spacer

EBI Dbfetch

ID   FP929060; SV 1; linear; genomic DNA; STD; PRO; 3108859 BP.
XX
AC   FP929060;
XX
PR   Project:PRJNA45955;
XX
DT   25-MAR-2010 (Rel. 104, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 2)
XX
DE   Clostridiales sp. SM4/1 draft genome.
XX
KW   .
XX
OS   butyrate-producing bacterium SM4/1
OC   Bacteria; Firmicutes; Clostridia; Clostridiales.
XX
RN   [1]
RG   metaHIT consortium -- http://www.metahit.eu/
RA   Pajon A., Turner K., Parkhill J., Duncan S., Flint H.;
RT   "The genome sequence of Clostridiales sp. SM4/1";
RL   Unpublished.
XX
RN   [2]
RA   Pajon A.;
RT   ;
RL   Submitted (24-MAR-2010) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
XX
DR   MD5; 6897b37fac325d1f3edc80c28356c761.
DR   BioSample; SAMEA3138375.
DR   EnsemblGenomes-Gn; CL3_R_35600.
DR   EnsemblGenomes-Gn; CL3_R_35610.
DR   EnsemblGenomes-Gn; CL3_T_35330.
DR   EnsemblGenomes-Gn; CL3_T_35340.
DR   EnsemblGenomes-Gn; CL3_T_35350.
DR   EnsemblGenomes-Gn; CL3_T_35360.
DR   EnsemblGenomes-Gn; CL3_T_35370.
DR   EnsemblGenomes-Gn; CL3_T_35380.
DR   EnsemblGenomes-Gn; CL3_T_35390.
DR   EnsemblGenomes-Gn; CL3_T_35400.
DR   EnsemblGenomes-Gn; CL3_T_35410.
DR   EnsemblGenomes-Gn; CL3_T_35420.
DR   EnsemblGenomes-Gn; CL3_T_35430.
DR   EnsemblGenomes-Gn; CL3_T_35440.
DR   EnsemblGenomes-Gn; CL3_T_35450.
DR   EnsemblGenomes-Gn; CL3_T_35460.
DR   EnsemblGenomes-Gn; CL3_T_35470.
DR   EnsemblGenomes-Gn; CL3_T_35480.
DR   EnsemblGenomes-Gn; CL3_T_35490.
DR   EnsemblGenomes-Gn; CL3_T_35500.
DR   EnsemblGenomes-Gn; CL3_T_35510.
DR   EnsemblGenomes-Gn; CL3_T_35520.
DR   EnsemblGenomes-Gn; CL3_T_35530.
DR   EnsemblGenomes-Gn; CL3_T_35540.
DR   EnsemblGenomes-Gn; CL3_T_35550.
DR   EnsemblGenomes-Gn; CL3_T_35560.
DR   EnsemblGenomes-Gn; CL3_T_35570.
DR   EnsemblGenomes-Gn; CL3_T_35580.
DR   EnsemblGenomes-Gn; CL3_T_35590.
DR   EnsemblGenomes-Tr; CL3_R_35600.
DR   EnsemblGenomes-Tr; CL3_R_35610.
DR   EnsemblGenomes-Tr; CL3_T_35330.
DR   EnsemblGenomes-Tr; CL3_T_35340.
DR   EnsemblGenomes-Tr; CL3_T_35350.
DR   EnsemblGenomes-Tr; CL3_T_35360.
DR   EnsemblGenomes-Tr; CL3_T_35370.
DR   EnsemblGenomes-Tr; CL3_T_35380.
DR   EnsemblGenomes-Tr; CL3_T_35390.
DR   EnsemblGenomes-Tr; CL3_T_35400.
DR   EnsemblGenomes-Tr; CL3_T_35410.
DR   EnsemblGenomes-Tr; CL3_T_35420.
DR   EnsemblGenomes-Tr; CL3_T_35430.
DR   EnsemblGenomes-Tr; CL3_T_35440.
DR   EnsemblGenomes-Tr; CL3_T_35450.
DR   EnsemblGenomes-Tr; CL3_T_35460.
DR   EnsemblGenomes-Tr; CL3_T_35470.
DR   EnsemblGenomes-Tr; CL3_T_35480.
DR   EnsemblGenomes-Tr; CL3_T_35490.
DR   EnsemblGenomes-Tr; CL3_T_35500.
DR   EnsemblGenomes-Tr; CL3_T_35510.
DR   EnsemblGenomes-Tr; CL3_T_35520.
DR   EnsemblGenomes-Tr; CL3_T_35530.
DR   EnsemblGenomes-Tr; CL3_T_35540.
DR   EnsemblGenomes-Tr; CL3_T_35550.
DR   EnsemblGenomes-Tr; CL3_T_35560.
DR   EnsemblGenomes-Tr; CL3_T_35570.
DR   EnsemblGenomes-Tr; CL3_T_35580.
DR   EnsemblGenomes-Tr; CL3_T_35590.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01990; SECIS_4.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; FP929060.
DR   SILVA-SSU; FP929060.
XX
CC   This is a reference genome for the metaHIT project
CC   DNA source: Rowett Institute of Nutrition and Health, University of
CC   Aberdeen -- http://www.rowett.ac.uk/divisions/ghp/
CC   Sequencing technology: 454
CC   Genome coverage: 14x
CC   Annotation was added using ab initio prediction IMG/ER --
CC   http://img.jgi.doe.gov/submit (Markowitz, Szeto et al. 2007).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3108859
FT                   /organism="butyrate-producing bacterium SM4/1"
FT                   /strain="SM4/1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:245012"
FT   rRNA            complement(89..2972)
FT                   /gene="23S"
FT                   /locus_tag="CL3_R_35600"
FT                   /product="23S rRNA"
FT   misc_RNA        complement(597..704)
FT                   /locus_tag="CL3_35630"
FT                   /product="Pseudoknot of the domain G(G12) of 23S ribosomal
FT                   RNA"
FT   gap             3255..3822
FT                   /estimated_length=568
FT   rRNA            complement(3837..5503)
FT                   /gene="16S"
FT                   /locus_tag="CL3_R_35610"
FT                   /product="16S rRNA"
FT   CDS             complement(<5480..5626)
FT                   /transl_table=11
FT                   /locus_tag="CL3_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35450"
FT                   /db_xref="UniProtKB/TrEMBL:D4MTP8"
FT                   /protein_id="CBL35450.1"
FT                   /translation="MKEYEHIQFMAQKLGFQSFTELQHKAFCADETYNPDRWLFVIGAT
FT                   SSGK"
FT   gap             7372..7848
FT                   /estimated_length=477
FT   gap             10212..10601
FT                   /estimated_length=390
FT   CDS             complement(10646..11374)
FT                   /transl_table=11
FT                   /locus_tag="CL3_00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35451"
FT                   /db_xref="UniProtKB/TrEMBL:D4MTP9"
FT                   /protein_id="CBL35451.1"
FT                   /translation="MKHIGIVCEGPTDYIILKGVIDQITSEKNTYVMLQPENDLTGKYG
FT                   NGWKGVWKWCYDNASIRNELMKSIQPALDFLVIQMDGDVSRKEKSSHCWCEATQCAHKG
FT                   KWNPLECDTTSAGRAACPIVLPCPGHDASVTGYMSHLKALLTTWLKETDDTCIVIPCDS
FT                   TEAWIVAAYDQTDGIETVEAPWEHIIARGKYYHNIRISGQKKRIRIFEQFVPTVCENWS
FT                   KVTELCQSAYDFEESLLALV"
FT   gap             12575..12669
FT                   /estimated_length=95
FT   CDS             complement(14046..14687)
FT                   /transl_table=11
FT                   /locus_tag="CL3_00180"
FT                   /product="Phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35452"
FT                   /db_xref="GOA:D4MTQ0"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/TrEMBL:D4MTQ0"
FT                   /protein_id="CBL35452.1"
FT                   /translation="MKDYMKIYEEWLANPYFDEDTKKELRAIQGDENEIKERFYMDLEF
FT                   GTAGLRGVIGAGINRMNIYTVRRATQGLADYILEQGGADRGVAIAYDSRRMSPEFSDEA
FT                   ARTLAANGIKAYRFESLRPTPELSFAVRELGCIAGINITASHNPPEYNGYKVYWEDGAQ
FT                   FTPPHDRGVTEKVMAITDLSAVKTMSREEAVASGRYVTIGAEIDDRYIAQ"
FT   CDS             complement(14826..15170)
FT                   /transl_table=11
FT                   /locus_tag="CL3_00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35453"
FT                   /db_xref="GOA:D4MNW7"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNW7"
FT                   /protein_id="CBL35453.1"
FT                   /translation="MGDQDTPIIEFNRMHLGVQAADLYHFIRKAMEKHSWNLELGMKML
FT                   EAYDRILPMGETEREYLYYLFLYPEKYWKQINFYFNANKAWIPARNVEKLKNLEQQQED
FT                   RNRFLSRIRG"
FT   gap             16207..16759
FT                   /estimated_length=553
FT   CDS             complement(17039..18031)
FT                   /transl_table=11
FT                   /locus_tag="CL3_00230"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35454"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNW8"
FT                   /protein_id="CBL35454.1"
FT                   /translation="MDFCRLTEELWRVYLCGDAGEKQKMVSEWLDEDCVIIGTGAHEFY
FT                   TNKQDFYKAMSQESEEVEEVSFRFENLRCRERKTGEDACLVYGVLYIRGSSADGKVQID
FT                   MDSRYSVLYERRGDRWKIVHIHQSMPNLEQREGEYYPKTLTEQVQKAQEEAGRMALLAQ
FT                   RDGLTGLINYHTFEEIWKKGDRTEKWLFIVDLDDFKKINDTYGHMEGNQVLKTIAGLLN
FT                   RVVRTHDLVCRMGGDEFLLLCGGISSMKGAARLAERIVDCIAAHRTEKAWPSISVGGTE
FT                   ILPDEKLESAIERADKALYSVKRTTKTDIASSDRKGAAHLLRRRRGRCT"
FT   gap             19359..19721
FT                   /estimated_length=363
FT   gap             21099..21348
FT                   /estimated_length=250
FT   gap             22708..23204
FT                   /estimated_length=497
FT   CDS             25216..25506
FT                   /transl_table=11
FT                   /locus_tag="CL3_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35455"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNW9"
FT                   /protein_id="CBL35455.1"
FT                   /translation="MEKFFCGRGTGEGYLFQRSHKYPSPVPGTGTEFFLVLGRFLVWRR
FT                   EESGKIFLKREKKQRDREGEDFGMAGDRRELASAYRGQKNRRILQKMAQYI"
FT   gap             25778..25860
FT                   /estimated_length=83
FT   CDS             complement(26608..28035)
FT                   /transl_table=11
FT                   /locus_tag="CL3_00320"
FT                   /product="Antirepressor regulating drug resistance,
FT                   predicted signal transduction N-terminal membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35456"
FT                   /db_xref="GOA:D4MNX0"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNX0"
FT                   /protein_id="CBL35456.1"
FT                   /translation="MPYYVLMMFTISIAGTGIFLLVFWMEKRFKSYSIDFLLRLMEVVF
FT                   IFFLIPAMALTACLFQNGIGGIEVLEMESEDFQYMYSFQLGWRSLFFRWPDSWIVRFIE
FT                   AAGILWLAGILAGVFRGAFVNYRIGREIKRNEEHFSEQARRNIQEQAKEVRGILKIRKM
FT                   PPVKLCRGLDTPILYGGARPVIMVNSEDYTPEEIKLILLHEGIHYKRGDLLFKNMAGLI
FT                   SIVYWFNPVIKILVKEFYDICELSCDERVISLIEGHEKKRYAKLIGETSTSFLAGCSAS
FT                   ALKASKKNIIIRRLENMLNQRKKSAACMAAIACILAIASPAAVLASNAAVIQTGKILEE
FT                   REDKKRTVFETVSEVRNVFSKIVEEEGNDTITQSIEIAPRGTSSFSVDLIGKKGAELSE
FT                   LSLELGDTISISAYGENETDQFKISISDSSGKQKSLYSLNGQIVYNFKVEKKGKYKITI
FT                   VGTTDSTVHVGGTISVR"
FT   CDS             complement(28037..28498)
FT                   /transl_table=11
FT                   /locus_tag="CL3_00330"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35457"
FT                   /db_xref="GOA:D4MNX1"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNX1"
FT                   /protein_id="CBL35457.1"
FT                   /translation="MNTPGSGQQANGSKNGGNFMGRMPDEGLRELGGKKKLSPQEREFM
FT                   EVIWEKPEGIMSEELYRRFPIVRGTVSAVLAHIAEKNYVTVKKEGRNYRYRANVTKREY
FT                   EKALMKEKMKKYLGVDSMAGLLGMFCGKEELTEKEKKEIDTLLKKLEEQ"
FT   CDS             complement(28767..30065)
FT                   /transl_table=11
FT                   /locus_tag="CL3_00340"
FT                   /product="iron-only hydrogenase maturation protein HydF"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35458"
FT                   /db_xref="GOA:D4MNX2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNX2"
FT                   /protein_id="CBL35458.1"
FT                   /translation="MGMNETPSAERVHISFFGCRNAGKSSLLNAFTGQDLAVVSDVKGT
FT                   TTDPVKKSMELLPLGPAVIIDTPGIDDEGSLGGRRVRKTRQILNMTDIAVLVADSQTGI
FT                   RKEDRELAALFQEKEVPYVVAFNKCDLTENHIPDIYKEETKKTGAKEGVPEDRETEKQE
FT                   AAVLSGAAAVLPVSARTGFGIEKLKETLAHIKTVEEGRDHVPLIGDLLSPSDFVVLVIP
FT                   VDKAAPKGRLILPQQQTIRGILDAGAVAVTVKDDELSTTLAVLGKKPKLVVTDSQVFGK
FT                   VKGEVPDDILLTSFSILFARYKGNLKTAVEGAAALDRLEDGAHILICEGCTHHRQCGDI
FT                   GTEKLPAWIRKHTGKELRFSFTSGTEFPDDLSPYSLIIHCGGCMLNAREMKYRLKCAED
FT                   QQIPMTNYGIAIAHMNGILKRSVEPFPDIREML"
FT   CDS             complement(30216..31241)
FT                   /transl_table=11
FT                   /locus_tag="CL3_00350"
FT                   /product="iron-only hydrogenase maturation protein HydG"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35459"
FT                   /db_xref="GOA:D4MNX3"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024007"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNX3"
FT                   /protein_id="CBL35459.1"
FT                   /translation="MGHKRLALETGEDPVNNPIEYVLESIKTIYSIKHKNGAIRRVNVN
FT                   IAATTEENYRKLKEAGIGTYILFQETYHRESYERLHPTGPKHNYCYHTEAMDRAMTAGI
FT                   DDVGIGVLFGLELYKYEFAGLLMHAEHLEARFGVGPHTISVPRVKKADDIDPDEFDNGI
FT                   DDDTFAKIVALIRVAVPYTGMIISTRESAKCRERLLNLGISQISGGSRTSVGGYAEEEP
FT                   EDESSAQFDVSDSRTLDQVVRWLMELGYIPSFCTACYREGRTGDRFMSLLKSGQIGNCC
FT                   HPNALMTLKEYLEDYASEETRKLGDQLIEKEILNVPSERVREILRKNLKAIAEGRRDFR
FT                   F"
FT   CDS             complement(31207..31650)
FT                   /transl_table=11
FT                   /locus_tag="CL3_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35460"
FT                   /db_xref="GOA:D4MNX4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNX4"
FT                   /protein_id="CBL35460.1"
FT                   /translation="MNSSTKYDPKSSKAEEFINHQEILETLDYAEKNRENFELIDAIIE
FT                   KARKKKGISHREASVLLACQDEERNEQIFKLAREIKREFYGSRIVMFAPLYLSNYCVNG
FT                   CLYCPYHLKKQAHSQEKADSGGDRAGGYGSAGYGPQAAGSGNR"
FT   gap             32044..32247
FT                   /estimated_length=204
FT   CDS             33324..33563
FT                   /transl_table=11
FT                   /locus_tag="CL3_00400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35461"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNX5"
FT                   /protein_id="CBL35461.1"
FT                   /translation="MFRIPLKENPVSVPVQLFLASEHFLGVSAAFLFSSPCVSPGAGAV
FT                   QEAGSLPGLILLLSSAKLSRPSREPVSESAFSSY"
FT   CDS             33700..34164
FT                   /transl_table=11
FT                   /locus_tag="CL3_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35462"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNX6"
FT                   /protein_id="CBL35462.1"
FT                   /translation="MDILFNVLLGVLIVAVIVLAVLYFLGRKMEKRQAEQQSMMEAAKQ
FT                   VVSILVIDKKKLKAKDSGLPKMVTDQVPWYMRRAKFPIVKAKIGPKVTTLIADEKVFLQ
FT                   LPVKTEAKVVISGLYITEIKSVRGGIPPLPKKKGFFSRFKKDKTEKKASK"
FT   CDS             34229..34414
FT                   /transl_table=11
FT                   /locus_tag="CL3_00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35463"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNX7"
FT                   /protein_id="CBL35463.1"
FT                   /translation="MEQWLPFYVFHLAFHSFLSSAFCLCLLFCRKFFLYEWHFSLLDRF
FT                   ENQEWNFGAGESIYQG"
FT   CDS             complement(34551..34643)
FT                   /transl_table=11
FT                   /locus_tag="CL3_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35464"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNX8"
FT                   /protein_id="CBL35464.1"
FT                   /translation="MPARAEATAAGAGSASMKKSKPEPIPVMDY"
FT   CDS             34858..35136
FT                   /transl_table=11
FT                   /locus_tag="CL3_00440"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35465"
FT                   /db_xref="GOA:D4MNX9"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNX9"
FT                   /protein_id="CBL35465.1"
FT                   /translation="MAGNTTNISIRMDADLKAQADALFAELGMNLSTAFNIFVRQSLRE
FT                   GGIPFEVKLEQPNKETIAAMLEAERIAKDPSVKGCNDLDELFADLKK"
FT   CDS             35133..35423
FT                   /transl_table=11
FT                   /locus_tag="CL3_00450"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35466"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNY0"
FT                   /protein_id="CBL35466.1"
FT                   /translation="MRKTKYTVKYTTSFKKDYKRAIRRGLKIELLEQVVALLAMGEPLP
FT                   EKNRDHDLSGDWVGHLECHILPDWLLIYRIEDDVLVLTLSRTGSHSDLFGK"
FT   CDS             complement(35474..35641)
FT                   /transl_table=11
FT                   /locus_tag="CL3_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35467"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNY1"
FT                   /protein_id="CBL35467.1"
FT                   /translation="MEKRSIRTDKGEVNRQIVSDNKLREDLKAVERLRKAADQLARQEQ
FT                   DKSHDRGPEL"
FT   gap             36383..37359
FT                   /estimated_length=977
FT   CDS             37472..37879
FT                   /transl_table=11
FT                   /locus_tag="CL3_00480"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35468"
FT                   /db_xref="GOA:D4MNY2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNY2"
FT                   /protein_id="CBL35468.1"
FT                   /translation="MSDKIIQLNEDLIKHDLKDLVRSSVEETLNALLDKEADELVNAEK
FT                   YERSSDRQGYRSGHYKRNLHTAAGEVELKVPKLKGIPFETAIIERYRRRESSVEEALIE
FT                   MYLAGVSVRRVEDMIHQISDEYKQGNSKKRK"
FT   CDS             complement(38026..38571)
FT                   /transl_table=11
FT                   /locus_tag="CL3_00490"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   small permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35469"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNY3"
FT                   /protein_id="CBL35469.1"
FT                   /translation="MSRSRRGANGKKGGIRVERVEKIEKIVERLLYFLVCATFAVLIFA
FT                   CVLQVFTRFVLNNSLSWTEELARYAFIWSNFLGAAICTQKESHATVTAVTDLLPAKAQT
FT                   VLKMAVSLIVILVAGVLIWYGFKVAYAVRLQLSPALRVSMALIYGAAPVCGVFVLFYSA
FT                   LNLLRQIQIFRGKESGKW"
FT   CDS             complement(39581..40000)
FT                   /transl_table=11
FT                   /locus_tag="CL3_00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35470"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNY4"
