA
FT                   GAKAFVKENKGRYECGGYIYSDEGQELGQFWAKLNVGKAKLQKTSSNDSITDGNGNYSV
FT                   AGATYGVFADKDCTKQLATLTTDKNGNTDVVEVTAGTVYIKELSAPAGYKVDKTIYPLT
FT                   IKAGETATLNVSDTPKVTDTLIELFKIDMETQKDNPQGNASLAGAEFTWKYYAGFYNKG
FT                   NLPAEATRTWVTKTIAETDSDGTTHYITKLADAYKVSGDSFYMQDSKAVLPLGTLTVEE
FT                   TKAPNGYLLDGAYMQAGDKSEQIKGLYVTQITEDGDLAVLSGSNQFSVSDKVIRGGVKI
FT                   QKRDLETGDTKPQGSATLKDTAFDIISLNDNAVLVEGKLYKKNEVVKTIRTDIEGIAST
FT                   SSDLLPYGKFRIVESEAPDGYLTDGAKPIDFTITENGKIVDLTDEAHSIYNQIKRGDIE
FT                   GVKIGAGTHKRLADVPFRITSKTTGENHVVVTDDNGQFSTSADWASHKHNTNAGKTSED
FT                   GVWFGTSEPDDSKGALPYDTYIIEEMRCDSNKGFELIPPFEIVVSRNNLVIDLGTLTDE
FT                   YEKEISIHTTATSKDGERTILAGKEITIVDTVKLDGLTKGTKYQLKGWQMLKEENAELI
FT                   IDGKRVENDYTFIADDEEMKVEISYTFNASALGGKNLVTFEELYDLSNPDEPVKVAEHK
FT                   DIEDDGQTVLITERIIKIHTTATDKDGNKELEAGKDVTIIDTVTLEGLEVGTQYKLVGW
FT                   QMLKEENAELLINGKRVESDYMFTADSETMKVEVAFTFDATSLDGKQLVTFEELYDLSN
FT                   PDEPKKVTEHKDIEDKGQTITFKEKPEEPEKPETPPTPEKPNRPSDSPKTGDSTNVMAF
FT                   IVMLLASAGGLAGTYLYKRRKMKKS"
FT   CDS             complement(639773..640348)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37723"
FT                   /db_xref="GOA:D4MYM8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYM8"
FT                   /protein_id="CBL37723.1"
FT                   /translation="MVEKKTDRRILKTKRALRESLLYLLKEQPIQKISVSRLCEKSDIN
FT                   RSTFYTYYSSPMDLLESIEDEILNTLEEDMIQFEKENSISQLMNSIIFYISEHKQLVRL
FT                   LFSDHGDPGFQNKLLLATQHWTMPMWQSRRPDYDAETLSSLHIYIVSGCMAVIRQWITG
FT                   GFKESDEEISSMLEKLSASTSAGFLQGK"
FT   CDS             640516..642321
FT                   /transl_table=11
FT                   /locus_tag="CL2_06830"
FT                   /product="alpha-1,4-glucan:alpha-1,4-glucan
FT                   6-glycosyltransferase"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37724"
FT                   /db_xref="GOA:D4MYM9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYM9"
FT                   /protein_id="CBL37724.1"
FT                   /translation="MNRQDFYDGKLFDAYRYMGAHKGGDKIRFVTYAPRASRISIIGEF
FT                   NNWNEEFMEQDAQSGFFLFYSDKAKEGQMYKYCIYGPDGNRQEHCDPYGFEMELRPGAC
FT                   SIIRDITTYRFNDRSWMQMRSVGMEDAINIYEMHMGSWRMNKKDENGWYQYDEIAKMLV
FT                   PYLKQNNYTHVELMPLSEHPFDGSWGYQNTGFFAPTKRYGTPDKLMKFVDMMHQAGIGV
FT                   IMDFVPVHFAVDGYGLKLYDGTPLYEYDNKDTGESEWGSCNFIHSRREVQCFLQSAANY
FT                   WLEEYHFDGIRMDAVSRLIYWQGDESRGVNDTAIDFLKAFNLGLKQRHPTAMLIAEDST
FT                   AYPGVTEPVWKGGLGFDYKWDLGWMHDTLEYFQTGPEYRSRDYHKLTFSMVYFWNERYM
FT                   LEYCHDEVVHGKATILQKMYGDYEDKFPQARAMYMYMMIHPGKKLNFMGNEFGQIREWS
FT                   EAQEQDWMILKYPIHDAFHKYMVKLNDIYKKEKAFHYDYHRENFEWLDCHQEERCIYAI
FT                   GRKTVDHMIVGIFNFSDKEQKDYKLMIKGHHTRRTLLHTEWEQYGGTMKKRKENIHLKK
FT                   KGKDSELTITLPRYSGVLLKLTKKE"
FT   CDS             642354..643274
FT                   /transl_table=11
FT                   /locus_tag="CL2_06840"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37725"
FT                   /db_xref="GOA:D4MYN0"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYN0"
FT                   /protein_id="CBL37725.1"
FT                   /translation="MKIYDLVIIGSGPAGMSAAIYAQRAMLDFVMIEKEYMPGGQVVQT
FT                   YEVDNYPGIPKTNGMDLGLKFSEHAKELGAKSITAEVKEIYADEEIKEIMLKNGDTLKT
FT                   RTIILATGAVHQTLGIEGEEKLKGMGVSYCATCDGAFFRNKVTAVVGGGNVALEDAIFL
FT                   SRMCKKVYLIHRRDEFRGAKILQDEVKKNDKIEILWNTIVTKIDGDEVVEGLHIQDVDN
FT                   HVDKLLDVDGIFIAVGTKPASELLSGKLSTDEKGYIIAGEDGVTNIPGIFAAGDGRSKN
FT                   LRQVVTAVSDGANCVYSVERYLQNA"
FT   CDS             643640..644170
FT                   /transl_table=11
FT                   /locus_tag="CL2_06850"
FT                   /product="ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37726"
FT                   /db_xref="GOA:D4MYN1"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYN1"
FT                   /protein_id="CBL37726.1"
FT                   /translation="MKFIISGKNIEVTEGIKAAIEEKLGRLDKYLVDDTIVNVTLSVQK
FT                   GRQKIEVTIPMKGHIIRAEEGSEDMYVSIDLVVDVIERQIRRYKTRLMNQKYDGTSFKQ
FT                   EFMEQEDDVEDDEIRIIRSKKFAIKPMDVEEACVQMELLGHDFFVFRNADTFEVNVVYK
FT                   RKGNTYGLIEPEF"
FT   CDS             644408..646978
FT                   /transl_table=11
FT                   /locus_tag="CL2_06860"
FT                   /product="protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37727"
FT                   /db_xref="GOA:D4MYN2"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYN2"
FT                   /protein_id="CBL37727.1"
FT                   /translation="MGLFDKVFGSHSDKELKRISKTVDKIEALDESMQKLSDEELRHKT
FT                   VEFKERLANGETLDDLLPEAYATVREASSRAIGLKHYRVQLIGGIILHQGRIAEMRTGE
FT                   GKTLVSTLPAYLNALEEKGVHIVTVNDYLATRDAEWMGKVHNFLGLTVGVVTNDMENDE
FT                   RREAYNCDITYITNNELGFDYLRDNMVIEKEDLVQRDLHYAIVDEVDSVLIDEARTPLI
FT                   ISGESGKSTELYRACDILARQMERGSSDGELSKMDILMNEDIEEDGDFLVNEKDKQIML
FT                   TADGVKKVEKFFHIENLADPENLAIQHNIILALRAHNLMFKDKDYVVKDDEVLIVDEFT
FT                   GRIMPGRRYSDGLHQAIEAKENVKVKRESKTLATITFQNFFNKYDKKAGMTGTALTEEQ
FT                   EFREIYGMDVVVIPTNKPVQRIDHDDAIYKTKREKMNAVVEDIIESHAKGQPVLVGTIT
FT                   IEMSEELSAMLKKRGIKHNVLNAKFHEKEAEIISHAGEIGAVTIATNMAGRGTDIVLED
FT                   GVAELGGLKIIGTERHESRRIDNQLRGRAGRQGDPGESKFYLSLEDDLMRLFGSERMIS
FT                   IYNALGIPEGEEIQHKTISKTIEKAQKKIENNNFGIRKNLLDYDRVNNEQREVMYKERR
FT                   RVLDGDDMKESVLGMMKETVANHVYQVISDELPPEEWDLAALNAELLPIVPLNKIVLTD
FT                   AEKSSGKVDDLVARLQEETVALYEQKEKEFEDFDLREIERIILLKVIDRKWMDHIDDMD
FT                   QLREGIGLQAYGQRDPVVEYRMAGFEMFNDMTKAIQEETTGALFHVQVEQKIEREEAPK
FT                   ITGTNKDAEVEKKPYVRKGTKVGRNDPCPCGSGKKYKNCCGRNK"
FT   CDS             646993..648114
FT                   /transl_table=11
FT                   /locus_tag="CL2_06870"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37728"
FT                   /db_xref="GOA:D4MYN3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR020853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYN3"
FT                   /protein_id="CBL37728.1"
FT                   /translation="MIEAEQLKYKLNSFQEPLEDLSGSLALEAKKERIDQLELNMEEPG
FT                   FWDNVEESQNVMKEVKSLKGVVEEYDDLKTKYEDIETLIDMAEEDEDADLIEEATALMD
FT                   EFEKTYEELRISTLLTGEYDKDDAILTLHAGAGGTESCDWAGMLYRMFTRWAGKKGYGT
FT                   EVLDYLDGDEAGIKSVTVKITGMNAYGYLRSEKGVHRLVRISPFNAAGKRQTSFASCDV
FT                   MPDIKDDIEVEIADEDIRIDTYRASGAGGQHINKTDSAIRITHLPTGIVVQCQNERSQH
FT                   KNKDQAMKMLKTKLYLLKQQQHLEKLSDIRGDVGDNGWGNQIRSYVLQPYTMVKDHRTN
FT                   FESGNPSAVLDGDLDGFMNAYLAWDNNSKKEEN"
FT   CDS             648243..648683
FT                   /transl_table=11
FT                   /locus_tag="CL2_06880"
FT                   /product="ACT domain-containing protein"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37729"
FT                   /db_xref="GOA:D4MYN4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008310"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYN4"
FT                   /protein_id="CBL37729.1"
FT                   /translation="MKETNYYVIKKKAVPEVLLKVLEVQKLLDSKRAVSVLEATEKVGI
FT                   SRSSYYKYKDDIFPFYAGKKGRSITFVIEVDDQPGVMASILNIFALYKANILTIHQSIP
FT                   INGKGLLTVSVDIEDSETDVSAMIQDVEKIEDVSYVKIIAME"
FT   CDS             648721..649920
FT                   /transl_table=11
FT                   /locus_tag="CL2_06890"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37730"
FT                   /db_xref="GOA:D4MYN5"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR013371"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYN5"
FT                   /protein_id="CBL37730.1"
FT                   /translation="MKYVIVLGDGMADEPIEAAGGKTPLQLADKPVMDEMAKVSEQGIA
FT                   YTVPSNLPAGSDVANLSMLGYDPQVYYSGRSPLEALSIGVDMKDTDIALRCNVVTVSED
FT                   EDYEDKTIIDHSAGEITSEEAAILIEAVRKELEDDEYKFYPGVSYRHLTIWDHGEVVEL
FT                   VPPHDVLGQKIGQYLPKQEKLKEMMEKSFDILNHHPINEARAEKGLNKANSIWFWGAGT
FT                   KPALDDFKEKTGMNGAMVSAVDLLKGIAVGANMRNLDVEGANGGLDTNYHGKAMAAVEA
FT                   LLEKNDDFAYIHVEAPDEMGHQGSLENKIKAIEHLDKEVVKVVKEELEKAGEDFRILIG
FT                   PDHPTPIAIRTHSKEPIPFMIYDSTKDYEGQEEYSEEAARETGIVISHAYDLMNRLLQK
FT                   "
FT   CDS             649946..651148
FT                   /transl_table=11
FT                   /locus_tag="CL2_06900"
FT                   /product="aspartate kinase, monofunctional class"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37731"
FT                   /db_xref="GOA:D4MYN6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYN6"
FT                   /protein_id="CBL37731.1"
FT                   /translation="MLVVKKFGGTSVGNKDRIMNVAKRCIEDYKKGNDVVVVLSAMGKM
FT                   TDELIAKAKEINPNPSRREMDMLLTTGEQTSVSLMAMAMDSLGVPAVSLNAFQVAMHTT
FT                   SVYSNARIKRIDTDRIMNELEQRKIVIVTGFQGVDQFDNYTTLGRGGSDTTAVALAAAL
FT                   HADACEIYTDVDGVYTADPRKVSEAKKLNEITYDEMLEMATLGAGVLHNRSVELAKKHG
FT                   VALVVRSSLTTEEGTVVKESVKSRDNEISGVAGDDDAARIAVMGIEDTPGMAFKIFNVL
FT                   AKKNVNVDMILQSVGHNDKKDISFTVKEEELDIAVKALEDYLPDSYYEEIKASKEVAKV
FT                   SIIGKGLLNHYGMAARMFNALYKADVNIRMISTSEIRVTVLVNQEDMVKAMNAAHEEFE
FT                   M"
FT   gap             651161..651716
FT                   /estimated_length=556
FT   CDS             652239..652718
FT                   /transl_table=11
FT                   /locus_tag="CL2_06910"
FT                   /product="Deoxycytidylate deaminase"
FT                   /EC_number="3.5.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37732"
FT                   /db_xref="GOA:D4MYN7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYN7"
FT                   /protein_id="CBL37732.1"
FT                   /translation="MKRKDYISWDQYFMGIAILSAQRSKDDHTQVGACLVNDHNKILSV
FT                   GYNGMPIGCNDDDMPWEREGDPLHTKYFYVCHAELNAILNYGGGSLDGARVYVTLFPCN
FT                   ECAKAIIQSGMKEVIYMQDKYAGSDTTKASKKMFDMAGVKYRQFVPKGQTIEVDL"
FT   CDS             652728..654869
FT                   /transl_table=11
FT                   /locus_tag="CL2_06920"
FT                   /product="Transcriptional accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37733"
FT                   /db_xref="GOA:D4MYN8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023097"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYN8"
FT                   /protein_id="CBL37733.1"
FT                   /translation="MDIIKILQEELGIRRGQVETTIKLIDEGNTIPFIARYRKEMTGSL
FT                   DDETLRNFHERLLYLRNLEERKEAIKKNIEEQGKLTKELAKQIEEAKTLVAVEDLYRPY
FT                   KQKKRTRAMIAKEKGLEPLANLILLQMTKEPLEKEAEAFINEEKDVKTVEDALKGANDI
FT                   IAEHIADDAEYRTWIRKATWNHGKITSSAKKPEESSVFEMYYDFEEPIEKIAGYRILAI
FT                   NRGEKEGILQVKIEPDMQKIATYLARKIITRKNPYTTKALFAAIEDSYKRLIAPSIERD
FT                   IRNELTENASTEAIKVFGKNLAQLLMQPPIAGQVVLGWDPAFRTGCKLAVVDATGKVLD
FT                   TVVIYPTAPQNKVEEAKKVVKALIKKYGITLISIGNGTASRESEQIVVDMLKEIKEPVQ
FT                   YVITNEAGASVYSASKLATEEFPNFDVGQRSATSIARRVQDPLAELVKIEPKAIGVGQY
FT                   QHDMNQKQLTEALGGVVEATVNKVGVDLNTASASLLEYVSGVSKTVAKNIVAYREENGT
FT                   FRNRKQLLKVAKLGPKAFEQCAGFLRVSGGDEPLDATGVHPETYKETGMLLKNLGYSTK
FT                   ELSKEGFKGISSKITDYKKLSEELGIGEITLKDIVKELEKPGRDPREDLPKPILRTDVL
FT                   EMKDLKPGMKLKGTVRNVIDFGAFVDIGVHQDGLVHISQMADRFIKHPLEVVSVGDVVD
FT                   VVVVSVDIDKKRIQLSMKL"
FT   gap             655492..655644
FT                   /estimated_length=153
FT   CDS             complement(655751..656476)
FT                   /transl_table=11
FT                   /locus_tag="CL2_06930"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37734"
FT                   /db_xref="GOA:D4MYN9"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYN9"
FT                   /protein_id="CBL37734.1"
FT                   /translation="MKTVLITGSSRGIGRETAIYFAQQGWNVIIHGFRHPEKLESLKNE
FT                   ILEENVSCLSFCGDISDPSFVDEMIKQSLLTFSKIDCLVNNAGISLVGLFTDATVDDWN
FT                   LMINTNLTSVFTTCKNIVPHMLHHHEGKIINISSIWGDAGASCEVLYSTTKGGINAFTK
FT                   ALAKEVAASNIQVNAIAFGMIDTEMNAEFDEEDLALIKEEIPADYIASPKEAAQMVYHV
FT                   ATSPAYMTGQVITFSGGWY"
FT   CDS             656665..657927
FT                   /transl_table=11
FT                   /locus_tag="CL2_06940"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37735"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYP0"
FT                   /protein_id="CBL37735.1"
FT                   /translation="MAEKKKSKLGAKAIFARILAVILVTAIGGVASFFGFKTYFSNKLK
FT                   KDKKAEIAKQLKEESKERVDVGMIQTGNSIVIRIYHNKNQEMIFVPLRQDMNLTLTKKG
FT                   KQAVEQTLGTSVSKATVADVIKATRKNGKLLRQQVEKTLGISINSYELISHKKFVKLMN
FT                   QAGDVKIEFDEAMAYTDSTDKYVTLSAGENSLNGTAIYSLLSESDIFTDKNKQAEITGE
FT                   ICVAVASALNDKTLSEYREYAQNYFDAVKTDASYEEAATSLERMHGIKDKNLNFKVLDG
FT                   TESNGKFELDTEEAKRVFDEMLSEEGDLSSALSTTEAKSTTTKSDSSASSSKNITIEIQ
FT                   NSTRISGLAGRWKDKLASDGYSVGSVRTNRQGVLTHTKIIVESKDLGQDLKSYFKNPEY
FT                   EVGSVDSGARICIIVGSEDEI"
FT   CDS             658182..659267
FT                   /transl_table=11
FT                   /locus_tag="CL2_06950"
FT                   /product="transcriptional regulator, CdaR family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37736"
FT                   /db_xref="GOA:D4MYP1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYP1"
FT                   /protein_id="CBL37736.1"
FT                   /translation="MISNQILQETINGMKEVTGIDLCILDLSGRIVVTTMEITDALAQH
FT                   AEEFADSMAESQVIDGFQYFKIFDDQRLEYILLATGMSENAYTVGKLAVMQIQNLLTAY
FT                   KERLDKENFVKNLLRDNLLLVDIYNRSKKLHIEVEQRRVAFLIQAEYEKDQNLLEATKE
FT                   VESGADSDFITAVDEKSIVYVTPVNGNEGQAQFIQHAKEIKEGLNEYGIKDAKIAIGNV
FT                   AETIKDVSRSYKEAQIALEVSKIFYEDASVIAYNQLGIGRLIYQLPLPLCKMFIREVFG
FT                   DYSPDSIDEETLATIDKFFENNLNVSETSRQLFIHRNTLVYRLDKIQKNTNLDLRNFED
FT                   AIAFKIALMVVKYMKHMDTMD"
FT   CDS             659271..659954
FT                   /transl_table=11
FT                   /locus_tag="CL2_06960"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37737"
FT                   /db_xref="GOA:D4MYP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYP2"
FT                   /protein_id="CBL37737.1"
FT                   /translation="MMITLKNVTKEYNKGNIGLEDVSLDIAKGEFVFIVGKSGSGKTTL
FT                   MKLLQKELDVTSGQIIVNGQDYKKLTQRNLPKFRRQMGMVFQDFRLLKDRTIFENVAFA
FT                   QQVVEVPHRYIKRQVENMLEMVGLKDRMNAFPNELSGGEQQRVAIARALVNHPVLLLAD
FT                   EPTGNLDPVTAKGIMELLSEINKSGTTVLVVTHNKELVNEMGKRVILIEDGHIEQDEIR
FT                   GSYDI"
FT   CDS             659944..660852
FT                   /transl_table=11
FT                   /locus_tag="CL2_06970"
FT                   /product="cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37738"
FT                   /db_xref="GOA:D4MYP3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYP3"
FT                   /protein_id="CBL37738.1"
FT                   /translation="MIFRRFLYGIKEGTRNIFRNKMFSLASLGTIIACVFLLGTFLSVA
FT                   LNVRSTMQQMEQSVGISVFFEPGISAERKDQIGEEIKKKEDIATMRYVSAEEAWESYKK
FT                   DVFQGNEELLEGFEGNNPLKESDSYEITLKEVKSYKQVVSHLETIDGVRKVRYSEGAAE
FT                   GMMKINTMGTYLAGGIILILMAVSIFLVSNTVSIGVAVREEEISIMKLIGAANGFIKAP
FT                   FQAEGMIIGILGSLIPTAIIFAGYEGIINWMNDKFHVVTVFMKFVPIQQIMLYLLPLAL
FT                   LVGIVIGLLGSSITIRKYLKV"
FT   CDS             660865..662094
FT                   /transl_table=11
FT                   /locus_tag="CL2_06980"
FT                   /product="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37739"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYP4"
FT                   /protein_id="CBL37739.1"
FT                   /translation="MKRRYQAGIIMMLISAMIASNLPMTTVFAAAKRQQVKQETKKLEE
FT                   QSRKMQQEIKDLDEKMIKSNDAYEACQEKLISVQKQLKKTQQELKEAKASKEDQSRIMS
FT                   KRIKFLYENGNMAYMEVIFEANNFQEFLKRADYVSKISKYDSNMFLQLQTTEDKIRMAT
FT                   KSLKQDYQNTKTLTAKAKTEKEKLDQAAAKKKSKLASYQKQLASDKELLAWFEAEEKRQ
FT                   EEMDLASAKDGNADNTTSKAQSEKNTTGSTASKNTTSKATTESKKETTTTTSPSTTVSS
FT                   GNLSWPVPSCHSISSGYGYRIHPVTGVRKLHAGIDIPCSTGTTIVAAASGTVVDAGYNA
FT                   YNGNYLKISHGNGLETMYLHCSKLLVSSGARVSGGQTIAKSGATGMVSGAHLHFVVKKN
FT                   GNYVNPQNYL"
FT   CDS             662127..663266
FT                   /transl_table=11
FT                   /locus_tag="CL2_06990"
FT                   /product="C-terminal peptidase (prc)"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_06990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37740"
FT                   /db_xref="GOA:D4MYP5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYP5"
FT                   /protein_id="CBL37740.1"
FT                   /translation="MKKFSKILVGLLVVVCIVEGFFLYRAYAIPSTTLQTARKINRIEQ
FT                   IIDKYYKGSVKKSELEDCTYKGLVAGLGDVYSTYYSEDDFKELEQSTSGVYYGVGIYLT
FT                   QDIKTGIITVVKPVKGSPADGSGLKKGDILTKVGNYKLKTSDALDDIVKKIKGAEGTKV
FT                   KLTFTRNQTSKTYTFTRQSIENPTVETKMLQDKVGYLQITEFDEVTVSQFRSGLESLKK
FT                   QGAKKLIIDLRDNPGGLLTSVVDIAGQILPKGTIVYTEDKNGNKKYYKDTKNEQLDMPL
FT                   CVLVNGNSASAAEILSGAIKDDKAGTLVGETTFGKGIVQGFFEVGDGSYVKLTYSSYYT
FT                   PAGHNIHKKGIKPDIEVKDNTKTKADEQLNKALSILQEK"
FT   CDS             663456..664430
FT                   /transl_table=11
FT                   /locus_tag="CL2_07000"
FT                   /product="Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37741"
FT                   /db_xref="GOA:D4MYP6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYP6"
FT                   /protein_id="CBL37741.1"
FT                   /translation="MSKENCESEARKKIAASIGATPEEIYFTSGRADGHLKALKAVVKA
FT                   SKKARPHVIITTMEDPEVLDECSRLERKDAVVTYLDPITTGRVEVAMIENELKENTELI
FT                   SVTAANCQTGTSEPFTGIGTMTSEKGVIFHTDAAFAFGKMPINVERSHIDLLTADASYF
FT                   GGPENAGFLYVRKSTGAGEYVSETALSEETLTVMSDMAESLAAKATTFMEEIRPVRNHM
FT                   CERIFAEIEDVELNGHKDHHLTNHLNIRIKNVSAAVVQKALKEEGIEAGIGTNSNILAA
FT                   IGRSKAESAESVSFSLKAGTTMEDADKIVDSLKEIVTGERTVL"
FT   CDS             664465..664860
FT                   /transl_table=11