FT                   /protein_id="CBL35470.1"
FT                   /translation="MKKMKLIASATALSMIAALSLTGCGGGGSSQEAESDNTITVWAWD
FT                   VALKQLELGQCGRWGLYAGRDGLEYKMRRSVECISGNRSGQSGKEVPVEGMKRFICALL
FT                   KSGFSPAEIRDMVQKVPEELVGEVGWQNVRKEEKT"
FT   CDS             40352..43357
FT                   /transl_table=11
FT                   /locus_tag="CL3_00520"
FT                   /product="Beta-galactosidase/beta-glucuronidase"
FT                   /EC_number="3.2.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35471"
FT                   /db_xref="GOA:D4MNY5"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013812"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNY5"
FT                   /protein_id="CBL35471.1"
FT                   /translation="MQMRAKKRWEDQTLTGIGRLKARTSFFTDSAERVSLNGNWAFKYL
FT                   TAPEYSPQGFERGDYDTADWDSIEVPSCWQLKGYDHMHYTDVLYLFPLNPPYVPTENPT
FT                   GIYKRNFEIPREWMENETILRFEGVDSAYDVWVNGAHVGYSKVSRLPAEFNISSYIKEG
FT                   ENHVAVRVYKWSDGTYLEDQDMWWFSGIYRNVSLLNVPVHGIEDCRVHADLDDTYTKGC
FT                   LEADVRLSSESGTLVWSLTDREGNEAAAGSVPAAGQVKISAELENVHTWTAETPYLYTL
FT                   NLSLKDGQQEHRVSIRTGFRRIEVKGNVFTVNGKAILINGVNHHDYSPEGGRTVDPEVM
FT                   RQDIILMKQNNINAVRFSHYPSIEAIYDYCDEYGLYVIDEADLECHGFEWAHVYDMITD
FT                   NPEWETAYVDRAVRMVARDYNHPSIIMWSLGNESCFGVNFKKEAEAIRAMDSSRLIHYE
FT                   GDFEAEITDVYSTMYTRLKGLKEIGETKIKHNRPHVHCEYSHAMGNGPGCLADYQELYR
FT                   TYDRLQGGFIWEWYDHGIKTVDENGTVTYKYGGNYGDFPTNGNFCIDGLLMPDRTPSPG
FT                   LVEYKQVICPVSIKKLGDSGDLYAVKNYYDFKTLEGIRLDCTVTDGTDTLAQFTVDGLS
FT                   TEPGKEEIVTIPHTSLDLKDNRDYYLNICVKEKEATSYAPAGHELGLYQFALPEKRTVC
FT                   TPRMAGAVRIAQTDTAVTAECSGTEFVFDKVHGSLTSMKRGGEELLVKGPSLTVDRADI
FT                   DNDMYKVDDWKNKYFISRGMEELEYMTVRELEGKAEIYIQKYFGCYNQAWGFRLAYVYT
FT                   VYGDGSMDVSLNGKAIRNPEFEPEFLPRIGVELAVNRAFDTVSWYGMGPGENYCDSRQA
FT                   AVMGVYRTTVEGMHTNYVKPQENGHREDVRWLALSGNESGILIKARESFGINVHDYSTE
FT                   ALRNAAHPCEIRKEDAVIINLDYRHSGLGSNSCGQEQTDSCKTGIEDFSMGFSIQAAAK
FT                   QEAEGLAFVRHC"
FT   gap             44360..44557
FT                   /estimated_length=198
FT   CDS             45803..46003
FT                   /transl_table=11
FT                   /locus_tag="CL3_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35472"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNY6"
FT                   /protein_id="CBL35472.1"
FT                   /translation="MGIINANKRVNEERIECGGTVKVTLSLAACPCIGKESHDIVFAID
FT                   RSAKMEGSALEAAKKGIKAFI"
FT   gap             46792..47129
FT                   /estimated_length=338
FT   CDS             47428..47631
FT                   /transl_table=11
FT                   /locus_tag="CL3_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35473"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNY7"
FT                   /protein_id="CBL35473.1"
FT                   /translation="MPGKPSGLEEPGRIKKQRYRQEEKVEFKQHISNDTGRNKENNRDR
FT                   ADAAAAGRWDDGVHLPSRPGGY"
FT   CDS             47591..48520
FT                   /transl_table=11
FT                   /locus_tag="CL3_00590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35474"
FT                   /db_xref="GOA:D4MNY8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNY8"
FT                   /protein_id="CBL35474.1"
FT                   /translation="MTAFTCPPGREDTERAEQFAASGADFQSFGELCLVKVADRGKTEF
FT                   VLAGRGSGDVLTCLRLAALQISGLIRFQKDRFDRENFIKRVVLGHLLPVDVDDQAKRFR
FT                   LDGRVSRTVFLIETREDGGDSDVILQILRPLYGETAGGFLFKTAHRKYVYVRTMREGES
FT                   TEGLEEIGRNIVDVINTEGMQDACLSFGTPTKKLSGLSESYREACLAMRIGRIFSRESH
FT                   VVAYDRLGMGRLIYSLPMPLCRKFLDEVFACAGPDELDEEALMTIRQFFDDSLNIAETA
FT                   RHLYIHRNTLVYRLGQAAETAGTEYQKF"
FT   CDS             48528..48605
FT                   /transl_table=11
FT                   /locus_tag="CL3_00600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35475"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNY9"
FT                   /protein_id="CBL35475.1"
FT                   /translation="MLLRLGLMVHEYVKEKAENIDEEDI"
FT   gap             49153..50428
FT                   /estimated_length=1276
FT   gap             51263..53083
FT                   /estimated_length=1821
FT   gap             54780..55364
FT                   /estimated_length=585
FT   gap             56532..57780
FT                   /estimated_length=1249
FT   gap             59528..60026
FT                   /estimated_length=499
FT   CDS             61464..61565
FT                   /transl_table=11
FT                   /locus_tag="CL3_00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35476"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNZ0"
FT                   /protein_id="CBL35476.1"
FT                   /translation="MRSRTAAEGRAKSEAVGQVHKKNLLLFYTKTGT"
FT   gap             62642..62835
FT                   /estimated_length=194
FT   CDS             62894..63814
FT                   /transl_table=11
FT                   /locus_tag="CL3_00730"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35477"
FT                   /db_xref="GOA:D4MNZ1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNZ1"
FT                   /protein_id="CBL35477.1"
FT                   /translation="MAGILSSLQGAVGQGILWGIMVLGIYITFRLMDIADLTVDGSFAL
FT                   GGSVCAAMVVDKGMNPVAALVICLIAGMIAGAVTGILHTVFEIPAILAGILTQISLWSV
FT                   NLKVMGKSNMNLGKAETPFSWLKETLGISQSQSMILAGLVVTVLVIVFLYWFFGTELGS
FT                   AMRATGNNEDMVRALGGNTNRYKLLALTVSNGLVGLSGGLVCQGQGYADIQMGTGAIVI
FT                   GLAAIIIGEVLLGRLVPFYWKLIAVVAGSVIYQIIRAVVLRLGFDSDNMKALTAIIVVV
FT                   ALAIPVLMARYRQKMAYTEGGEEEC"
FT   gap             64656..65472
FT                   /estimated_length=817
FT   CDS             65709..66812
FT                   /transl_table=11
FT                   /locus_tag="CL3_00750"
FT                   /product="Bacterial SH3 domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35478"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNZ2"
FT                   /protein_id="CBL35478.1"
FT                   /translation="MGINKPDDYAARLKKARRKRNGKDPFKYFLIAAGCVIVILLIVLA
FT                   GKIAKGGRIELGTRRSADSSNIEGVFESAGTDETEAAALEGELMEEDEEQKKIDEQKAS
FT                   VVESYENLGIVQVTGYLNMRESPDQNADIIGKLLDGSACEILDDSTEGWYQVTSGGLTG
FT                   YISSEYVLTGEEAKTAAFDLVDEMAVITADKLNVRSEPNQDAQVLEQVLRNERYTIEEE
FT                   QDGWIKIPAGYISSEYVQQRYALNEARKLDLRTMVLNMYDNIGISNVNNYLNIRQEPKE
FT                   DGKIIGKMTSKSAGEILETTEDGKWYKIKSGPVTGYVSSEYILTGQAAKDEALQEAKLM
FT                   AIVSTDRLNARTEPTTDAPHLDPDFQQ"
FT   gap             66908..67168
FT                   /estimated_length=261
FT   CDS             complement(67720..68832)
FT                   /transl_table=11
FT                   /locus_tag="CL3_00770"
FT                   /product="[citrate (pro-3S)-lyase] ligase"
FT                   /EC_number="6.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35479"
FT                   /db_xref="GOA:D4MNZ3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNZ3"
FT                   /protein_id="CBL35479.1"
FT                   /translation="MAEYQISEIRQTDSRALAQFDSLLRKEGIRRDKNLDYIAGLYDED
FT                   YHLAAAGACFGSTLRCMAVDSAFQGEGLLNQLVTHLVDFQYRRGNIRLFLYTKYSKAAF
FT                   FESLGFYEIARARGEAVFMENRRSGFKGYLENLVRETKEALADLPAQTQAFQKPGEQLP
FT                   AGAVVLNANPFTLGHQYLLKQASSSCGVLHVFVVSEDVSLFPFSVRYRLVKEGCSRLGN
FT                   VIFHSTGSYLISNATFPSYFLQDEESAIRSHARLDAELFSSIADALSISVRFVGDEPLS
FT                   HVTGIYNEVLLEESRCQEKAGKGCRLVILPRLESEGAPVSASQVRSLIKKGRFQELQSL
FT                   VPETTLRYLLSPEAAPVIQAIQSAAQVRHY"
FT   CDS             68897..69031
FT                   /transl_table=11
FT                   /locus_tag="CL3_00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35480"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNZ4"
FT                   /protein_id="CBL35480.1"
FT                   /translation="MKIPMPPIRKAAVYLTSYGNKKNSAGKNNPEKLRQQKSRFSLEG"
FT   gap             69272..69487
FT                   /estimated_length=216
FT   CDS             73741..74298
FT                   /transl_table=11
FT                   /locus_tag="CL3_00840"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35481"
FT                   /db_xref="GOA:D4MNZ5"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNZ5"
FT                   /protein_id="CBL35481.1"
FT                   /translation="MVSAGDFRNGITVEIEGNVFQIVEFQHVKPGKGAAFVRTKLKNIK
FT                   NGGVVEKTFRPTEKFPAARIDRVDMQYLYSDGDLFHFMNVENYEQIALTADQIGDALKF
FT                   VKENDMVKICSHNGEVFSVEAPLFAELEITETEPGFKGDTATGATKPAIVETGATIYVP
FT                   LFVEIGDKVKIDTRTGEYLSRV"
FT   gap             74821..75189
FT                   /estimated_length=369
FT   CDS             77103..77750
FT                   /transl_table=11
FT                   /locus_tag="CL3_00890"
FT                   /product="Arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35482"
FT                   /db_xref="GOA:D4MNZ6"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNZ6"
FT                   /protein_id="CBL35482.1"
FT                   /translation="MIFLGFGTMNSKDGGPFKTRDGGVMRLEHLIDEIDEEVYRKIQEK
FT                   QRVPEEEMRRTAEMIGLAALKYGDLSNQATKDYVFDVDRFISFEGNTGPHIQYMVVRIK
FT                   SILEKYGELMGGTYSLSPIRPAASETEKKLQLELCRFGEVVESAFAETAPHRICQYMYD
FT                   LSDAFNNFYLVNKIIGEEDREKQAGFISLISLTKDVLNACMDLLGMEAPEHM"
FT   gap             78364..78575
FT                   /estimated_length=212
FT   gap             79782..80988
FT                   /estimated_length=1207
FT   CDS             81062..81223
FT                   /transl_table=11
FT                   /locus_tag="CL3_00930"
FT                   /product="Rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35483"
FT                   /db_xref="GOA:D4MNZ7"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNZ7"
FT                   /protein_id="CBL35483.1"
FT                   /translation="MKKYVCDVCGYIYDPAEGDPDNGVAAGTAFEDIPESWVCPLCGVG
FT                   KDQFSVEE"
FT   gap             82435..83783
FT                   /estimated_length=1349
FT   CDS             83823..84767
FT                   /transl_table=11
FT                   /locus_tag="CL3_00960"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_00960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35484"
FT                   /db_xref="GOA:D4MNZ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNZ8"
FT                   /protein_id="CBL35484.1"
FT                   /translation="MKYFFKKLVTLIITLLLISLLTFTAFSVIPGDAALTRLGEDATEE
FT                   QIEAFREEYGLNDPMPVRYVNWLSGAVRGNFGDSYYYDNMTVSELLAVRLPVTVLLAAV
FT                   SLVMILVCSVPLGLLCARGAGGALDHAVNGTLQVVMAVPSFFLGIILTYVCGLILKWFQ
FT                   PGQFVAPSESFWGAVSYLVFPAAAVALPKIAMVVKFLRNSVLSELSRDYVRTARSRGNS
FT                   SRRILYVHVLKNALIPVITFVAMVVAEILAGSIIVEQVFSVPGVGRLLISSISNRDYPI
FT                   VQAIVMYVTLVVVLVNFLVDMMYQLLDPRVRTS"
FT   gap             87031..87639
FT                   /estimated_length=609
FT   CDS             88265..88339
FT                   /transl_table=11
FT                   /locus_tag="CL3_01010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35485"
FT                   /db_xref="UniProtKB/TrEMBL:D4MNZ9"
FT                   /protein_id="CBL35485.1"
FT                   /translation="MEISLFFYGIHGIIRGRLNNRKDG"
FT   gap             88768..89978
FT                   /estimated_length=1211
FT   gap             91311..91876
FT                   /estimated_length=566
FT   CDS             complement(91977..93083)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01070"
FT                   /product="ABC-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35486"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP00"
FT                   /protein_id="CBL35486.1"
FT                   /translation="MRKRTIAALLISAMTAAVLSGCSGSDSGTANPGESKTAETAAAET
FT                   DTAGTKAAEEAGNTAPLADGEYTIGIAQYAVHGSLDNCREGFLKGLADEGFVENENLKI
FT                   IYENANGDGSLSGQIITNFVSNDVDLICAIATPIAQSAYGVTKRTDIPVVYTAVTDPVL
FT                   AELATEDQMPVGEITGTSDKLPVSEQLSMIRKLLPEAKTVGILYSTNEVNSQAAIEEYK
FT                   QAAPEYGLEIVESGISTVADIPLAAEQLAAKVDCISNLTDNNVVSSLPVVLDAANKNGI
FT                   PVFGSEIEQVKKGCLAAMGLDYVALGEQTGRMAAKVLKGETKASEMPYELIEGASFYGN
FT                   TAVAENLGITLPEELTDSAAEMFDEIAQ"
FT   CDS             93154..93297
FT                   /transl_table=11
FT                   /locus_tag="CL3_01080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35487"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP01"
FT                   /protein_id="CBL35487.1"
FT                   /translation="MLNRTKNPALQDSPPAAGLRRDVFLSAAVRSRPEGFLFNRKFNGI
FT                   FC"
FT   CDS             complement(93385..93498)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35488"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP02"
FT                   /protein_id="CBL35488.1"
FT                   /translation="MTQPAEWTFEGIPDTAFAEVGNDGNRNRYLRGIYVGI"
FT   gap             93948..95663
FT                   /estimated_length=1716
FT   gap             96709..96740
FT                   /estimated_length=32
FT   gap             98056..98817
FT                   /estimated_length=762
FT   CDS             98821..98973
FT                   /transl_table=11
FT                   /locus_tag="CL3_01140"
FT                   /product="Translation elongation factors (GTPases)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35489"
FT                   /db_xref="GOA:D4MP03"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP03"
FT                   /protein_id="CBL35489.1"
FT                   /translation="MSELYGYNTDLRSMTGGIGVYSYEFSRYEQAPGDVQKREVEARAA
FT                   EAEKD"
FT   CDS             100619..101506
FT                   /transl_table=11
FT                   /locus_tag="CL3_01170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35490"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP04"
FT                   /protein_id="CBL35490.1"
FT                   /translation="MADQENQMESTEMKNQDTCRRIPVQEIIEKLDRMLEQDEPERAME
FT                   HLKYWMSEAEKAGDWGGQLTVANELMGLTRSTGEERIGLEAAERGIELIKIHKMEDTVT
FT                   AGTTWLNAATTFKAFGRCAVSLPLYEAAKQVYQKHLREDDYRFAGLCNNMALAYTQLKE
FT                   FDRAERLFMRAGELAGLLQHSEMELAVTWVNLACLYRDWEAAESETGSCSQEEMELWEK
FT                   KKSQCLERAWEQFEKRSVKWDGYYAFNCRKCAGTFGEFGYFRIQRELEKRAEQIYRANR
FT                   RAGQTEGTTGKEEE"
FT   gap             101574..101856
FT                   /estimated_length=283
FT   CDS             102168..103340
FT                   /transl_table=11
FT                   /locus_tag="CL3_01180"
FT                   /product="Major Facilitator Superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35491"
FT                   /db_xref="GOA:D4MP05"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP05"
FT                   /protein_id="CBL35491.1"
FT                   /translation="MGEKMNNNSKRGIGLFLAAAFLDSLCFYAPVASLYRLAFGMTLFQ
FT                   ITVTESCFFAVSMLLELPWGFLTERIGCKTTLVIAGAFHLAAQLLFLAADSFWLFLLQR
FT                   CVLAAAASGCSGCDAAYLSSLSGHGAEHRVLGYYQAVSFAAVSIAGLFFPLAVRVGYRG
FT                   LAALTAVSVGTAFFLRCLLPDIQGSAKNCRTAGQQIREVGEMLLENKAFLVFVVSGAVL
FT                   SETEHTFTVFFSSPAWQAAAVPEMWYGALNVMMNLAGLGGSLASVWLSGRQGEKRGRAV
FT                   AVFWALAVFSSAGLWAAGESFWCVLLFPVFRFAAQGYLPCEQSLKLCHTGKAGKAASLS
FT                   AYNLIISAAGILPGPVIGACTRQGLSGGFFAGGLLLLTGAALAAAVWRKI"
FT   gap             105185..106100
FT                   /estimated_length=916
FT   CDS             106174..106893
FT                   /transl_table=11
FT                   /locus_tag="CL3_01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35492"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP06"
FT                   /protein_id="CBL35492.1"
FT                   /translation="MTEETCGCCGSLIKEGPVFNQRFADYGWCAYDTISEELVHRANQT
FT                   FEEEGMEAAQRVLIEYYKTEAPKQVEHILNASPSFAMREGMIRQCFEDHAEGRYYASVP
FT                   LSLIIIDGAVNDYTRKKGFFTAATTVDPWDCLVGCTEGLSKLKFQFNQNRLKTNTEPIY
FT                   IPYRNGILHGRDINYGNEYVSCKCIALMFAIADWMVRRSAREELEREELQKEELREAGP
FT                   GQGNRAEKGKDGRTCPL"
FT   CDS             107900..109243
FT                   /transl_table=11
FT                   /locus_tag="CL3_01230"
FT                   /product="Predicted acetyltransferases and hydrolases with
FT                   the alpha/beta hydrolase fold"
FT                   /EC_number="3.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35493"
FT                   /db_xref="GOA:D4MP07"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP07"
FT                   /protein_id="CBL35493.1"
FT                   /translation="MKQLTKYGVRAFYSAGIFLTANTVLAGVLWPEMGGLWRTTAAAVF
FT                   LLANFLPSFANRSLPTSRLRRCGNGCELLTLFLISATASVLFTLYGAKRMFDESFWLFF
FT                   WQILTAFLAEAAVFWNGMVRIYLSSFQLGAKWRVIGALCGWIPVVNLLVLIRLIRIVRE
FT                   ETDFESMRILRNRERKEERLCATRYPILMVHGVFFRDYKYFNYWGRIPKELEENGAVIY
FT                   YGNHQSAASVADSGRELLERIRELSRETGCEKFNLIAHSKGGLDCRYALSVLGMDQYAA
FT                   SLTTINTPHRGCVFADYLLNEIPKPVKDKVAAGYNRALRKLGDDKPDFLAAVTDLTASA
FT                   LRDFNQKVPDCPGVFYQSVGSKLNRASGGRFPLNFSHALVRYFDGPNDGLVAESSFPWG
FT                   ERFRFLTARGKRGISHGDMIDLNRENIPDFDVREFYVELVHDLKERGC"
FT   CDS             complement(109371..110093)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01240"
FT                   /product="Mg-dependent DNase"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35494"
FT                   /db_xref="GOA:D4MP08"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP08"
FT                   /protein_id="CBL35494.1"
FT                   /translation="MRLFDAHAHLGDEEELLSRKRENISSLVCAGTPEEAERLMLLCEH
FT                   SPFSPILLPALGLHPWQAGNVSFRDMEPWLLKAPVIGEIGMDSVWCDVPLSKQEKVFCA
FT                   QLELASALKKPVVLHTKGQEKKIAGLIRNYENTYLVHWYSGEEGFSDFLELDCYFTVGP
FT                   DVFYNPSVQRAARLAPENRLLVETDGCSAVKWAYENFCPSRSVSERSRGECTQRSSLFL
FT                   TGGIYAGFWSTVSARRLS"
FT   CDS             complement(110080..110529)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01250"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35495"
FT                   /db_xref="GOA:D4MP09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP09"
FT                   /protein_id="CBL35495.1"
FT                   /translation="MDRARKEALDNFPAFGLSGYEYKYPGSLSGGMRQRAAFLRTALCE
FT                   ADILLLDEPFGALDVITRGEMQDWLLTMRERLNRTVLLVTHDMDEAIYLSDRILILNGS
FT                   PARITCEISVEEKNRSRSWLYEQGSLRQTIYREIIKTGGKGNETV"
FT   gap             110569..111616
FT                   /estimated_length=1048
FT   CDS             111768..112148
FT                   /transl_table=11
FT                   /locus_tag="CL3_01260"
FT                   /product="desulfoferrodoxin ferrous iron-binding domain"
FT                   /EC_number="1.15.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35496"
FT                   /db_xref="GOA:D4MP10"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR004462"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP10"
FT                   /protein_id="CBL35496.1"
FT                   /translation="MALKFYVCKHCGNIVTYVKNAGVPVMCCGEKMSEIVPGTSDGAHE
FT                   KHVPAVSVEGQKVTVKVGEVEHPMLEAHWIQWIALETKQGSQIKYLNPGEKPEAEFVLS
FT                   EGDEAVAAYEYCNLHGLWKKEI"
FT   CDS             complement(112321..112617)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35497"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP11"
FT                   /protein_id="CBL35497.1"
FT                   /translation="MNTAWKQDPRLKTMDPEKVKYLSNLAETVECTPKDKLMPLFMSMA
FT                   AGSSQYHFSDDETDLLVSIMTAKMNPAEKKRVEMLRSLSRRLGAGKQGRPKKG"
FT   CDS             complement(112648..113214)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35498"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP12"
FT                   /protein_id="CBL35498.1"
FT                   /translation="MKSEPDLKMTDLDYLTASPHLQMIKAALPYIHVPEQRFFSLMVKI
FT                   SELERTVRLFQETEDGMVGICSLEEDEPSSPIDMLNAMKPYGTPQEQEFIDLVANFLQG
FT                   SRLYQSYRESAPETIRPVSPEHSGGTAESSADSSGPTARSRAEEAGRRDTGHFPIEQLK
FT                   NMLPPEQQSRLETAQLLMQTMQSLS"
FT   CDS             113326..113487
FT                   /transl_table=11
FT                   /locus_tag="CL3_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35499"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP13"
FT                   /protein_id="CBL35499.1"
FT                   /translation="MGIRLIIEGNAAYEIDEDCMACQNRSKEKGVVKGTEKRETRGRKV
FT                   RGTGKRDN"
FT   CDS             115003..117297
FT                   /transl_table=11
FT                   /locus_tag="CL3_01320"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35500"
FT                   /db_xref="GOA:D4MP14"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP14"
FT                   /protein_id="CBL35500.1"
FT                   /translation="MKAPNTNYVNRPVMKKDAMALVTGRAVYTDDIAPSDCLVVKALRS
FT                   PHAHALVKNIDTEKAKKVPGIACVLTWEDSPRCRFTQAGQTYPEPSPYDRYIIDRRVRF
FT                   VGDVAAVVAGETEEAVDRALKLIKTEYEVLTPVLDFRTAKDNPVLVHPEEDWKALCPVG
FT                   ADNQRNLCASGGEEEGDVDAVLADCDLVLERTYHTKANNQTMMETFRTFTYMDAFGRLN
FT                   VVSSTQVPFHIRRILATALGIDKSRVRVVKPRIGGGFGAKQTGVSEIYPALVTMKTGRP
FT                   AKMIYSRYESMIAASPRHEMEVRVKMGLNKDGLVRAIDVYTLSNTGAYGEHGPTTVGLS
FT                   GHKSIPIYTPEAFRFRYDVVYANFQASGAYRGYGATQGLFAVESALNEAAGILGIDPLE
FT                   IRRMNFVREGQRMPAYYNELLESCHVEQCMNRAAQMIGWKDKYPRRDMGNGKVRGVGVG
FT                   IAMQGSGISGVDVGSVTIRLADSGHYNMLIGATDMGTGCDTILAQMAADCLECEVDQIV
FT                   VYGVDTDNSPYDSGSYASSTTYITGMATVKACGELRDKIVRLGAQMLEAEEADADFDGS
FT                   FVYLLGDEEKRVSLADIAAKSMCGNDLSLEASASHSSPKSPPPFMCGMAEVEVDLETGQ
FT                   IDVINYKAAVDCGTVINPALARVQAEGGIVQGIGMTLYEDINYSEKGKLKENSFMQYKI
FT                   PARVENPDLEVEFESSYEPTGPFGAKSIGEVVINTPLPAIAHAVYNATGLWFHELPITP
FT                   EKVIRGLGKLK"
FT   gap             117973..118419
FT                   /estimated_length=447
FT   CDS             118642..119058
FT                   /transl_table=11
FT                   /locus_tag="CL3_01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35501"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP15"
FT                   /protein_id="CBL35501.1"
FT                   /translation="MYLLHLRVGQAVFSHETALFFHDLTDREPMEYTVTVKTGYNPTKL
FT                   KAEGVQVFTIKAELHEVGLITAQTPFGHTVPVYDMERTICDLLRSRNNMETQIFQGALK
FT                   MYARRKDKDLRNLMRYAGMFRVEKILRQYLEVLL"
FT   gap             119101..120956
FT                   /estimated_length=1856
FT   CDS             121071..121988
FT                   /transl_table=11
FT                   /locus_tag="CL3_01360"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35502"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP16"
FT                   /protein_id="CBL35502.1"
FT                   /translation="MYIDINTGRIPYRPENFGNSRAGQTDSEKRRNGYMWSIGEVKRRG
FT                   WRQIGLYYWPAFLLLLIFSLASGLGEVFRVDTDSLIEGIMEGGAFYGIWDMAAGLLLSF
FT                   VAISGLVGLLVRIFVLNPMEVGVYRFFMESRAEGFSVGVSRILYAFSSGSYGNIVKIMF
FT                   FRDLFLFLWTLLLIIPGIVKSFEYRMIPYILSENPDADMRDVFALTKDMMRGSKFQLFL
FT                   FDLSFLGWYLLGILACGIGLFFVAPYVSAAEAEVYAELRNSVSGFPLRGFGERNTDSSG
FT                   ETEMKAGEAMKTRNRIKAAGTDRA"
FT   gap             122004..123079
FT                   /estimated_length=1076
FT   CDS             complement(123524..123808)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35503"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP17"
FT                   /protein_id="CBL35503.1"
FT                   /translation="MHGEAMNFPENKKHRGAGNFRYPADGGPAFRKPWPPSSYRYFAAL
FT                   PVSVICPVELFILPPESGKACALPLSRAWNPCCFLLLKPSARHRAGTSF"
FT   CDS             123855..124436
FT                   /transl_table=11
FT                   /locus_tag="CL3_01390"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35504"
FT                   /db_xref="GOA:D4MP18"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP18"
FT                   /protein_id="CBL35504.1"
FT                   /translation="MSLVPYVIESTSRGERSYDIFSRLLKERIVFLGEEVTDVSASLIV
FT                   AQLLFLESEDPNKDIHLYINSPGGSVTAGMAIYDTMNYIKCDVSTICVGMAASMGAFLL
FT                   AGGAKGKRLALPNAEVMIHQPSGGARGQATEIQIVAENILRTKKKLNEILAANTGQPYE
FT                   VIERDTDRDNYMTAEEALKYGLIDRVIAGR"
FT   gap             124772..125536
FT                   /estimated_length=765
FT   CDS             complement(126424..126540)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35505"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP19"
FT                   /protein_id="CBL35505.1"
FT                   /translation="MTYRSPLPVRARRDAALSRSREKLPPSVKSGGLSSAPA"
FT   gap             128175..128517
FT                   /estimated_length=343
FT   gap             130037..130944
FT                   /estimated_length=908
FT   CDS             complement(131142..131678)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35506"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025374"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP20"
FT                   /protein_id="CBL35506.1"
FT                   /translation="MLAEPMTLYELMNLYMLKQVNFPLTNAQLSNFFLDRDYTTYFTLQ
FT                   QALNELLEAGLIRQETLRNSTRYEITKEGEDTLEFFGKTISPAIVEDMDQYLKENRFRM
FT                   RNEVGLVSDFYKSTHQDYTVHCEVREGKNVLVSLDVSVPDKDQAEMMCSHWKDKSQEIY
FT                   SFIMKSLMTDKPVNP"
FT   gap             132364..133664
FT                   /estimated_length=1301
FT   gap             134537..136052
FT                   /estimated_length=1516
FT   CDS             136829..137395
FT                   /transl_table=11
FT                   /locus_tag="CL3_01510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35507"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP21"
FT                   /protein_id="CBL35507.1"
FT                   /translation="MSLILCRQEEVKNPLYIEALGIHIWSSQELCYVIYNYPLLAMDHL
FT                   LDDSLTEFIEKELQMTVISVKIQNGLRNGEDRDELIFMILEECRYYDTKEITAFRQKIA
FT                   TYRGMGPFEFAKVTADYYYSLRQYGTALGCYEKLLDDRRNTAADDEFLGRVWNNIGACY
FT                   AGLFWFDKAMQAYEMSWIYRKTRTR"
FT   CDS             137401..137640
FT                   /transl_table=11
FT                   /locus_tag="CL3_01520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35508"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP22"
FT                   /protein_id="CBL35508.1"
FT                   /translation="MYYLTLMDPKLKVKERFGGVLLEEKKDEWKEAFDETVSRAGKSEG
FT                   VRRVEEMFNQDEKSRRQASGELLSRWKSGYRTMI"
FT   gap             137759..138165
FT                   /estimated_length=407
FT   gap             140452..142316
FT                   /estimated_length=1865
FT   gap             143282..145269
FT                   /estimated_length=1988
FT   CDS             complement(145435..147582)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35509"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP23"
FT                   /protein_id="CBL35509.1"
FT                   /translation="MKKRFLNLPECLSGLEAKTWKRRLVPLAAGMLLLSSFPALAAGRW
FT                   QSAEGEKYYIKEDGSRYENTWFSIESIPANPLAKVTVTWYYAGPDGAVLTNGWHEIEGK
FT                   HYYFYPGGNSPRNAFFNLDGKRYYVDETGARAEKGWFSVTTVNSSAGVSSVSWYYANPD
FT                   GSLRTGGWQVIDGVEYYFDANGRSPRNNWVNIEDARYHVDERGGKQTGWFSVSGVNGNG
FT                   QAYENWYYAEPDGKLARNGWKDLEGHRYYLDANGLSYRKRWYVDGDKNRYYLDEGGILQ
FT                   QNGWFRITNTSASTGVTTENWYWADAAGSVKKDGVYEIDGAMYRFDSNGTMYKKRWYTD
FT                   EKGKKQYFGENGAMCRGQWFSISGERADGSEYTNWFYADENGLILTNGWKTVDGKDYSF
FT                   NTGGNISTGWLDDDKYYCGDDGARRYGWSWIELDYDWIDDNDNVRRYADQNGDWGWFYF
FT                   SPESGRKRESGSGFEESRVDGITYCFDTYGIMQMGWVKMRGASPALSGYRYYFPSAGLE
FT                   GFIQGQKAEDCWLMTELPEDIDGASGEKWRYFQGNGAPVCAPAGGYVIQKIDGKKYAFD
FT                   DRGAARTGLLEIDGEVYYFGEPDGDYSMVTGACELTDDTGEKADYYFEASGKGATGIKN
FT                   GRFYYKGRLQTADRHAKYEVFRVPGKGLRLIDSNGKVVKGRKVTDGDKCRWKVNSSGTI
FT                   EEFGSDYVAEITEPETVPYEG"
FT   CDS             complement(147792..148409)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35510"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP24"
FT                   /protein_id="CBL35510.1"
FT                   /translation="MKIRYQAGILAAALSLSVMTMAFAAGSPSTNPRPIGGGGSSSSSG
FT                   PRPIGGGSYNPGGPGITTIEDGSTPLASSGSGVLSGNTNAGVGVTFTENFGASISDNQI
FT                   AQVNAGLSTIQSLPSDTDLAGYNPLVRIQNMETTASTDGQPIQFSIYVPNLVEGLNNIQ
FT                   ILIQNPSTGKWELVAPTAVSTGTKTVTVSLNYAGPLTVVYKN"
FT   CDS             complement(148466..148735)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35511"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP25"
FT                   /protein_id="CBL35511.1"
FT                   /translation="MEQATNEQQKDSQFLGKTFDALQEYMVTDLNKDAYLDAGLAAMGT
FT                   ENLFGGDHFFTVPGEGTEGLVYDEFYPDEEAFEEMIIDLFYRET"
FT   CDS             complement(148716..149507)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01620"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35512"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP26"
FT                   /protein_id="CBL35512.1"
FT                   /translation="MTENKKRQRWLAAILKIFVFAAVVGFVTFSVQSYQAKKEAEMMAE
FT                   MRKSEREKTGFQTGDREAVRVYNGKEYRQNTLNTVILCVGVDTSGAVEQQKVSGAGGQA
FT                   DVMALLIQNRATDEVNILTIPRDTMTEIRLFDLNGNYLGTDVQHLNLAYGYGDGEQESC
FT                   ELLTEAVENLLGGVEIDGYVSVNMSAIPVLNDLVGGVTVTIDDPGMEERDPSLPYGETV
FT                   TLHGNRQRPMCATGHQCFPERHFKNGSPQDLREGVDGASHE"
FT   CDS             complement(149504..150082)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01630"
FT                   /product="Sugar transferases involved in lipopolysaccharide
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35513"
FT                   /db_xref="GOA:D4MP27"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP27"
FT                   /protein_id="CBL35513.1"
FT                   /translation="MDILGAAVGICLTVLIGLFVVPAIKLESPGPAVFKQTRIGKNGRK
FT                   FSIYKFRSMYMDAEERKKELMKQNEMDGLMFKMKDDPRITKVGKFIRKTSIDELPQFFN
FT                   VLRGDMSLVGTRPPTVDEFERYEEHHKRRLSLRPGITGMWQVSGRSDIQNFEDVVRLDL
FT                   EYIDNWSVWLDIKILFQTVLVVLLHRGAE"
FT   CDS             complement(150158..150916)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35514"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP28"
FT                   /protein_id="CBL35514.1"
FT                   /translation="MSVKNRSFYILIDLAAMAAAYVMTQLALYGSLPARMKWYGLTMVL
FT                   GVYLVSDLFFGHEKPLAEESAVETFLDVVRQTVYMAFLFALLLFLLGQRGGDTRLFFGL
FT                   LVLFSFGCLYLGRIYCKAVIFNYYGNEKNRTRLLIFANPSNAQRTMGRLAASNLYMYEL
FT                   IALVIMDCEGKNPELNLIRPKDAGGYERESTSDFDLTEYLKRQAVDEALISLPASSREC
FT                   ISSLLGSCSAWGLSSMWRPAAWDSQRRKSR"
FT   CDS             complement(150906..151148)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP29"
FT                   /protein_id="CBL35515.1"
FT                   /translation="MKKNKRRKRLIILFMVLMIGAAAAMLSSRLGISGSGEQGGPRWDI
FT                   LAAEGLLLAGGYGLALAAGGEGRKRLRKDVSSHVG"
FT   CDS             complement(151233..151934)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01660"
FT                   /product="capsular exopolysaccharide family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35516"
FT                   /db_xref="GOA:D4MP30"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP30"
FT                   /protein_id="CBL35516.1"
FT                   /translation="MGKMMKVVNIHTDENRDFRFEEAIKTLRTNIQFSGPDIKTVMFTS
FT                   AVPGEGKSQITVSEAMSLAGLGKKVLVVDADIRKSVLLTRYQVEQEVHGLTEYLSGQRQ
FT                   MEEVICTTDIQGMDIIFAGPYSPNPSELLAEPLFKELILKKREEYDYILIDTPPMAGIT
FT                   DGAIISTVCDGAVLVIAAGTVSRRIERRIKEQLEKSGCRILGAVLNKVTSEHGGYYGKR
FT                   YRKYYGYGAEK"
FT   CDS             complement(151937..152641)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01670"
FT                   /product="Capsular polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35517"
FT                   /db_xref="GOA:D4MP31"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP31"
FT                   /protein_id="CBL35517.1"
FT                   /translation="MEKNRYEENDEIDLLELFYELKKKLWLIILAAIIGGGAFGLYSKM
FT                   ILVPKYTSTAMMYVLSKETTLTSLADLQIGSQLTQDYKVMITSRPVLQQVVDELGLEYG
FT                   YKALREKLTIDNPKDTRILTLSVEDPDPILAADIVNTVAECSSEYIGEIMEMIPPKIVE
FT                   EGEAAVAPTSPNVKKNAVMGAAGGIFLVCAFVAVRVIVNDTVKTEEDVEKYLKLSVLAS
FT                   VPEKDKGKRGQR"
FT   CDS             complement(152648..153421)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01680"
FT                   /product="Capsular polysaccharide biosynthesis protein"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35518"
FT                   /db_xref="GOA:D4MP32"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP32"
FT                   /protein_id="CBL35518.1"
FT                   /translation="METGGLKGRREMLRRKVKAELTDVHAHILPGVDDGAESLEEARQM
FT                   LQMAYDQGIRRIIATPHYRRGQDTARLRELARELKKEAEKIDSDFRIYLGQELMDSEEL
FT                   LEDLKEGRAFTMAGSRYILIEFQPVVSFSHMCQRLRQLQMAGYLPVIAHMERYECLKRG
FT                   ERVRDLIQAGNFTQMNFSSLQGNPLHKNTRWCRRQVLDGNVHLLGTDMHHINQRTPDIK
FT                   KAVSWLSRNCTRSRLYWMVWKNPAYIIKKKEGMGR"
FT   CDS             complement(153787..154632)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01690"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35519"
FT                   /db_xref="GOA:D4MP33"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP33"
FT                   /protein_id="CBL35519.1"
FT                   /translation="MKKMKMTEAKMEAYRIYLMESEKSPSTIEKYLRDIRNFYQFLPEE
FT                   KIIDREAVLLYKRQLIPKYQISSANSMIIAVNGFLSFMGLEELRVKVFKFQRAMVSDPE