FT                   /locus_tag="CL2_07010"
FT                   /product="Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37742"
FT                   /db_xref="GOA:D4MYP7"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYP7"
FT                   /protein_id="CBL37742.1"
FT                   /translation="MLNLPMDHIGLHCSDVELNAKWYQEELGFKVAGKFPGMGGRNVYF
FT                   LENPQDGKMYEISQRDQLPGGATTRIDHIAYRSSDLEKDYEYCKVNGYKIVSDGIETSL
FT                   NFWEKGSRCFKIESACGEVIEICQKIK"
FT   CDS             665289..665573
FT                   /transl_table=11
FT                   /locus_tag="CL2_07020"
FT                   /product="MarR family."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37743"
FT                   /db_xref="GOA:D4MYP8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYP8"
FT                   /protein_id="CBL37743.1"
FT                   /translation="MVDKAEIVKIRKSTISHVSTSLKKLENKGLVEKIQSKDNKKHIEI
FT                   ILLDKAELIIEAGHNAQKQFAKNVLSGLTEEKQVCINIFDKICNNAEEH"
FT   CDS             665730..667340
FT                   /transl_table=11
FT                   /locus_tag="CL2_07040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37744"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYP9"
FT                   /protein_id="CBL37744.1"
FT                   /translation="MSDEEYKKLLKQYHKLSDRHILVVETDMPYPDVLKVVALSDKIRK
FT                   AGNELVSLMRKNYDQLMRTKKYRKLLKLYGNTEDKDKRKALADQLNDMQKSYNVTWDLC
FT                   RTSMIPIGKKYSIDAVFALTKAEDIWRGMEKCLYDNGKTTHFSKYGELPCIRAKQINRG
FT                   IPMFVEDGKLRFKLRKMQFGIQVNDRFQSDEVNAILSYLENPDKMDADAVNTLIEEACC
FT                   IDTYRPCYATLVPRLIRGKYRVYLHLTIEGKAKPKYDRSGNPRHKYGKGMIGADIGTQT
FT                   VAYTSDTEVGLKNLSERGNSIQTSERKERLYYRAMDRSRRATNPQNYNPDGTIKKGKKT
FT                   WKYSDRYKKLKAKHTELCRINAVNRQLAINEDANYLRSLGDTFVTEPKNASKLMKRAKK
FT                   TTVNSKGKFNKKKHFGKSIKNRCPSGFQTTIEKKFKVTGGAYIEVPNNYRASQYDHTAD
FT                   DYIKKKLSDRLYRLRDGTLVQRDWYSSFLLYCYDYRTQDIDKDKCITDFGRCYDKEKAL
FT                   IAWIKANHIKILNSGIKVA"
FT   CDS             667593..669581
FT                   /transl_table=11
FT                   /locus_tag="CL2_07050"
FT                   /product="excinuclease ABC, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37745"
FT                   /db_xref="GOA:D4MYQ0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYQ0"
FT                   /protein_id="CBL37745.1"
FT                   /translation="MDHFELVSEYEPTGDQPQAIEKLTKGFQDGNQFETLLGVTGSGKT
FT                   FTMANIIQNLNKPTLILAHNKTLAAQLYSEFKAFFPHNAVEYFVSYYDYYQPEAYVPST
FT                   DTYIEKDSSVNDEIDKLRHSATAALIERKDVIVVSSVSCIYGIGSKESYSEMMISLRPG
FT                   MIKDRDEVIDDLINIQYVRSELDFKRGTFRVKGDVLEILPVSTFEDAVRVEFFGDEIDR
FT                   IVEFDVLTGEVKRSLNFVAIFPASHYVVPQEQIERAIKGIKEELAEQVTYFKEHDQLIE
FT                   AQRIAERTNFDIEMLRETGFCSGIENYSRHLAGLEPGQPPSTLIDFFGDDFLMIIDESH
FT                   ITVPQIGGMYAGDQSRKSTLVDFGFRLPSAKDNRPLEFGEFEQKIDQMLFVSATPGKYE
FT                   EEHELLRAEQIIRPTGLLDPAIDVRPVEGQIDDLLGEIHKETDKGNKVLVTTLTKRMAE
FT                   ELTDYMREVGIRVKYLHSDIDTLERIEIVRDLRMGVFDVLVGINLLREGLDIPEITLVA
FT                   ILDADKEGFLRSETSLVQTIGRAARNSEGHVIMYADHMTDSMHAAITETERRREIQDEY
FT                   NKEHGITPQTIKKDIRDLIKISDEHEEETGGYEKDMESMSKKELKEVIERLSKKMNQAA
FT                   AELNFELAAQLRDELKEFKIAYQEYDD"
FT   CDS             669630..672455
FT                   /transl_table=11
FT                   /locus_tag="CL2_07060"
FT                   /product="excinuclease ABC, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37746"
FT                   /db_xref="GOA:D4MYQ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYQ1"
FT                   /protein_id="CBL37746.1"
FT                   /translation="MKKEMIRIKGARENNLKNIDLEVPRNQFVVFTGLSGSGKSSLAFD
FT                   TIYAEGQRRYMESLSSYARQFLGQMEKPDVDSIEGLSPAISIDQKSTNRNPRSTVGTVT
FT                   EIYDYFRLLYARVGIPHCPKCGKPISKQTVDQMVDRLMQLEERTRIQLLAPIVRGRKGE
FT                   HAKVFQNAKKSGYVRVRVDGNVYDLSEDIPMEKNKKHNIEIVVDRLVVKPGIEKRLTDS
FT                   IETILNLADGLMMVDVIGGETLNFSQSFSCPDCGISIDEVEPRSFSFNNPFGACPVCHG
FT                   LGYKMEFDVDLMIPDQKLSIAEGAIQVFGWQSSTDKKSYTRAILDALAREYHFDLETPF
FT                   KDYPQEVKDVLLYGTGGREVKVYYKGQRGEGVYDVAFEGIIKNVGRRYREASQNMKAEY
FT                   ETFMTITPCDECHGQRLKQESLAVTVADKNIAEMCDMSVGEMVSFLETMELSERQKLIG
FT                   EQVLKEIKARIGFLNDVGLDYLTLSRATGTLSGGEAQRIRLATQIGSGLVGVVYILDEP
FT                   SIGLHQRDNDKLIRTLKNLRDLGNTLIVVEHDEDTMLAADYIVDIGPKAGEYGGEVVAT
FT                   GTAKQIMKNKKSITGAYLSGKIKIPVPQVRRKPSGFLKVVGAQENNLKNIDVEIPLGIF
FT                   TCVTGVSGSGKSSLVNQILYKRLAKELNRAKTKPGLHKDIEGFDQLDKIIAIDQSPIGR
FT                   TPRSNPATYTGVFDQIRDLFAMTKDAKAKGYNKGRFSFNKKGGRCEACAGDGIIKIEMH
FT                   FLPDVYVPCEVCHGKRYNRETLEVKYKGKSIYDVLNMTVEEACDFFSNIPSISRKMETL
FT                   RDVGLGYIRLGQPSTELSGGEAQRIKLAAELSKRSTGKTIYILDEPTTGLHFADVHKLV
FT                   DILARLTEGGNTVIVIEHNLEVIKTADYIIDMGPEGGSGGGTVVAAGTPEEICEVEKSY
FT                   TGQYLKGILNR"
FT   gap             672568..672784
FT                   /estimated_length=217
FT   CDS             673164..675233
FT                   /transl_table=11
FT                   /locus_tag="CL2_07070"
FT                   /product="Bacterial surface proteins containing Ig-like
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37747"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYQ2"
FT                   /protein_id="CBL37747.1"
FT                   /translation="MNGKSTVKSLIALTMAGAMVFSMNTMPVSAAKKKTKAKSTVKSVK
FT                   VVAPSGSKKSATVAKGKSIKLAVTVNATKKAYKKVTYKVSNKKVISVSKKGVVKGKKAG
FT                   TATVKVISAKNKKKTASIKIKVVSGAVKKVKLNKSNLALNVGDLGKLSVKVTASKKAYK
FT                   TLKWTTSNKKVATVTSKGVVKGIGKGTAKITAASLDGTGKKSTCTVTVREKQVVNGIKS
FT                   LEVYNPLKSYSSSTLKVTLDSPQALTADDFKVETKSYGEGSYMRTVSVDDIYTTDNQTY
FT                   EVYLANDDIYNGRYVRVTVNALNGQKTAEVRFLVDPDTVRQVHTAKVGDDEHSFSVDDD
FT                   TMGTSKSAIKTGTLPAGYKLINELGDSARVRGIPSAVADNQHVVFATTDELGRDTTTDV
FT                   NFLIGDDDHIVVENQTIGDQVSGMIYAKDSFYKNLYFAGGNGKITAEILNTYDGTFKID
FT                   DTYSDSVGITVADSNKLAAGTYDIPVRITDNNGKTGQGTLKVIVTTSAKIVTKVNNNSP
FT                   DGTIYFYNHNSNEEFSLRSIEKESKYSGSVGNTTLTSTGYLPHGTYSVYYRMCGRKIML
FT                   NKSLNVSGDTNLEFTLPTTKITGTIYDVNNKKYENSVDVCMYRSNDLDTRYYSVSDYTS
FT                   DGTYLFQGVPDGQYVLVVSGQKDGKYFETTSGTITVSGGNATMDVKLPVANPQQ"
FT   CDS             675375..676145
FT                   /transl_table=11
FT                   /locus_tag="CL2_07080"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37748"
FT                   /db_xref="GOA:D4MYQ3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYQ3"
FT                   /protein_id="CBL37748.1"
FT                   /translation="MFVEERHQKILHLLQENEKVKVKELSKQFEVTEDCIRKDLASMEA
FT                   KNLLKRTYGGAVLPDTLHPGHTNLVSTRKDKNIKQKQKIAKKAVKLIRPGDMIFLDTST
FT                   TNIELAKEIQKQELEITVISCMMDIAQIFSQTKKVKFILLGGEFNRAQNGFLGELTVQM
FT                   MKKFRFDICFMGVVGADVENDEVMTYVPEDGIMKSHAMKRSRRRYLVMENCKFDFKANY
FT                   VYTTFEDVDGILCEEKPSKKISEKLKEYQVEVIE"
FT   CDS             676173..678527
FT                   /transl_table=11
FT                   /locus_tag="CL2_07090"
FT                   /product="pyruvate formate-lyase"
FT                   /EC_number="2.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37749"
FT                   /db_xref="GOA:D4MYQ4"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYQ4"
FT                   /protein_id="CBL37749.1"
FT                   /translation="MEGLYQTQRIKDLKDKMLSEPRYASIEQALIITKTYQENEDDPKI
FT                   IQRAKSLKAALEKMEIRVEPEELIVGNRTAGVRYGVVFPESGSTWVDKEFETLPTRPQD
FT                   RFNVHQEDIETFRKVIKPYWEGKSLEDVLNQRYGKEINKIAKVVKINQKDHAQGHICPD
FT                   CVKWLKMGPQGLLDQAEEKLKICKEEQKDFYESVKIVMEGAKHFMVRYHDLIMNMAENE
FT                   SDETRKQTMIKVAQNCKNISERPVQTFHEAVQSTWFLFVILQMESNASSFSPGRLDRHL
FT                   EAYYEKDNKEGTLDKQQALEIIECLWLKFNEIVYMRNSHGAKYFAGFPIGFNIAIGGQD
FT                   ENGNDTYNDLSFLFLEAQKHLGLPQPNLSVRLHEGTSDELLKEAVRVVAKGSGMPQFFN
FT                   DKAVIPSIQELGIEEKDARDYAIVGCVELTTQGNNLGWSDSAMFNLNKALEVALTGGIC
FT                   LLTGEKIAPDYGNLETYETFEELEAAFKKQIDYFMDKMLLACEEVEKAHIDLLPSPFLS
FT                   ASIENCMENGMDVTVGGAKYNLSGIQMIQVANLADSLVAIKQLVYDEKKCTQKEMLDAL
FT                   KNNFEGYEILRAMCVNKVPKYGNDIDEVDKQGTKWADYFKNRLRTFKNYRKGPYHTGMY
FT                   TVSAHVPMGENVGATPDGRYAKEPLADGGMSPVYGRDIKGPTAVLKSVSKLDKILTTNG
FT                   GLLNMKFLPEFFKTETGIDKFANFLRTFVDLEIPHIQFNVVRKEDLLAAKKNPEQYRGL
FT                   TVRVAGYTAYFTELADELQNEIIARTSYGDI"
FT   CDS             678529..679443
FT                   /transl_table=11
FT                   /locus_tag="CL2_07100"
FT                   /product="glycyl-radical enzyme activating protein family"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37750"
FT                   /db_xref="GOA:D4MYQ5"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYQ5"
FT                   /protein_id="CBL37750.1"
FT                   /translation="MTGKVFDIRRFSTHDGDGIRTTVFLKGCPLKCVWCQNPEGISIRK
FT                   RPIYFENRCMHCKTCIEKSKNQGVTMENDQIHIHPNRNENWNTIIDWCPTGAIAMDSRE
FT                   MSVEMVMEEIRKDKSFYRYGNGGVTISGGEPLLQWKFTKELLKACKKEGIHTAIETSLY
FT                   ADQEVIKELLPYLDRIFADFKLATEKDHMHYTGVSNQKIKDNIRYLLETSNREKVIIRT
FT                   PMIPEMTATKDNIKGIAKYLNGIYQYVSYEILNYNPLAEAKYHLVDREYCFEENPKLYT
FT                   KEQMQEFKSWAVEGGLENIIIES"
FT   CDS             complement(679514..680056)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07110"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37751"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYQ6"
FT                   /protein_id="CBL37751.1"
FT                   /translation="MKATGIIRRIDDLGRIVIPKEIRKTMHIRESDPLEIFTERDGDII
FT                   LKKYSPIGELGNSAKLYAESIAAQIPHTICICDQDCVIAAAGPNAKKLIGKLLDEKAEE
FT                   ALIDRKHILMDREKEDFFPLILDFPEVFRYVCLSTIIAESEAVGFVCILSIEDELDDQE
FT                   FKIAKIASDFLGKQLEA"
FT   CDS             680179..680790
FT                   /transl_table=11
FT                   /locus_tag="CL2_07120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37752"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYQ7"
FT                   /protein_id="CBL37752.1"
FT                   /translation="MKFHTQLKAKDIFKFSLAYTYSGVQAILTIFMLGVGAYMIVHGIG
FT                   QPEGQTNIIFGAVVIALFVVINPLMIYVKAKKQAIENPVYKNPTYYTLRDDGIFVELGE
FT                   ESATIEWNRVYKITHFMGLTLLYTGKQQAFVFPDYELGDDREKMLDYMKEHIKEARKKA
FT                   VQTQTDGGDISKYSKASTETEREETEVSESEVQENSEGEE"
FT   CDS             680794..681219
FT                   /transl_table=11
FT                   /locus_tag="CL2_07130"
FT                   /product="conserved hypothetical nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37753"
FT                   /db_xref="GOA:D4MYQ8"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYQ8"
FT                   /protein_id="CBL37753.1"
FT                   /translation="MIVQSFCAEDTYEIGKKIGQEAQPGQVICLYGDLGVGKTVFTKGL
FT                   ADGLGITEPIQSPTFTIVREYEEGRLPLYHFDVYRIGDIEEMDEIGYEDYVYGEGVCLI
FT                   EWANLIEEILPDHYQKITIRKDLEKGFDYREIEMEEQ"
FT   CDS             681220..681930
FT                   /transl_table=11
FT                   /locus_tag="CL2_07140"
FT                   /product="Inactive homolog of metal-dependent proteases,
FT                   putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37754"
FT                   /db_xref="GOA:D4MYQ9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYQ9"
FT                   /protein_id="CBL37754.1"
FT                   /translation="MKLLVLDSSGLVASVALIEDDQLIAEYTTGNKLTHSQTLLPMLDE
FT                   VIKRTSFEIEDIDAVAVAKGPGSFTGLRIGAATAKGLGLALDKPIIPVPTVDGLAYQLF
FT                   GTSMIICPMMDARRKQVYTGFYRFEGSEMKVLKEQCAQSVEDTLIQLREYNEPVVFLGD
FT                   GVPVYKEEILEKMGDLAIFAPAHANRQRAAAVGTLAQVYFAQGIYESADEFVPEYLRKS
FT                   QAEREREERLHGQK"
FT   CDS             681917..682651
FT                   /transl_table=11
FT                   /locus_tag="CL2_07150"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37755"
FT                   /db_xref="GOA:D4MYR0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYR0"
FT                   /protein_id="CBL37755.1"
FT                   /translation="MDKSSITAREWHVRKALPEDLPMIAEIEKLSFHRPWSFDSIESFY
FT                   YRKTSDIYVWRDRNRISGYIIAEHVLDQAELHRIAMIPFIRKMGIGTLLFHEFRRRYQE
FT                   IGVDTIYLEVRESNEAAYQFYLKNGFEEYGRRAKYYKDPIEDAILMFCEISTDDQSFPL
FT                   DSSETPVYNDERKEENEMKCNVCGQLLNNKTDYIEVKKEWGYFSNKDTQIHEFKICERC
FT                   YDRIVKQFEISPKVTEKSEILS"
FT   CDS             682662..683576
FT                   /transl_table=11
FT                   /locus_tag="CL2_07160"
FT                   /product="RNAse Z"
FT                   /EC_number="3.1.26.11"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37756"
FT                   /db_xref="GOA:D4MYR1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYR1"
FT                   /protein_id="CBL37756.1"
FT                   /translation="MLDVCLLGTGGMMPLPYRKLTACMTRFNGHSLLIDCGEGTQVGIK
FT                   ERGWSVKPLDAICFTHFHADHISGLPGLLLTLGNAERTEPLLIIGPKGVERVVNSLRVI
FT                   APELPFPIEFYELNEKEHVIEMDGYKIEAFYVKHNVPCYGYNMIIPRAGKFDPVKAKEN
FT                   DIPMKYWNRLQKGETVTSEDGRVLTSDMILGSPRPGIKLTYCTDTRPVQTISEHAKNAD
FT                   LFICEGMYGEEGKEKKAREYKHMTFYEAAHLAKEADVKQMWLTHYSPSLVRAEEFMGKV
FT                   KSIFPRAKAGKDGKTITLDFQEE"
FT   CDS             683586..684614
FT                   /transl_table=11
FT                   /locus_tag="CL2_07170"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37757"
FT                   /db_xref="GOA:D4MYR2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYR2"
FT                   /protein_id="CBL37757.1"
FT                   /translation="MSDKIKILAIESSCDETAAAVVEDGRCVKSNIISSQIELHKLYGG
FT                   VVPEIASRKHVEKVNFVVREALKEAGETLDSIDAIAVTYGPGLVGALLVGVAEAKALAF
FT                   AKKKPLVGVHHIEGHICANYIEHPDLEPPFLCLVVSGGHTHLVDVKDYGKYEIIGCTRD
FT                   DAAGEAFDKVARAIGLGYPGGPKIEALAKEGDKNAISFPRAKVNDSKMDFSFSGLKSSV
FT                   LNYLNKCEMKGEEVNRADVAASFQEAVVDVLSSHGVEAAKELGYKKLAIAGGVASNGAF
FT                   RAKMIERCKEAGIEFYHPSPIFCTDNAAMIGVCGYYDYINGVRSGLDLNAVPGLKIGTR
FT                   QG"
FT   CDS             684619..685407
FT                   /transl_table=11
FT                   /locus_tag="CL2_07180"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37758"
FT                   /db_xref="GOA:D4MYR3"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYR3"
FT                   /protein_id="CBL37758.1"
FT                   /translation="MGEKIAAIVLAAGEGKRMGSGIPKQYMLIKSRPLVYYALKAFEES
FT                   AVDEVILVTGEDEIDYCKEYIVDRYHFNKVKKIVPGGWERYASVYFGLEAIEDADYVLI
FT                   HDGARPMISAELIQKCIYYVKKYRACVVGMPSKDTIKVVDEENYAIRTPERKTLWQVQT
FT                   PQCFEFDLVKKAYEKMMENDDGKVTDDAMVVETYGNVPVKLFEGGYDNIKVTTPEDVRL
FT                   ATNLVRVRKVFHKLHVLHDKLIYLQMKAYKKRFREKKQKK"
FT   tRNA            685507..685592
FT                   /locus_tag="CL2_T_31620"
FT   tRNA            685622..685710
FT                   /locus_tag="CL2_T_31630"
FT   CDS             complement(686854..687351)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37759"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYR4"
FT                   /protein_id="CBL37759.1"
FT                   /translation="MKMQKIEVHIKNTEKWIKLIQEDLELINDKEDYLHGHYITPDIDE
FT                   SEITVFKGFVEEDIVKIIYIYEKNPFNINEVVMFDGKLENSELKGCTKLEKIEYIKEIP
FT                   APGILIFGTLYVLFLCMGWIKVTDFVLFMISFVIIIMIDRRSTLRRGTKKIKKYIQKFN
FT                   RE"
FT   CDS             complement(688635..689108)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37760"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYR5"
FT                   /protein_id="CBL37760.1"
FT                   /translation="MYKIDKEIKTKLTEKEIKKKLYNISSKKRRASIFFIPNQEKFFIK
FT                   EMEDSIVLYTIPYYKNRGFVPKIKIKMYSNGENTIMTMRYSLYFEAELIIIIANILLII
FT                   SSLLILMITPNNRYWGLYIIIFVIFCDFGFYKTFKDETEKIMQYFNENVFIES"
FT   gap             689310..689782
FT                   /estimated_length=473
FT   CDS             complement(689918..690055)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37761"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYR6"
FT                   /protein_id="CBL37761.1"
FT                   /translation="MDLSSLRPYEVTDFGETTIHGDDQAKNEVCYTSGMYLILHGKIIV
FT                   "
FT   CDS             complement(690312..692024)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07270"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37762"
FT                   /db_xref="GOA:D4MYR7"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYR7"
FT                   /protein_id="CBL37762.1"
FT                   /translation="MYKGIGASAGIGIGKIVKIKEEELNYTKQSIEDTEAEKKRLSDAI
FT                   EVFIEKTQKMVESMKVTAGEQEAEILEGHIMMIQDPAISEQIEAKIDGEKINAEAAVEE
FT                   ACDFFAQIFAMADDELTQQRASDLGDIKTRLIKILLGIEEVDISAVPEGTILVAEDLTP
FT                   SMTAGINPANVQGVLTEIGGKTSHSAIICRSMEIPAVLSIENIVSIVNDGDEVVLDGST
FT                   GEAFINPEASVVEEYKAKKAKFLEEKAALQKFVGQKSQTADGYVVELVANIGGPDEAEG
FT                   VLERDGEGVGLFRSEFLFMESDAIPSEEAQFEAYKKVAETLDGKPVIIRTLDIGGDKAL
FT                   PYLGLPTEENPFLGFRAVRFCLQRKEDIYKPQLRALLRASAFGKVRIMVPLVTCVDELR
FT                   AVKAIIEELKQELDAEGIAYDKDIQVGVMMETAAASLIADILAKEADFFSIGTNDLTGY
FT                   TMAADRGNPDVAYLYSAYNPAVLRSIRNIISAANKEDIMAGMCGEAASDPLLVPVLLGF
FT                   GLNEFSVSATAILATRKVMSLWTMDECKALVDEVMQLETEAEVKALLEERARS"
FT   CDS             complement(692077..692340)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07280"
FT                   /product="Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37763"
FT                   /db_xref="GOA:D4MYR8"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYR8"
FT                   /protein_id="CBL37763.1"
FT                   /translation="MVSKKFVIENEQGLHMRPAGVLAKAVTKFESDVTIVFEDKKINAK
FT                   SLLNIIGACIKCGSEIELVCEGPDEEAALAHATELIESGLGE"
FT   CDS             complement(693073..694311)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07300"
FT                   /product="GTP-binding protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37764"
FT                   /db_xref="GOA:D4MYR9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYR9"
FT                   /protein_id="CBL37764.1"