FT                   REIQREEYIRLVEEAERMGKSRLSLILQTLGATGIRISELVCITREAVSSGRAAVNLKG
FT                   KTRVVILPKRLREKMEIYCRENQIYSGPVFVTRGGKPVDRSNIWSEMKILCKTAGINEK
FT                   KIFPHNLRHLFARIYYKNNHDIVYLADILGHSSVETTRIYTSISGFEHEKVLEDMELII
FT                   "
FT   CDS             complement(154855..155079)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35520"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP34"
FT                   /protein_id="CBL35520.1"
FT                   /translation="MDMMKFAGMWAGFRDRHPKIPMFFKKASETGAFCAGTVLELTIKT
FT                   SEGKEMTANMKILPEDVDLLKQIAGIKGK"
FT   gap             155115..155385
FT                   /estimated_length=271
FT   CDS             156367..157239
FT                   /transl_table=11
FT                   /locus_tag="CL3_01720"
FT                   /product="Galactose mutarotase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35521"
FT                   /db_xref="GOA:D4MP35"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP35"
FT                   /protein_id="CBL35521.1"
FT                   /translation="MIYEITNNGISARVDSLGAQLISFMDEQGTEYIWQRNPKVWSSCS
FT                   PLLFPIIGNLRDGKTIIGGKVWEMPKHGFTRNTQFHLLNRTESSVTLGMSDSDFPEDSF
FT                   PFAFEFSITYSLDGKTLTFFTEIRNPADRELPFCYGLHPAIRCPLFAGESFDDYVIRFG
FT                   RPQLRGYRAYDLEKLQFDKNSEHPFPGSGTDISLSHSLFSEDALWFDRPDSHEVSIINP
FT                   RSGRGIHAHFEDFATVAFWTKPVPEAEYICIEPWNGSSACSDEDDEFLHKNHLRILKKG
FT                   LYKALSWSC"
FT   gap             158520..159808
FT                   /estimated_length=1289
FT   CDS             160559..161806
FT                   /transl_table=11
FT                   /locus_tag="CL3_01750"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35522"
FT                   /db_xref="GOA:D4MP36"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP36"
FT                   /protein_id="CBL35522.1"
FT                   /translation="MKTQKQTINEMIAQIIAEARKLGYSEATIWRNITPKFQTVAVYYE
FT                   KRGVCFYDPAITRELVDLQKERLDREEISIHYYKRVKSAANRLDEFYLTGTLHLNMPKH
FT                   GTKYPVSEDSEKLIDLFLDYKGYGPNTRDDVVWVVRRYLHYFESLGYASLEWVTVEQVR
FT                   EFILKTAAEVKTSSLHNILLYLKHFHIFLKESSLPAPDCVELFSYRVYRDMPIQSYVTD
FT                   EELDQILRVIDTDSEMGKRDRAIILLAATTGLRAGDLIRIKLTDIDWRKGEIRFTQRKT
FT                   GRVSYTPLVKEAGEALQDYILNARPRSESPEVFLRLIAPRTGLADAVSIGCMFQQYQRK
FT                   AGIYRHAFDGKGFHGLRRRLAKKLLVTGTPLTTITQILGHDDPKSARQYLSLDTRNLKE
FT                   CALDFKGIPLERGLEG"
FT   CDS             161803..162777
FT                   /transl_table=11
FT                   /locus_tag="CL3_01760"
FT                   /product="Site-specific recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35523"
FT                   /db_xref="GOA:D4MP37"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP37"
FT                   /protein_id="CBL35523.1"
FT                   /translation="MNDKFASGFAQDLESMIALKCALGYSENTYLEKAKSFDRRCFEVY
FT                   PGQQELTQAIVLNWLKPEPGKSPQTIHGKAAFVRALGKYQKSIGKAAYILPDRFTAGGT
FT                   VFIPYLFGDDELAALFHEIDCYQYPRDPFRPHLLRTYFRMTYTCGLRPNEGRHLKRNEV
FT                   DLNSGEVRIIETKWRKSRTIVMSEDMLFLARSYAGIRDAAFPGSAYFFPAPDGGPYSAQ
FT                   KMQGKFKWFFARTKPGIPKDLLPAVRVYDLRHRFATAVLNRWLDEKKELSSRLPYLQTY
FT                   MGHKDWEATAYYIHLLPEKLVKSAGIDWEAMNGLIPRVELWEK"
FT   CDS             162765..163802
FT                   /transl_table=11
FT                   /locus_tag="CL3_01770"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35524"
FT                   /db_xref="GOA:D4MP38"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP38"
FT                   /protein_id="CBL35524.1"
FT                   /translation="MGKVKDEQLFSLLRNFLLIYLPNQRHASSNTVKAYRTAWNQLLKY
FT                   IAGQKKIPMMSVTFGMIRYEMVVAYLDWLSEEKGVGPATRNNRLAAIRAFITYASACRP
FT                   EYISLSSELAAIKIQKKKRFREVDYMSEDAVKALFAAPDTRTKMGLRDQFLMIFLYDTG
FT                   ARIQEALDVKICDLRIDKTPTVTLHGKGGKIRVVPLMKDTVQHLDNYMGVFHKGESVFS
FT                   TEWLFYVERKGSRSAMCDDTARLRIQKYAELARENCPDVPERVHPHLWRHTRAMHLYQH
FT                   GMDLTMISQWLGHKQVETTLIYAYADTEAKRKAIEKAMGTGLAGTESVNYTVSDEDMLR
FT                   RLYGL"
FT   CDS             complement(163927..164136)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35525"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP39"
FT                   /protein_id="CBL35525.1"
FT                   /translation="MKALVKNELRLTRKLLLIWMGIVLILCGFAYFEYLSLKESLNELT
FT                   GLISNFPKILKAMGYTESWIIPKL"
FT   CDS             complement(164149..164940)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35526"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP40"
FT                   /protein_id="CBL35526.1"
FT                   /translation="MLIFRFEWKRKRKYILIWAATLAVCIFSMTPVYYGMIETVETLPV
FT                   EFTQGGFFETVGISLELLMEPLGMYSFLTGFFMVAGGIFGMHLGLSLHTEECTGNTAEY
FT                   LYTKPCGRKQIYMGKLLCALAGICVTGIFYLATSFLTMTLFRFGFPIGEFFLVAGSFIL
FT                   ISLFFALLGLMVGIFHPNNRSPLLTAGLVVFVEYCITSFSRTVNIRAIGFLSPFSFFSP
FT                   AEIHNAGTYSWDYMLWYLLLLFGFALLAYWKILKRDIALAV"
FT   CDS             complement(164950..165375)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP41"
FT                   /protein_id="CBL35527.1"
FT                   /translation="MDEPTSGLDPLIQQAFYDILKEENKRGVTIFLSSHVLSEVQRLCD
FT                   RVAILREGKLISVQSMKELRENGYKKISLTAKSAIPEDFFSVPGTANLEWDKSKTSVSF
FT                   MFCGPVMMIMNQLHRLELEDILIEEPSLEEVFLHYYE"
FT   CDS             complement(165417..165839)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01810"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35528"
FT                   /db_xref="GOA:D4MP42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP42"
FT                   /protein_id="CBL35528.1"
FT                   /translation="MSKPVIVLNELTKSYGKHRGIENISFTVEQGEVFGFIGPNGAGKS
FT                   TTIRTLMGLLKPSNGGASIFGLDCSREPARIAKDVGYLPSENCYYNNMKVKEMLFYTAE
FT                   LYGVNAHSRMEELAERLNLDLSRRIGDLSLGNKKKS"
FT   CDS             complement(165836..166441)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01820"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35529"
FT                   /db_xref="GOA:D4MP43"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP43"
FT                   /protein_id="CBL35529.1"
FT                   /translation="MEKFLAFSQEKQATIRNAALACFARHGYEKTSINDIAVAAGISKA
FT                   SIFQYFGNKQTLYQYLFDYCAAQMKQAYNTSALEETTDFFDRVWEASVMKVEILKKHPH
FT                   IASFIASVAVEPTPELKSAIFSEANEKYIASLVLHERDYKKFRHPEDAELVFQMLMMLA
FT                   KGMSVQLESGVDYDSMMKEFRNILDMLKHNFYKEEYLP"
FT   CDS             167527..168549
FT                   /transl_table=11
FT                   /locus_tag="CL3_01840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35530"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP44"
FT                   /protein_id="CBL35530.1"
FT                   /translation="MKPEVQEELQPLFDQCIQDAIDGRITRLDSLWPPVVVSSEGAPFE
FT                   VHALVRKWTEAQQAETLDAEKAIAFSENLRRQSRWGEIDYYLLDMLKRELQEKYFVVTG
FT                   NEDDHFWDREYSLKPGIRAEEVPEPLLRFACYVAVSYKVYGLDFEYLDANYLFGLVEKV
FT                   RPDMVKKLREHGTGKLPLSLQKRKTEHFTASANDAFAVIRITARDNTEECCREVLNYLC
FT                   EILEQEDFPRSYAVEFKGPEKSYLPITGLPKKGVNQLFACAVEYPGPPPPRWNSTPGLP
FT                   CGNMSSTPISAMSSARSPEVLPCSPWECWGKSGGSWYGIISISAMMSTPTYRKNSSGSM
FT                   "
FT   CDS             168796..169674
FT                   /transl_table=11
FT                   /locus_tag="CL3_01860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35531"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP45"
FT                   /protein_id="CBL35531.1"
FT                   /translation="MLYEWINDSKTKVTGSPSNAEADGNNIGTAPARDMVYYNAVEEGW
FT                   RADGWYEIDGSEDLEADSDTDWYYFDDGEVEKTESSDAFNLPTGKTEYRMKKKISENGS
FT                   KYFCFNEKGQMQTGLPYVNDGFYFFDDNGYMQTGKVSNVEEDNDSFTYYFNTSNGHNGQ
FT                   GVTGEKSGYLYFNGKRLEADDDYRLYFVKDKVYLVNTSGKIQSSKTKKFYIEELDKEYK
FT                   ATFGSGDNVLTLTELNDDGDETTNVINFETLATENAMRDGVTLPVIELYDSEYSYEFKD
FT                   GEWIAGFTVAQ"
FT   gap             169774..170972
FT                   /estimated_length=1199
FT   CDS             171771..171884
FT                   /transl_table=11
FT                   /locus_tag="CL3_01890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35532"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP46"
FT                   /protein_id="CBL35532.1"
FT                   /translation="MENKDTEQKKPPRRSFLYYYGIVMLVLLLLNILYFRL"
FT   gap             172780..173498
FT                   /estimated_length=719
FT   gap             175509..175904
FT                   /estimated_length=396
FT   gap             177680..178620
FT                   /estimated_length=941
FT   CDS             complement(180001..180903)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01960"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35533"
FT                   /db_xref="GOA:D4MP47"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP47"
FT                   /protein_id="CBL35533.1"
FT                   /translation="MQRKSADSCCFSVQTEVLMKAAKTAEYLTDFYSRYDEERRLLLRH
FT                   GTVEFLTTMRYIEKYIKPGDRILEIGAGTGRYSHALAHRGYRVDAVELVDHNIKIFRSH
FT                   ITPDENVSITRGNALDLSMFPDSQYDITLLLGPLYHLYSTEDKRQAVREALRVTKTGGI
FT                   IFAAYVISDGCLLDEGFHRQNIHVAEYIKNGLLDPETFAAKSEPKDIFELVRKEDIDDL
FT                   MSVFPVTRLHYVASDGCALFMREAIDAMDEEMFQLFLSYHFATCEREDLSGVTSHALDI
FT                   FQKGPGNFFPEYLQKRQQE"
FT   CDS             complement(180884..181435)
FT                   /transl_table=11
FT                   /locus_tag="CL3_01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35534"
FT                   /db_xref="GOA:D4MP48"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP48"
FT                   /protein_id="CBL35534.1"
FT                   /translation="MILKAVLNITRRTGFETVNARSIAHELQCSTRPIFTCYENMEELK
FT                   KEFLDYAFDFYSRYAEHYSQTAGGNPCLSLPLSYIAFASEETFLFKLLFVTDMDLDMRD
FT                   ANDFYTEIGNEQKAETFSEMIGVNLETAKRIFLDLFLYSHGIAVLTASGKLALQRDKIE
FT                   DMVQHFLSALINQEHAEKVC"
FT   gap             182157..182597
FT                   /estimated_length=441
FT   CDS             complement(183596..184198)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02010"
FT                   /product="Cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35535"
FT                   /db_xref="GOA:D4MP49"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP49"
FT                   /protein_id="CBL35535.1"
FT                   /translation="MNRIITIGREFGSGGRELGLRLSQKLCIAYYDQEIITEISKRTEL
FT                   SEQYIRKMSEKKPVFSFPLHIGRSFHYMQNSPWDLNLSIFREQSSIIREMAQKSDCVIV
FT                   GRCADDILQEMNPLRVFVYADMEAKLTRCRQRSASDEQMTDREILSNIRRIDKSRSEYY
FT                   GLYTGKVWGDKRSYDLCINTTEISMERACALLAEFFR"
FT   gap             184831..185698
FT                   /estimated_length=868
FT   CDS             186499..187122
FT                   /transl_table=11
FT                   /locus_tag="CL3_02050"
FT                   /product="Phosphate transport regulator (distant homolog of
FT                   PhoU)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35536"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP50"
FT                   /protein_id="CBL35536.1"
FT                   /translation="MSKKQDAFYFDNFVACADYSVKAARLLKEILSDYRPDEISGRLDE
FT                   MHELEHQADGQRHKITDKLAKAFITPIEREDIAALSQLIDEVTDKVEEVLIRIYINNVQ
FT                   TIRPEALPLVDVMSRCCEGVYNLLKEFADFKHSSKLKQEIININSLEEEADSLYISSMR
FT                   KLHTEETDVRQIIAWREIYDYLEKCADTCEHVADTVGSVVMKNS"
FT   gap             187580..188004
FT                   /estimated_length=425
FT   CDS             complement(188125..189330)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02080"
FT                   /product="SAM-dependent methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35537"
FT                   /db_xref="GOA:D4MP51"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP51"
FT                   /protein_id="CBL35537.1"
FT                   /translation="MNTNAVVHIKKGEARALKAGGAWIYDNEIDRIEGEFENGDIVTVL
FT                   DFDGYCLGYGFINTRSKITVRMLSRRKDAVIDEAFLEMRVRNAWEYRKATVDTSSCRII
FT                   FGEADFLPGIVIDKFSDVLVVESLALGIDRLKPLIVEILKRILAEDGIRIRGVYERSDA
FT                   KVRLQEGMERTKGFIGEEFDTKVEIVENGVRYLVDVKDGQKTGFFLDQKYNRLAIQKLC
FT                   RGKRVLDCFTHTGSFALNAAVSGASEVLGVDASELGVSQARENARLNQVSDRVSFVCAD
FT                   VFELLPELEKKGEKFDVVILDPPAFTKSRSSVKNAVKGYREINLRGMKLVKDGGYLATC
FT                   SCSHFMTPELFTKTIREAAGNVHKRLRQVEYRTQAADHPILWAADESYYLKFYIFQVCE
FT                   EK"
FT   gap             190241..190462
FT                   /estimated_length=222
FT   CDS             191417..191500
FT                   /transl_table=11
FT                   /locus_tag="CL3_02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35538"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP52"
FT                   /protein_id="CBL35538.1"
FT                   /translation="MNRSRRKTGAFERGLLLSYSIGNFISY"
FT   CDS             complement(193248..193679)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35539"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP53"
FT                   /protein_id="CBL35539.1"
FT                   /translation="MTKIRKNILPAMILLFQLFFLYELICNYNVYVLDPSFRSFSEDYW
FT                   ADFSADGAVKLASAVELFFKCIFILSFLYLIMRNPNASWKRIVLAVLAGFVLYGILMLL
FT                   FRHFSYHCRLYMTLTDTEILSILLLFQTAQPGLFQKRLP"
FT   gap             193748..193875
FT                   /estimated_length=128
FT   CDS             complement(193894..194025)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35540"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP54"
FT                   /protein_id="CBL35540.1"
FT                   /translation="MNTSIAKAFLIRGAERNPVFTYPNREWGYGTLNLYNAFLRMRE"
FT   CDS             complement(194022..195374)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02160"
FT                   /product="Subtilase family."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35541"
FT                   /db_xref="GOA:D4MP55"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP55"
FT                   /protein_id="CBL35541.1"
FT                   /translation="MESSGILTAFAQPSLALRGRGTLIGIVDTGIDYRNPIFLGSDRST
FT                   RILGLWDQTEEGPGIMMGNILEDIPYGREYTREEINQALEAEDPFSVVPSRDESGHGTL
FT                   LAGIAAGNETDSASFTGAAPEAFLAVVKLKQAKQYLRDYYLIPSSSEAYQENDIMMGIK
FT                   YLLLVARRHRLPLTILISLGTNMGSHEGTSPLARYLDTVSAFPGVVTVIAAGNETGYSH
FT                   HYFGTVEADEEFEDVELRIASGEEGFTMEMWTQEPELFSVGFLSPTGELIGRIPNNSPM
FT                   EQRITFLLEDTVIYLNYQVAEFETGSQLIVMRFVRPTPGIWRLRVYNSLYLKGAYHLWL
FT                   PAHGFLSEDTFFLRPHPDTVITEPGNASLPITVGAYNHRSGGIYIHSSRGYTRLGRVKP
FT                   DLAAPGVDVEIPSSSGLSPIRITGTSAAAAHAAGAAANLLSWAFRDGSFPI"
FT   CDS             195464..195610
FT                   /transl_table=11
FT                   /locus_tag="CL3_02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35542"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP56"
FT                   /protein_id="CBL35542.1"
FT                   /translation="MVDGILTADNRKTALLCLSLRKSGGRRIEGQCSLRKGKIAYNKIR
FT                   VIL"
FT   gap             195734..196213
FT                   /estimated_length=480
FT   CDS             complement(197724..198083)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35543"
FT                   /db_xref="GOA:D4MP57"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR023804"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP57"
FT                   /protein_id="CBL35543.1"
FT                   /translation="MGKSKLQAMLRSLLASYLLTAIFLAVLAFLLYRFRLQEAQISLGI
FT                   NVIYIIACLIGGILAGKAIRQRRFVWGLLSGALYFLILLAVSFAMNRTLGSDTKELMTV
FT                   FLMCAGSGTLGGMLS"
FT   CDS             198271..198417
FT                   /transl_table=11
FT                   /locus_tag="CL3_02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35544"
FT                   /db_xref="InterPro:IPR023975"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP58"
FT                   /protein_id="CBL35544.1"
FT                   /translation="MKHVKTLSTNTLKNTMKKGGCGECQTSCQSACKTSCTVGNQSCEN
FT                   KDR"
FT   CDS             complement(198858..200720)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02210"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35545"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP59"
FT                   /protein_id="CBL35545.1"
FT                   /translation="MNEKEIQRRIFRITVLTVAVSLILIVCAGVVITSMLRAEKNSYEA
FT                   QMKAFINEYKINMERQMDSDIESLETLAGFISNSRLLELENLADGIDGAGTAALFLRLG
FT                   YCEKGSDKIRISMTRELGRDLPISERAPELQEVIEKGWNGENATSQVYMDVTLKTPVIA
FT                   YSVPVYDESGILKGCLLGVRALDVFQDILNETTLSQISLDVAWLDADGNFVGHTEEEEG
FT                   RHMSASIFSQEGISEKDRSLLRENMAMGRDCTISYQYGGSTYGLYLEPLDRNDWYLLCI
FT                   DDSDKVKSPVYFMLLAVATTFLIILVLSIASIWYGSRILRKNNRELIRTAYYDSLTGLF
FT                   NMKRFEQEASELLEQDGCRSVAALNIRHFRYINEIFGKKQADQVLCELALIIRENIRED
FT                   ERFCRYNGDQFCMLLHTVEEEEIRRRIGDIMKSCERISRRFNRNYPIQIYAGAAVNQVT
FT                   RPDELIDRAEFALKQARQGVERDIVFYDEKLHKAEELVRLIESSKNEALEKEEFRLFLQ
FT                   PKRDLASGEIASAEALVRWIREDGSVIFPDQFIPLFELNGFCAQLDLYMVAQVCRKLRQ
FT                   WEDEGRRGLFCRDTLPPRQSSTGRPDCSHGQYAGTGPLPRSFSF"
FT   CDS             complement(200737..201537)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02220"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35546"
FT                   /db_xref="GOA:D4MP60"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP60"
FT                   /protein_id="CBL35546.1"
FT                   /translation="MLIKEEFLKKYNIAENEFRSANISFRELERIYNHYCSLEPKLRSI
FT                   SRDFLDEYLYDTERAGIHSYRYRLKEPGHLIEKIIRKRNDSLDSYQEIDSTNYYKYITD
FT                   LIGIRVFFLYREDWRGFHEYITGRFENNPEHYVEDRLRDFDEDPGHWYIAERPKSYRRI
FT                   GDTKIYDKNLIDIKSDGIYRSIHYIVKYKGYYVELQARTLFEEGWSEVDHDIVYPYFQN
FT                   DVMLKDFSTLLNRLSGMADEMSSYFRRLKEAKERYQMEEDRHSL"
FT   CDS             complement(201620..202633)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02230"
FT                   /product="Galactose-1-phosphate uridyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35547"
FT                   /db_xref="GOA:D4MP61"
FT                   /db_xref="InterPro:IPR000766"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR023425"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP61"
FT                   /protein_id="CBL35547.1"
FT                   /translation="MKQSGYPKCQLCMENEGYAGRANHPARNNHRIIPITVNGSPWGFQ
FT                   YSPYVYYNEHCIVFNGKHTPMKIDRAAFVKLFDFVKMFPHYFLGSNADLPIVGGSILTH
FT                   DHFQGGNYTFAMAKAPIEKYFTVPGFEDVEAGIVKWPMSVIRTRAKDPERLIELGDKVL
FT                   GCWREYTDEAAFIFAETDGEPHNTITPIARKNGEMYELDLVLRNNITTEEFPMGVYHPH
FT                   QELHHIKKENIGLIEVMGLAVLPSRLKGELAKLAEYIVSGRDIRSDEEIEKHADWVEGF
FT                   LPKYPSVTAENVDEILKKEVGLVFEKVLEDAGVYKFTPEGREAFARFLHAAGFQEK"
FT   gap             202647..203472
FT                   /estimated_length=826
FT   CDS             complement(203822..204055)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35548"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP62"
FT                   /protein_id="CBL35548.1"
FT                   /translation="MSRRRPGKDGRRMDSYGTEEKVKKRRMREKAEKNKTQTEADIVRG
FT                   RRKQKQSTDRRDRRHRNKRNGNRRNGNKGNKN"
FT   CDS             204185..205225
FT                   /transl_table=11
FT                   /locus_tag="CL3_02260"
FT                   /product="Membrane-associated lipoprotein involved in
FT                   thiamine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35549"
FT                   /db_xref="GOA:D4MP63"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP63"
FT                   /protein_id="CBL35549.1"
FT                   /translation="MNQKRLTQAAGVLAGAAVLAACFFLDQKTVPQEPISRSDFLLNTF
FT                   VTVTLYDTDDEELLTQCMALCREYENRFSKTIADSEIYKLNHRSPDETTFTLSDDTAAL
FT                   LREGLYYSQVSDGAYDLTIEPLSSLWDFTGGQAVIPPQSSIDEAVSRVGYENLSLDGNK
FT                   LTFLSPDTTLDLGSIAKGFIADRLKDFLASRGVESAIINLGGNVLCIGTQPDGTPFRIG
FT                   IQKPFAEYSDVVGYVDIDDMSVVSSGVYERHFVADGKNYHHLLNPKTGYPYDNGLISVV
FT                   IICPESVDGDALSTTCFSLGLEKGVELLDSTDDACGIFITDDYELHFSEGARELSIYDI
FT                   HGKPLN"
FT   gap             205240..205942
FT                   /estimated_length=703
FT   gap             207198..208031
FT                   /estimated_length=834
FT   CDS             complement(208191..209498)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02300"
FT                   /product="citrate transporter, CitMHS family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35550"
FT                   /db_xref="GOA:D4MP64"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP64"
FT                   /protein_id="CBL35550.1"
FT                   /translation="MYLAFLGFAMIVVFMGLIMAKKLSPFTSLIIIPVLFGLLAGYGWD
FT                   TLEYAMAGIKDVAGTFSMMTFAILYFGIMLTAGMFDPMVDKVVSWCKGDPLKVLVGTAV
FT                   LAAFVSLDGDGTTTVMICCTAMIPIYERLKIKKIYLATLIILQNCIMNLIPWGGPTARV
FT                   MSVMHLDAGEILAPLVPGMVLSAIYVIGVSYYLGLKERKRLGVSKDVENHAVKVQLSEE
FT                   EKAWKRPGLIWFNLILTAAIIAALIMGLASSAILFGVGTAVALLVNYPNQKIQRNVISS
FT                   IAPDMINVVMMVLGAGVLMGILNGPENAGMSNAIAEFLVAVIPESLAKYFAVVIAVVSA
FT                   PGTYLLNNDAFYYGVLPPLAATAKAYGFTDLNVGFAALMGQAFHFLSPLVPFIYLLMDK
FT                   TEITLAQYQGYIFKWCIGIFVIFMAAGLATGYLPIL"
FT   CDS             complement(210434..210634)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35551"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP65"
FT                   /protein_id="CBL35551.1"
FT                   /translation="MRCFPDRKNKNHKKSHKRLNGKNGSGQGFSLNGAVFCLQPVPFSP
FT                   GRPEPGAEGEGLGAEEPGGQP"
FT   gap             210714..211572
FT                   /estimated_length=859
FT   gap             212623..213345
FT                   /estimated_length=723
FT   CDS             complement(214132..215196)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02360"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35552"
FT                   /db_xref="GOA:D4MP66"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP66"
FT                   /protein_id="CBL35552.1"
FT                   /translation="MNRYLVLENGKVLKGTAFGADREVTAEIVFTTAMTGYIETLTDKS
FT                   YKGQAVVQTFPLIGNYGIIREDQESGTAGLSAYIVREWCAHPSNFRCDTDLDSYLKENQ
FT                   IPGICGIDTRALTKMLREHGTMNGFITDDPSRADLEQIRAFRCENPVSQVTIHEPTLFR
FT                   GRASRRLVVMLDFGRKDNILRSLLERDCDVWVLPASTSPKEVLKYKPDGIFLTNGPGDP
FT                   AENTEIIKNLRELLESGIPMMGICLGHQLLALAHGFQTEKMKYGHRGANQPVKDGKTGR
FT                   IYITSQNHGYAVREDSIDTSVAETSFVNVNDGTNEGLRYKNYPVYSVQFHPEACGGPKD
FT                   TDFLFDDFLGMLKR"
FT   gap             215468..215901
FT                   /estimated_length=434
FT   gap             217776..218967
FT                   /estimated_length=1192
FT   CDS             complement(219924..220604)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02410"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35553"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP67"
FT                   /protein_id="CBL35553.1"
FT                   /translation="MKQILKRYLYFILGVAINSFGVAFITKSALGTSQISSVPYVLSLR
FT                   FPSVSFGMTTFFVNLLFILIQAVLLKKNFQTVQFLQVAVNVLFSVLIDVSMTLLSFFQP
FT                   EAFGLRIVSLLAGCVILAVGISIEVAPDVLVVPGEGAVRAISQTTGLKFGSVKVYFDVS
FT                   LIVIASALSFLFFGRLNGVGLGTVISALTVGKFVNIVNLHLPAVRKIRDLAASASCPSA
FT                   NFVP"
FT   CDS             complement(220601..221029)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02420"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35554"
FT                   /db_xref="GOA:D4MP68"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP68"
FT                   /protein_id="CBL35554.1"
FT                   /translation="MLNEELHVLLLRAFHHCNKRIVQRTSRLPLLPGQPKILEYVEENN
FT                   GCIAKDICRGCVLDKSTMTSLLTRMEREGLLVKSGSPADRRAYHIFLTPKGEQAAREVK
FT                   RIFSETDEKAFQGISASERAGFLSTLNKIIANLEDETE"
FT   CDS             complement(221270..221887)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02440"
FT                   /product="Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35555"
FT                   /db_xref="GOA:D4MP69"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP69"
FT                   /protein_id="CBL35555.1"
FT                   /translation="MKVLMLNGSPRKNGNTSAALKEMERVFLREGVEVETVQIGARDIR
FT                   GCIACYSCSKTGRCVFEDEVNQLAPKFEEADGLVIASPVYYASANATLIACLDRLFYST
FT                   HFDKTMKVGASVAVARRGGCSATFDELNKYFTITGMPVASSQYWNSVHGRNAGEALEDE
FT                   EGLQTMRTLAANMTFLMKSIALGKETFGLPEREPQVFTNFIR"
FT   CDS             complement(221940..222482)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02450"
FT                   /product="Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35556"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP70"
FT                   /protein_id="CBL35556.1"
FT                   /translation="MQERQEPVSENRAKAPGEIRGKWYGNKKQKHDRRRADMKENVEEL
FT                   VKEKLGQGAVFPAGEENTAFSQYFKGQSYLKMLTTAGVRIGNVTFEPGCRNNWHIHHKG
FT                   GQILLVTGGRGWYQEWGKEAVELHAGDVVNIPPEVKHWHGAAKDSWFQHLAVEVPADGA
FT                   SNEWLEAVEDEEYSRLP"
FT   CDS             complement(222526..223620)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02460"
FT                   /product="Predicted oxidoreductases of the aldo/keto
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35557"
FT                   /db_xref="GOA:D4MP71"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP71"
FT                   /protein_id="CBL35557.1"
FT                   /translation="MEYRRLQRGGENISILGLGNSSLGAAGQREAEETIALALENGINY
FT                   FDMAAADASPFSAFGNAVLGYRNQVFYQIHFGADYRSGKYGWTLKLEDIKKSVDWQLQA
FT                   LKTDYIDFGFIHCIDEQADWEKVLSGGTLEYIRELKKAGTVRHIGLSSHTPSIVERFLD
FT                   EGDIDMVMFSINPAYDYRQGDYAIGSVDERMAMYRRCEAEGVGISVMKAFGGGQLLNAK
FT                   TSPFKRALTEYQCIQYALDKPGVVTVLPGVRGKEDLERILGFFRASREKKDYSVLGTFA
FT                   PQDAEGICVYCNHCQPCPAGLDVGLINKYYDLAMAGDALARDHYENLEKKASDCIGCGH
FT                   CDRRCPFHVGQAERMKEIAGYFGK"
FT   CDS             complement(223751..224881)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02480"
FT                   /product="Predicted oxidoreductases of the aldo/keto
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35558"
FT                   /db_xref="GOA:D4MP72"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP72"
FT                   /protein_id="CBL35558.1"
FT                   /translation="MIYKKFQNLNLSALGMGTMRLPVIDGDDSRIDEAAAEKMAAYAIE
FT                   NGVNYFDTAWGYHGGQSELVMGRILKKYPRDSFYLATKFPGYDLSNMDKVEEIFEKQLE
FT                   KCQVEYFDFYLFHNVCEMNIDAYLDPKYGIYDYLTRQRKEGRIRHLGFSVHGSLDVMKR
FT                   FLDAYGDAMEFCQIQLNYIDWDFQDARAKVELLAEKKIPVWVMEPLRGGRLASLPEEGE
FT                   KRLKELRPDETIPAWAFRFLQTIPGVTVVLSGMSNMEQMQANIETFKEDRPLDEKERKV
FT                   LAEIAEGMVKKTALPCTACHYCVSHCPKGLDIPSLLNLYNEHSFTEGGFIAPMALSAVP
FT                   EDKRPSACIGCRSCEAVCPQQIKISEAMKDFVRKLG"
FT   gap             225666..225898
FT                   /estimated_length=233
FT   CDS             complement(227088..227390)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02540"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35559"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP73"
FT                   /protein_id="CBL35559.1"
FT                   /translation="MSASIAIQVLPKVDSDQEVCRIVDQVIEYIKSTGLHCEVGPFETT
FT                   IEGESYDELMDIVKECQHVAVRAGAPKVSAYVKIVYRPDGEILTIDQKIGKYRDE"
FT   CDS             complement(227418..228059)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02550"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35560"
FT                   /db_xref="GOA:D4MP74"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP74"
FT                   /protein_id="CBL35560.1"
FT                   /translation="MDKQFAVFDLDGTLADSMVCWAELAGEFLKKRGIHPVPEGIADEI
FT                   KTMTMAESAALFVRTFGLEDTPEQVAGEMNAMIEEHYRKDIPLKDGAGEYIRRLASQGV
FT                   RMCVASATDRHLVSDCLKRLGILPYFEFLISCEEVGRGKDSPRVYEEAARRFGAQPGEI
FT                   AVYEDALFAARTARQAGFYVVGVYDRGSKDFDQLKQMADEVVLSWRDCLG"
FT   CDS             complement(228052..228678)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02560"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35561"
FT                   /db_xref="GOA:D4MP75"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP75"
FT                   /protein_id="CBL35561.1"
FT                   /translation="MLLYAVTDRSWLREGESLSGVCREVLKGGATFLQIREKDLDEASF
FT                   EAEARELKELCAEYRVPFVVNDSVEIALKIQADGVHVGQSDIKGRDIRAMIGPDRILGI
FT                   SAGTPEEAAAAEKAGADYIGVGAVFGTSTKKDARNLSVDALREIRNSVSIPIVAIGGIQ
FT                   PSNLMELAGTGVDGVAVVSAIFAAERPGEAAENLRKLAEEMVRHG"
FT   gap             228901..229107
FT                   /estimated_length=207
FT   gap             230599..231371
FT                   /estimated_length=773
FT   CDS             complement(232255..232455)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35562"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP76"
FT                   /protein_id="CBL35562.1"
FT                   /translation="MKFLIKHEIQGRLRIHVMRNRMTCEEADALCWALEKQKNITKVKV
FT                   YERTADAVIYYTGNRKELLCD"
FT   CDS             complement(232463..232765)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35563"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP77"
FT                   /protein_id="CBL35563.1"
FT                   /translation="MFSDSALKKIGCFVGGAVFGTVGVKILSSKDAKKVYTNCTAAALR
FT                   AKDCVMKTAAAVQENAEDILAEAQQINEKRAEEEAMQVMEDGVQEEGASEQKENE"
FT   CDS             complement(232977..233210)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02630"
FT                   /product="Fe2+/Zn2+ uptake regulation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35564"
FT                   /db_xref="GOA:D4MP78"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP78"
FT                   /protein_id="CBL35564.1"
FT                   /translation="MLSEKETIIRKLRDNGCRITEQRKMILDVILESRCSSCKEIYVQV
FT                   EKLDRNIGIATVYRLVKELENIGVLSRKIVYK"
FT   gap             234470..234668
FT                   /estimated_length=199
FT   CDS             complement(236033..236245)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02670"
FT                   /product="FeoA domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35565"
FT                   /db_xref="GOA:D4MP79"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP79"
FT                   /protein_id="CBL35565.1"
FT                   /translation="MNLLEAKEGEEYIVKEIQTDDEELTAFLFSLGCYSGEPITVVSHL
FT                   KGGCVVSIKDGRYNIDTDLAKAISI"
FT   CDS             236435..237010
FT                   /transl_table=11
FT                   /locus_tag="CL3_02680"
FT                   /product="Mn-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35566"
FT                   /db_xref="GOA:D4MP80"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP80"
FT                   /protein_id="CBL35566.1"
FT                   /translation="MYINPSRENYLETILLLSKKLPVVRSVDIAVELNFKKSSVSVAMK
FT                   KLRESGHITVSPEGYIYLTESGKEIAAQIYERHILLSSWLERLGVSPEIAAEDACKMEH
FT                   IISLESFEALKKTPHIMLLLIQEGCSPHTHCLTDFLEGLYSETSSRSRTKDRKNAQRSA
FT                   AKSSIMICSLLDRQVKIINRLGGSIFSL"
FT   gap             237488..237866
FT                   /estimated_length=379
FT   CDS             complement(238158..238298)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35567"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP81"
FT                   /protein_id="CBL35567.1"
FT                   /translation="MAAGICGCRDVWARGTGECIGREKTAVKFPGRTDFRRSVGLSGFR
FT                   A"
FT   gap             238898..240159
FT                   /estimated_length=1262
FT   gap             241354..242042
FT                   /estimated_length=689
FT   CDS             complement(242678..243457)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02770"
FT                   /product="sulfide dehydrogenase (flavoprotein) subunit
FT                   SudB"
FT                   /EC_number="1.18.1.2"
FT                   /EC_number="1.97.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35568"
FT                   /db_xref="GOA:D4MP82"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP82"
FT                   /protein_id="CBL35568.1"
FT                   /translation="MDEEGERIPLTICDFDREKGTITIVFQTVGASTEKMAGLKAGDAF
FT                   RDFVGPLGNASEFVKEDIEELKNKKYLFVAGGVGAAPVYPQVKWMHEHGIDVDVIVGSK
FT                   TKDLIILEQEMKAVAGNLYITTDDGSYERKGMVTEVVKDLVQNQGKKYDVCVAIGPMIM
FT                   MKFVCLLTKELGIPTIVSLNPIMVDGTGMCGACRVTVGGKVKFACVDGPEFDGHEVNFD
FT                   EAMKRQQMYKTEEGRALLKLREGDTHHGGCGHCGGNE"
FT   CDS             complement(243473..243619)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35569"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP83"
FT                   /protein_id="CBL35569.1"
FT                   /translation="MESEFYRCKEQEEREKDMYQILRAEKLADKIYLMEVEAPRVARAC
FT                   EPG"
FT   CDS             243977..244084
FT                   /transl_table=11
FT                   /locus_tag="CL3_02800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35570"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP84"
FT                   /protein_id="CBL35570.1"
FT                   /translation="MTGKYKDDRLEKQVSRLYNFIRIDTQQNSFRRSLH"
FT   gap             244319..244541
FT                   /estimated_length=223
FT   gap             247320..249225
FT                   /estimated_length=1906
FT   gap             251369..252044
FT                   /estimated_length=676
FT   CDS             complement(252310..252486)
FT                   /transl_table=11