FT                   /translation="MEEIKKEIIEKVILVAVADQDTTEAEESLDELEELVKTAGAEVVA
FT                   RVIQVRETPHPGTYIGKGKIDEVNALLYGTDATGIVCDDELSPAQISNLEEALDTKVMD
FT                   RTLIILDIFAKRAFTREGKIQVELAQLKYRASKLTGQGRALSRLGGGIGTRGPGEKKLE
FT                   MDRRLIRTRISRLKAELRDVVKHREVQRKQRQKNHLPVVCIVGYTNAGKSTLLNHFTNA
FT                   GVYEEDQLFATLDPTTKSLDLSGGQTILMTDTVGFIRKLPHHLVEAFKSTLEEAKYSDL
FT                   ILHVVDASNPQKEKQMEAVYDTLKQLGANESPIITAFNKIDLLNGDEILKDPNAEAVVR
FT                   ISGKNGEGTDQLLEQIEKILQKQKLYLEKLYGYQEAGKIQLIRSHGQLLKEEYRDDGIY
FT                   VEAYIPKEILGSI"
FT   CDS             complement(694329..694619)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37765"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYS0"
FT                   /protein_id="CBL37765.1"
FT                   /translation="MGYAQTNAFTEPVTLMLAVSKDDHRVVDAWEVTQEEMENSCRSCE
FT                   EYIGMDLIKYYKENQERIEKSQMMNQTMGRDSAKKQAFDMAVQQILGKLGK"
FT   CDS             complement(695018..695833)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07320"
FT                   /product="D-sorbitol 6-phosphate 2-dehydrogenase"
FT                   /EC_number="1.1.1.140"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37766"
FT                   /db_xref="GOA:D4MYS1"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYS1"
FT                   /protein_id="CBL37766.1"
FT                   /translation="MNNDWLELEGKTVIVTGAASGIGKAVAQEFLNIGANVVISDMAEN
FT                   APEMDAKEGQLLYVRTDVTKVSDVEAMVAKTIETFGTIDVLVNNAGINIPRLLVDPKDP
FT                   KGQYELDEAVWDKVCNVNLKGVFFCAQAVGRILVEKGEGVIINMSSESGLEGSEGQSVY
FT                   AATKNAVNSLTRSWAKELGKQGVRVVGVAPGIMEATGLRTIGYETALAYTRGITVEQLR
FT                   AGYSKTSTIPLGRSGKLSEVADLCVYLASKRSSYVHGVTVNVAGGKTRG"
FT   CDS             complement(695849..696697)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07330"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37767"
FT                   /db_xref="GOA:D4MYS2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYS2"
FT                   /protein_id="CBL37767.1"
FT                   /translation="MSSDILVRDQIFSTYDSLYDAEKKVADYLISHPSEAIEMSVSELA
FT                   SHCDASQATIIRFCKKIGCKGFHQLKIKLAGEQRQQEEQVISNEIDIDQMDKSLNNIMI
FT                   SKVEEIKATFHNFNPEELREIVDLIIHANLIEFAAMGDTIPIALDGSYKFNQLGLKAVS
FT                   STIWESQEAFSRTLRKGDVFFAISASGASKRLVKMVEIVKDNGVTTIAITNQSKSPLAE
FT                   LCDHVLLTATREHIFHDQVSFTRMAAMSVIDTLFLLLFSTKWDSFENVAQHEQSVAEEK
FT                   L"
FT   CDS             complement(696709..697965)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07340"
FT                   /product="L-sorbose 1-phosphate reductase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37768"
FT                   /db_xref="GOA:D4MYS3"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYS3"
FT                   /protein_id="CBL37768.1"
FT                   /translation="MKTKAVRLYGEMDLRLDEFELPEMQDDEIMAEVVTDSLCMSSYKA
FT                   ITQAQKHKKVPDDISENPIILGHEFCGTIKKVGKKWKDQYQEGDKFVIQPNIGDIRGYA
FT                   PGYSFHHMGGDATTIIFSDQVMENGSLLKYNGDSFFEGSLVEPLSCVVGAFNAQYHMKK
FT                   MYSYEHVMGIKEGGAIALLGATGPMGFLAIDFAIHGPKKPKTLVVTGRTQKKIDMAARL
FT                   YTVEEAKKNGVKLVYVNTRDIADVNKELRKYSEKGFDDVFIFAPNEEMVTYGVKMLAFD
FT                   GCLNFFSGPADQEFSSRVNFYNIHYNSTHFVGTSGGNTEDMKQSIELIENKTVNVAKIA
FT                   THILGLDHAVETTKVLPELEGSKKIVYTHKKFPLTEVDKFDENSDDKYIRELKSIVERN
FT                   GNLWSGEAERYFIQNAPEI"
FT   CDS             complement(697984..698805)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07350"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37769"
FT                   /db_xref="GOA:D4MYS4"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="InterPro:IPR018405"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYS4"
FT                   /protein_id="CBL37769.1"
FT                   /translation="MSEKKLTKGDRFNMFMRTNLQQASFNYERMHALGMCFDMVPAIKR
FT                   LYDTKEEQVAALKRHLTFFNVTPAAVGPVLGVTAAMEEAKANGADIDEGTIGSIKIGLM
FT                   GPFCGVGDPIFWGTLRPITAAIGASLALTGSALGPVLFFLAFNIVRMAALYFGLEFGYK
FT                   KGLDFVKHLAGNMLQKVTEGASILGLFVMGALVSKWTTINVPLVVSRVTTNGKTTVTTV
FT                   QNILDQLLPGILALVLTLVVSKLLKKNISPIAIIFILFAVGIVGYGLGILA"
FT   CDS             complement(698826..699644)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07360"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37770"
FT                   /db_xref="GOA:D4MYS5"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="InterPro:IPR018404"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYS5"
FT                   /protein_id="CBL37770.1"
FT                   /translation="MGISTVQIVLLVVFGCIAGMGSVLDSFQTHRPLIACTVVGLILGD
FT                   VKTGILLGGTLEMIALGWMNIGAAQSPDSALASIISTILVVVGHQSVANGIAIALPVAV
FT                   AGQVLTVFARTVTIFFQHAADKYAEDANFKMLDICHVAALVVQALRVAIPTFLVAAVVS
FT                   PEGVQTLLNSIPKVVTGGLTVAGGMIVVVGYAMVLNMMGAKYLMPFFFLGFVIAAFTEF
FT                   NLVAFGIMGAVFAIVYVQLNPKFQTPVAAPVTAGAGGSDDLDDDLDDELD"
FT   CDS             complement(699670..700158)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07370"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIB
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37771"
FT                   /db_xref="GOA:D4MYS6"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR018455"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYS6"
FT                   /protein_id="CBL37771.1"
FT                   /translation="MKINLVRIDDRLIHGQVATVWSKEANAQRIIICSDEVAKDQIRKT
FT                   LLLQVGPPGVKVSVVDVAKAVRVYNNPKYEKDTVFFLYTCPQDVLRMAEAGVPIKSVNI
FT                   GGMAFKTGKTQITKAVSVDESDIAAFKKLHEMGIELEIRPVATDKKVDLMSKIEGIEG"
FT   CDS             complement(700155..700586)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07380"
FT                   /product="PTS system D-mannose-specific IIA component, Man
FT                   family (TC 4.A.6.1.1)"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37772"
FT                   /db_xref="GOA:D4MYS7"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR013789"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYS7"
FT                   /protein_id="CBL37772.1"
FT                   /translation="MKLIVSAHGMLAKEVVNSAGMVFGAIDDLDIVTFVPGENAETLKA
FT                   RYKELIDGYKEDEEILFLVDLFGGSPYNAAFETVIGQDRMDVITGLSLPMLIDVVGIRT
FT                   MEEDIKAGEVYDKLSGDYVKSCKKLLGNTNEDEMEDDEL"
FT   CDS             complement(700845..701498)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07390"
FT                   /product="Tetratricopeptide repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37773"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYS8"
FT                   /protein_id="CBL37773.1"
FT                   /translation="MNSKGKGIITAVIVVLIALAAFCGFGYISQRMTASEGITYLDKKE
FT                   YQKAYEQFDHAAGKFTLIFTKQKKDVLFYEGEALYQMGEYGKAIEIYDELIDHGESRAY
FT                   SLKAYCLAQQKKLNKAIDVCDQGIKEHPDDGEIYCTKYAVLAKQEKYTQGLKVIERALK
FT                   QKELENKKEVLFARISAYESMFDFDTAYRYAKAYVKAYPKDANGKKELTFLETR"
FT   CDS             complement(701596..703359)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07410"
FT                   /product="Predicted hydrolase (metallo-beta-lactamase
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37774"
FT                   /db_xref="GOA:D4MYS9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYS9"
FT                   /protein_id="CBL37774.1"
FT                   /translation="MKYFTKKIIAVLLTVMLTGITVLHVSGGQTIKVNAAQTFKVHFID
FT                   VGAADGALLQYGEGENAKYALIDSGAYSYETTDYDTIDVSDRVHQYLLDHGVKHLEFVV
FT                   LTHPHGDHIGGMKKILEDKNITIDTIYGNPLEFEYLESSEDKEKQTEETARWTAFDTQT
FT                   YQTFKKKLEKRNSYKDASLHIQYVVPQAGTSVKLGEAVMTFYGPLDNTYRYGRAQDAPN
FT                   LNTRQVNKYSIVTRIVYGSNSFLMTGDAQQETIKKIVARGYDLSAQVLKQPHHGYQDVR
FT                   LQDKPKGRYVYDSDHKYLIDRTGASIAIISNGYKNVNQTPESNVLRDLSGMDVYQTSDK
FT                   GTIVVSSDGKNLSVSAQKGGNVPSHAGYVVKQKRTPLMQKVTVQANTKKKMTPLRSDAS
FT                   AAYQHYERKNIKIRISAQAKSFTNLKQIQYKFVKKGTSKGSVPYKTGTTLTLRDGMIGR
FT                   VYVRFVTDAGIDEMQLSGIAVDKKAPTKTKIKVNRSGIKTLKTSTKTSYNKKIKKSAKF
FT                   VFSASYGISGKSKTQYKIVPKGKKASKYRWKTANKITYKKKNKKVSIYARFIDKCGNIT
FT                   QRKSSGFYITK"
FT   CDS             complement(705365..707821)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07430"
FT                   /product="glycogen/starch/alpha-glucan phosphorylases"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37775"
FT                   /db_xref="GOA:D4MYT0"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYT0"
FT                   /protein_id="CBL37775.1"
FT                   /translation="MKTERFDKKLFKQEVLNNLKTQFRVELDNASQQQIYQAVAYALKE
FT                   WIIEDWMDTQKTYEEKDPKILYYMSMEFLMGRALGNNLINMSMYGEVKEALDELGVDLN
FT                   AVEDQEPDPALGNGGLGRLAACFLDSLATLGYAAYGCGIRYQYGMFKQKIKDGYQIEVP
FT                   DEWLKNGNPFELKRPEYAKEVRFGGNIRTEYDEATGRTNFIQENYQSVMAVPFDYPIVG
FT                   YGNHIVNTLRIWDAEAITDFQLDSFDKGEYDKAVEQKNLAKNIVEVLYPNDNHYEGKEL
FT                   RLKQQYFFVSASLQAAVAKYKKNHDDITKLYEKMTIQMNDTHPTVSVAELMRILMDEEG
FT                   LGWDEAWEVTTKTCAYTNHTIMAEALEKWPIDLFSKLLPRVYQIVEEIDRRFVNKIREM
FT                   YPGNEEKVKKMAILWDGQVRMAHMAIAAGYSVNGVAKLHTEILKNQELKDFYQMMPEKF
FT                   NNKTNGITQRRFLMHGNPLLADWVTKKLGTDTWATDLSLMSGLKKYVDDPKAQKEFMDI
FT                   KLQNKKRLAKYILEHNGVEVDPTSIFDVQVKRLHEYKRQLMNILHVMYLYNQLKKNPNM
FT                   KFYPRTFIFGAKAAAGYLRAKQTIKLINSVADKVNNDASIKGKLKVVFIEDYRVSNAEW
FT                   IFAAADVSEQISTASKEASGTGNMKFMLNGAPTLGTMDGANVEIVDEVGAENAFIFGMS
FT                   SEEVINYENNGGYHPYEIYQKDKDIHEVLDQLVDGTYANGDPELYKDLYQSLLFGDTGS
FT                   QADMYFILKDFRSYAEAQKKVEEAYRDTKGWAKMAMTNTAGCGKFSSDRTIQEYVDDIW
FT                   HLDKIR"
FT   CDS             complement(707933..709633)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07440"
FT                   /product="Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37776"
FT                   /db_xref="GOA:D4MYT1"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017310"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYT1"
FT                   /protein_id="CBL37776.1"
FT                   /translation="MEQDEKFENQLNLALDLSEEERERSKDLDAGYDKETDQWEIIFRY
FT                   AGTLDTIRWSDTTRIEPLSMGYAIAYIKEDELEAFGANEQVIYIEKPKNLLLSRQPSIA
FT                   ASCMLSVKNPPLSLTGRGVFVAVIDTGIDIFHPDFIDENGDTKIYALWDQTVKGSPPKP
FT                   FLNGNLYTKEEINKVLHSESGRYDFRSRDRSGHGTHVASICAGINGVAPEAELIVVKLG
FT                   DTREKGFPRTTQLMTALQYVINEASQAGRPVAVNISYGHNYGDHRGNSLLERFISQIAQ
FT                   QWKCTICIGTGNEGNSGKHKQGKLIKEEQKILLDIAPFEQNLNLQIWKDFVDELRIQLE
FT                   SPSGISYEITDKQGKSQYAYGNTIVFVYNGYPTPYNVRQEIFLSFIVQEGNHIESGQWN
FT                   LTLIPRNIRNGEYQMWLPVSLGSNQETRFLEPDKEFTLTIPSTAEKVISAGAYDVRYQS
FT                   YADFSGRGDQRYGVKKPDLVAPGVGILAAAPGGGENGLSGTSMATPFVTGAAALLMEWG
FT                   IIRKNDPYLYGERIKAYFHKGARKMNGFLDYPNNEIGYGKLCVAASLYN"
FT   CDS             complement(709700..710152)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07450"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37777"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYT2"
FT                   /protein_id="CBL37777.1"
FT                   /translation="MKAEIIQVLASFVGSFGFAVLYNLRGKKLCMAGISGMVSWIAYLI
FT                   VWNEMPSTFVANLAAAAVATIYAETMARILKTPVTVFLITGIIPLVPGGNLYYTMNYVL
FT                   AKQWHLFYLYGQKTLLIAVAVAAGIMTASSVYGICASVWKYCKREI"
FT   CDS             complement(710153..710911)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07460"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37778"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYT3"
FT                   /protein_id="CBL37778.1"
FT                   /translation="MEMKKVLKYAMEIGECMLVSGAGVSRVEDTISRICKAYGAKEANV
FT                   FSITSSIVTTIEDEKGEILTQTKRIRSYKTDFTKLDELNQLSRYMCKELPEEEEVKRKI
FT                   SEIKKGKVVVFTEEVLTSAVIAAAWTSFYGGGITEGIIAMIAGAFVAVLARYIKILAPN
FT                   EMVLNFLLSFFVAAFAYISAKFGLTEDYGKIIIGNIMLLVPGVAFVNALRDMIGGDMMS
FT                   GILRVCESILLAVFLAAGSFMALMFLGGVL"
FT   CDS             complement(711056..711925)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07470"
FT                   /product="EDD domain protein, DegV family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37779"
FT                   /db_xref="GOA:D4MYT4"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYT4"
FT                   /protein_id="CBL37779.1"
FT                   /translation="MGKIAIVTDSNSGITQKEGKELGISVIPMPFYINEELYFEDITLT
FT                   QDEFYQKLNEDEDIKTSQPAPGDVLDLWEKLLEDHDEIVHIAMSSGLSSSCATAAMLAD
FT                   DYDGKVQVVDNQRISVTQRQSVLDAAKLAEEGKSAKEIKDILEADKLDSGIYIMVDTLK
FT                   YLKKGGRVTAAGAAIGTVLGIKPVLQIHGEKLDAFAKTRGVKQAKKKMIAAVRKELEER
FT                   FPDGDFGKHAYLQSAYTKDEEAALKWKEELMAEFPGMEFQQDPLSLSVACHIGAGALAV
FT                   AWTHKIDD"
FT   CDS             complement(712050..712601)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07480"
FT                   /product="MAF protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37780"
FT                   /db_xref="GOA:D4MYT5"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYT5"
FT                   /protein_id="CBL37780.1"
FT                   /translation="MKHIILASASPRRKEILELADLKFDVMPSDAQEITTKTAPNEVVM
FT                   ELASIKAKDIYKKSEKQSMIVGADTVVAYQGQILGKPTDKADAKRMLTMLSGQTHEVYT
FT                   GVCVIEDGKTKTFYEETKVTFYEISDEQINHYIKTGEPMDKAGSYGIQGKAAVFIKGIE
FT                   GDYYNVVGFPIARFLQEITK"
FT   gap             712799..713306
FT                   /estimated_length=508
FT   CDS             complement(713450..715540)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07490"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37781"
FT                   /db_xref="GOA:D4MYT6"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR003101"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYT6"
FT                   /protein_id="CBL37781.1"
FT                   /translation="MTKQFSMELAGRTLMVEVGRVAAQANGAAFMHYGDTVVLSTATAS
FT                   EKPRDGIDFFPLSVEYEEKLYAVGKIPGGYLKREGKPSENAILTDRVIDRPMRPLFPKD
FT                   YRNDVALNNLVMSVDPDCSPELTAMLGSAIATAISDIPFDGPTASTMVGLIDGEFVINP
FT                   TSAQKEVSDLALTVASTREKVIMIEAGANEVPEDVMLEAIFKAHEVNQEIIKFIDTIVA
FT                   ECGKEKHDYEHHIVDPEMYDDMVAFITPEAMEEAVFTDDKQTREANIRAIEEKLEERYA
FT                   ENEEWLAQIGEAVYAFQKKTVRKMILKDHKRPDGRDIKQIRPLHAEVDCLPRVHGSALF
FT                   QRGQTQVMTVTTLGSLSEAQRLDGIDVTETTKRYMHHYNFPSYSVGETRPSRGPGRREI
FT                   GHGALAERALVPVLPSEEEFPYAIRTVSEIMESNGSTSQGSICASSLSLMAAGVPVKAP
FT                   VAGISVGLVTGEGDDDYIILTDIQGLEDFFGDMDFKVAGTDKGITAIQMDIKIHGLTEQ
FT                   IIREAIARTKEARTHILHDVMNPVIPAARDHVGEFAPKISQYTIDPEKISEVIGKQGKT
FT                   INGIIDETGVKIDIDESGRIDILSEDQAMIDKAISIIKSIVEPLNVGDIYEGEVVRIMN
FT                   FGAFVQLSPNKDGMIHISKLSNERVEKVEDVVNIGDKVAVKVLEIDKMGRINLKLEEKI
FT                   ED"
FT   gap             715740..716563
FT                   /estimated_length=824
FT   CDS             complement(716613..716879)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07500"
FT                   /product="SSU ribosomal protein S15P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37782"
FT                   /db_xref="GOA:D4MYT7"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYT7"
FT                   /protein_id="CBL37782.1"
FT                   /translation="MISSEKKAEIVAKYGKDAKDTGSPEVQVAILTARINELQDHFNQH
FT                   PKDHHSRRGLLKMVGKRRNLLAYLKSKDVERYRSLIEKLGLRK"
FT   CDS             complement(717008..717820)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07510"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37783"
FT                   /db_xref="GOA:D4MYT8"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYT8"
FT                   /protein_id="CBL37783.1"
FT                   /translation="MKLGFIGCGNMAQAMITGILTQKVVSPQELIVSNPREEKTAKLKD
FT                   EFGIITTTDNKEVAKQSDILVLSVKPQVYPAVIKEIRDEVSSEQIIVTIAAGVSMEAAE
FT                   RQFGKEVKIVRVMPNTPALVGEGMSGLCCNEYVTEEEFDLVHKIFESFGKAEKITENLM
FT                   DAVVGVSGSGPAYVYMFIEAMADAAVAQGLPRKQAYTFAAQTLLGSAKMVLETGQHPGE
FT                   LKDAVCSPAGTTIEAVNVLEKKGMRSAVIEAVTAAAKKNHQLGKKKEK"
FT   CDS             complement(717845..718762)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07520"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="5.4.99.12"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37784"
FT                   /db_xref="GOA:D4MYT9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYT9"
FT                   /protein_id="CBL37784.1"
FT                   /translation="MDETIEIKVTSEMAGKRLDVVLSEQCSDLTRSYINKLCKEERAAL
FT                   NGKTSKGNKKCKEGDVITLQVPEPTELEILPEEMNLDIVYEDQDVILINKPKGMVVHPA
FT                   AGHYSGTLVNGLMAHCKDDLSGINGVLRPGIVHRIDKDTTGILIVCKNDMAHQSIAKQL
FT                   YDHSITRKYHAIVYGNIKEEEGTVNAPIGRSLKDRKKMGIVMDGKHAVTHYKVLKRLKK
FT                   GFTYIECQLETGRTHQIRVHMASIKHPLLGDDVYGPKKSKYTLEGQCLHAKVLGFVHPR
FT                   TGEYMEFEVPLPEYFEKLLNKLDN"
FT   CDS             complement(718740..719255)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07530"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37785"
FT                   /db_xref="GOA:D4MYU0"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYU0"
FT                   /protein_id="CBL37785.1"
FT                   /translation="MKKQIRIYIYIIGLILIDQLSKVWALSALRGTEGIAVIPNVFELS
FT                   YLENRGAAFGILQDHQIFFVLITVASAVILTWIYRRIPQTKKYIPLRISYALIMAGAFG
FT                   NLIDRVFRGYVVDFFYFKWIDFPVFNVADIYVTVTMILLLILILFFYKEEDLDFLNRKG
FT                   KHGRDNRN"
FT   CDS             complement(719273..720391)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07540"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37786"
FT                   /db_xref="GOA:D4MYU1"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYU1"
FT                   /protein_id="CBL37786.1"
FT                   /translation="MEMKKMNSKNNLEMNNKIEICNEGKKAYDIVLRDSFADLLDQMEF
FT                   LEIEKKKVCIVTESNVAPIYLKEVCELISSKASKTITFSFEAGEKHKQLKTIEALYEEL
FT                   IINHFDRQDLLIALGGGVVGDMTGYAAATYLRGIDFVQVPTTLLSQVDSSIGGKTGVDF
FT                   LQYKNMVGAFHQPKLVYINTTTLKSLPEREYFSGMGEVIKHGLIKDADYYEWIKENIDA
FT                   IKAREHEAVKEMIYQSCLIKGGVVERDPKEKGERALLNFGHTLGHAIEKLKDFTWLHGE
FT                   CVAAGCCLAAEISCIKGNISKEEVDDIKGVFEAFDMNGDISELSADDIVKTTKSDKKMV
FT                   GDKIKFVLLRSVGDAYIDMSVTDDEMKQVLQG"
FT   CDS             complement(720342..720932)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07550"
FT                   /product="DivIVA domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37787"
FT                   /db_xref="GOA:D4MYU2"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYU2"
FT                   /protein_id="CBL37787.1"
FT                   /translation="MITPVEVLGKELRRGFGYKAVEVDEFLEELAKDYEKVYKENNELR
FT                   EKVSALTENLSHYRTIEESLKRALVLAEETSKETIENANNKAQALEAEASRNAKQLVSE
FT                   AEDQAEKILTSAKEDFKEEKEQHEKTIENYQKLIRKLESDYQSYKARMKQFINGQMDIL
FT                   DNPVYEMEFEIAGCEQTDGDEEDEQQKQFGNEQ"
FT   CDS             complement(720942..721697)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07560"
FT                   /product="Uncharacterized conserved protein, contains
FT                   S4-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37788"
FT                   /db_xref="GOA:D4MYU3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYU3"
FT                   /protein_id="CBL37788.1"
FT                   /translation="MKEEELLKKRLMELCEKAYNQNIYTYTHFLNEYEQSIYQDMKQEL
FT                   AYAHPILVGGHKYFTRAVVMFGSEELFGYQGEVPVVCARISPVFDKFAEELSHRDYLGA
FT                   LMNLGIERHLIGDILIDGRYAYIFCMEHIIGVIKEQLDQVRYTRVFVEEVSWEETGYVQ
FT                   KYKKKEGFVASMRLDVLVSQAFSLSRNISEKLLKSQKVFHNGKMCLSGGQKIKQGDIIS
FT                   VRGYGKFLVEDLGKTSKKGRQFITLAIFQ"
FT   CDS             complement(721704..722264)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07570"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37789"
FT                   /db_xref="GOA:D4MYU4"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYU4"
FT                   /protein_id="CBL37789.1"
FT                   /translation="MKGTVDKLLNFMKLSDDEEYDEEYEEYEDDEEEEEEPRSTFSFFK
FT                   KKEPEVEEESSNSKISQPFDNTITASREAKKRRFTSTGSKVVSMNGRGVEVYVIKPQDF
FT                   AEAQMAADLLKEGRTVVINLEGVELTVAQRSIDFVGGATYAINGSLQAVSNNIFIAAPD
FT                   SIEVSGDLKSEIMNENTISPQLK"
FT   CDS             complement(722278..722973)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07580"
FT                   /product="pyridoxal phosphate enzyme, YggS family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37790"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYU5"
FT                   /protein_id="CBL37790.1"
FT                   /translation="MLIERYNEVKKHVEEACKRVGRDPREVTVIAVSKTKPLEMVEELR
FT                   KEKVLDFGENKVQEIRDKYANISWPVRWHLIGHLQTNKIKYIVDKVALIHSVDSIKLAQ
FT                   AIDKEAAKHDVKEVPILIQVNFAHEDTKFGLNPEDVFDVVKEISALEHVKIKGLMQIAP
FT                   FVDDPEDNRKYFRAMKQLSVDINNKNFDNVDMSILSMGMTNDYEIAVEEGATMVRVGTA
FT                   IFGERNYNI"
FT   CDS             complement(723016..724395)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37791"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYU6"
FT                   /protein_id="CBL37791.1"
FT                   /translation="MAAKRRRKTKIHWNIGMIIFVVILVYILINVILFLGKKKLTVYKV
FT                   TEDKITNTLSFTGIAIRDEELLKASQSGYITYYVEEGKRIKKSGTVFTVDKDQKVQDAF
FT                   VSQVQQLEKNKKVIDDEEIQHKITDYQSVYSDHKFSTVYDLKYDLKNAILNLSEDSMKT
FT                   VIEAVKQKLGDTSFETQKSTSSGVTQFYSDDFDGKSAKDITSKDFDQSQYRVQRYNTSD
FT                   KVKKGKVVARINKSEKWQIVIPLEADQYRMLKDKSEVSVRFLQDQTTATATVEVTKKGS
FT                   SYFGYLKFNDYAVRYINERYLEIDVTLDSYKGLKIPNTSIVKKKFYQVPVKYLTKGDNS
FT                   AKEQFTVRDTSNKGDVTVEQKSFTIYGRTKDYCYLDPEEVGENVVLQAMDSKDTFLIEK
FT                   MKTLKGVYCTNQGYADFRPIDILIEKDDYSIIANDTDQGVSRYDFIVLDGTTIKENQII
FT                   Y"
FT   CDS             complement(724399..725340)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07600"
FT                   /product="radical SAM protein, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37792"
FT                   /db_xref="GOA:D4MYU7"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYU7"
FT                   /protein_id="CBL37792.1"
FT                   /translation="MERYKAYSTHLKELYGEKVYKLPVNLPVTCPNRMDGDGCTFCGGV
FT                   GTGFEAMNSEVSVSEQLNATKGKITKRYKAKKFIAYFQNYTNTFLPVDKFEKYLVEAAQ
FT                   TEDIVGISVSTRPDCITKEYLDCLKKISEEYQVKISMEYGLQTVNYKTLNKINRGHTLA
FT                   EYLDAVLMTAPYGFEICTHIILNLPGDDMTDVIETAKILSALPVQIVKLHSLYIPKGSK
FT                   MYEEYKEGKITLCDPKEYLDRLVNFICYVRKDMVIERLFSRVPKEDASFSNWGISWWKL
FT                   KDRFDEIMETNDYMQGCKFDYLNGAALRRWEI"
FT   CDS             complement(725342..726310)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07610"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37793"
FT                   /db_xref="GOA:D4MYU8"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYU8"
FT                   /protein_id="CBL37793.1"
FT                   /translation="MKKLICICMSVMMIALSGCQTSAKTGGFTSYDEHYQKNETTLKED
FT                   ALSDRWESRGSKVAVVSKEKADNNDYPEAKEVLLVNNTKNKVIVSQKVFDQAYPASTTK
FT                   IMTALLTLENLNLSQVVTIKHDITFPDGAAVAIHLKKGDKITVEALLNALIIMSANDAA
FT                   VALGEAVAGSEANFVKMMNKRAKELGATNTHFANPNGLHLSDHYSTAYDLYLIFKEVAK
FT                   HNEFFNIAGRSSSRIEYLGSKGEQKIYDMASTNQYIAGTYTLPSQVYMIGGKTGTTTQA
FT                   GSCLILLTKNKDGEEFISVVLKGVTKSALYHTMTDILSKEN"
FT   CDS             complement(726349..726624)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07620"
FT                   /product="Methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37794"
FT                   /db_xref="GOA:D4MYU9"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYU9"
FT                   /protein_id="CBL37794.1"
FT                   /translation="MIEDVANLKIHKLLAGHFGGMQQMGSKISNNEIDLLIFLQDPANK
FT                   KRTPDFYNVLNLCDQYNIPCATNLPTAEVLILALDRGDLDWRNMYK"
FT   CDS             complement(726621..726740)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37795"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYV0"
FT                   /protein_id="CBL37795.1"
FT                   /translation="MNVGLVAHDGKKNLMQNLCIAYQDILKNINYMLQVRLDR"
FT   CDS             complement(726753..727868)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07640"
FT                   /product="Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37796"
FT                   /db_xref="GOA:D4MYV1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYV1"
FT                   /protein_id="CBL37796.1"
FT                   /translation="MLRNYRLQNYNFKLVFNVLVLMAMSLLFIHSAKASYVPKQALGII
FT                   MGLGIIVVVSLIDYQVFTRNAEILYILNVIMLIGVKLFGKDVNGAKRWFSLGPLGTFQP
FT                   SELSKVIMIIVVAAFLAKHQDDLNEPKVLGKLAVICGIPLLLILKQPSLSSTLDICFII
FT                   LGMIFMAGLSSRLIVQVLIVGVPLLAIFLWYVQTPGQVLLEPHQVARIMSFLHPENYAD
FT                   STALQTSNSIMAIGSGGLFGKGFGSNTISNVSASDVNLVSENQTDFIFSVIGEEFGFVG
FT                   CVVLIIVFACLVYQCMNVAKKSGNLIGTYVAVGVACYMGFQSFINIAVATGTMPNTGQP
FT                   LPFISYGLSSLMSASIAIGMVLNIYLQRKRH"
FT   CDS             complement(727884..728144)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07650"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37797"
FT                   /db_xref="GOA:D4MYV2"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYV2"
FT                   /protein_id="CBL37797.1"
FT                   /translation="MGFFDNFFKKKSSGEVAKDRLKLLLVSDRSNCSPETMELIKNDII
FT                   QVISKYMEIDPEGLDIQITQSSEESEGPALYANIPIRELRK"
FT   CDS             complement(728159..728944)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07660"
FT                   /product="septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37798"
FT                   /db_xref="GOA:D4MYV3"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYV3"
FT                   /protein_id="CBL37798.1"
FT                   /translation="MSEVIVITSGKGGVGKTTTTANVGTGLAKEGKKVVLIDTDIGLRN
FT                   LDVVMGLENRIVYNLVDVVEGNCRIKQAMIKDKKYPNLFLLPSAQTRDKTSVTPEQMSK
FT                   LVEELKSEFDYIILDCPAGIEQGFKNAIAAADRALIVTTPEVSAIRDADRIIGLLEAND
FT                   IHKIDLVINRIRMDMVERGDMLSKDDVLDILAVDLIGIVPDDENIVISTNQGEPLVGSN
FT                   TPAGKAYQNICNRVMGKDVPFMEITGPTFFQRLANVFKK"
FT   CDS             complement(728963..729703)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07670"
FT                   /product="septum site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37799"
FT                   /db_xref="GOA:D4MYV4"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYV4"
FT                   /protein_id="CBL37799.1"
FT                   /translation="MNQPVLLKGNSLGLTMVLDPGMKFDQLIKAIEDKFVQAKDFFNGQ
FT                   TQIALKIEGRKLDAKELQNVLQIIAEKTTLTIAYVIEDDKIMETSFKDVLKKIQEREQK
FT                   RSQSMVDERRKGDGQFYRGTLRSGQSLESDASVVVVGDVNPGASVCAKGNVVVLGCAKG
FT                   YLSAGCDGDDHAFVAALDMQPMQIRIGKHIARSADGEPEKKKKLFGRSKNNDNQPMEAQ
FT                   IAFVEDENIYIEPISKALLNEIIV"
FT   CDS             complement(732636..733151)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07690"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37800"
FT                   /db_xref="GOA:D4MYV5"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYV5"
FT                   /protein_id="CBL37800.1"
FT                   /translation="MKIKRILFYVISVLVCFLLQTSVFNFLKLAGVMPNILLILTVTIA
FT                   FIRGRKAGTVIGFVCGLLIDIFSGNVLGQNAFVYLMFGYVNGWFHTYFYEDDILLPIGL
FT                   LTANSLAYSFVIFFFFFAMRGRLQFFSYLFKVMIPEAVYTGIVALLIYKILLEVDIRIR
FT                   DGEKRSMF"
FT   CDS             complement(733163..734029)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07700"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37801"
FT                   /db_xref="GOA:D4MYV6"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYV6"
FT                   /protein_id="CBL37801.1"
FT                   /translation="MKLQKKKFNSNHLLAIFIVVCGLLAGISVFAGGVLTPVKNIFFTV
FT                   LSPMQEGINSVGNAVFSWNENAKSKKTLRAENERLQEKIDVLKMQNRVLQQNQVELERL
FT                   QDLLKLKQKYKKYHTVGARVISKGSGNWFDIFLINRGSKDGIKKDMNVIAGNGLVGIVY
FT                   DVSSHTAKVRTIINDTSMVSAMFLKTNDACIVNGSLDTMEDGYLEVVYISKDAKVKNGD
FT                   ELVTSYVSSKFNEGITIGKVSDLKLDSTKLTKTAKVTPVVDFKHLKEVLVITDLKKTKN
FT                   LDEETKE"
FT   CDS             complement(734051..735010)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07710"
FT                   /product="Actin-like ATPase involved in cell morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37802"
FT                   /db_xref="GOA:D4MYV7"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYV7"
FT                   /protein_id="CBL37802.1"
FT                   /translation="MKTAQLGIELGTRHLRICTRDKEEFLKIKNMIAFDEDAKLKAFGN
FT                   EAFAMYEKQPYSIHVVKPMEHGVISDYTNMRYLLGTVLDHYFKRIRKTGLMIAVPVDIT
FT                   NVEKRAFEDLAWESASRVKDVTLVPKPILAAIGSGIDVNAPCGNMIIDIGASTTEISVI
FT                   SLGGIVTSRLLPYGGDQIDEWIRDYVKKNYKLAIGTRSARHLKLAYAKIEDKEAAMIKG
FT                   RDLVSGLPKQEKIPIQIVEEKAHSQVRDICVQVKAVLESITPELASDIMNQGIYVSGGG
FT                   AAFPKTAEWIKEEFKIPVHIADRPEDHVILGMQSYLKR"
FT   CDS             complement(735021..735749)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07720"
FT                   /product="DNA replication and repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37803"
FT                   /db_xref="GOA:D4MYV8"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYV8"
FT                   /protein_id="CBL37803.1"
FT                   /translation="MEIFRQKGSDMEEKHQTLKELPVSERPYEKCEKNGTAMLSDAELL
FT                   AVILRSGTKDQTAIDLATKVLSIDPFYEGILGICHTSREELQKIPGIGKVKAMQILCIA
FT                   ELSKRLASAKVEDKISFHSPASIADYYMERMRHLSREEMILIFFNGKNKVIKELTVSVG
FT                   TVNQTVASPRELFLEALRCEAVSVLMIHNHPSGDPTPSRQDILTTKRMKEAGEFLGIPL
FT                   CDHIIIGDQTYLSFREEHMM"
FT   CDS             complement(735844..737139)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07730"
FT                   /product="Cystathionine beta-lyase family protein involved
FT                   in aluminum resistance"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37804"
FT                   /db_xref="GOA:D4MYV9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR009651"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYV9"
FT                   /protein_id="CBL37804.1"
FT                   /translation="MDQLKNYYKEMGVDEKVFDYAQEVEKGLKDRFETLDAIAQLNQIK
FT                   VLNAMQKHQIAEMHLGGTTGYGYNDSGREAVEALYADVFGTEDALVRPQITCGTHALGL
FT                   ALSANLRPGDEILAISGKPYDTLEEVIGIRESKGSLKEYGITYAQVDLLEDGSFDLEGI
FT                   KNAINDKTKLIHIQRSKGYATRPTLSVDVIGEAIAFVKEINKDLIVMVDNCYGEFVEEK
FT                   EPSEVGADMIVGSLIKNPGGGLAPIGGYICGRSDLIEQCAYRLTTPGLGKEVGASLGVN
FT                   RQFIQGFFMAPTVVNAAVKGAIFAANLYEKLGFKVIPDGKEDRHDIIQAVEFHDPEKLI
FT                   AFCEGIQKASPIDSHVTPIPWDMPGYDSQVIMAAGTFVSGASIELSADGPMKEPYAVYF
FT                   QGGLTYPHAKYGIIMSLQRMAEKGLVEIPEIS"
FT   CDS             complement(737114..738076)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07740"
FT                   /product="tRNA isopentenyltransferase (miaA)"
FT                   /EC_number="2.5.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37805"
FT                   /db_xref="GOA:D4MYW0"
FT                   /db_xref="InterPro:IPR002627"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYW0"
FT                   /protein_id="CBL37805.1"
FT                   /translation="MKPMVILTGPTAVGKTELSIRLAKILDAEIISADSMQVYKKMDIG
FT                   TAKIMPEEMEGIKHYLVDELDPKEEFHVARFQQMAKDALKEIYAKGKIPLIVGGTGFYI
FT                   QSLLYDIDFTKEDGDQEYRKQLEEKAKREGNDSLYEMLKQVDPKSTEKIHKNNVKRVIR
FT                   ALEFYKLNGYPISEHNEKEAAKTSPYNFAYFVLNHKRDILYDRINRRVDIMAEQGLIDE
FT                   VKRLKEEGYEKTMVSMQGIGYRQVFEYLEGNLSLEDTIEQIKKDTRHFAKRQLTWFGRE
FT                   KEVCMVDKSQFGSEDEILTYMLTILKEKGIYDGSVKELL"
FT   CDS             complement(738081..738458)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07750"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37806"
FT                   /db_xref="GOA:D4MYW1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYW1"
FT                   /protein_id="CBL37806.1"
FT                   /translation="MTDQELLDFADKAKEKAYAPYSRFQVGAAILTKEGKVFTGCNVEN
FT                   SSYGAAICAERTAAVKAVSEGYHDFEMIAIASNGSDKETVYPCGICRQFLHEFNSDLKV
FT                   ICQSPDGFETYRLSELMPKGF"
FT   CDS             complement(738484..740421)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07760"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37807"
FT                   /db_xref="GOA:D4MYW2"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011186"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYW2"
FT                   /protein_id="CBL37807.1"
FT                   /translation="MAKIQLLDQKTIDNIAAGEVIERPASVVKELVENAVDAKANAVTV
FT                   EIKDGGMTLIRVTDNGIGIPKDQVKTAFLRHATSKIRSVEDLLSVSSLGFRGEALSSIS
FT                   AVAQVELVTKTAESFSGVSYKIYGGEEEAFDDIGAPDGTTFLVKNLFYNTPARRKFLKS
FT                   ATTEAGYVEQMMVHIALSHPEISFKFIHNNKNKIYTSGNGKVKDIIYHIYGRDVAGALI
FT                   PLEAQNEDVKVTGFVAKPYVSRGNRNYESYFINGRYIKSSIIYKAIEEGYRTFTMKHRY
FT                   PFVCLDFKIDQELLDVNVHPTKMEIRFRNGREIYELVVDAVRAALLQKDLVQDVLRETP
FT                   KKKELPKTKEVKKPEPFEVNRRKEEVQKVDQQGQGVQQQVEKQRQAVQQQIEKPSHPVK
FT                   KTPTASESSKNTKKPTYAGLNYNTQKKDFPQYKTDELSSNQMTLREDPVFSVQARPDRK
FT                   ILGQLFKTYWLIEYEDQLFIMDQHAAHEKVNYERLMKNFKEKEIYSQRLEPPMVVTVSM
FT                   TEAEALTRYKDAFAGLGFTIESFGGNEYCIREVPANLYGIGERDLFMELLDAVSQENGT
FT                   LDTEVIASKIATMACKMSIKGNQRVSLMEVEHLLDELMKLENPYQCPHGRPTIIKMSKY
FT                   EIDKKFKRIV"
FT   CDS             complement(740426..743053)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07770"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37808"
FT                   /db_xref="GOA:D4MYW3"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYW3"
FT                   /protein_id="CBL37808.1"
FT                   /translation="MAKKGKLTPMMQQYMQIKEENKDCILFYRLGDFYEMFFDDALTAS
FT                   KELEITLTGKNCGLEERAPMCGVPYHAVDSYLNKLVEKGYKVGICEQVEDPSQAKGIVK
FT                   REIVRIVTPGTNISQQSLDDEKNNYLMCIFANDGSYGISFVDVTTGDFRTTSMDSLAKV
FT                   RDEIFKFEPAEIICNDAFLISGMDFDYLKDKMSIVISSIEPYHFDEEQAEERIKRQFKV
FT                   GNLEGLGLLDHPMGVIATGALLGYLHETQKSSLDHLMHIEAYETSEFMIIDSSSRRNLE
FT                   LCETLRDKQKKGSLLWVLDKTKTAMGARMLRNMVEQPLVDKKKIEERYDAITTLTDQTI
FT                   VREELREYLNPIYDLERLMTKVSYKTANPRDMIAFKTSLELLPAIKTVLEECKDPLLSG
FT                   LREDLDPLEDIHNLLEDSIIEEPPLAIKEGGIIKEGFKEDIDKLKRAKTEGKQWLMELE
FT                   EREREKTGIKNLKIKFNKVFGYYLDVTNSYKDLVPDHYIRKQTLANSERYTTEELNQLA
FT                   DTILGSEDRLYALEYETYVMIRETLAGEMERISRTANVIAQIDALASLAYVAERNHFVR
FT                   PKLNVRGTIDIKDGRHPVVEQVIPNDMFISNDTYLDNKKNRVAIITGPNMAGKSTYMRQ
FT                   VALIVLMAQIGSFVPAAKANIGIVDRIFTRAGASDDLASGQSTFMVEMSEVANILRNAT
FT                   KNSLLILDEIGRGTSTFDGLSIAWAVVEYISNSKLLGAKTLFATHYHELTELEGKIDSV
FT                   HNYCIAVKEQGDDIVFLRKIVKGGADKSYGVQVAKLAGVPDAVINRAKEIARELEEHDL
FT                   TSGAKDIMPYGEAQQLSFFRESDEPTMEHPFMAELREKDLSDMTPLEALNYLYVLQEKL
FT                   KNEE"
FT   CDS             complement(743046..744458)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07780"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37809"
FT                   /db_xref="GOA:D4MYW4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023970"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYW4"
FT                   /protein_id="CBL37809.1"
FT                   /translation="MEQLKNESSRQYEYMEEMKKWVQKKSEELGRKLTCHVTTFGCQMN
FT                   EKDSEKLLGILETIGYEEVETEEADFLIFNTCTVRENANTKLYGHLGQVKKMKERNPQM
FT                   MIGLCGCMMQEEHVIEKIRSSYKFVDIIFGTHNIFKLAELLKARVDSKGMIVDIWKDTD
FT                   QIVEDLPSDRKFSFKCGVNIMYGCNNFCSYCIVPYVRGRERSRKPEDIIKEVKQVVSEG
FT                   VKEVMLLGQNVNSYGKTLEEPMSFAELLREVEKVEGLERIRFMTPHPKDLSDDLIEVMA
FT                   TSKKVCKHMHLPMQSGSSRLLKLMNRHYTKEQYVALAKKIQERIPGVSFTTDIIVGFPG
FT                   ETEEDFKETLDVVREVGFDSAYTYVYSKRSGTPAASMEDQVDKDVIKDRFDRLLALLKE
FT                   TSAKNCKKKVGDIERVLIEEENTHEEGMLTGRLENNLLVHFKGCKEQIGTMADVKLVEE
FT                   KGFYYMGEQIHG"
FT   CDS             744748..746430
FT                   /transl_table=11
FT                   /locus_tag="CL2_07790"
FT                   /product="Na/Pi-cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37810"