FT                   /locus_tag="CL3_02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35571"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP85"
FT                   /protein_id="CBL35571.1"
FT                   /translation="METAGFSFLFLAESWNTDGHYAGRLERSWKAKSKKSACAAYGQVR
FT                   FKPARMLYGALSS"
FT   CDS             252622..253335
FT                   /transl_table=11
FT                   /locus_tag="CL3_02900"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35572"
FT                   /db_xref="GOA:D4MP86"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP86"
FT                   /protein_id="CBL35572.1"
FT                   /translation="MDQTGRKKILIADDEQDLREILKMILSAEGYEVVEAENGLQAARL
FT                   ADESIDMYILDVNMPEETGFEAAKKIRARFQAPLLFLTAYSGEADKVNGFLIGADDYIV
FT                   KPFSNMEMIMRVRAVFRRAEQGTPPAAAREETAEKKGMIPIGDLLLDTESQSLIKNQAV
FT                   ISLTYTEYRILELMAKHRKKIYSLDNIYQSVWGEDAVVDGAIMVHIKNIRKKMGDNSRN
FT                   PKYIKTAWGRGYYID"
FT   gap             254110..254512
FT                   /estimated_length=403
FT   CDS             254784..255116
FT                   /transl_table=11
FT                   /locus_tag="CL3_02930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35573"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP87"
FT                   /protein_id="CBL35573.1"
FT                   /translation="MALGMLMVLFVVMSVLGAIGILIMFLAKKSRFQSGAVYVMAAFGL
FT                   LTAYLGANSLPSNYLSAQLFRWAIGAVGIAGALLYWKSSEESWKLAGRLLVAGSVVLGI
FT                   AKLFLL"
FT   gap             256014..257537
FT                   /estimated_length=1524
FT   CDS             257847..258431
FT                   /transl_table=11
FT                   /locus_tag="CL3_02960"
FT                   /product="Cobalt transport protein."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35574"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP88"
FT                   /protein_id="CBL35574.1"
FT                   /translation="MLLIDSFSYQSRLRYINTGEKFFLSILTLCLCVAGRCIRLDLYII
FT                   LVMAALTVLAGGLSPVSYFRLFLIPLSFLAMNALVLGLSLRETPLELFSLPVGGLYLTA
FT                   GRETLSAAACMAATALAGVSCLYFLALSTPLSELLLFLKGLRLPALIIELMMLIYRFIF
FT                   LLLDCAGKISVAQRSRLGNRDFTPPCLPLPP"
FT   CDS             258485..258613
FT                   /transl_table=11
FT                   /locus_tag="CL3_02970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_02970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35575"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP89"
FT                   /protein_id="CBL35575.1"
FT                   /translation="MEARCYDGNFSVLRECLPPKPSHLVLIAAFEASACLVLWLAS"
FT   gap             259355..260384
FT                   /estimated_length=1030
FT   gap             263959..264397
FT                   /estimated_length=439
FT   CDS             complement(266267..266881)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35576"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP90"
FT                   /protein_id="CBL35576.1"
FT                   /translation="MSNYQRLISYIYTYEGGIKGKNIGFAKLETRNGQCRLTVNVKKIF
FT                   VGGNPLGVYLLSGDGELRIGTLFARNGAGEFRAVLDAGNVEGSQKTLEEFYGLTIHDVE
FT                   SGWRTYTTVWEDAVAHAAAVDLAGVTAENVQKSRREEENQSAKVLPELVLPISGEIEKE
FT                   LAREAAAESRGQSRGRKRETGLRKAFKERRQILSPQVSGIR"
FT   gap             267029..267436
FT                   /estimated_length=408
FT   tRNA            complement(267456..267537)
FT                   /locus_tag="CL3_T_35590"
FT   CDS             complement(267586..267672)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35577"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP91"
FT                   /protein_id="CBL35577.1"
FT                   /translation="MDGASYRKKNLPKLSPWLNGYYFILKSA"
FT   CDS             complement(267676..269874)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03050"
FT                   /product="Glycosidases"
FT                   /EC_number="3.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35578"
FT                   /db_xref="GOA:D4MP92"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP92"
FT                   /protein_id="CBL35578.1"
FT                   /translation="MMMMKINREALFCDETEDYRSPYEPDTGDTVCFRLRTGRDNADSV
FT                   FYLEPDTKVRRRMRRVFSEGRFDYYEITMELGEGPVSYCFEIRLGSEVCYYNRLGPEDR
FT                   ADASYAFEIIPGFHVPEWVKGAVIYQIYVDRFCNGDPTNDVETNEYIYIGSPVQRVSDW
FT                   EELPENLDVGRFYGGDLKGVWNKLDYLKSLGVECIYLNPVFVSPSNHKYDCQDYEHIDP
FT                   HYGVIAEDLDLLVDPNDMDNDMAGKYATRTADMTNLKASDDFFAAFVEAAHEKGIRVIV
FT                   DGVFNHCGSFNKWMDAELLYQHEGNYEPGAYVSADSPYRSYFKFNNKDGWPFNDSYDGW
FT                   WGFSTLPKLNYEESEKLCEAIMNVARKWVSPPFNADGWRLDVAADLGRSSEFNHKFWRR
FT                   FRDAVKKANPEAVILAEHYGDPSSWLDGSQWDTVMNYDAFMEPVSWFLTGMEKHSDEAN
FT                   ESLFGNGAAFFDMMRYHMCRMQPQSIQAAMNELSNHDHSRFMTRTNRRVGRLTSAGAQA
FT                   ASEGISYGIFRQGVVMLMTWPGAPTIYYGDETGLCGWTDPDNRRTYPWGKEDQELIEFH
FT                   RYMTGIHKRYPAFRKGSVRKLLAEQDLIAYARVVEGWKPGSHAQALGRGFARADFSCLD
FT                   TGDTGHLSEQFNRERRENESRAVVAVNTAMEEKVAEIPVWQAGITDEMELHRRMLTYEE
FT                   GYNVGRIIYEVKDGMARISVPARGSIVLVAERKQEDEA"
FT   CDS             complement(269879..269926)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35579"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP93"
FT                   /protein_id="CBL35579.1"
FT                   /translation="MQLKLAGRLKAQGRE"
FT   gap             270109..270520
FT                   /estimated_length=412
FT   CDS             complement(273082..274530)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03090"
FT                   /product="tRNA(Ile)-lysidine synthetase, N-terminal
FT                   domain/tRNA(Ile)-lysidine synthetase, C-terminal domain"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35580"
FT                   /db_xref="GOA:D4MP94"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP94"
FT                   /protein_id="CBL35580.1"
FT                   /translation="MRRNERGDGTKEERGRDRMREKVSRYMEKNGMLKAGQRVVVGLSG
FT                   GADSVCLLSLLSDMRSSLSIRLRAVHVHHGLRGQEADRDADFSRELCRKLDIPFILKME
FT                   NAHQEAQNRRISEEEAGRLLRYEAFEQEAARWEEEEREQEGAALPVRIAVAHHGDDSAE
FT                   TILYHLFRGSGLRGLAGIAPVRGRVIRPLLCVSRQEILEYLREEGLSYVTDSTNLLNDY
FT                   TRNRLRNQILPMAVQEINRGAVEHILRAGEIIGEADQFFRERAGKFLKKEGIWKESCLE
FT                   KSRMLAVPVSALGSLAHIEQGYVIREAFSELGWPLRNIDASHIESILSLLDGRTGAGAD
FT                   LPGGVRAERVYENLVLKKKERAAAKDGLPRLSMEVIPRENQAEIPKNRYTKWFDYDKIK
FT                   DTLSVRYRLPGDYITLKGGGRKSLKSLFIDEKIPREMRGSIPLLAEGNHVLWMIGGRIS
FT                   EYYKVTEQTKRILKVHLDGGTNCG"
FT   CDS             complement(274574..275122)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03100"
FT                   /product="Stage II sporulation protein E (SpoIIE)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35581"
FT                   /db_xref="GOA:D4MP95"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP95"
FT                   /protein_id="CBL35581.1"
FT                   /translation="MSLSDGMGSGPAASADSSRVIELTEQLLETGFSARAALKLVNTVL
FT                   LLAGMEQNPATLDLCCIDLCTGVLESMKLGAVGTFIMGREGVELLESGNVPMGIMNTVE
FT                   PILLSRKLWDNDRIIMVSDGILEALPGEDKEQTFCEFLNGLDVQNPQDMADEILQFALS
FT                   FCSVPADDMTVLVGGVFGK"
FT   CDS             complement(275188..275985)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35582"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP96"
FT                   /protein_id="CBL35582.1"
FT                   /translation="MLGKKIHRDMADVNVYTAKRLREMACSLSGLARAFTDEVGAKRQL
FT                   SFEDGLAAMQTAGAMVCGDCSKCNLYETGQKEDSYYLYYLLRAFEQKGKVDEEDMPRLF
FT                   NETCRRREEYLSQLNRNLGRATMNLTWKNRFLESRDAVIVQFREMASILEEFSGQMEQA
FT                   ADITGNYEDSVRYLFRRHHMKVENMLILEYENEQREAYLTVRTLGGRCVTSRDASDILT
FT                   RAVGGRRFGIARDSKEHYHKEDRHLPLCGGGEIPDDPRSLRGR"
FT   CDS             complement(276505..276831)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03130"
FT                   /product="Spore cortex protein YabQ (Spore_YabQ)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35583"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP97"
FT                   /protein_id="CBL35583.1"
FT                   /translation="MDTMYTELSLAAAGFVLGIFLMAVYDVLRLFRFLVSHTPLWTGLE
FT                   DVVYWLFSGISCFALLSVKNGGEVRIYIIASVLIGMLLWDKTFSRILPALLKKVKKYFR
FT                   MKKR"
FT   CDS             complement(276842..277126)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03140"
FT                   /product="sporulation protein YabP"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35584"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP98"
FT                   /protein_id="CBL35584.1"
FT                   /translation="MEEKINRRPHRLDLMNRGKGSVTGIQDVVAFDENQIVLDTDMGLL
FT                   TVKGKGLHVSRLTLEKGEVDIEGMVDSLTYSSNDSYRKQGESLFARLFK"
FT   CDS             complement(277189..277428)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03150"
FT                   /product="Ribosome-associated heat shock protein implicated
FT                   in the recycling of the 50S subunit (S4 paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35585"
FT                   /db_xref="GOA:D4MP99"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="UniProtKB/TrEMBL:D4MP99"
FT                   /protein_id="CBL35585.1"
FT                   /translation="MRLDKFLKVSRLIKRRTVANEACDAGRVLVNDKAVKASYAVKTGD
FT                   IIEIQFGVKSVKVEVLDVAETVKKDDAKELYRYL"
FT   gap             277702..278843
FT                   /estimated_length=1142
FT   CDS             complement(279531..281015)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03190"
FT                   /product="transporter, NhaC family (TC 2.A.35)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35586"
FT                   /db_xref="GOA:D4MPA0"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPA0"
FT                   /protein_id="CBL35586.1"
FT                   /translation="MSGTVFSLLPPVAAIGLALLTKEVYLSLLIGILAGCFLFSGANPI
FT                   HAVETMTGIMGGKIGENVNILLFLSFLGIIVALITRSGASRAYGEWASGAIKTRRGALL
FT                   ASMFLGALIFVDDYFNCLTVGTVMRPVTDKHRISRAKLAYIIDATAAPVCIIAPISSWA
FT                   AAVGSSLPADSGVDGFSLFLHTIPFNLYAILTIIFLLFVILNDFDFAAMKRYEEEFLKT
FT                   GREKTVEGETIEAGGRGKVADLAVPILVLIVLCVGAMLYTGGILEGKGVVEAFSGCDSA
FT                   LSLVLGSFFTLVFIFAFYLARRVLSFKDFCGTFASGIRAMIPAVMILCLAWTLSGICGE
FT                   EYLNIGGYVSSVVGASPLVGALLPALLFLVAAGLSFSTGTSWGTFGILIPIAFAVVGAE
FT                   DLNGLTIATSAILAGAVCGDHMSPISDTTILASAGAQCDHINHVSTQLPYVLCTAGFCV
FT                   IGYLAAGLTRNGWTGTGTAAALVFVFLFWMKKNRKG"
FT   gap             281220..282027
FT                   /estimated_length=808
FT   gap             284054..284565
FT                   /estimated_length=512
FT   CDS             284642..286033
FT                   /transl_table=11
FT                   /locus_tag="CL3_03220"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35587"
FT                   /db_xref="GOA:D4MPA1"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPA1"
FT                   /protein_id="CBL35587.1"
FT                   /translation="MNLITVREIYRDREKFLGKEIRIGGWVRSVRDSKTFGFIVVSDGS
FT                   YFETLQVVYHDNMENFSEISKLNVGAAILVKGTLVATPEAKQPFEIQATEVLVEGASSP
FT                   DYPLQKKRHSLEYLRTISHLRPRTNTFQAVFRVRSLIAYAIHQYFQERDFVYVHTPLIT
FT                   GSDCEGAGEMFQVTTMDLANVPKASDGSVDFSQDFFGKPTNLTVSGQLNAETYAMAFRN
FT                   VYTFGPTFRAENSNTTRHAAEFWMIEPEMAFADLNDNMALAESMLKYVIRYVLEHAPEE
FT                   MNFFNQFIDKGLLDRLNHVLNSEFGHVTYTEAVKLLEEHNDEFDYKVFWGCDLQTEHER
FT                   YLTEQIFKRPVFVTDYPKEIKAFYMKMNEDGKTVAAMDCLVPGIGEIIGGSQREDDYEK
FT                   LLARMDELGLKKEDYGFYLDLRKYGSVRHSGFGLGFERCVMYLTGMGNIRDVIPFPRTV
FT                   NNCEL"
FT   gap             286146..286546
FT                   /estimated_length=401
FT   CDS             286560..287960
FT                   /transl_table=11
FT                   /locus_tag="CL3_03230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPA2"
FT                   /protein_id="CBL35588.1"
FT                   /translation="MNTSGNMALNITRATAYLKNQKRQFESQLMPEAARTYTSLLGEIK
FT                   NLEREISSPEYENQLRSFTRERSELKAAIEKKQAERDELLHRIEKGRKALAEFEFTDAQ
FT                   SVSSYLDHAEDIYRQYREAAAGAEKKSLRILGGLFAGAGFLLLLAAAYFFYWGFVPDNT
FT                   LLPWMPQEIDALLSASAVSCAAAVSFFAAVILRLKIRQSKKTASLCASTLTEIFRGHLG
FT                   DQTVGENAMEALRARMEEFVRLCHMLSRSEEAVRQQRDMVEQLQVRQNECSETIERQQR
FT                   IQWELEKKLEHLAELKDQAAALRQIIAENDRIREEIAAIEMAQDTMKELSMSIRDSFGL
FT                   YLNKAASELISGITGGLYSSMSIDENLNAFLNTKRKLIPLEQVSSGTADQIYLALRLAA
FT                   AKFIQNGRDAMPLIFDDSFVLYDDDRLKTALKWLTKAYSGQIIVFTCHKRELAILEQEG
FT                   IAHHVVRI"
FT   CDS             complement(288143..288349)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35589"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPA3"
FT                   /protein_id="CBL35589.1"
FT                   /translation="MYMRRWEITDPEPICLRSMRRCPGGSADSSERRPDAAKSCEFIGM
FT                   CEVIQKYAKNALLEKKNIWQGIS"
FT   CDS             complement(288340..288915)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03250"
FT                   /product="Kef-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35590"
FT                   /db_xref="GOA:D4MPA4"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPA4"
FT                   /protein_id="CBL35590.1"
FT                   /translation="MHAERGLHRHVLIAFVFCLLMSYVAETFFGVADITGAFIAGVVIS
FT                   STQRTKFLASKFDVLSYAYLSPIFFASIGLKVSLPSMNSTVILFSASLVLVAILTKVIG
FT                   CGIGARLRGYTNEECVRIGVGMISRGEVALIVASKGEALGLLGSTFLGTCGAGGHYHHY
FT                   CNACISKAGLPQRSQPHDSGGRGLLKCI"
FT   CDS             complement(288954..289565)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03260"
FT                   /product="Kef-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35591"
FT                   /db_xref="GOA:D4MPA5"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPA5"
FT                   /protein_id="CBL35591.1"
FT                   /translation="MGEYQYLCDIAAILLSTKLLGLATRKFQMPQVVGALLAGLILGPA
FT                   MLGLVQETDFVKKTAEIGVIVLMFCAGMETDLDELKKSGRASFIIALIGVIVPLLGGYA
FT                   VAMLFNRPGMIESDAGGSLFLQNMFIGVILTATSVSITVETLKELGKLKTRSGNAILGA
FT                   AIIDDVLGIIALTIITSVADSSVHLSVILLKMPAFSSLPW"
FT   gap             290461..290873
FT                   /estimated_length=413
FT   CDS             complement(291324..292505)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03300"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35592"
FT                   /db_xref="GOA:D4MPA6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPA6"
FT                   /protein_id="CBL35592.1"
FT                   /translation="MLYEEKIIETIPVGPLGLIPLKSCRTLGEKVDRYLVDWRRERESE
FT                   HKTTIAFAGYQKDSYMIDAGTPRFGSGEGKGTLNESVRGDDLYLMVDVCNHSLTYSLSG
FT                   KVNHMSPDDHFQDLKRVIAAVGGKARRINVIMPFLYESRQHKRTGRESLDCALALQELV
FT                   KMGVENIITFDAHDPRVQNAIPLKGFETVQPIYQFIKYLLKNEKELEIDNEHMMVISPD
FT                   EGGMRRAVYFANVLGLDMGMFYKRRDYTKIVNGRNPIVAHEFLGSSVEGKDVIIVDDMI
FT                   SSGESMLDVAKELKRRKARKVFVCATFGLFTNGLQKFDEYYENGLIDRVLTTNLVYQSA
FT                   DLLSRPYYIDVDMSKYIALIIDNLNHDASLSELLNPTGRINRLISKYKAGIRE"
FT   CDS             complement(293212..293712)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35593"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPA7"
FT                   /protein_id="CBL35593.1"
FT                   /translation="MALSNSQYDSIMRIYNQAQLRQKRELDKRREEVYEKIPAVKEINE
FT                   EITASAVKSARQLLAGDDRSAKGLKRRIADLCEEREVLLSAYGYPADYLELHYDCPDCR
FT                   DTGYRDGKKCHCFKKREISLLYDQSNIREILSRENFDTFSYEYFDDTKVDERSNKTARE
FT                   YMR"
FT   gap             294708..294808
FT                   /estimated_length=101
FT   gap             296021..296021
FT                   /estimated_length=1
FT   gap             296052..296052
FT                   /estimated_length=1
FT   CDS             complement(296725..296847)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35594"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPA8"
FT                   /protein_id="CBL35594.1"
FT                   /translation="MLIWRSLPDRKAGEGRRLLETPDSMERKNQVKGGKKHVSD"
FT   gap             297025..297627
FT                   /estimated_length=603
FT   gap             299013..300862
FT                   /estimated_length=1850
FT   gap             302164..302976
FT                   /estimated_length=813
FT   CDS             complement(303582..304406)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03420"
FT                   /product="ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35595"
FT                   /db_xref="GOA:D4MPA9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPA9"
FT                   /protein_id="CBL35595.1"
FT                   /translation="MKKKTLWDISVQAVCILCALLILFPILYACSVSFMEQKDVLSSPP
FT                   NLLPPKATLENYRTAFSRTMLLRYMLNSFIVASVCSVTRMVTATMAAFAFSFFEFKGKK
FT                   ILFALTMATIMIPPDVLIVSNFTTISRMGLINTYAGMCSIFLVSATNVFLLRQFYLSFV
FT                   KSLKEAAYVDGCGNVRFFLWVLLPASKPIMVTVFLSSFVSVWNQYVWPMLVTNQNEMRT
FT                   IQVGITMLKDRESAVFGPVMAGVIIALLPTVLLFVLFQRKIVSGMMSGAVKE"
FT   CDS             complement(305266..306090)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03440"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35596"
FT                   /db_xref="GOA:D4MPB0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPB0"
FT                   /protein_id="CBL35596.1"
FT                   /translation="MEQRRSKIRLVVSDVDGTLVGNDCVMEEGMKELSRLLREQGIAFT
FT                   LASGRPVGMMRQYMEALDITLPVIASNGAAGYEKGAFIWKEILPGRAVRTAAEEADRLG
FT                   LAVFLNDGITEGVYRQNDYTRRQTEKTGLYETVIHPEGDEWETIELQKLMIIDPDSPGR
FT                   CDELRELLKERENGIYVVRYDDRCFEAMPEGCSKGSGIRRLADYLGIHPGEILAVGDNI
FT                   NDLDMFEAAGWSAAVGNAAEELKKRADYVCRGETVQGVIEAVRHFHSGGKMR"
FT   gap             306133..306516
FT                   /estimated_length=384
FT   CDS             complement(307378..309090)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03460"
FT                   /product="Glycosidases"
FT                   /EC_number="3.2.1.93"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35597"
FT                   /db_xref="GOA:D4MPB1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPB1"
FT                   /protein_id="CBL35597.1"
FT                   /translation="MELNLGDKVVYQIYPKSFRDSDGDGIGDLRGVTEKLDYLEELGVD
FT                   YLWLTPFFPSLQYDNGYDITDYRGIDPMYGTMDDFDELVSEAGKRGISLMVDMVFNHCS
FT                   TKHEWFQRALQGDPYYRDFFIIKKGTKEGLPPTNWTSKFGGSAWGYLPRTDEYYLHLFH
FT                   VSQADLNWENPNVRRELYDVVNFWIEKGVKGFRFDVINLISKPAIYEDDLEGDGHRFYT
FT                   DGARIHEFLHELNRETFGPHEDIITVGEMASSDLPNSIRYSRREEQELSMIFDFHHLKI
FT                   DYPSGNKWEVQPFRFHDLKKNLFEWQEGMEQGGGWNALFWDNHDQPRIVSRLGDEGSLR
FT                   KQSAKMLATALHGLRGTPYIYQGEEIGMTNAGFTEIGQYRDIETLNVFQELRLKGKTSE
FT                   QIYESLRKKSRDNARTPMQWDSTKNGGFTSGTPWISVNKNFREINTEDREKPDSVFQYY
FT                   RKLIELRKQLPVLSRGRFEALLRDDARILAYRRVLEENGKTEIYVVCNFFREEAELPAG
FT                   LIPEGARLLLGNYEADTKKPQEEELQTGGKGLCAAAAGKRLRPYECFIALAEG"
FT   CDS             complement(309142..310632)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03470"
FT                   /product="PTS system, glucose-like IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35598"
FT                   /db_xref="GOA:D4MPB2"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPB2"
FT                   /protein_id="CBL35598.1"
FT                   /translation="MPLPETAESCRRKGKRRSRMSEFASDARRLLELVGGRENIVSFTH
FT                   CATRMRFVLADEKKADVKGIEALESVKGSFTQGGQFQVIIGNKVSVFFDEFSAVSHMEG
FT                   VDKQEVKNAAKGNMNLLQRAVANLAEIFAPLIPAIIVGGLILGFRNIIGDIKLLEGGTK
FT                   SVTEVYQFWNGVYSFLWLIGEAIFTFLPVGVTWSVCRKMNADQMLGIVLGITLVSPQLM
FT                   PASDFVAAKAAGEAVKMWDFGWFHINMVGYQSQVIPAILVGIVFSLIYRFLKKRIPDAV
FT                   SMILVPFCSLVPAVLLAHTVIGPFGRMLGDGLAGIIMAGFSSSLCWLFSGIYGLLYPLL
FT                   VITGLHHSMLPIDLQTVATMGGIYTFPVVALSNIAQATAVAAFVFVNRKDAKIREIGIP
FT                   SFISGFLGVTEPAMFGVNLKYLYPFIGAMLASGIMGVISRLFGVIANSVGVGGIPAFLS
FT                   MRGDKILVYLVCILLDMVLAFGITVILSKTKLKNYGTR"
FT   CDS             complement(310785..311498)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03480"
FT                   /product="trehalose operon repressor, B. subtilis-type"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35599"
FT                   /db_xref="GOA:D4MPB3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012770"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPB3"
FT                   /protein_id="CBL35599.1"
FT                   /translation="MSSKYVQVYNTLKKQIESGEYAIGEEFPSEGELQSRFQVSRDTVR
FT                   KSLGMLENQGYIRKSRGRVAVVVERGEGNFPFAEILSFKELNAQLKRKTETEVENLEIL
FT                   SDPELIFRLFEDDEEKEIYDLVRVRRIGGERVIIDHDYFKRSIVKNLPLRACRESVYEY
FT                   LEGEAGLKIGYAAKEIVVEEATAQDRKYLDLKQYGLVVVVRSYTYTKDNRLFQYTESRH
FT                   RPDQFRFVEVAQRKK"
FT   gap             311803..312462
FT                   /estimated_length=660
FT   CDS             complement(313028..313303)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35600"
FT                   /db_xref="GOA:D4MPB4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPB4"
FT                   /protein_id="CBL35600.1"
FT                   /translation="MDLLIKNARFTDPETGRESAVSAGIKDGKICSLQWEGESREESEG
FT                   AERTVDAKGAYLLPGMIDFHTHLFTGGSAFGLNGDLLLPSGGHPGC"
FT   CDS             complement(313433..314704)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03520"
FT                   /product="Di-and tricarboxylate transporters"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35601"
FT                   /db_xref="GOA:D4MPB5"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPB5"
FT                   /protein_id="CBL35601.1"
FT                   /translation="MEPSTITIIILILAVISFLMEKIPVNMTVMLTMCALVLTGLVTPE
FT                   EAVKGFASTTILMLIGVVIVGSALFETGVCDRVASVVTRYAKTERQMIMAILILSSIMS
FT                   AGLSNSGTVAVFIPIILGITATTNFSRSKLMMSAFLGAMAGGRLTLVGDAAVNVLIGNQ
FT                   IKELGQPFGFFEISKIGVPLTLIMLVYIYFIGYKFLPDIKDYHDEDQIFSQGAGKDVPK
FT                   WKQIASVAVLLCVFVGMIFEEQTGIPSYMVAIMGAVADVLLGIFTEKQAYNLVSIKTVI
FT                   LLGGMTPLATALEKTGAAQIMADMLIRIIGGSTNVYYITIVIFILTCIMTQFMSNVVTI
FT                   TLLMPIIIAIAETIGVVPSALLMVLCIASTMSILTPIGCPPGNLIYAYGGYKFSDYLKS
FT                   NIGLTLVFLVACIVLIPMIWPLYG"
FT   gap             315024..315786
FT                   /estimated_length=763
FT   gap             317980..318070
FT                   /estimated_length=91
FT   CDS             318158..319174
FT                   /transl_table=11
FT                   /locus_tag="CL3_03570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35602"
FT                   /db_xref="GOA:D4MPB6"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPB6"
FT                   /protein_id="CBL35602.1"
FT                   /translation="MTTILLGMGLLLLTLAGFSLFSMKAPKGSVAMSGLANAAVATFLV
FT                   EAVHRYISGDLLGIAFLGEIGSVAGGLGGVASAILIPIGMGANPLFAVVAGVAVGGYGI
FT                   LPGFMVGYLTGFLAPLIEKYLPAGLDTILGALVLAPIARTIAFFTDPVVNAAMGYIGNT
FT                   ITAATEQSPILMGFLLGGIIKMICTSPLSSMALTAMLGLTGLPMGIAAIACFGGSFTNG
FT                   LIFARLHLGNKSNIAAVMLEPLTQAHIITRHPIPIYGSNFFGGGLAGIAAAMLGIINNA
FT                   PGTASPIPGLLAPFAFNPPGKVATALVLAAAGGSLAGFVGSIVFKRFDEQKNSAKTA"
FT   CDS             complement(319346..320485)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35603"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPB7"
FT                   /protein_id="CBL35603.1"
FT                   /translation="MAKGYFYVFHDPEDGFISGKASDVARDMAARGAFRPTGWVEIAVW
FT                   AAISLFVSREISVYLNLAGAVTLVLWIAAVVLLYAVSRGILFLSAWISSRKNAQNPEVR
FT                   QALRQYIWFGEGSMFTESEDSRLDISYKRIRNIECEGDRFVLNMSTGKQMILEKKNFLE
FT                   GKPEKFEAFIRKKIEEGTSLELEEGAPRARVLESEEGIYRLYQAAEWNRLKSGREKYPF
FT                   SMYLLIFLCVSAGFTFINISLKDGALPFAAYAAVEAVLAGVCAAHYRMKNRQARSEKSL
FT                   RKAAGREWKMLKGKADGLEKELVFFKKGFKVRTEEYTTSYNYENVNTVIASEDSMVIAG
FT                   DGFSFVAMAGTETLGYPEIKRLIEGGKKIHIEEMSQDNK"
FT   gap             321969..321969
FT                   /estimated_length=1
FT   CDS             complement(322740..324020)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03600"
FT                   /product="Protein of unknown function (DUF1576)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35604"
FT                   /db_xref="InterPro:IPR011470"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPB8"
FT                   /protein_id="CBL35604.1"
FT                   /translation="MAHMNHLSRRGKFLLLSTIPLYFMVCGFLLQPVNEIWPGIVTLIR
FT                   EPDFLITDYFVVGGVGAAFLNAGMLTLLSIALIYFLGMEMDGHTITSACLMFGFSLFGK
FT                   NLLNIWAVMVGIWLYAKYHKMPVSKYIYIGLYGTSLSPIITQIMQIGQMPLIFRVFLAL
FT                   GAGMVIGFVLPPLATHVHFSHKGYSLYNVGFAAGIIATVIVSLLKSFGITVESRLIWYT
FT                   GNTMTFFAILCILFAGMAVGALYVGGRQAVEEYRAILKCSGIGGTDYLRDNGGPATVLN
FT                   MAVNGFLSTLMVVIAGGDLNGPTIGGIFTIVGFSSTGKHIRNIFPIMMGVYLAGLTKYW
FT                   SISEPSPMLAFLFSTTLAPISGEFGWLAGLLAGFLHSSVALNVGIVYGGMNLYNNGFAG
FT                   GIIATFLVPVIQSIRDRRARAREEDAL"
FT   gap             324627..325773
FT                   /estimated_length=1147
FT   CDS             complement(326214..327242)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03630"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35605"
FT                   /db_xref="GOA:D4MPB9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPB9"
FT                   /protein_id="CBL35605.1"
FT                   /translation="MKRISIIIPCYNEQEAIPLFMEEAGRVCGGLTEYEFEWIFVDDGS
FT                   KDGTLSLLKEYAKRDRRVKYLSFSRNFGKEAAIYAGLEHARGDYTAIMDADLQDPPRLL
FT                   PEMIEALESGEYDSAAARRVDRRGEPPIRSFFARMFYRLIRHISDIDIVDGARDYRLMN
FT                   RKMKDAIVSMTEYNRFSKGIFGWVGFRTKWIPFENVERVAGETKWSFWKLLIYSIEGIV
FT                   AFTTVPLTIAAYLGLIFCVVAFFMVLVVIGKTLMFGDPVGGWPSLACIILFVGGIQLLC
FT                   AGIVGKYLAKIYLEVKRRPIYLVAEENLDRDHESDRKGRQSSENTSVSEEEADKAAAEW
FT                   DG"
FT   CDS             complement(327391..328074)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35606"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPC0"
FT                   /protein_id="CBL35606.1"
FT                   /translation="MTASLKELRKENKREMEAMEAEDRRILYQIREYFEMPRMGAVDSE
FT                   LLVRDLIGMTQEARMRGESLQEVIGSDRRGWCESIKEGYGRVSTKERVLSALRNGCGRF
FT                   CLFWVFMIGWGNDFKDMVAWVEILLLAVCLGWDIADEFLGIKRRNFAFYTEKEKKRADA
FT                   REGVAGLAVLIASGVLAMAAEPLRRPALHFTGASTILWLAVFLVFLICAVLYRNLIKSQ
FT                   LAGKN"
FT   CDS             complement(328049..328405)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03650"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35607"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPC1"
FT                   /protein_id="CBL35607.1"
FT                   /translation="MYDQSQLMKGIMEGCIFSIIGRERTYGYEIVERLREKGFSDVREG
FT                   TIYPLLLRLEKKGMLRAEFMPSPLGPSRKYYSLTEEGRRQLEVFCDSWRRTARAVERTI
FT                   GEEGENNDGQFKGA"
FT   CDS             complement(328381..328518)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35608"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPC2"
FT                   /protein_id="CBL35608.1"
FT                   /translation="MQDSLEEEYGRNKRRVRRAGTKNQDTNQNYREKTGGQECTISRSL
FT                   "
FT   CDS             328676..329023
FT                   /transl_table=11
FT                   /locus_tag="CL3_03670"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35609"
FT                   /db_xref="InterPro:IPR014580"
FT                   /db_xref="InterPro:IPR023204"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPC3"
FT                   /protein_id="CBL35609.1"
FT                   /translation="MDSEKVYRMKFSSIYPLLVNKAVKKGRTGEEVSQVISWLTGYSRD
FT                   EILKLSQSDIEYAEFFRNAPAMNPARNLIRGTVCGVRVETISEPLMREIRILDKLIDEL
FT                   AKGKPMEKILR"
FT   gap             329141..329781
FT                   /estimated_length=641
FT   CDS             complement(330354..330656)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03690"
FT                   /product="Cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35610"
FT                   /db_xref="GOA:D4MPC4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPC4"
FT                   /protein_id="CBL35610.1"
FT                   /translation="MGRIYGGIEELVGRTPLVRLARLEGREKVRAEILAKLECFNPAGS
FT                   AKDRVARQMLEDAKEQGILKEGSVIIEPTSGNTGVGLAALAAVNGYRAVIVIPDS"
FT   CDS             complement(330722..332974)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03710"
FT                   /product="DNA topoisomerase III, bacteria and conjugative
FT                   plasmid"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35611"
FT                   /db_xref="GOA:D4MPC5"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPC5"
FT                   /protein_id="CBL35611.1"
FT                   /translation="MKSLVIAEKPSVGKDIARVLGCRKSADGCLEGDKYIVTWAFGHLV
FT                   ELAAPEEYDKKYKDWNMADLPMMPEPFKLEVIGKTAKQFGVVKRQLFRNDVKDIVIATD
FT                   AGREGELVARFILMKAGCRKPLKRLWISSVTDRAIKEGFSRLRDGREYNHLRDAAMCRA
FT                   EADWLVGLNATRALTCKYNAQLSCGRVQTPTLAIIAKREEEIRNFRPKAYWGLTARTSK
FT                   PALTLTWQDKKSGGMRSFDRDRMEGLQKSLRDQQVWITKVKKTPKKTMAPLLYDLTELQ
FT                   RDANKRFGYSAKETLNIMQRLYENHKVLTYPRTDSRYLSSDVADTIHDRLAACGTGPYR
FT                   KLAGKLSKNVWTKKASFINDGKVTDHHAIIPTEQFVQLQNMTSEERKIYDLVVRRFLAV
FT                   LYPAAEYDETVITAEIGGEIFTARGKVMRTPGWREVYESADESGLSGTGGYLDEEDGDE
FT                   DGEGPQNERVKAQTLPDLREGDVIGPAGISLTEGKTKPPAPFNEATLLSAMENPVRYME
FT                   SGDRAMAKTLGETGGLGTVATRADIIEKLFSGFMLEKKGKDICLTSKAKQLLRLVPEDL
FT                   RKPELTAQWEMRLSKIAKGEMKRDAFMEDIRTYTKDIVEEIKGGEGTFRHDNLTNTKCP
FT                   RCGKRMLSVKGKNSQMLVCQDRECGYRETISRTSNARCPKCHKKMELRGKGENQMFSCV
FT                   CGYKEKLSNFKERRQREGAGVTKRDVARYLNQQKKEEKMVNNPFADALKKMQEQDV"
FT   CDS             complement(333040..333615)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03720"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35612"
FT                   /db_xref="GOA:D4MPC6"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPC6"
FT                   /protein_id="CBL35612.1"
FT                   /translation="MGKVTEERKAGSFAEGKDRANVTLIGMPAAGKSTVGVLLAKRLGY
FT                   AFVDVDLVIQEQENRLLKEIIADEGMDGFMAVENRVNASLDVQKSVIAPGGSVIYGEEA
FT                   MEHLKSIGLVVYLKISFEELLKRLGDVVDRGVVLKEGMTLQDLYEERISYFEKYADITV
FT                   DEEGKNLGQVVDELRGLLEQRLGLLQGE"
FT   gap             334569..334678
FT                   /estimated_length=110
FT   CDS             complement(334826..336478)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03740"
FT                   /product="Inorganic pyrophosphatase/exopolyphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35613"
FT                   /db_xref="GOA:D4MPC7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPC7"
FT                   /protein_id="CBL35613.1"
FT                   /translation="MSDSKKRRTIVIGHKNPDTDSICSAICYANLKHILTGEEYTPARA
FT                   GHVNSETQYVLDYFGVEAPELIENVRTQVKDIEIRETKGVDKNISLKKAWNLMQDNTVV
FT                   TIPAVTEDNTLEGLITVGDITRSYMNVYDSSILSKACTQYSNILETLEGALLVGDPEAY
FT                   FDKGKVLVAAANPDMMEYYIEKHDLVILGNRYESQLCAIEMEADCIIVCEGAGVSMTIK
FT                   KLAQERGCTVLTTPYDTYTAARLINQSMPISYFMTKDNLITFGTEDFIDDIRDVMTNKR
FT                   HRDFPILDRDGKYKGMISRRNLLGARGKNLILVDHNERSQAVEGMESANVMEIIDHHRL
FT                   GTVETMSPVFFRNQPLGCTATIIYQMYNENKVEIDRKIAGLLCSAILSDTLLFRSPTCT
FT                   AVDKAAALELAEIAGVDAESLAKEMFEAGSKLKGKTDSEIFYQDFKRFTAGKLTFGVGQ
FT                   ITSLNVEELGKIKERLIEYIGEARNEQKVDMMFFMMTNILEQSTELICDGQGAEQLAAL
FT                   AFHLKEGEKVVTLPGVVSRKKQLIPALMIATEQ"
FT   CDS             complement(336692..337408)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03750"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35614"
FT                   /db_xref="GOA:D4MPC8"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPC8"
FT                   /protein_id="CBL35614.1"
FT                   /translation="MPDGSVEVCVNLGWRNMNPQKELSGLLDGLTVKTGNDANVAALGE
FT                   MWQGGGKGYSDLVMVTLGTGVGGGVILDKKIVPGRHGTGGEIGHIRIREEEKEFCNCGG
FT                   RGCVEQVASATGIAREARRAMERSDAPSEMRKFGKDITAKDVLDCAKAGDEMACEVMET
FT                   VSYYLGWMLSILAMTVDPEVFVIGGGVSKAGTFLTDMIEKYYDKFTPLSEKKAKLTLAT
FT                   LGNDAGIYGAARLILD"
FT   CDS             complement(337408..337635)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35615"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPC9"
FT                   /protein_id="CBL35615.1"
FT                   /translation="MEKKCVGIDVGGTSVKLGMFEMDGTLLEKWEILRERRRMDGTFSQ
FT                   TQRLPSEKRFLRRGFPFPIWLERVLAFQDL"
FT   CDS             complement(337798..337896)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35616"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPD0"
FT                   /protein_id="CBL35616.1"
FT                   /translation="MKNGSPRFLAGCRFLIDSAEIFCPGSSAALPD"
FT   gap             339591..340302
FT                   /estimated_length=712
FT   CDS             complement(341080..342534)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35617"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPD1"
FT                   /protein_id="CBL35617.1"
FT                   /translation="MGDLYEPLSKLPKNIRQIGDRDDTVKLYMEDYVSTYLKRLFPTGG
FT                   QDLRVGLLLGTEKTEDGTPFIFVDGALEMEDVTAEGEKVVFTEAAWKKAYQNIEESFPR
FT                   RTVQGWFLCGAPGCALSPLNYWKQHGQYFSEKNQLMYLNSGIEGDESVYITSDDGFYRL
FT                   KGYCIYYDRNQMMQDYMICRKDVKRVESGAGDRVIRDFRERMEDRKKEAMSHRHTVRNL