FT                   /db_xref="GOA:D4MYW5"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYW5"
FT                   /protein_id="CBL37810.1"
FT                   /translation="MNYTIILALMGGLGLFLYGMKLMSDGLEKAAGAKLRRILEIFTTN
FT                   RLTGMLVGIFFTAVIQSSSAATVMVVSFVNAGLMNLSQAAGVILGANIGTTVTSQLVSF
FT                   NLSEIAPVFLMAGVIMVLFINNPTVQKVGEVILGFGVLFMGLTSMSSAMSVLRDSPLIT
FT                   SYLQTLDNHFLGVLFGFIMTAILQSSSVTVSIVLLMASQGLLHLPICFFIILGCNMGSC
FT                   VSALLASLSGNKGAKRAAMIHFLFNIFGSIIIFTGLSFALTPITNFFLSISGGNLGRSV
FT                   ANAHTTFKIIEVLFMFPCTPLVVALTEKIIRGKDEKVHHNELQYITEISLKSPATMIPQ
FT                   AKNELRRMANMAQENLDHAIHGFLNQSDEFVDKIYHREEDINNVSHAITDYLVKSNQLS
FT                   LPLADQKILGSMFYVVNDIERIGDHAENFADFTKTEIKHNTGLTGDAKEEIKKMYTAVS
FT                   KLLKLSLECFMEQDGVNKPEEKLAEIAILEASIDKMERRYQKHHIKRLAKGECEPRAGL
FT                   LFSDMLSELERIADHSVNIAYSMSDEDEDEILAAESEALTAKN"
FT   CDS             complement(746525..748447)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07800"
FT                   /product="Glycosidases"
FT                   /EC_number="3.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37811"
FT                   /db_xref="GOA:D4MYW6"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYW6"
FT                   /protein_id="CBL37811.1"
FT                   /translation="MIHNASVEKYRTPVGAVTCGSEMMIRLYDVGQEVNKAEIIMYSES
FT                   FHREYEMKRKKDCMEEHIKMTSEAGVVWYYFRIWEHGKCYFYGARHGKTQGEGMIVDDN
FT                   PDSFQITVYEENFDTPRWMSKGIMYQIFPDRFCQGNKENMKRGKAYHESMGRTVYLHDD
FT                   WEEQPVFGPLPGKEFYDPCDYFGGDIEGIISKLDDLKRLGISCIYLNPIGEAASNHRYN
FT                   TSDYKKVDPFLGNNEDFKRLCQLAKERRIHVILDGVYSHTGDDSVYFNKKGNYEEPGAY
FT                   QGEESKYYDWYDFNEDGTYKSWWGFETLPEVNELNEKFVDYIITGEDSVIKHWLKLGAS
FT                   GFRLDVADELPDEFIFKLRSELKKKFKNYTLIGEVWEDVTTKESYGTKRKYALGKGLDS
FT                   AMNYPLKVNVTDYLLGNQSAKDMKTFLISQQCNYPKPLYYALMNLLSSHDIPRIRTTLA
FT                   TGMNENLPSREQQAEYVITSKMDQKGKALTRLAMAVQFFVPGMPCIYYGDEYGMHGLMD
FT                   PFNRGAFFENDKETYQEVLRLTSLRNREKVLQTGYALYMAPTENVLAILRFISEKKDVF
FT                   GEASENKAILLLVNPTMKKEEINLDLNKVKEGVNENALQALLKNLSNAVIKANVAPIDY
FT                   KVIEL"
FT   gap             749844..750169
FT                   /estimated_length=326
FT   CDS             complement(751332..752777)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07830"
FT                   /product="glycogen/starch synthases, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37812"
FT                   /db_xref="GOA:D4MYW7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYW7"
FT                   /protein_id="CBL37812.1"
FT                   /translation="MSNNNSLKVLLAGAECAPFVKLGGLADVMGTLPKELNQIGADARV
FT                   IMPFHSQMKGKYGAQTRHLADFNINFSGGETYVGVEELVYNEVTYYLIDNEGFFGDAVY
FT                   RGGLAEGEQYAFFCRAVIEAASRIGFIPDVIHCNDWQTGLIPILLRTQYGHWDIGHAKT
FT                   IFTIHNMMYQGEFGFDQFEHWLGIDPKYDTPEFMHNYECASFMKAALVFADRLSTVSPT
FT                   YAQEIRDPAFAYRQEGILNARAGDTWGILNGMNQEEFNPETDPLIPYHFNKDDLSGKKK
FT                   DKQELIKALGLSITPGVPIIGMVTRLTEQKGLDLVKYMLDEIMCTENVAFVILGTGDYE
FT                   YEEFFRYMEEKYKGRVCSYIAYDNAVAHQIYAGSDLFLMPSKFEPCGISQMIALRYGTL
FT                   PIVRETGGLRDTVQSYNEYEDTGNGFSFANYNAHEMLGAIRYALQTLQSPKRKHGLIRR
FT                   AMESDNSFAKSAKIYLDMYNSVL"
FT   CDS             complement(752770..753903)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07840"
FT                   /product="glucose-1-phosphate adenylyltransferase, GlgD
FT                   subunit"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37813"
FT                   /db_xref="GOA:D4MYW8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYW8"
FT                   /protein_id="CBL37813.1"
FT                   /translation="MDKQMLGIINAGEENRKLKDLVRSRSLSALPVGGRYRTVDFMLSN
FT                   MVNAGIKNVGLLTRRNYDSLLSHVNSGKYWGLNKKRGGLYIFPPYINDASPSGEYASVM
FT                   DGLRGTLGFLKKAKEKYVLLGRSYVICNADFQDMLDKHIKSGADITLMYFDNSDDSTNC
FT                   DYDGVYLKTDEDDKVLDMCYSEGKHRSNKKSMDAYIMKTTLLIDFIETAIAHNKKHFFF
FT                   DVIVPNFDRLVIQGYEYKGYVGCITSLEAYYNVNMDMLKPDVYKELFLGNRRIYTKSAD
FT                   GAPAKYGPNAKVSNSLISSGCEIDGEVENSVIFRGSQIAEGAVIKNSVVMAEGFIAPQA
FT                   EINHTILDRHVKVYSNAHLSGSSNHPVFIPKGASVNE"
FT   CDS             complement(753917..755101)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07850"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37814"
FT                   /db_xref="GOA:D4MYW9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYW9"
FT                   /protein_id="CBL37814.1"
FT                   /translation="MINKKEIVAMLLAGGQGSRLFALTQKKAKPAVSYGGKYKIIDFPL
FT                   SNCTNSGIDTVGVLTQYEPLELNAYIGTGGFWDLDSLNGGAYVLPPYMKGETGNWYRGT
FT                   ADAIYQNINFIDNFDPDHIIVLSGDQICTMDYDKMLQYHKEKGADCTISVLNVTYEEAK
FT                   RFGIMNTDEDERIYEFEEKPAEPKSTKASMGIYIFKWKLIRQYLIDDGNDPESEHDFGK
FT                   NIIPRMLEDGRKMYAYSFDGYWRDVGTIDSLWEANMELLDENPQIDLNDDKMRIYTRNF
FT                   SLPPHYIAPGASVKNSILADGCVIEGEVENCVIHSGVKIGKGSVVKNSVIMKDTVVRTD
FT                   CQIDKALIDEEVVIEQGCKVGEGNNVTVIGYHCVALENATVEDGAMIYPDTILH"
FT   CDS             complement(755123..757351)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07860"
FT                   /product="alpha-1,4-glucan:alpha-1,4-glucan
FT                   6-glycosyltransferase"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37815"
FT                   /db_xref="GOA:D4MYX0"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYX0"
FT                   /protein_id="CBL37815.1"
FT                   /translation="MNETINREDLYLFQTGKARQAYLTFGCHYQKKTKTHRFTVWAPNA
FT                   KSVSVVGDFNFWNPLAHPMKGDKDGIYTIEIEGLKKGDLYKYHVEGYDGICRYKSDPFA
FT                   FYAECRPDTASKVWDFDDFKWSDKRFINQRKKRQALDQPMSIYELHLGTWRMPQEEERE
FT                   FYNYREIADMLIPYLGEMGYTHVELMPITEYPYDLSWGYQVTGYYGVTSRYGTPEDFNY
FT                   MINELHKAGISVILDWVPAHFPRDEHGLAMFDGTHIYDHEDPRKGSQPDWGTLLFNYGK
FT                   PEVQSFLISSAMFFADIYHIDGIRIDAVSAMLYLDFGKQEGEYVPNEDGTNINYEAVDF
FT                   LRNLNEALRTTHEGFLTIAEESTAYPKVTSDVDDPEGLGFVYKWNMGYMHDTLYYMELD
FT                   PLYRKDNHGAIIFSMDYAYSENYILPYSHDEVVHGKGSMINKMYGAYDEKFASLRTLYG
FT                   FTMAHPGKKLLFMGGEFAQFVEWRDKEQLDWFLIDQYEMHDSFHKYVAKLNEIYKSEPA
FT                   LYELDQDPAGFEWCLQRDADHSVVAFIRKNKKGRGRKQQQILCVCNFTPMEWDKYKVPL
FT                   PKKSKLTKILDSSELDFGGDGDVSESKVSTKRVKVPSEGKKAVYQQAAEISLKPLSVVY
FT                   YKIEEVETKSRKSVAKKAEPAKKATAKKAEPAKKAAQEKKTEAVKKTVEKKPEVTKKVT
FT                   KEEAPETKKDTPKKEDIKVTKQTTEKEEEQPKKEQARQEEQKRIMIKV"
FT   CDS             complement(757776..758993)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07870"
FT                   /product="threonine dehydratase, medium form"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37816"
FT                   /db_xref="GOA:D4MYX1"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYX1"
FT                   /protein_id="CBL37816.1"
FT                   /translation="MLELKDFEAAYNKVQEVVLPTKLIKSDYFSDQTGNDVYLKPENMQ
FT                   LTGAYKIRGAYYKISTLSEEEKAKGLITASAGNHAQGVALAAARQGVKATIVMPTTTPL
FT                   LKVNRTKDLGAEVILHGDVYDEACAHALDLAAEHGYTFVHPFDDPTVATGQGTIAMDIF
FT                   KELPTVDYILVPIGGGGLATGVSTLAKLLNPKIKVIGVEPVGAACMKASLEAGKVVSCD
FT                   HVSTIADGTAVQTPGKIIFPYIQENLDDIITVEDEELIPCFLDLLENHKMLAENSGLLT
FT                   IAALKHLDVKNKKVVSIISGGNMDVITIASLVQHGLIMRDRIFTVSVFLPDKPGELNKV
FT                   SDVIADAQGNIIKLEHNQFVSINRNSAVELTITMEAFGTEHKNKIIKSLKKAGYDPKMR
FT                   NSTSVY"
FT   CDS             complement(758995..759930)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07880"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37817"
FT                   /db_xref="GOA:D4MYX2"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYX2"
FT                   /protein_id="CBL37817.1"
FT                   /translation="MSEKKGFFKRLAQGLSKTRDNIASSFDSIFSGFSGIDEDFYEELE
FT                   EILIMSDMGIDTTMNIIEDLKKKVKENKIKEPEECRQLLIDSIKDQMRLEDSAYDFIDK
FT                   KSVVLVIGVNGVGKTTSVGKLAASLKGQGKKVLLAAADTFRAGAIEQLKEWSNRAGVDI
FT                   ISQAEGADPAAVVYDAVAAAKARDVDVLLCDTAGRLHNKKNLMNELSKINRIIQKEYSE
FT                   AYLETLIVLDGTTGQNAMAQAKQFKEATDISGIILTKLDGTAKGGIAIAIQSELGIPVK
FT                   YIGIGEQVDDLQRFDPDMFVNALFEKGEEN"
FT   CDS             complement(759944..763501)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07890"
FT                   /product="condensin subunit Smc"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37818"
FT                   /db_xref="GOA:D4MYX3"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYX3"
FT                   /protein_id="CBL37818.1"
FT                   /translation="MYLKSIEVNGFKSFAHKMIFKFEHGITGIVGPNGSGKSNVADAVR
FT                   WVLGEQRAKQLRGSRMEDVIFSGTELRKPMGSAYVAITLDNSDHSLPIQFEEVTVARRV
FT                   YRSGESEYLINGSACRRKDIVELFFDTGIGKEGYSIIGQGQIEQILSGKPEERRELFDE
FT                   AAGIVKYKKNKLETQKSLEIERENLVRVTDILTELERQVGPLKKQSERAREYQLLRDQL
FT                   KDEDVKLFLLENQNLEKELKELDEKIEIAQREINEANQTLAKAKEKYGKQEEFLDHLKQ
FT                   EIETITAHISEMKLTKQKKEGKIQVLNEQINTEHMRESMYLESKDKLYKDLNEKKAQLK
FT                   RFEAETEEIRKEYESVMEQKIQKESEVALYQKQIQDLEREQEEIEIRVNAVREGRMRVA
FT                   GAIERSQTVKEQLNVRIIGLDHQIEEIKRQINDQEKEKDSSSQKIEEINEKKKRSEIEC
FT                   HNAKRIEETLIAERRQIQAQMDQKREKYHRVRSNYETMRNMAERYDGYGFGIKKVMEQQ
FT                   AVTSGIIGAVADIIKVEEKYETAIETALGGSIQNIVTDTQKTAKKMIEYLKKNRYGRVT
FT                   FLPLDAVKGKEFARKEILLEPGVIGAANQLVIYDEVYKDLFASLLGQILVVKDMDAGIK
FT                   IANKYHHSVRIVTLDGDSLNRGGAMSGGAFKNKSNLLGRSREVEELKKKLDRWTKAITE
FT                   DEEKYHENEKKLKEYQQNMIDLEKEMQEISLELNTQQMSQSAIKRRKEELDNRHEQLSI
FT                   QRQQLEEELRNAEDDADRLQDEQVDLESANEQDEERIKEISEILEHLRKHAEQHAMEVS
FT                   KVHMQLSKESQKLEFQENNQERVRSEIEHLSEEVQENQKDTGSINENVKALKQQIEHLK
FT                   ESCEVIERKIIEDQNRHQKMQEEVKEKEVLYKDILKEREEMLERISGYDKEMYRLESQR
FT                   ENRKGKKKELLDYMWENYEITYHQAKQRIDLDETQSLTKVKETISELKNKIKNLGPVNI
FT                   NAVEDYKEVSERYEFMQKQHEDIVTAEAHLTGLMEELEDAMRRQFNAKFKDIKRVFQEV
FT                   FVELFGGGEARLELTDDDVLESGIRIIAQPPGKKLQNMMQLSGGEKALTAISLLFAIQN
FT                   LKPSPFCLLDEIEAALDDSNVTRFAKYLHKLTKDTQFIVITHRRGTMMAADVLYGITMQ
FT                   EKGISTQVSVNLIENDLDE"
FT   CDS             complement(763520..764206)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07900"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37819"
FT                   /db_xref="GOA:D4MYX4"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYX4"
FT                   /protein_id="CBL37819.1"
FT                   /translation="MDAKSVEEFQEQIGIKFHEPSRLWNAFIHSSYANERRMSKDKNNE
FT                   RLEFLGDAVLELVTSNYLYRTYQKESEGKLSKIRASLVCEPTLAGCARDINLGKYVLLS
FT                   KGEDMTGGRSRDSILSDAFEAVIGAIYLDQGIETATKFIETYLFKDVENKVLFFDAKTN
FT                   LQEIVQGEGKGRLKYVLVGEEGPDHAKIFTVEARLGENVIGTGSGHSKKSAEQHAAFEA
FT                   IKRHKK"
FT   CDS             complement(764214..765221)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07910"
FT                   /product="phosphate:acyl-[acyl carrier protein]
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37820"
FT                   /db_xref="GOA:D4MYX5"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYX5"
FT                   /protein_id="CBL37820.1"
FT                   /translation="MEKLVKVAVDAMGGDHAPGEVVKGAVDAVNEKNNLKVFLVGKAPR
FT                   IHEELSKYQYKNEQIEVVNAEEEISCDESPVEAIRKKKDSSMVVALKMVKDKTADAFVS
FT                   AGSSGAILVGGQFVVGRIKGIKRAPLGAVMPTAKGPMLLVDAGANMDAKAEYLLQFAQM
FT                   GSIYMEDVLGIKNPRVGLVNVGVEEAKGNQLVKETGPLLKECENINYIGSIEAREIPYG
FT                   AADVVVCDAFAGNIVLKLEEGLAAVLVSQIKEGMMSTLKSKIGALLAKPALKKTLKKFD
FT                   ASEYGGAPLLGLNGLVVKAHGSSSAKEMKNAIIQCIAFAEEDITQKIKDQIVKG"
FT   CDS             complement(765317..765502)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07920"
FT                   /product="ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37821"
FT                   /db_xref="GOA:D4MYX6"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYX6"
FT                   /protein_id="CBL37821.1"
FT                   /translation="MSICPKNKSSKGRRNRRRANWKMTAPTLVKCSKCGALMMPHRVCK
FT                   ACGSYNKKEIVSAHAE"
FT   CDS             complement(765508..766017)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07930"
FT                   /product="Predicted metal-binding, possibly nucleic
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37822"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYX7"
FT                   /protein_id="CBL37822.1"
FT                   /translation="MKIQLSKIISVPKYEETVEASIDLNEIKLKGVSYPIREKNDFSIV
FT                   FRNIGKDKISFAFETEVTLGIPCSRCLEEVSYPVSVQVTKELDFSDLDEEDSSYIEDKY
FT                   LDLDILIFDEVVPKLPSRVLCKEDCKGLCPVCGTNLNEKECGCDRTVADPRMAAIQDIF
FT                   KNFKEV"
FT   CDS             complement(766145..767335)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07940"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37823"
FT                   /db_xref="GOA:D4MYX8"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYX8"
FT                   /protein_id="CBL37823.1"
FT                   /translation="MKVLVINCGSSSLKYQLIDSETESVLAKGLCERIGIDGALTHQPA
FT                   GKDKIKSTPAMPDHKTAIGIVIDQLTDKENGVVESLDEIGAVGHRIVHGGEKFTKSCLI
FT                   TDEVIKEVEECSVFAPLHNPAGLIGVRACQELMPGLPMVAVFDTAFHQTMPEKAFLYGI
FT                   PRKYYDEDGIRRYGFHGTSHQFVSLETAKVLGKDIKDLKIIVCHLGNGASVTAVKGGES
FT                   VDTSMGLTPLEGLIMGTRSGDLDPAIIEFIANKENKTASEVLNILNKESGVYGLSGVSS
FT                   DFRDVKAARAEGNKVAAAALDAYAYRVAKYIGAYTAAMNGVDAIAFTAGLGENDDITRK
FT                   AICEYLGYLGTELDDVKNDVHGETAIISTDDSKVTLLCVPTNEELMIARDTVALVK"
FT   CDS             complement(767362..768375)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07950"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37824"
FT                   /db_xref="GOA:D4MYX9"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYX9"
FT                   /protein_id="CBL37824.1"
FT                   /translation="MSVIDEIKNKAKANKKTVVLPETTDMRTLTAAAEVISEGIADIIL
FT                   VGKEDEIKAKAEAEGLDLAKASFVDPENCDHLNTYIESLCEARKSKGLLPEDAKEILLS
FT                   NPLFFGATMVRVGDADGMVAGAINSSANVLRAALQVVKTAPGTEIVSAFMLMDTQAKDM
FT                   GENGCFVFADCGLNQNPNPEQLAAIASSSAKTFEQLIGATPRVAMLSHSTCGSAKHDDV
FT                   TKVVEATNIAKEKYPQYLICGELQLDAAIVPEVAASKAPRSEVAGKANVLVFPDLDAGN
FT                   IGYKLVQRLGGAQAFGPITQGIAKPVNDLSRGCVASDIVGAVAITCVQAAALEADK"
FT   CDS             768649..769860
FT                   /transl_table=11
FT                   /locus_tag="CL2_07960"
FT                   /product="Predicted nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37825"
FT                   /db_xref="GOA:D4MYY0"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYY0"
FT                   /protein_id="CBL37825.1"
FT                   /translation="MKTAAIICEYNPFHNGHEYHIMQTRNITGADCVIAIMSGNYVQRG
FT                   TPAVMDKKIRTKSALLGGADLVIELPLFAACSSAPDFAIGAVSLLHKLGVIDYLSFGSE
FT                   CQDINKLKQIASFLIQYKEEIEHGTKELMSLGHSYPKAKELYLREHLDDASLIEVLKQP
FT                   NNILGIEYLKALLQLDSPIIPVCVTRVSNDHHSKELTPSISSATSIREILEQNQIRPLF
FT                   SRVPEALHDIYQMHYQKDFPVCLDDFSLLLHAAIYSCEDLTQISGISSDFKDRIFKMLK
FT                   SDLSFEELISACKTKNLTWSKISRNLLHIMLDITKEKVEKARTYDMSPYFQILGFKRSA
FT                   SFLIGNIKRKSSIPMVRHLRVMNDPLSKDQEELLSTEQRANQLYRTVIGQKFHTIIKDE
FT                   QIIF"
FT   CDS             769909..770820
FT                   /transl_table=11
FT                   /locus_tag="CL2_07970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37826"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYY1"
FT                   /protein_id="CBL37826.1"
FT                   /translation="MKTSFIQFLLIFSVLSLLFFPQTSVQGAKNGLILWSATITPTLLP
FT                   FLLLTGFMQYYQTFHLISRLFYPLKKLFPGINEDFFYTCILGFFCGCPLGAKIIDDFIS
FT                   CGSFTKSEGEKLLYTCNQISPMFSAGYTLTLILHGKISALRFFFCLYFPVMCYLIYLVF
FT                   LFFTSDFLHTHHSSPTIAHKKSADQVIFDSLHSIFMIGICIMIFSIAVSLLEILPLPFY
FT                   LKRGLTAVLEITNAISHFGSSHMSISRKVILLCMITSFGGLSAAVQTLSVYKKSRLSLW
FT                   KYLLIRSLFSVSSGLLAYLVFI"
FT   CDS             complement(770806..771414)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37827"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYY2"
FT                   /protein_id="CBL37827.1"
FT                   /translation="MSEKYLHEMIDDIEVLIDEAKPARFSPGKIMIEKDVLMTVIEELR
FT                   KQIPGEIERSHKIILNKDAILEDARVKSQQMIDQAARDAGELIDQNEVVEMAKMRANEI
FT                   ETHAKDTARSVVHNANEEADQIRAGALRYVNEIMEDVQGYVASVKEAQESVFNQLLSAL
FT                   DSDLASIKTNAKEIEEQLSGVSIPQARTRTVEDFISDED"
FT   CDS             complement(771428..771907)
FT                   /transl_table=11
FT                   /locus_tag="CL2_07990"
FT                   /product="Phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_07990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37828"
FT                   /db_xref="GOA:D4MYY3"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYY3"
FT                   /protein_id="CBL37828.1"
FT                   /translation="MSIAVYPGSFDPVTYGHIDIIERSAKVFDKLIIAVLVNSAKKPMF
FT                   TTQEKVDMIRKVTSHLDNVEVMSFSGLLVDFAKQQGASVSVRGLRAVTDFEYEIQIAQT
FT                   NARLDKDLDTMFFTTSIEYSYVSSTIVKEIASYHGDVSEMVPPYVQECLEKKFKS"
FT   CDS             complement(771911..772468)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08000"
FT                   /product="RNA methyltransferase, RsmD family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37829"
FT                   /db_xref="GOA:D4MYY4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYY4"
FT                   /protein_id="CBL37829.1"
FT                   /translation="MRVVAGSAKSLKLKTIEGMETRPTQDRIKETLFNMIQYDIPGSTF
FT                   LDLFSGSGGIGIEALSRGAKEAYFVEKAKPALRCIRENLRYTKLDKKAQVLATDVNSAI
FT                   RQLETKNVTFDHIFMDPPYKKGFEEEVLSIIDRSSICTEDTVVIVESSLDTEIPDFEKL
FT                   KVIRVKEYKTNKHTFLMKTVED"
FT   CDS             complement(772697..772918)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08010"
FT                   /product="Small, acid-soluble spore proteins, alpha/beta
FT                   type."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37830"
FT                   /db_xref="GOA:D4MYY5"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYY5"
FT                   /protein_id="CBL37830.1"
FT                   /translation="MEERTSARSKGTNRVEVPEARGALDRFKFEVANEIGVDLKEGYNG
FT                   HLTTAQAGSVGGEMVRKMIRRQEEEMSR"
FT   CDS             complement(773053..773325)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08020"
FT                   /product="Acylphosphatases"
FT                   /EC_number="3.6.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37831"
FT                   /db_xref="GOA:D4MYY6"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYY6"
FT                   /protein_id="CBL37831.1"
FT                   /translation="MVRFYLRFTGRVQGVGFRFFVAMNAERCHLTGWVKNMSDGSVTAE
FT                   VQGTRVEIEKFLNLIQTGNRFIRVDEIEKEERPYEENEKRFHVRY"
FT   CDS             complement(773341..775371)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08030"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37832"
FT                   /db_xref="GOA:D4MYY7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYY7"
FT                   /protein_id="CBL37832.1"
FT                   /translation="MDGTTNIIELKGIGEKSATAFGRLGIRDVDSLITMYPKYYLTYED
FT                   PKDVNEIEIGQRVSIFVRINSEVHIQYAKRMKIVTCTAKDHTGTIMLVWYNMPYLKKQL
FT                   HQGRDYIFTGTPIYKNGRITMEHPEIFTKEDYEAKQETLQPVYPLTSGLTNKLVSKAMA
FT                   QTKDYIFHIPEYLPQNILDQYQPMEYHQAIWNIHFPESKEQLIKAKKRLIFDEFFIFIA
FT                   AMHMITSGEDLKEEGYKIGVCKEAKELVKNLPYELTTAQKRALNEMAKDMASGKVMNRL
FT                   VQGDVGSGKTILAVILLLMCAKAGYQGVLMAPTEVLAAQHYESFTELLESYDIKIALLT
FT                   GSTKAKEKRETYQKIKDGEVDIVIGTHAVIQDKVEYNKLALVITDEQHRFGVRQRESLS
FT                   LKGEKPHVLVMSATPIPRTLAIILYGDLDVSIIDELPAERLPIKNCVVNTSYRPTAYRF
FT                   IEKQVSQGRQVYIICPMVEESETMEGENVIQYAQMLRSQFAPSVRISYLHGKMKAADKQ
FT                   KVMDDFSEGKIDVLVSTTVVEVGVNVPNATVMMVENAERFGLAQLHQLRGRVGRGGYQS
FT                   YCIFMTSSKKKETMQRLEVLNKSNDGFYIANEDLKLRGPGDFFGVRQSGMMDFVLADIY
FT                   TNADIMKQAADAVKQLEESGFDFSNLKNSRLEKQIGLARNI"
FT   CDS             complement(775455..777116)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08040"
FT                   /product="DAK2 domain fusion protein YloV"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37833"
FT                   /db_xref="GOA:D4MYY8"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYY8"
FT                   /protein_id="CBL37833.1"
FT                   /translation="MEAKIKMKQIDAALLQKMLIGGAKRLEANKEYINELNVFPVPDGD
FT                   TGTNMTMTALAAAKEVGNAAEVTVKEVTRGLSSGSLRGARGNSGVILSQLFRGFYKGVK
FT                   DQDVLTTETVAVGFKKAVETAYKAVMKPKEGTILTVAKVTAEKAVYCARNTEDFEEFAQ
FT                   VVIKEANEILQKTPEMLPVLKEAGVVDSGGQGLVEFLQGAVDALMGKEVDLSSVEKTAV
FT                   KPAATASEAPLEEKDIKFGYCTEFIVMTKEEISMEEEQKFKDFLMGIGDSIVVVADEDI
FT                   IKVHVHTNHPGKAIEKGLTYGELTNMKIDNMREEHRERLNLTQAEESKPEEPRKDFGFV
FT                   AVSIGQGMNDIFRELGVDYLIEGGQTMNPSTEDMLNAIEQVNAETVFILPNNKNIILAA
FT                   TQAQSLVEDKNVVIIPTTTVPQGISAIIGFDPEADAEENEDNMKDIIECVKTGEVTYAV
FT                   RDTSINGITIKVDDIMGIDDDGIKKVGQDVEKVTLGLLEEMVDEDSELISIYYGEDTTK
FT                   EQAEALLEKVEETYGDCDVQLEYGGQPIYYFLLSVE"
FT   CDS             complement(777123..777479)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08050"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37834"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYY9"
FT                   /protein_id="CBL37834.1"
FT                   /translation="MKGHVNTKNGEISIENQVIAKYAGICALGCFGIVGMAMVNMKDGI
FT                   AKLLTRDNIRKGVFVSVKNNKITIDFHIIVSYGVSISTVASNLMESVKYRVEEFTSLEV
FT                   ERINIYVEGVKDIG"
FT   CDS             777673..777858
FT                   /transl_table=11
FT                   /locus_tag="CL2_08060"
FT                   /product="LSU ribosomal protein L28P"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37835"
FT                   /db_xref="GOA:D4MYZ0"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYZ0"
FT                   /protein_id="CBL37835.1"
FT                   /translation="MAKCAICGKGAHFGNAVSHSHRRSNKMWKSNIKSVKVKVNGAAKK
FT                   MYVCTSCLRSGKVERA"
FT   gap             778280..778526
FT                   /estimated_length=247
FT   CDS             complement(778609..778980)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08070"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37836"
FT                   /db_xref="InterPro:IPR014229"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYZ1"
FT                   /protein_id="CBL37836.1"
FT                   /translation="MSKENLKDTMGSLFDGMEGFLTSKTVVGEPIYIKDTIILPLVDVS
FT                   FGMGAGAFSGDKKDKSGGGIGGKMTPSAVLVIKDGQTKLVNIKNQETIVKLLDMVPDVI
FT                   DKFTGKNETLEDIVDDLEK"
FT   CDS             complement(778982..779965)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08080"
FT                   /product="Protein of unknown function (DUF2953)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37837"
FT                   /db_xref="InterPro:IPR021338"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYZ2"
FT                   /protein_id="CBL37837.1"
FT                   /translation="MSILFLILKIIGILILIPIVLLLILLIFPICYQIEGDFDGKSLKA
FT                   QVKVSWAVIFLRAKAFYEEELNFGIRIFGIPIYDSRKEHWSVFGEHKEKDRKKHKKRSD
FT                   SKKKQKNKKNNKKRVEKKKSTYPSEDEDVFNLTWDEKEERTKTSTTRKMYERSEDKISE
FT                   SKIDKTTDKEKEFFGKRIVNFLKKCYNRCKNFITKIRKITNKMEMIGDLLEDEDIIDAV
FT                   KRIKRYGVNGVKLLLPQKLNAKIIFGFEDPYYTGKVLGWTAALIPIYGDHINITPDFEK
FT                   RILKGELKIKGRIRRYKILYLLWKVYKDKDELIKQKDRAIRMIGGS"
FT   CDS             complement(780386..781828)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08100"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37838"
FT                   /db_xref="GOA:D4MYZ3"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYZ3"
FT                   /protein_id="CBL37838.1"
FT                   /translation="MLTKKTKIICTMGPATDDDEVLKDLMRSGMDIARLNFSHGDHEEQ
FT                   LGRIKRIKKFREELNLPIAILLDTKGPEIRTGLLETDDDVELVTGQEYTLTTRDIKGNN
FT                   EITSITYAELPQDVEAGNTILIDDGLIELKVKEIKDGTDIVCDVINGGLLGSRKGVNVP
FT                   NVRVNLPSITEKDKADIEFGLENGIDFIAASFIRNAEAVEEIKDIIGAHNMHVGVISKI
FT                   ENMEGVENIDAIIDASAGIMVARGDLGVEVPAEEVPFLQKEIIRKCNDAFKPVVTATQM
FT                   LDSMIRNPRPTRAEATDVANAIYDGTDAIMLSGETAKGKYPVEAVKMMNQIAISTEVHL
FT                   STKIKDYRSKYINRGISAAVAYSAVQTAHNVNAKCILASSMSGFTTRIVSKFKPDAQII
FT                   GLSPDDAIVRQMQIYWGVRPFKSHKAETTKDLLDEATDIVLDAGLAEKDDILVLTGGGP
FT                   ANHRGKGVTNMLKVVKIGEFGE"
FT   CDS             complement(781875..782741)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37839"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYZ4"
FT                   /protein_id="CBL37839.1"
FT                   /translation="MWLNKLEEKFGRYAIPNLPKIIVLLYAVGFVIANISPRLYSLLEL
FT                   NPYLILHGQVWRIVTFLLIGPETNLIFVIFVLLFYYSIGSSLEQVWGTFRFNMYYLIGV
FT                   LGTIVGAFLTYAILTFAYGEGYGAFVNMDTFYLNMTLFLAYASMFPEMEVYLYMILPIK
FT                   VKWLGYLDGLYLIYIFLSSGFTVAGISVKVSIVAALLNFLLFFFSMKKIRRMGANFKAK
FT                   TIHKKKARAYKAKTITPKKNGAMHECAVCHRTELDDPELEFRYCSKCDGNYEYCQDHLF
FT                   THKHVKR"
FT   CDS             complement(782767..783699)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08120"
FT                   /product="Mg2+ and Co2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37840"
FT                   /db_xref="GOA:D4MYZ5"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYZ5"
FT                   /protein_id="CBL37840.1"
FT                   /translation="MIKYYRTMDHQIHEISEPMEGTWISLIHPTAAELAKIATDYKIDI
FT                   DDLRAPLDEEERSHIEVEEGYTLFIVDVPTTEERKEKEYFLTIPCGIILTEKVIITVCL
FT                   EDTAVLADFKNGRVRNFWTFKRTRFILQILYRNASLYLQYLRIIDKKSDSVEKQLHIST
FT                   KNQELIELLELEKSLVYFSTSLRSNELVLEKMLKIDKIKQYPEDEELLDDVIIENKQAI
FT                   EMADIYSNILSGTMDAYASVISNNLNIVMKVLAIITIVMSIPTMIASFWGMNVPVPLAH
FT                   SAHGFLILVIVSLILTIFGGYILGKKNMF"
FT   CDS             complement(783824..784225)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08130"
FT                   /product="LysM domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37841"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYZ6"
FT                   /protein_id="CBL37841.1"
FT                   /translation="METRECCCIFYKKSEGMPRMMQTNSCKGTVYVVKEKDSLYKIAKA
FT                   HGVRVKDIMRQNPFVNVYNLQIGDELCVPGFTNVIEGAFIPYVVKKGETILDIAKMHKT
FT                   TVENLAKSNKKIRELTLPVGTVLLIDKAK"
FT   CDS             784386..788603
FT                   /transl_table=11
FT                   /locus_tag="CL2_08140"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37842"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYZ7"
FT                   /protein_id="CBL37842.1"
FT                   /translation="MKRLGIDIGSTTVKVAVIDEQHNILFSDYQRHFAKIQETLSSLLK
FT                   KAKDQIGEMTFAPTVTGSGGLSISSYLDIPFCQEVVCVSSALQDYAPQTDVAIELGGED
FT                   AKIIYFTNGIDQRMNGVCAGGTGSFIDQMASLLQTDAGGLNEYAKDYDTIYPIAARCGV
FT                   FAKTDIQPLINEGATKPNLAASIFQAVVNQTISGLACGKPIRGNVAFLGGPLHFLTELK
FT                   EAFIRTLNLKDDEIIAPTHSHLFAAVGAALNAKEEVTTDFEHLLKQFEKKIELQQEVDR
FT                   LEPLFKSEQEYKNFVKDHNRHVVKRGDLATYKGNCYLGIDAGSTTTKVALAGEDGELLY
FT                   SYYNNNNGSPLHAVVEALHEIDAQMPKTAKIVSSCSTGYGEHLVKAALNLDFGEVETIA
FT                   HYYAAAFFDPDVDCILDIGGQDMKCIRIKNGVVDDVQLNEACSSGCGSFIETFAKSLNH
FT                   SVQEFAKVALTAQNPIDLGSRCTVFMNSKVKQAQKEGATVGDISAGLAYSVIKNALYKV
FT                   IKLTDPSDLGKHIVVQGGTFYNDAVLRSFERISGCHAVRPDIAGIMGAFGSALIARERY
FT                   EDGMETSMLPLEEIFTMSVDTSMTRCKGCTNHCLLTINKFSNGRRYITGNRCERGIGKE
FT                   PNAENIPNLYDYKLHRTFDYEPLSDEKATRGVIGIPRVLNIYENYPFWYTFFTDLGFKV
FT                   VVSPESSRKIYELGIESIPSESECYPAKLAHGHVMWLIKQGIKDIFYPCIPYERDEMEG
FT                   TNNHYNCPIVTSYAENIKNNMEELATEHINFMNPFLALDNEEALKSRLFEELEAQYHLT
FT                   ADEINHAVDKAYAELSQVRTDIQNKGEEVLAYLAETGRTGIVLCGRPYHIDPEINHGIP
FT                   ELINSYGIAVLTEDSISHLSKVERPLNVQDQWMYHSRLYAAANYAKANKQLEVIQLNSF
FT                   GCGLDAVTTDTVKDILTKSGRIYTVLKIDEVNNLGAARIRIRSLISAVRVRKKHKIEPK
FT                   PVSPAIKRVEFTKEMRKNYTLLVPQMSPIHFEFLEPALQSCGYNVEVLNQGGMEDVNTG
FT                   LKYVNNDACYPSLIVIGQLMNALLSGKYDPHKIALVISQTGGGCRATNYISFIRRALEK
FT                   AGYGYVPVVGLSAQGIEKNSGFSFTPGLLNKAVQAIVYGDVFMRTVYHTRPYEVKPGSV
FT                   NKLHRQWAAKCKRDIAKGNFYTFQKNIRGIIRDFDRIPLKDIKKPRVGIVGEILVKFLP
FT                   DANNHLVELLEREGAEAVVPDLLDFFMYSFYNSNFKYRYLGKSKKSAIVSNSAIWVVER
FT                   YRQTLRKELAKSNRFEPPAYIKDLAEYAKPFVSIGNQTGEGWFLTGEMVELIHSGAPNI
FT                   VCTQPFACLPNHVVGKGVIKEIRQAFPDANIVAIDYDPGASEVNQINRIKLMLSAAEKN
FT                   MNK"
FT   CDS             complement(788722..789129)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08150"
FT                   /product="C_GCAxxG_C_C family probable redox protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37843"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYZ8"
FT                   /protein_id="CBL37843.1"
FT                   /translation="MSIKTDKAAQNHQKGYNCAQAVACAFAEEMGIDESIIFKMMEGHG
FT                   LGMGCMEGTCGAITGAVAVIGAIKSCGDIEKPVSKAATYKLTGELVKRFQEKNLATKCK
FT                   DLKGIETGKVLRSCPGCIEDATAILEEILAE"
FT   CDS             complement(789149..789463)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37844"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/TrEMBL:D4MYZ9"
FT                   /protein_id="CBL37844.1"
FT                   /translation="MERIQEEMVKMSQDERDRYLYLREAMAASDRVSQLQSAENRGVRA
FT                   GKLLNQISMIQKKVKKNKNLEQIADELEESTTKIRPIYDQVKQHPDKTAEEIYNLINNE
FT                   "
FT   CDS             complement(789611..789973)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08170"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37845"
FT                   /db_xref="GOA:D4MZ00"
FT                   /db_xref="InterPro:IPR005357"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ00"
FT                   /protein_id="CBL37845.1"
FT                   /translation="MKTLNEYMSMSYKMEIIEDQDEGGFVISYPDLPGCITCGETIESA
FT                   MQNAKDAKREWIRAALEEGIEIYEPDSLENYSGQFKLRIPRSLHRSLAEHSQREGISMN
FT                   QYCVYLLSKNDVMYSK"
FT   CDS             complement(789957..790214)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08180"
FT                   /product="YcfA-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37846"
FT                   /db_xref="GOA:D4MZ01"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR015146"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ01"
FT                   /protein_id="CBL37846.1"
FT                   /translation="MSKWDKLIARICNLSKDLRFTQLQKVLETYGYRMDAPRSGSSHYT
FT                   FRKQGKSPITIPKHEPIKKVYVEMVRKVVESEERENENAE"
FT   CDS             complement(790407..791168)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08190"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37847"
FT                   /db_xref="GOA:D4MZ02"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ02"
FT                   /protein_id="CBL37847.1"
FT                   /translation="MHTKRIIPCLDVKAGRVVKGVNFVNLIDAGDPVEIAAAYDKAGAD
FT                   ELVFLDITASSDARNIMIDMVRKVAEKVFIPFTVGGGIRTVDDFKAILREGADKISINS
FT                   SAINTPDLINDAADKFGSQCVVVAIDAKRRADGSGWNVYKNGGRIDVGLDAVEWAMEAN
FT                   RRGAGEILLTSMDCDGTKAGYDNELTRIIAENVDIPVIASGGAGNKEHFYDTLTEGKAD
FT                   AALAASLFHFNELKISDLKEYLDQRGISVRR"
FT   CDS             complement(791181..791786)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08200"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37848"
FT                   /db_xref="GOA:D4MZ03"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ03"
FT                   /protein_id="CBL37848.1"
FT                   /translation="MIAIIDYDAGNIKSVEKALNYLGEEAIITRDHDEIVNSDKVILPG
FT                   VGAFADAMEKIRHYGLEETIHEVVEKNIPFLGICLGLQLMFESSDEGPGVKGLGLLPGK
FT                   ILRIPKSGDLKIPHMGWNNIKVKEDSRLFKGLPENPYVYFVHSYYLQADDEDIVAATTE
FT                   YGVKIHAAVEKDNIFACQFHPEKSSTVGLQILKNFVSL"
FT   CDS             complement(791796..792575)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37849"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ04"
FT                   /protein_id="CBL37849.1"
FT                   /translation="MLKDYKEQIQDADLVLVGIGRELRADRVIDFKKVITNEHYQNLID
FT                   KEDEDSKWMRTVYEREYLLSMKETDLFKELEEVLEGKEYFVVTSNDDGLLYHTHLKKDH
FT                   VTAPCGNGDFFQCSAPCDEQLYPANLGLRDLIDYYEKTGKIEHLECPKCRKQLIFNVRT
FT                   EETKSIYIEGAYLNSWASYTKWLQNTLNKKLFILELGEGFEVPSLFRWPFEKMAFYNEK
FT                   ATFVRVHHSLYQIGKEIKEKGIGIKMDSRDFLNIAHE"
FT   CDS             complement(795019..795108)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37850"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ05"
FT                   /protein_id="CBL37850.1"
FT                   /translation="MIIKEVLQEFICETSFFDIFCEEMMIVNS"
FT   CDS             complement(795138..796007)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08250"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37851"
FT                   /db_xref="InterPro:IPR007163"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ06"
FT                   /protein_id="CBL37851.1"
FT                   /translation="MLNFIRGFCMALADSVPGVSGGTVAFLLGFYDKFIMSLDHLMSGT
FT                   KEERIEAIKFLIRIGIGWVVGMGAAVSVLASIFDDRIYEISSLFLGLIIFAIPMICKEE
FT                   KDSLKGKYQNIIWAVIGVVLVAAITYFNPVSGKGISVSVEHLNIALVVYIFAVAMVAIS
FT                   AMVLPGISGSTMLLIFGLYVPVITALKEVMHLHLSYFPVIVIFGLGVLAGITLVIKLIR
FT                   RALENHRSAMIYFVIGMMIGSLYAIVMGPTTLENTKAAMTLHTFHPVFFIIGIVIVFGL
FT                   EKIKAIAE"
FT   CDS             complement(797196..797633)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08270"
FT                   /product="FeS cluster assembly scaffold protein NifU,
FT                   Clostridium type"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37852"
FT                   /db_xref="GOA:D4MZ07"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR017787"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ07"
FT                   /protein_id="CBL37852.1"
FT                   /translation="MYSEKVMDHFQHPRNVGEIENASGVGTVGNAKCGDIMRIYLDIDD
FT                   NGIIQDVKFKTFGCGAAVATSSMATELVKGKNIQQALEVTNKAVMEALDGLPPVKVHCS
FT                   LLAEEAIHAALWDYAEKNGIKIEGLEKPKTDISEGEEEEEY"
FT   CDS             complement(797708..798892)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08280"
FT                   /product="cysteine desulfurase NifS"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37853"
FT                   /db_xref="GOA:D4MZ08"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ08"
FT                   /protein_id="CBL37853.1"
FT                   /translation="MEKKIIYLDHAATTATRPEVVDAMLPYFTENFWNPSSVYTPALNN
FT                   RKVVDESRETIARSLGTTPENIYFTAGGSESDNWALKCTAEAYANKGKHIITSKIEHHA
FT                   ILHTCEYLEKKGFEITYIDVDENGILKLDDLKAAIRPDTILISVMFANNEIGTIQPIKE
FT                   IGAIAKEHGILFHTDAVQAYAQIPINVDEYNIDMLSVSGHKFGGPKGIGFLYIRKGLKL
FT                   RSFIHGGAQERKRRAGTENITGIVGIAKAVEIAFATMDERIKHETEVRDYAIKRILAEV
FT                   PYCRLNGDAQKRVPNNINISFQFIEGESLLIMLDMAGICASSGSACTSGSLDPSHVLLA
FT                   IGLPHEIAHGSLRMTIGEETTKEDMDYVVDNIKEIVTKLRTMSPLYEDFVKKNN"
FT   CDS             complement(798895..799353)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08290"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37854"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ09"
FT                   /protein_id="CBL37854.1"
FT                   /translation="MKLSTKGRYGLRAMVDIAVYSQDSPVPISAIAERQNISVRYLEQL
FT                   LPKLKKAGIIKSIRGAQGGYMLDKDPKDISAGDILRTLEGDLTPIDCAAFTGDTSTCSG
FT                   TKFCVTKTVWQRINDSVQQAVDSITLQELMEESIEIHTKYDQEERQES"
FT   CDS             799488..800804
FT                   /transl_table=11
FT                   /locus_tag="CL2_08300"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37855"
FT                   /db_xref="GOA:D4MZ10"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ10"
FT                   /protein_id="CBL37855.1"
FT                   /translation="MKKASPFICGTVILTLSNFFSRLIGFYNRIFLAGVIGAHQIGIYQ
FT                   LIFPVYLLGFAVCFQGFQIALSKITAEKKAAGNINAARYVLRITIILTLCLCIIFSFFV
FT                   FWYAELICSVFLHEPSCVPCLRLAVLVLPFVGIKNCIHGYCLGIENSGVPAFSLCLEQI
FT                   SRVSSIFLLSVFMIEKMPVPAFLAVCGMTVGEIVSFFFTLIFYFLHKKSADSLSKSTLS
FT                   ASKLSVFHELLSLGIPLTLNSFSVTLLQSVQSILIPMMLYRFYGNRYRSVEIYGILSGM
FT                   ALPFIMFPSTITNALSLMLLPKISAAKTHNDPSYLRRCAILPLIFCTFLGIGAFGGFFV
FT                   FGPWIGNFFFHDPLCGKYLRSLSFLCPFLYCSSILSTILNGLGKTKDTLLHNSVSLVIQ
FT                   ICFILFAIPLYGVNGYLWGLFLSCLFLCFVNYRKVMLHV"
FT   CDS             complement(800820..802496)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08310"
FT                   /product="Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37856"
FT                   /db_xref="GOA:D4MZ11"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017310"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ11"
FT                   /protein_id="CBL37856.1"
FT                   /translation="MLCENAAQSNDYFEFIGEYSGVLDYVKEEFNTECITVIDQRFAIA
FT                   YVKKNGRTSIYGQNYPYNTIPRCFGLMDTQMLEDVGVAQVRRSVLDLYGNGVLVGMIDT
FT                   GIDYEHPAFRYEDGSSKIYSLWDQTIEGDSEDTFLGYGTEYTKEQIEEALKSDVPQQKV
FT                   PSKDESGHGTFLAGLIAGNEDNETGFSGIAPNAGLIVVKLRKAKDYLKEYYCIDPKYEA
FT                   YAETDIMLAVHYIDHIAEQLQRPIVIFLGIGTNLASHLGTGPLDQYLSGRAMLRGVAVV
FT                   TSAGNEGQARHHYSGQVSQNDAKVEVKVGESEYGFTMELWGLAPNRYYVDIESPSGQKT
FT                   GRIQGGLSGQRYVTFLLEKTRLIVEYFTVDTSAGAPVIVMRFQNPAPGIWNIYVSDDGV
FT                   GNREFDLWLPITNFISEDTFFLESTPYNTLVAPSNTGLLISCGSYNSNTGSLAIDSSRG
FT                   FPRNAVKPDFTAPGVEILGPLPRKRYGRKSGTSVSGAITAGIAALMLEWGIMQKNDMQI
FT                   NTTRIKNYLIRGARRDPERIYPNREWGYGQVDLYETFLGIR"
FT   CDS             complement(802581..804536)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08320"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37857"
FT                   /db_xref="GOA:D4MZ12"
FT                   /db_xref="InterPro:IPR009164"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ12"
FT                   /protein_id="CBL37857.1"
FT                   /translation="MDQMKYLKELAVRYPNVAAASTEIINLQAILHLPKGTEHYVSDVH
FT                   GEYEKFSHIIRNGSGAIRSRIEDEFGNTLTTKQKKNLASVIYYPEQKMDLMEEELPKNF
FT                   LLEWQHDTMVRLVHVARSVGNKYTRSKVRKAMSPEFAYVMEELMVEHRRADKKRYVEQI
FT                   LETIIMTGRVRQFIAAMAHLIQDLTIDHLHVIGDIYDRGSGPHRIMDCIMKTANVDIQW
FT                   GNHDILWMGAASGHRACICNVVRICARYNNLDVLENGYGINLIPLARFALECYKDDECE
FT                   LFHASGEVDESNIREEELNKKMHKAIAIMQFKVEGQLIKRRPDFLMDQRLLLDKIDYEK
FT                   GTITLDGKEYELKDKNFPTIDPNDPYKLTKEEEYVMEHLVTVFKYCAYLQEHIRFLFAK
FT                   GHLYKVFNGMLLYHGCVPLNEDGTFREVEIEGRKYAGKELYDVLEHLARQGYYEEKDMK
FT                   SRKYGQDIMWFIWSNENSPVYGKAKMATFERYFLDDADLKKEKKDYYYQWYENEAVINQ
FT                   ILEEFGLDTSTGKIVNGHMPVAVKKGESPIKCGGKLFVIDGGFSKAYQKTTGIAGYTLV
FT                   SNSYGLKLVAHEPFVSRTIAIREETDIHSDTIVINKVTKRKCVMDTDNGKALQEKVADL
FT                   EQLLWAYQKGLITERI"
FT   CDS             804763..805821
FT                   /transl_table=11
FT                   /locus_tag="CL2_08330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37858"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ13"
FT                   /protein_id="CBL37858.1"
FT                   /translation="MLKKNKSIALVMILALLIITSSCAPKNTQAEIDKPAKTSASWERK
FT                   LCRSKLDIISSYGDDQAFHPKVLNFEKPWNGYRYWMAYTPYPGADQRKENPHVCVSNDR
FT                   IHWKPFEGEGKAVSLDPLTPFEDPDKQYNSDTHLVYRKDIDTLECYWRQVDNRTRIDKI
FT                   MKRTTTDGIHWSKAQNVLVSDARTDRILSPAIIYENGRYKMWTVNCKRKFPVLYRESKD
FT                   GFHWTTPSTIQLKYPSDRLRSWHLDVIHTEKGYEMLVVAFYKGHRHREMNLYYTSSKNE
FT                   HDFKKCITILKPSEKEKAWDNRGIYRSSFFVENGIYYIYYSGIGYPKGPNSSQGVGLTY
FT                   GPSVKNIHGYDA"
FT   CDS             805940..806965
FT                   /transl_table=11
FT                   /locus_tag="CL2_08340"
FT                   /product="branched-chain amino acid aminotransferase, group
FT                   II"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37859"
FT                   /db_xref="GOA:D4MZ14"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ14"
FT                   /protein_id="CBL37859.1"
FT                   /translation="MEKKNIDWANIGFGYMPTDYRFVANYKDGAWDEGELTTDANITIS
FT                   ECAGVLQYAQTCFEGMKAYTTEDGHIVVFRPDLNASRMADSCRRLEMPVFPEDKFVEAI
FT                   EKVVAANEAFVPPFGSGATLYIRPYMFGSDPVIGVKPANEYQFRIFTTPVGPYFKEGAK
FT                   PITIRVSDYDRAAPRGTGNIKAGLNYAMSLYPIMEAHRQGFDENMYLDPATRTKVEETG
FT                   GANFIFITKDGKVVTPKSDSILPSITRRSLVYVAKEYLGLEVEEREVLFDEVKDFAECG
FT                   LCGTAAVISPVGKIYDHGNEICFPSGMEKMGPVIQKLYDTLTGIQMGHIEAPEGWIKVI
FT                   K"
FT   CDS             complement(807071..808456)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08350"
FT                   /product="endopeptidase Clp ATP-binding regulatory subunit
FT                   (clpX)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37860"
FT                   /db_xref="GOA:D4MZ15"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ15"
FT                   /protein_id="CBL37860.1"
FT                   /translation="MSEEKNQNEIEEVTNEDEHKDVEHYCYLCRRPESAAGKMLELPNN
FT                   IFICTDCMQRTLNSMGNGQFGFIDARNMDLDSMDITKMMNDMQSMQPKAEVKKKKKDKK
FT                   EEPEFTLKDIPAPHQIKAMLDEYVIGQDYAKKVMSVAVYNHYKRVVTNTMDEIEIDKSN
FT                   MLMIGPTGSGKTYLVKTLARLLKVPLAITDATSLTEAGYIGDDVESVLSKLLQAADNDV
FT                   DRAEHGIVFIDEIDKIAKKQNTNSRDVSGESVQQGLLKLLEGAEVEVPVGATSKNAMVP
FT                   LTTINTRNILFICGGAFPNLEGIIKKRLMKKTSIGFGADLKDRFDEEENIIAQVTNEDL
FT                   REYGFIPEFIGRLPMIFTLEGLTKEMLVKILKEPKNAILKQYQKLLELDEVKLEFDEGA
FT                   LEAIAEQALKKKTGARALRAIIEKFMLDIMYEIPKDDTIGSVTITRDYIENHGNPEIHL
FT                   RDQ"
FT   CDS             complement(808475..809866)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08360"
FT                   /product="Transcriptional regulators containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37861"
FT                   /db_xref="GOA:D4MZ16"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ16"
FT                   /protein_id="CBL37861.1"
FT                   /translation="MLIVALDTSKKEPLYEQIYNSIKEEIITGVLPFGARLPSARRLSK
FT                   HLDVSRNTVDTAYAQLCAEGYIESKPKRGFFVCQVEELAELHIPVKIEEEEEEIRPEKI
FT                   PYDFSSAGVDMEQFPYHIWRKLLKEIMINDNSELFQKGNFQGDLELRKAIMYYLRQSRG
FT                   VHVHASQIVVAAGMENLLFLLRQILGEKVSIGIENPVYKNAYEILKELDFKIHPISMDE
FT                   SGMCVEQLQKTDANLAYVTPAHQYPTGVIMPIGRRSQLLGWAKKDPDHYIIEDDYDSEF
FT                   RYHGKPIPAMQGLDDGENVIYMGTFSKAIAPAIRASYMVLPKKLAKRYQQIGQTFSCAV
FT                   SRIDQKVLTLFLTEGHFERHLNRMRNIYKEKHDLLIKEIKKLNSDIQIYGHGAGAHIIV
FT                   RFPVSDQKEFQKKLRQKGVMIYPLSWYYIEGKPLKEEYILGFTRMKKEDMIRGIEIIGE
FT                   VLYSK"
FT   CDS             complement(809890..810660)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08370"
FT                   /product="Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37862"
FT                   /db_xref="GOA:D4MZ17"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ17"
FT                   /protein_id="CBL37862.1"
FT                   /translation="MRKIIAAACLMAAMTLCVGCSSAKDSNKDTTKATTETKMKVQSKY
FT                   KVPKITAAKKTDQLADAQKGETIVTMKVKGYGEMQFKFFMKKAPLAVKNFVTLASNGYF
FT                   DGQIFHRVINDFMIQSGDPTGTGTGGESIWGEDFDNEVCEELLPLRGSLCMANSGADTN
FT                   GSQFFIVQAKADTAKKGLEEGNVELTKKQQALFLDQGGYPSLTGSYTVFGQMINGYDVL
FT                   DKISGCKTQDNGSGEVSQPVKKVVIEKMTVSNAE"
FT   CDS             complement(810702..811691)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08380"
FT                   /product="Predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37863"
FT                   /db_xref="GOA:D4MZ18"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ18"
FT                   /protein_id="CBL37863.1"
FT                   /translation="MIRLATIGTNFITDWLMEGILELDEIQLTAVYSRNLEKGKQFAAK
FT                   YNVEKVYDNYEEMAKDPEIDAVYVASPTYMHYTHSITMINYGKHVLCEKPVCSNREELD
FT                   ILIKAAKEQGVVFMEAMKNVHSPGFHAMMDNLHKIGTVRRATIQYCQYSSRYDKFKKGI
FT                   IENAFNPKLSNGALMDIGSYCIHFLASLFGKPEKILADSLFLENGVDGAGSVIASYGDK
FT                   QAEIIYSKITDSKLPTQIQGENGCMIIEQCPIIKKITIYYRNGETEELQFDKRDNPMIY
FT                   ETKDFIRLIKEHKVDHQFLRSSEIEMDITDEVRRQTGIVFPADKIREQ"
FT   CDS             complement(811756..812757)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08390"
FT                   /product="K+-dependent Na+/Ca+ exchanger related-protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37864"
FT                   /db_xref="GOA:D4MZ19"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ19"
FT                   /protein_id="CBL37864.1"
FT                   /translation="MEKFINQSPLFLVIICLIIGFAFLMKGADYFVEGSSSVAKRLKVP
FT                   SIIIGLTIVAMGTSLPETAVSVTASIANNNALAISNVVGSNIFNMMFVIGVCSILATIG
FT                   VKRETIIRDIPLSLVCATLLLIFGYLAFGDRSHMILGRFDGIIFLIIFAVYVLMMVFQA
FT                   MRARNNQEVVQLETMENEELMIMSYPKSLLCIVGGAAAIAFGGDLTVDAASRIAIDFGM
FT                   SQNLVGLTIVSIGTSLPELVTSIVAARKNEVDMAVGNAIGSNIFNILMVLGIASAISPL
FT                   QLIGENVIDIIVLVVFSVVVWIFGATKKKISRTEGIAMICMYLCYSVYIIMR"
FT   CDS             814770..815144
FT                   /transl_table=11
FT                   /locus_tag="CL2_08410"
FT                   /product="FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37865"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ20"
FT                   /protein_id="CBL37865.1"
FT                   /translation="MDMDNLKTINDIYGHKAGDRVLKLLGNLLLEYSSECLVCRLGGDE
FT                   FLLFMPNADQNSITEVITAIFKKFNTRKEQDPELHAASISAGLYMCNIGDSFDECYTKA
FT                   DKTLYFVKQNGKSDFSFHEK"
FT   CDS             complement(815201..816598)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08420"
FT                   /product="Mg2+ transporter (mgtE)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37866"
FT                   /db_xref="GOA:D4MZ21"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ21"
FT                   /protein_id="CBL37866.1"
FT                   /translation="MKNARNQHRTDYAKELVKIVQTTKDREELKKKIAAYHERDIANAI
FT                   VESDKTVRKCIYDILDIAEIAEIFSYIEEEPGKYLEEMPIERAAKVVSNMDSDDAMDLF
FT                   EELNEEDKYKLLKRLDKEAKEDVQKLLSYEEDQIGSCMTNNYIVVRNDVTIREAMSTLV
FT                   KQAGEHDNIQTLYVIDENGIFAGAIDLKDLIIAREHDNLQDIISSSYPYVYEHEKISEC
FT                   MEILTDYEEDSIPVLTQDKKIAGILTSSDIVELVDDEMGDDYAKLAGLTEEEDLNEPTI
FT                   VSMKKRLPWLIALLFLGMAVSSVVGMFESIVAVLPIVICFQSLVLDMAGNVGTQSLAVT
FT                   IRVLMDENLSGKKKIALLFKEMKIGFLNGASLAIMALVFLGVYIHLFKHYAWISSFLIS
FT                   GCVGISLIVAMVISSLVGTIIPMFFHKINIDPAVASGPLITTINDLVAVITYYGLSGLV
FT                   LIQLFHI"
FT   CDS             complement(816765..816860)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37867"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ22"
FT                   /protein_id="CBL37867.1"
FT                   /translation="MDSCDRIGRSCMRGQKRKYKIRMLLSVKIHE"
FT   CDS             817747..818208
FT                   /transl_table=11
FT                   /locus_tag="CL2_08450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37868"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ23"
FT                   /protein_id="CBL37868.1"
FT                   /translation="MVYEDICNFGMDQLVITQYKKILKILQENSNILILKIPIEKVKSK
FT                   EEKEREELQTKNCLIFKKLEKFFLESRLCRKNGTIIKREKGKKGYYMTDNWYLYKYNKD
FT                   VRKVLQEYPNIYAFADWIDLCFVSENKIILQTIAHEGMCFGSAELFRDI"
FT   gap             818569..819146
FT                   /estimated_length=578
FT   CDS             819229..819558
FT                   /transl_table=11
FT                   /locus_tag="CL2_08460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37869"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ24"
FT                   /protein_id="CBL37869.1"
FT                   /translation="MTEDTYRGDTTKSETGHLYVYCANNPVNYVDPSGHFLVSTAVLVG
FT                   VGVGGIVGAVAGSYKGRLVAKRLGYKGKKRNLFIATYGIKGAVVGAIIGAFAGYGIGCY
FT                   GSIIK"
FT   CDS             819524..819871
FT                   /transl_table=11
FT                   /locus_tag="CL2_08470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37870"
FT                   /db_xref="InterPro:IPR029109"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ25"
FT                   /protein_id="CBL37870.1"
FT                   /translation="MVSVAMGASSSSGLAVKGVNSAIRRVASDQNKVRHIMQSKHAWTK
FT                   VTKKNQWKYVKPIVKKAMKSGKMEAIGKTKGKEIVYKFVYNYKGKIIEGTCIAKKGVVK
FT                   LSDAWVKTIGL"
FT   CDS             819843..820163
FT                   /transl_table=11
FT                   /locus_tag="CL2_08480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37871"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ26"
FT                   /protein_id="CBL37871.1"
FT                   /translation="MHGLKQLVYDNQPFFSSNQTGKTNRELYILWKQNKRDDIFLLLYT
FT                   QLWMVLEEVYMENVIDYYKKDCYEKKLFFELVEYQKRFFKKISKYNYLQVIFMRPRNIY
FT                   FS"
FT   CDS             820417..820971
FT                   /transl_table=11
FT                   /locus_tag="CL2_08490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37872"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ27"
FT                   /protein_id="CBL37872.1"
FT                   /translation="MIVCNIQLQNKKDSFIKKSYSIPVGIFPGNKATIDDKGNIYVATG
FT                   MLGVVQKFNKNGDFIKSILIKDDIDMIKNERDGIHVYAGKFDYTDYHITEKKIIEKEIS
FT                   ETDLDHIKSGPNELVIGNFWIFKGKITILKSSLFPIDPFIIMYTAILMEIIFWIKAKIS
FT                   RFRENKSSKSVVITGGDEIGS"
FT   CDS             822323..823204
FT                   /transl_table=11
FT                   /locus_tag="CL2_08520"
FT                   /product="Aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37873"
FT                   /db_xref="GOA:D4MZ28"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ28"
FT                   /protein_id="CBL37873.1"
FT                   /translation="MLSRMEHDSIGALNVPAEAYYGVQSMRAATNFQITHRPLHPVLID
FT                   SIVMVKKAAAITNEKSGKLDQQIAQAIIKACDEILDGNLRDQFIVDAIQGGAGTSANMN
FT                   ANEVIANRAIEIFGGTKGDYSIVHPNDHVNMSQSTNDVIPTAGKITVLKLLPQTIKELE
FT                   KLEKAMEEKEAEFDDILKMGRTQLQDAVPMRLGQSFGAFAHVLKRDIKRLKNVMDEMKV
FT                   LNIGATAIGTAINVDPYYLANISYELSKVAGISLKQADDSSKTEWFIHHVRKDQPSDSK
FT                   SCITGCIPDHWT"
FT   CDS             823603..824007
FT                   /transl_table=11
FT                   /locus_tag="CL2_08540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37874"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ29"
FT                   /protein_id="CBL37874.1"
FT                   /translation="MIIILCLDNNNGMMFNDRRQSQDRGLREYIAEMTKGEKVYMNAYT
FT                   EKLYEEINDPVVCEDFLHKAGKGETCIVENLPLKPVIDQIEEIVIFRWNKVYPSDQVLD
FT                   VDLEEWKLAEEEQIEGSTHEITKQIYLPKQ"
FT   CDS             824048..825076
FT                   /transl_table=11
FT                   /locus_tag="CL2_08550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37875"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ30"
FT                   /protein_id="CBL37875.1"
FT                   /translation="MMRVTKKLYALLIAGMMVVSLAGCQSTGNSSNSGNAQSEQSSKGS
FT                   TNSSTKSVSSDNIPDFSGNMTVAVDNNNPDFTSKDLTTKSYESYSRLDSEGRCQVAEAC
FT                   VGKDIMPKGKRGAIGMVKPTGWHTAKYDNVDGKYLYNRCHLIAYQLTGENANNKNLITG
FT                   TRSFNVDGMLPYEEMVGDYVRETGNHVLYRVTPVFDGDDLVAKGVQMEAMSVEDKGEDI
FT                   KFNVFVYNVQDGVKIDYESGDSEADSSVQVTTENSKASQKYHTNQNSSNNSKNYSSNKN
FT                   TTAAKTNTKTTASQKIRGNSRSKVYHCPGQRDYDRMGTSKYLVTFKSEKEAKAAGYHKA
FT                   QR"
FT   CDS             825121..826329
FT                   /transl_table=11
FT                   /locus_tag="CL2_08560"
FT                   /product="iron-only hydrogenase maturation protein HydF"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37876"
FT                   /db_xref="GOA:D4MZ31"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ31"
FT                   /protein_id="CBL37876.1"
FT                   /translation="MSLNATPRGDRIHIALFGKRNAGKSSVINAMTNQELAIVSNVKGT
FT                   TTDPVYKAMELLPLGPVVMIDTPGLDDEGELGEKRVKKAKEVLAKADIALVIMDATAGM
FT                   TEFEEDMIRLIEDRKIPYLKVYNKMDLANAQEWKEDKACFVSAKDKKGIWELKEEIGKL
FT                   VPTDDDTLKIVGDLVCPNDFVILVVPIDSAAPKGRLILPQQQTIRDLLEAGAASIVVRE
FT                   TELEKTLEEIGKKPALVITDSQAFGEVSKIVPEDVKLTSFSILFARYKGDLEEEVRGVK
FT                   ALEHLEEGAKILIAEGCTHHRQCDDIGTVKIPRWLKQYTGKDFDIHTSSGNSFPEDLDT
FT                   YDLVIHCGGCTLNRREMKNRIARVKDAGVPIVNYGIFIAATQGILKRTLEPFEEASRIL
FT                   NEI"
FT   CDS             826449..827909
FT                   /transl_table=11
FT                   /locus_tag="CL2_08570"
FT                   /product="glutamyl-tRNA synthetase, bacterial family"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37877"
FT                   /db_xref="GOA:D4MZ32"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ32"
FT                   /protein_id="CBL37877.1"
FT                   /translation="MSKVRTRFAPSPTGRMHVGNLRTALYAYLIARHAGGDFILRIEDT
FT                   DQERQVEGAEEIIYNTLKKAGMNHDEGPDIDGGVGPYVQSERQAQGLYLKYAKELIDKG
FT                   EAYYCFCDQERLDTLKVKSGDVVISHYDKHCLNLSKEEVQAKLDAGVPYVIRQNNPTEG
FT                   TTSFVDEIYGEITVDNIELDDMILIKSDGYPTYNFANVVDDHLMGITHVVRGNEYLSST
FT                   PKYNRLYDAFGWEKPVYIHCPLITDEEHHKLSKRKGHSSFEDLIEQGFLPETIVNFVAL
FT                   LGWSPGGEQEIFSLKELEEIFDYKHMSKTPAVFDMNKIKWMNGEYIKAMDFDRFKELAM
FT                   PYVTETIHREMDFDKILSMVKTRIELFTEIPGHIDFFEAVPEYDVEMYKHKKMKTTPET
FT                   SLTVLKEIYPVIEAQEDFTNDALYEMLVSFAKGHEYKNGYVMWPVRTAVSGKQMTPGGA
FT                   TELMELLGKEESLKRINDAIAKLEAALA"
FT   CDS             829754..830287
FT                   /transl_table=11
FT                   /locus_tag="CL2_08590"
FT                   /product="Protein of unknown function (DUF1653)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37878"
FT                   /db_xref="InterPro:IPR023387"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ33"
FT                   /protein_id="CBL37878.1"
FT                   /translation="MENRAMPRAGEFYMHFKGKLYQIVTVAIHTETEEPLVVYQAMYGT
FT                   FKTYARPLAMFLSEVDHEKYPDVQQIYRFRKVELCENSEAELVDEVTAQENECDETEET
FT                   ADIEPLLKFLDETDLHERLNILLQYRDQITETMLESMGMAMDCVLNGKTLEEKYYELDK
FT                   VIRTKLQYEKKPRI"
FT   CDS             complement(830317..830634)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08600"
FT                   /product="Protein of unknown function (DUF1292)."
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37879"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ34"
FT                   /protein_id="CBL37879.1"
FT                   /translation="MSEFNEVDNIIEEETPVLHLELEDGTEQDCAVIALFSVEELDDQE
FT                   YIALITVEDLESDDEEGALLLYRYNEDPEDPDTFSLDNIETDEEYETVTAVLDEILEDE
FT                   E"
FT   CDS             830779..831945
FT                   /transl_table=11
FT                   /locus_tag="CL2_08610"
FT                   /product="sodium/proton-potassium antiporter GerN, CPA2
FT                   family (TC 2.A.37.2.2)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37880"
FT                   /db_xref="GOA:D4MZ35"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ35"
FT                   /protein_id="CBL37880.1"
FT                   /translation="MEEYKFLLDIAIILAMTKSFSLVSKKFNMPPVVGALIAGIILGPV
FT                   VLNVVSPSDSVLNLAEVGVVVLMFQAGLETDIDELKKSGIPAFVIALCGVLIPLIMGAV
FT                   LSVIYGNNIMESIFIGVILTATSVSITVEALQDMGHLKGRVGTAILGAAIIDDILGIVL
FT                   LSIMTSLGGASGFHIQAILKILIQMAAFFAISIIGGVGIKKFFEWLSTYKNPEIERHRR
FT                   RVPVFALAFCLALAFLAEVFGIADITGAYLAGIILCRLPERFYIYNKIEVLSYMLITPV
FT                   FFASIGLNVNIHGMTQTLIIFTIILCVIAVISKIAGCGFGALLCKYTKRESVQIGAGMV
FT                   CRGEVALIVAQKGISVGLLSEIFFAPVVIMVLVTTLLSPIILKMLFAK"
FT   CDS             832009..832947
FT                   /transl_table=11
FT                   /locus_tag="CL2_08620"
FT                   /product="Predicted deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37881"
FT                   /db_xref="GOA:D4MZ36"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ36"
FT                   /protein_id="CBL37881.1"
FT                   /translation="MIDTVVSVKLPIGEMLRIKRNRLMPDVVTGEEKRICLVSGIYGDE
FT                   LGGQYICGEIIRRIKAEFENLTGIVDVYPAVNPLGLDARTRAVPISDIDYSSAFPGDIN
FT                   GGLEDYTAAKLIEDIKGASCCIDIHSSNIFLQEVPQVRLNNDYDETLLHLSKYMNTDLV
FT                   WIHPSQTVNEGSLAFTLNQMGIPTMVTESGAAFRIRYEYCRQIIDGIFSVMAELGIWKG
FT                   KVQGKTKVPFIHEDQIFYLNCESSGLFVSYKRLKDPVKKGEIIGIVQNPLMGATEEEVV
FT                   APTDGILMTLREHPSVTEGSLVARVIGGNAL"
FT   CDS             832944..833891
FT                   /transl_table=11
FT                   /locus_tag="CL2_08630"
FT                   /product="Predicted deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37882"
FT                   /db_xref="GOA:D4MZ37"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ37"
FT                   /protein_id="CBL37882.1"
FT                   /translation="MKKEIIYSSGNYLRDEFKIEGYLFGKQSEGSEPAACIVGAMRGNE
FT                   YQQLYICSQLVKRLKELENSGAIVGDNQILVIPCVNNFSMNVGMKYWVSDNSDINRQFP
FT                   GNFDGEPTSRLAAHLFERVKGFRYGIHFASFFRSGDFVPHVRMPATGKESTSLASLFGL
FT                   PYVLTSKQRNFDKKTLTYNWQINGTDAFSVYSGETDNIDVNLARKAVSAVLRFLTRMGI
FT                   LKYNCHNGYIASIIEEEDLVSVKASAPGFLRRFVTINEEVNRGQLLGEVINPYNGEILS
FT                   EIRSTADGIIFYAEDQPTILENASAFQVIKKLHE"
FT   CDS             833884..837660
FT                   /transl_table=11
FT                   /locus_tag="CL2_08640"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37883"
FT                   /db_xref="GOA:D4MZ38"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ38"
FT                   /protein_id="CBL37883.1"
FT                   /translation="MNKWEEIMGEVRRVYVEKKKDYAVKAKELHASLKQYLGLDVESVR
FT                   VLVRYDIENLSDASYEKALVTVFSEPPVDDVYEETLPLADGEISFSVEFLPGQFDQRAD
FT                   SAQQCVKLLNEDEDALIRSATTYVVKGDLTDEQLEAVKEYCINPVDSREAAADKPETLV
FT                   MDFEEPADVKILDGFKDMEEDKFKELYDSLNLAMTFKDFLHIQNYYKGEEKRDPSMTEI
FT                   RVLDTYWSDHCRHTTFSTELTSIGFQDGFYRAPLEEAYYSYMDDFEEMYKDRDDKYVCL
FT                   MDMALMAMKRLKKDGILDNMEESDEINACSIVVPVEIDGKEEEWLISFKNETHNHPTEI
FT                   EPFGGAATCLGGAIRDPLSGRSYVYQAMRVTGAADPTVPLKDTLKGKLPQYKIVNEAAN
FT                   GYSSYGNQIGLATGYVNEVYHPDYVAKRMEIGAVMGAAPRKNVIRENSDPGDIIILLGG
FT                   RTGRDGCGGATGSSKVHTEESIETCGAEVQKGNPPTERKIQRLFRREEVSRLIKKCNDF
FT                   GAGGVSVAIGELADGLVVDLDKVPKKYAGLDGTELAISESQERMAVVVDPKDVDQFLAY
FT                   SAEENLEAVEVAVVTEDPRLVLKWRGKEIVNISRAFLDTNGAHQETEVFVEIPHRVESY
FT                   FNRKDETGTFEEVCKNTLSDLNVCSQKGLVERFDSSIGAATVTMPYGGKYQMTPIQTMV
FT                   AKLPVLKGECDTVTMMSYGFDPYLSKWSPFHGAVYAITESIAKIVASGGDYRNIRLTFQ
FT                   EYFKRLGEDKTRWGQPVAALLGAYQAQMGFGLASIGGKDSMSGTFNDIDVPPTLVSFAV
FT                   DVAKTTDVITPELKRAGNRLIRICIPTDAYNLPIYSEVKKVYQCITKLIKDGIIKSAYA
FT                   IGGGGALEAVAKMAFGNKLGVIFDEEVELKDLTDPKFGSFVVEMSTRDVHKLAIPGLML
FT                   GEVTDKHEFVFGDEVVTLEEAIDTWKKPLEKVFPTRSEGDQSIVDTTRHYTKGNIYVCK
FT                   NKVAKPNVFIPVFPGTNCEYDSAKAFERAGANVITKVFKNLDAQGIRDSVEVFEKAIKE
FT                   SQIIMFPGGFSAGDEPDGSAKFFATAFRNEKLKEAVMDLLNNRDGLALGICNGFQALIK
FT                   LGLVPEGKIVEQNAKSPTLTTNRIGRHISKVAYTRIASNLSPWFNNVHVDDIFSIPVSH
FT                   GEGRFVADEDVIQKLFENGQVATQYVDLNGDPTMNEEFNPNGSYHAIEGITSPDGRVLG
FT                   KMGHSERRDSYVGINIYGQKDQKIFESGVEYFK"
FT   gap             837667..838467
FT                   /estimated_length=801
FT   CDS             complement(838473..839723)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08650"
FT                   /product="Hemolysins and related proteins containing CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37884"
FT                   /db_xref="GOA:D4MZ39"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ39"
FT                   /protein_id="CBL37884.1"
FT                   /translation="MILQIIAIIILLLLSAYFSSAETALTTVNPHSMRAMAEDGNKKAA
FT                   IVLKLIENPSQMLSSVLVGNNLVNISLTSLTTTIAIRIFGSMGAGIATAVITVLVLIFG
FT                   EITPKTFATINNTKLALSYASSIYLITKLLTPVVYIINKLSTAILIILRIDSKQSKRIM
FT                   TERELRTIVDVSHEEGVIEESEKDMLNNVFDFKESLAKDIMIPRIDVTFVSVDASYDEV
FT                   LDIFREAGYSRLPVYEGSKDHVVGIVYFKDVYFYRSQHRGEIFHLKDVLRKPFFTYETQ
FT                   KVSSLLAQMREKSVSFSIVLDEYGVTAGLITLEDIVEEIFGELRDEYDDSEEETFKKLS
FT                   DGSYMVSASLKLDDLDDLLDVDLDSEDYDSLGGYIIELLDHLPSEGETAEDEHFLFKVV
FT                   SVDKNRMETIHIIPKEQ"
FT   CDS             839874..840353
FT                   /transl_table=11
FT                   /locus_tag="CL2_08660"
FT                   /product="O-6-methylguanine DNA methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37885"
FT                   /db_xref="GOA:D4MZ40"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ40"
FT                   /protein_id="CBL37885.1"
FT                   /translation="MRYYYDYSFPIGNLTIEEDGHGICGIYFGTKILEGEKKNTELIRE
FT                   AALQLSQYFDGRRKKFDLKLSYHGTEFQIKVWKALEKIPYGETYTYKDIAESVGIPKGC
FT                   RAVGMANNRNPIVIVVPCHRVIGMNGSLTGYAGGLEMKEYLLDLEKRNQKLKERY"
FT   CDS             840634..841194
FT                   /transl_table=11
FT                   /locus_tag="CL2_08670"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37886"
FT                   /db_xref="GOA:D4MZ41"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ41"
FT                   /protein_id="CBL37886.1"
FT                   /translation="MDLLTLLTLAVGLAMDAFAVSICKGLAMREKVLKKGIIVGLWFGG
FT                   FQALMPTIGFFLGTQFKDQITSIDHWIAFVLLGLIGINMVKEALSNDEEQADDSIAVKE
FT                   MFMLAVATSIDALAVGITFAFLNVHIVSAALMIGVCTFLISFVGVKIGNIFGTKYKSKA
FT                   ELAGGIILILLGFKILFEHLHIL"
FT   CDS             841354..843543
FT                   /transl_table=11
FT                   /locus_tag="CL2_08680"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37887"
FT                   /db_xref="GOA:D4MZ42"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ42"
FT                   /protein_id="CBL37887.1"
FT                   /translation="MNGDVKTKIIKRNGEEVTFDLNKIINAITKANEEVTKIHQMNQYQ
FT                   IMAIAEKVADQVANSSHAVNVEDIQNMVETGIMEMRGYEVAQKYVRYRFKRELRRKSNT
FT                   TDDGILSLLDNINEEVNQENSNKNPVINSTQRDYMAGEVSKDLSKRVLLPNEIIRAHEE
FT                   GIIHFHDSDYFAQREHNCDLINLEDMLQNGTVISETLIEKPHSFFTACNVTTQIVAQVA
FT                   SNQYGGQSFTLAHLAPFVDISRKKLRKNVVKERKVIGESMDDAIIDKITEMRLYDEIKQ
FT                   GIQTIQYQLVTLMTCNGQAPFVTVFMYLDEVPEGQTRDDLALVIEEVLKQRIQGVKNEK
FT                   GVWITPAFPKLIYALDDDNITPDSKYWHLTELAAKCTAKRMVPDYISAKVMRELKNGEV
FT                   YPCMGCRSFLTVEDSQRNADGSHKFYGRFNQGVVTINLVDVACSSNGDMDKFWDILEER
FT                   LELCHRALRCRHERLKGAVSDVAPILWQHGALARLKKGEKIDKLLYDGYSTISLGYAGL
FT                   YEMCVRMTGKSHTSDEGKEFALKVMQKLNDKCNEWKAAENISYSVYGTPMESTTYKFAK
FT                   CLQKRFGIIPGVTDKNYITNSYHVHVTEEIDAFSKLAFESEFQKLSPGGAISYIEVPNM
FT                   QDNIPAVLSVMKFIYDNIMYAELNTKSDYCECCGYDGEIQIKEDESGKLIWECPNCGNT
FT                   DQDHMFVARRTCGYIGTQFWNQGRTQEIKDRVLHL"
FT   CDS             843567..844055
FT                   /transl_table=11
FT                   /locus_tag="CL2_08690"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37888"
FT                   /db_xref="GOA:D4MZ43"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ43"
FT                   /protein_id="CBL37888.1"
FT                   /translation="MHYGEIKKCDIANGPGVRVSLFVSGCRNHCPGCFNKETWDFCYGK
FT                   PFTTETKDHIMELLKPDYIEGFSLLGGEPFEPENQEELVRLLKEIKENYPKKNIWCYTG
FT                   YTYDKDLLEGGKVYTPFTEEMLSYIDTLVDGQFIESQKDITLKFRGSANQRILDLNEK"
FT   CDS             844206..844583
FT                   /transl_table=11
FT                   /locus_tag="CL2_08700"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37889"
FT                   /db_xref="GOA:D4MZ44"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ44"
FT                   /protein_id="CBL37889.1"
FT                   /translation="MILEIDFNSDEAIYVQLRNQIIMGIACAEFADGESLPSVRQLAQV
FT                   LGVNMHTVNKAYAILREEGYLKLDRRKGAVISVETLEKQQELASIQDNLRMLVAEAVCK
FT                   GVTEDEMNRLIHDMYQKLDRK"
FT   CDS             844598..847057
FT                   /transl_table=11
FT                   /locus_tag="CL2_08710"
FT                   /product="ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37890"
FT                   /db_xref="GOA:D4MZ45"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ45"
FT                   /protein_id="CBL37890.1"
FT                   /translation="MNRLPFTKYASKALNEGREIAGYLGFKDVSSIFVLLGLYGADGSL
FT                   ASEVLKMHGVTRELIEEAIKEKSKMPKDRRRTVMDTPKTEYLLEIAGELAMKYGCEAIG
FT                   SEHILMAMIKDGDNEAFRFLEDHKISSEGIYTDILVTAGIDFRSAKNEYNEAISDGGDM
FT                   EDGAGEYMLLQYSTDLTEKAMLGKLDPMIGRESEMERLMQILCRRTKNNPCLIGDPGVG
FT                   KTAIVEGLAQRIAEGNMPRILKNKRILSLDLTKVIAGTKFRGEFEERMKRIVTEATQDD
FT                   SIILFIDEIHTIIGAGGSEGAMDASNILKPALARGDFQLIGATTSEEYTKYFEKDAALV
FT                   RRFQPVRVKEPTVEETITILKGIKHRFEDYHRILVSEDVAEAIASLSDRYISDRFLPDK
FT                   AIDLLDEACARKRMEQLGSHAGFKKERKEIREIIEKIEAALSDGDITEARELKKEKNKL
FT                   EKSLERKMKRNQKKQNEIPELTTEDAAEVVSLWTQIPVTQLTKGDMERLRHLEKELHKH
FT                   VIGQDEAVNAVAKAVKRSRVGLKSPNRPIGSFLFLGPTGVGKTELSKTLAKALFGREED
FT                   LIRVDMSEYMEKHSVSKIIGSPPGYVGFGEGGQLSEQIRRHPYSVLLFDEIEKAHPDVF
FT                   NILLQVLDDGHITDSNGRKVDFKNTVIIMTSNAGANRIIAPKHLGFSMDDTDKAKTHER
FT                   MKKGVMEEVKQIFRPEFLNRIDETIVFAVLTKEEVKKIAKLFMDELRARLLSEHQITLK
FT                   ITSGAMDLLADKGYDENYGARPLRRIIQNEIEDVLADKILEGTLTNGQTMTIGKKDKKL
FT                   TFSVKEN"
FT   CDS             847125..847538
FT                   /transl_table=11
FT                   /locus_tag="CL2_08720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37891"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ46"
FT                   /protein_id="CBL37891.1"
FT                   /translation="MAVVTELFRSEDNGTLSFGDYTLAQKAKKGDIQFEGDIYKIKTFK
FT                   TMTKLDKNGQLIFESVPGSAVHNFVATTDGVAFEIESSSDVQVTLEVEAGQEYKVFIDN
FT                   TNVGMMKANLGGKLTLSVELSEGTAAAVRVKKQ"
FT   CDS             847557..848912
FT                   /transl_table=11
FT                   /locus_tag="CL2_08730"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37892"
FT                   /db_xref="GOA:D4MZ47"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ47"
FT                   /protein_id="CBL37892.1"
FT                   /translation="MAKQKTVYFCSQCGHESSKWMGQCPACKQWNTFTEEKVTETKKGG
FT                   AKSLKTSASPMNISEVTVENEERIPTGIHELDRVLGGGIVKGSLSLVGGDPGIGKSTLL
FT                   LQVCRNLANSKRKVLYISGEESMHQIKMRAERIGTFEEEMLLYCETDLDAITNAILKTK
FT                   PEFAVIDSIQTMYSEDLSSAAGSVSQVREVTAAMMRVAKENNIAVFIVGHVTKEGVVAG
FT                   PRTLEHMVDTVLYFEGEREAAYRILRGVKNRFGSTNEIGVFEMCNNGLVEVENPSKTML
FT                   NGRPLDASGSVVVCSMEGTRPILIEIQALVSPTSFQMPRRTAVGIDYNRVNLLMAVLEK
FT                   RVGLQLGGCDAYVNLAGGMKLGEPAIDLGIIMAIASSYKNRPILEDTIIFGEVGLVGEV
FT                   RAVSGGEARIKEAQKLGFKRCILPQANVDQIKVQTDMRLVGVSNVMEALDLI"
FT   CDS             849001..850671
FT                   /transl_table=11
FT                   /locus_tag="CL2_08740"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /EC_number="6.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37893"
FT                   /db_xref="GOA:D4MZ48"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ48"
FT                   /protein_id="CBL37893.1"
FT                   /translation="MEEDMEETISKNFIEQIIEKDIEEGHCKKVVTRFPPEPNGYLHIG
FT                   HAKSILLNYGLAQEYGGDFHFRFDDTNPTKEKEEYVNSIKEDVEWLGADYHEHIYYASN
FT                   YFDKMYECAEFLIKKGKAYVCDLNAEQIREYRGTLTEPGKNSPYRDRTPEENLQLFREM
FT                   KEGKYPDGSKVLRAKIDMTSGNINMRDPILYRIARMEHHNTGNKWCIYPMYDFAHPLED
FT                   AFEGVTHSICTLEFEDHRPLYDWVVNECEFENPPKQIEFAKLYLTNVVTGKRYIKKLVE
FT                   DGIVDGWDDPRLVSLSALRRRGYTPESIKKFMELVGVAKSHSSVDSAMLEYCIRDDLKL
FT                   KRPRMAAILDPIKLVITNYPEGEGELVDVPNNQENEEMGTRQVPFSRELYIEREDFKIE
FT                   KPKKYRRLYVGNEVRLMNAYFVTCTGYDVDEDGNVTCVYATYDPESRGGNSPDGRKVRG
FT                   TIHWVSVPTAKKAEIRLYENIVDEEKGVYNEDGSINVNPNSLTVIKEAYVEPELEKYDK
FT                   EDSFQFMRTGYFCLDSKDSTKEHMVFNRIVSLKSSYKPN"
FT   CDS             850724..851131
FT                   /transl_table=11
FT                   /locus_tag="CL2_08750"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37894"
FT                   /db_xref="GOA:D4MZ49"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ49"
FT                   /protein_id="CBL37894.1"
FT                   /translation="MKVIVVSHGSYARGLVDTAQMIAGEQEDLEAFGLEPEESVDTLRE
FT                   KIRESIEQTSEGEEVLILTDLFYGSPFNTVISLMSECDLYHVTGINLPLMMEVVMGRYA
FT                   GKSAQEVCKDLLKAAPETVKDVRELYKEVEE"
FT   CDS             851128..851613
FT                   /transl_table=11
FT                   /locus_tag="CL2_08760"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37895"
FT                   /db_xref="GOA:D4MZ50"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ50"
FT                   /protein_id="CBL37895.1"
FT                   /translation="MKNIVLARVDDRLIHTEILTLWVPEVRANRIIIVDDVVAKDKFRS
FT                   KVIKEMAPQGLIIHVYGIDRATEKLKEAPSFDGERVIVIAESPLVFEELIKRGIKINQL
FT                   NIGGMGIRGERKAVARRVACDTMEMEAIHELIKKHVHVYFQTVPTRSSEEAKKYIKE"
FT   CDS             851786..852058
FT                   /transl_table=11
FT                   /locus_tag="CL2_08770"
FT                   /product="Co-chaperonin GroES (HSP10)"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37896"
FT                   /db_xref="GOA:D4MZ51"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ51"
FT                   /protein_id="CBL37896.1"
FT                   /translation="MKLTPLGDRVVLKQLEAETTTKSGIVLTTATQEKPQEAEVVAVGP
FT                   GTEDVKMEVSVGQKVIYSKYAGTEVKLEDEEFIIVKQNDILAVVE"
FT   CDS             852120..853745
FT                   /transl_table=11
FT                   /locus_tag="CL2_08780"
FT                   /product="chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37897"
FT                   /db_xref="GOA:D4MZ52"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ52"
FT                   /protein_id="CBL37897.1"
FT                   /translation="MAKEIKYGIEARKALEAGVNQLADTVRVTIGPKGRNVVLDKSFGA
FT                   PLITNDGVTIAKEIELEDPFENMGAQVVKEVATKTNDVAGDGTTTATVLAQAMINEGMK
FT                   NLAAGANPIILRKGMKKATEAAVEAIAEMSSKVTGRDQIAKVAAISAADEEVGELVADA
FT                   MEKVSNDGVITIEESKTMKTELDLVEGMQFDRGYLSAYFSTDMEKMVAELDDPYILITD
FT                   KKITNIQEILPLLEQIVQSGKKLLIIAEDIEGEALTTLIVNKLRGTFSVCAVKAPGYGD
FT                   RRKAMLEDIAILTGGTVISEEVGLELKDATLDQLGRAKSVKVEKENTVIVDGEGDKDAI
FT                   QARLGQIKAQIEETTSEFDKEKLQERLAKLSGGVAVIRVGAATETEMKESKLRLEDALA
FT                   ATKAAVEEGIIFGGGSAYIHASKKAAEKVADLEGDEKTGANIILKALEAPLFQIAVNAG
FT                   LEGAVIVNKVKEAEIGKGFDALHGEYVDMVEKGIIDPAKVTRSALQNATSVASTLLTTE
FT                   SVVANIKEEAPAMPAGAPAGMGMM"
FT   CDS             complement(853957..854562)
FT                   /transl_table=11
FT                   /locus_tag="CL2_08790"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37898"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:D4MZ53"
FT                   /protein_id="CBL37898.1"
FT                   /translation="MLKTEQNIVYMVQEFDRKLRSITIASCAPAPLWLLSPNISFYYPD
FT                   NIISFSICEIDQVIKHIETGQIDIGILPFEYQKDDLCTTHFFTEHLSVCIPFGHSLCSY
FT                   DKLTFHDLNGYNRLLWDQLGFWTDLCKRKMPASKFLIQTDESEFLELVKSSTLFCFSTN
FT                   YASYPDEILNDRKRIPIVDDCANVEYWVVWKKGNTYRF"
FT   gap             854775..855328
FT                   /estimated_length=554
FT   CDS             855372..855437
FT                   /transl_table=11
FT                   /locus_tag="CL2_08800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL2_08800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL37899"
FT                   /db_xref=