FT                   GLVCSTMSLVILAGGVTMLNNYQKMQEMETALVSVLPEGARPWDREDNREESVPVVVEE
FT                   IKGNVYPQETDSQSQNSGNRAQSVKLSDGTLYLEDTAESAGTEKMGELSSEKAPVKSQA
FT                   EGGDSSTVRSEQTSKAESGEIKAEDGEAPEEKSEAENQEADSGGEETGDAAKDQKDSTA
FT                   DSQPDPESGEVSVPVTDMTPGAKYLVGEGETLYGICFKLYGNINYVKDICALNGVSDIN
FT                   HIMAGQKLILPAEVPVLEEMKGAVEE"
FT   CDS             complement(342518..342649)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35618"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPD2"
FT                   /protein_id="CBL35618.1"
FT                   /translation="MISQMEEGRRFLTDRRRLRNMLQGDKLCCRKQRSGVSLNGRFI"
FT   CDS             complement(342674..343273)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03820"
FT                   /product="putative sporulation protein YyaC"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35619"
FT                   /db_xref="InterPro:IPR009665"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPD3"
FT                   /protein_id="CBL35619.1"
FT                   /translation="MKILEWMAAKDSRDIYYFNSDRNFEAEAFAARLHQMIVEEKLRQG
FT                   KRGVVFLCIGTDRSTGDSLGPLIGYKLRKMEVSGASVFGTLERPVHAMNLEDYVRVIQS
FT                   CYHDCLVVAVDASVGNREHIGYLTLGKGALKPGLGVSKELQAVGDIFITGIVGSCSSYD
FT                   PLMLQSVRLSVVMRMADCISRSIGIVEKLWDNAALV"
FT   CDS             complement(343425..344522)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35620"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPD4"
FT                   /protein_id="CBL35620.1"
FT                   /translation="MAQTITDFREFLTDAKQIAAELSELEQSEAQAREEESRLLRTLEA
FT                   EKKAVTDNINQTVKRRRDEISKSYDNEISITQDRLKKTRARREKAKNQGIKDRIEEETS
FT                   ELHLHNRELKVRMKTLFQKEHVPAFCQSGFYYALYFPRGLKESLILLATLIVCFLLIPY
FT                   GIYSAAPVQKTVYLILIYFACVLVFGGLYTVVGNMTRGRHQKALREGRQIRNVMQSNYR
FT                   KIRMITSSIKRDKNESVYNLEKYDDEISQLEQDVDDMLKKKKDALNTFENVTRMIISDE
FT                   IAQNSREKLEAMEARHEEASSHLKYIQTILQEKRIYMTNTYETYLGKEFLSAERIEALK
FT                   TIIEAGEASNISEAIEVYRGRGKKE"
FT   gap             344790..345318
FT                   /estimated_length=529
FT   CDS             complement(346059..347408)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03860"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35621"
FT                   /db_xref="GOA:D4MPD5"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPD5"
FT                   /protein_id="CBL35621.1"
FT                   /translation="MGREVTFDYSKAASFVRAEELENMKSAVMCAKDVLVNRTGAGNDF
FT                   LGWIDLPVDYDKEEFARIKKAAEKIQSDSDVLLVVGIGGSYLGARAAIEFLNHSFYNVL
FT                   PKGKRKTPEIYFVGNSISSKYIKDLQDVLEGKDFSVNIISKSGTTTEPAIAFRVFKKML
FT                   IDKYGKEEAGRRIYATTDRAKGALKNLANEEGYESFVVPDDVGGRFSVLTAVGLLPIAV
FT                   SGADIDKLMEGAASGRKKALEAPYEENGALLYAAIRNILHRKGKQVEIVANYEPSLHYV
FT                   SEWWKQLYGESEGKDQRGIFPAAVDLTTDLHSMGQFIQDGSRIMFETVLNVEESPAEVL
FT                   LDREEVDTDGMNYLAGKSVDFVNKSAMNGTILAHTDGNVPNLLVNIPEQNEFCLGELFY
FT                   FFEFACGVSGYLLGVNPFNQPGVESYKKNMFALLGKPGYEEAREELLKRL"
FT   gap             347499..348542
FT                   /estimated_length=1044
FT   CDS             complement(348703..349401)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03870"
FT                   /product="methylthioadenosine nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /EC_number="3.2.2.16"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35622"
FT                   /db_xref="GOA:D4MPD6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPD6"
FT                   /protein_id="CBL35622.1"
FT                   /translation="MLGIIGAMDEEVAKIKEEMEEAEVITVAGMDFYVGKLAGKDAVVV
FT                   RSGIGKVNAGMCTQILADRFHVDAVINTGIAGSLKNEINIGDIVISTDTVQHDMDASGF
FT                   GYRKGQIPRVDTFSFKADEKLSSLALACNEKVNPDIQAFLGRVVSGDQFISDRDKKKWL
FT                   AQEFEASCTEMEGAAIAQAAYLNGIPYLVIRAISDKADDSAGMDYAEFEAQAIRHSVNL
FT                   ILEMAKRISC"
FT   CDS             349806..350051
FT                   /transl_table=11
FT                   /locus_tag="CL3_03890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35623"
FT                   /db_xref="InterPro:IPR023806"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPD7"
FT                   /protein_id="CBL35623.1"
FT                   /translation="MIYATNGVCSREIEFDIIDNKLTNVRFIGGCSGNTQGVARLVEGM
FT                   DIDEVISRLNGIRCGFRPTSCPDQLANALKQYKAKL"
FT   CDS             350163..350231
FT                   /transl_table=11
FT                   /locus_tag="CL3_03900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35624"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPD8"
FT                   /protein_id="CBL35624.1"
FT                   /translation="MKYLKDRCYSPPDVRFHVSMYG"
FT   gap             350360..351008
FT                   /estimated_length=649
FT   CDS             351392..351904
FT                   /transl_table=11
FT                   /locus_tag="CL3_03920"
FT                   /product="UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35625"
FT                   /db_xref="GOA:D4MPD9"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPD9"
FT                   /protein_id="CBL35625.1"
FT                   /translation="MKKIVLTGGGTAGHVTPNLALLPSLRAEGFEIRYIGSYNGIERRL
FT                   IEDAKIPYDGISSGKLRRYFDLKNFSDPLRVLKGYSQARKLIKKYRPDIVFSKGGFVAV
FT                   PVVLAAKHYKVPVIIHESDMTPGLANKICIPAAKKSLLQFSRNTQLPSQGEGCAYRFPY
FT                   QERAAHR"
FT   CDS             complement(352426..352674)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03940"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35626"
FT                   /db_xref="GOA:D4MPE0"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPE0"
FT                   /protein_id="CBL35626.1"
FT                   /translation="MENDIYRQIRDLMDGMKKDWRDVLILYVLEGRTIKDTSQILGIAE
FT                   TVCRSRIFRARQELKRLLENKAIFDIQSNSCSHESDP"
FT   CDS             complement(352722..352994)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35627"
FT                   /db_xref="GOA:D4MPE1"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPE1"
FT                   /protein_id="CBL35627.1"
FT                   /translation="MQQRDAELLRALYENYLIPLKKYAVKIGVDCDYIEDMVHETFLEY
FT                   YARYSLEFGDRQKRVLLTMILRCRWIDYCRKINDAAHSALTSILK"
FT   CDS             complement(353003..353425)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03960"
FT                   /product="Diadenosine tetraphosphate (Ap4A) hydrolase and
FT                   other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35628"
FT                   /db_xref="GOA:D4MPE2"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPE2"
FT                   /protein_id="CBL35628.1"
FT                   /translation="MVEKECIFCKIASGEIPSATVYEDGDFRVILDLGPASRGHSLILP
FT                   KQHYRDLCELDDAVAAKILPLAGRLGKAMKKTLGCAGFNVVQNNGEAAGQTVFHFHVHV
FT                   IPRYENGPEMVAWKPGKMEQEELTKISGMLKSEMDA"
FT   CDS             complement(353517..354101)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03970"
FT                   /product="Predicted sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35629"
FT                   /db_xref="GOA:D4MPE3"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPE3"
FT                   /protein_id="CBL35629.1"
FT                   /translation="MGGAAYLSALAAYRTGAGLVKILTPRENCQILQTLLPEAILSAYD
FT                   REEAMEEPESFALQIERECGWADAVVLGPGLGREPWAVRLVQQILLSAFVPIVLDADGL
FT                   NIVAENPSLSEYFTENVIVTPHVGEMARLTGMEIVEVREHLVETAVSYSEKYGVITVLK
FT                   DAATVVVKKDEPVYINKSGCSAMAKAGSGDG"
FT   CDS             complement(354207..354863)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03980"
FT                   /product="yjeF N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35630"
FT                   /db_xref="GOA:D4MPE4"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPE4"
FT                   /protein_id="CBL35630.1"
FT                   /translation="MKRLVTGAQMKEIDRHAIETVGIPSLVLMERAALSVVEEMEPELF
FT                   REDRIFVACGTGNNGADGAAIARMLFLRGYNVTVLTAGRQESRTEELKLQLAIDERIGI
FT                   SVMEAEDFIPGSYEVAVDALFGVGLSRNVEGPYRNVIEMICGMAPRLTVAVDIPSGIHS
FT                   DTGRVMGRAVRADLTVTFGFEKLGLVLFPGRDYCGRVAVKDIGFPPCPDVCLGET"
FT   CDS             complement(354893..355273)
FT                   /transl_table=11
FT                   /locus_tag="CL3_03990"
FT                   /product="phosphopantethiene--protein transferase domain"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_03990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35631"
FT                   /db_xref="GOA:D4MPE5"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPE5"
FT                   /protein_id="CBL35631.1"
FT                   /translation="MIAGVGTDMIEIGRIRRACEKEAFLTRVYTQEECQQAGGNYARLA
FT                   GTFAVKEAVAKVLATGFRSFGPAEIEVLRDSLGKPYVRLYGGARELADRLSIKEIHVSI
FT                   TNTKDYAVAFAVGEGAEKKTAE"
FT   gap             356003..357047
FT                   /estimated_length=1045
FT   gap             358817..359638
FT                   /estimated_length=822
FT   gap             361963..362648
FT                   /estimated_length=686
FT   gap             364003..365355
FT                   /estimated_length=1353
FT   CDS             complement(365376..365666)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35632"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPE6"
FT                   /protein_id="CBL35632.1"
FT                   /translation="MKKCKQILLAVCLTFAFVFLTACGSKEDVKNTTNASGTTSGMETT
FT                   ARESTDGMVSGTDSAADRETDGARESTGVLEGVADDLKTARRQLWIAPERI"
FT   CDS             complement(365722..366477)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04090"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.3.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35633"
FT                   /db_xref="GOA:D4MPE7"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR011770"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPE7"
FT                   /protein_id="CBL35633.1"
FT                   /translation="MVRAIMHGCSGAMGQVITNLVKDDSELCIVAGVDITDSGKNPYPV
FT                   YKNLDEVKEEADVIIDFSSARAVDGLLDYCERTGRAVVLCTTGLSEAQILRAEEVSGKA
FT                   PVLRSANMSLGVNTLLKLLKDAARVLAPAGFDIEIVEKHHNRKIDAPSGTAIAMADSVN
FT                   EALGNTCHYKYDRSSERVPRDAKEIGIQSVRGGTIVGEHDVIFAGTDEVVTFSHTAYSK
FT                   AIFAKGAIQAAKFLKGRDAGMYTMADVIG"
FT   CDS             complement(366572..366754)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04100"
FT                   /product="Dihydrodipicolinate synthase/N-acetylneuraminate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35634"
FT                   /db_xref="GOA:D4MPE8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPE8"
FT                   /protein_id="CBL35634.1"
FT                   /translation="MQLEAIPLIDALFSEVNPIPVKEAMNLMGKNVGPYRKPLVEMEPE
FT                   NREKLIKAMKDYGLL"
FT   gap             366803..366870
FT                   /estimated_length=68
FT   CDS             complement(367775..368275)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04130"
FT                   /product="ATP:corrinoid adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35635"
FT                   /db_xref="GOA:D4MPE9"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPE9"
FT                   /protein_id="CBL35635.1"
FT                   /translation="MDKGSVQVICGPGFGKTTMALGKGVVAVTKHKKVIMIQFLKGNLS
FT                   ADVAEGLKCLEPQMKVFRFEKQGDYFEKLSEEQKREERINIQNGLNFARKVLTTRECDL
FT                   LILDEILGILDHDILTLEEFENLLSLRDEEVSLILTGKNFPKQLMRCVDSISKIENVEI
FT                   DNK"
FT   CDS             complement(368377..369012)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04140"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35636"
FT                   /db_xref="GOA:D4MPF0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPF0"
FT                   /protein_id="CBL35636.1"
FT                   /translation="MSEKVIENNKVSVIGEVISEFTFSHEVFGEGFYLVSLAVSRLSDQ
FT                   VDIIPLMISERLLDVTQDYRGRTVKAIGQFRSYNCHEGVKNRLVLSVFVRELNFLEEFT
FT                   DCTKTNQIYLDGYICKEAIYRKTPLGREIADILLAVNRPYGKSDYIPCIAWGRNARYAS
FT                   GFAVGARVKVWGRVQSREYTKKLNETECEKRVAYEVSVSKMECETEGA"
FT   CDS             complement(369948..371081)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04160"
FT                   /product="small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35637"
FT                   /db_xref="GOA:D4MPF1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPF1"
FT                   /protein_id="CBL35637.1"
FT                   /translation="MKTKREDVRNIAIIAHVDHGKTTLVDQLLRQSGVFRANQEVVDRV
FT                   MDSNDIERERGITILSKNTAVFYKGVKINIIDTPGHADFGGEVERVLKMVNGVVLVVDA
FT                   YEGAMPQTKFVLRKALDLDLPVIVCLNKIDRPEARPDDVIDEILELFMDLDASDEQLDC
FT                   PFLYASARAGFAKKNMDDPEVDMTPLFETILDYIPAPEGDPDAETQVLISTIDYNEYVG
FT                   RIGVGKIDNGSLKVNQECVIVNHHEPDKFRRVKIGKLYEFDGLNKVEVAEAQIGSIVAI
FT                   SGISDIHIGDTLCSPEKPEAIPFQKISEPTISMDFMVNDSPLAGLEGKYVTSRHLRERL
FT                   FRELNTDVSLRVEERILRTALRCPAAASCTCLSLLKI"
FT   CDS             complement(371168..371956)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04170"
FT                   /product="conserved hypothetical protein TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35638"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPF2"
FT                   /protein_id="CBL35638.1"
FT                   /translation="MKKNYKILYKEGEGTIVEKKSRFIATVRPVESEEEALAFIAEMRK
FT                   KYWDATHNCTAFVIGENHELMRCNDDGEPSQTAGRPMLDVLLGEDVHNCCAVVTRYFGG
FT                   TLLGTGGLVRAYSGAVKEGLKNSVIVEKRLAEKLTVQTDYTGLGKIQYILGEENITVLD
FT                   SEYTDQVVLTLLVPVDAVEPLMAKLTEGTNGRCVIERAEKLYYGLLGKEIVFSRTDADV
FT                   PGPGKAGPLEKNCNFPLFFPQITLNLCKDNVKITNCVNSS"
FT   gap             372790..373911
FT                   /estimated_length=1122
FT   gap             375543..376598
FT                   /estimated_length=1056
FT   CDS             complement(376856..378211)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04220"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35639"
FT                   /db_xref="GOA:D4MPF3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPF3"
FT                   /protein_id="CBL35639.1"
FT                   /translation="MQKTFDYIDRNFDTMVEELQKFCAQPSIAAQNKGMKETAEMLAEK
FT                   MREAGIQAQILENENGFPVVYGEVKGDSEKTLLFYNHYDVQPPEPIEKWNYPPFGSEIH
FT                   DGILYARGCSDDKGTLLSRVHGIEAILKSGHTLPVNVKFLVEGEEEIGSPSFQAFVDSH
FT                   RELLKADACLWENSAKDEDDNPVVKLGNKGMLYCQLCVKTGQTDVHSMNATIVPNAAWR
FT                   LVEALNTLRDREGNVLIEGFYDDILPVCSEEKEAWKQVPSPEKGLKKRLGIDRFVNDVK
FT                   GEEVNLALYTKPSCNICGIVSGYTGEGQKTVTPCEASAKLDFRLVVAQKPEKIVRLLRE
FT                   HLDRHGFEDIEICVFSQAAPAKTPVTEKFVQVVTRAAQDVYEKPMVVLPTAAGTGPRDV
FT                   FDWSGMPIAGIGCGHAGSVQHAPNENIRLADYKEAVKHVAALLFRAGEEEIR"
FT   CDS             complement(378226..378702)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04230"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35640"
FT                   /db_xref="GOA:D4MPF4"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPF4"
FT                   /protein_id="CBL35640.1"
FT                   /translation="MGQDTAKKNLFDSFQDGVRKGWGIFVKSMLPSIVMAYTFIYILET
FT                   TGLMDLFSRIFAPVMGIFGMPPIAIVCLATVFFSRAGGCALAASFVADGSLTAMQATVL
FT                   LPTMFLIGGTINQWVRVISVCGTRASRQKYIILMTWVIAFLSLWVARLIFPLFS"
FT   CDS             complement(378683..379360)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04240"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35641"
FT                   /db_xref="GOA:D4MPF5"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPF5"
FT                   /protein_id="CBL35641.1"
FT                   /translation="MDGKKETNRLSPLGVAMLIVAILIFSGAFTNAQGPLKVLDFSNLL
FT                   GSFGKIADNLDFRGKGGDSAREGFMFALTLAPTVMVAMGLIQIFENFGALKAAEKLLTP
FT                   IMKPIMGVPGQASLALVGSLSSSDAGSAMTRELYESGRITEDERDVFTAFQYSSSGIIV
FT                   NYFGGASSIFGSITVGAGIPFVYLFVIKIIEANLMRLIIRLERKKGGKTQMKEEGEHGT
FT                   GHS"
FT   CDS             379805..380269
FT                   /transl_table=11
FT                   /locus_tag="CL3_04260"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35642"
FT                   /db_xref="GOA:D4MPF6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPF6"
FT                   /protein_id="CBL35642.1"
FT                   /translation="MDVYELRNITRCMLDICRCLDAIREGQFAKFGLTRGQHSFLTRIS
FT                   ENPGINQENLSYLLKVDRSTTAKALKKLIEKGYIKKIHPENNKKEWILFVTEEGASLNE
FT                   KMEDLVINPLIQLYQGVSDREITRLYKTMSLMDTNIVAAYLNYKNSSFLE"
FT   gap             381224..381390
FT                   /estimated_length=167
FT   CDS             complement(381646..382638)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04300"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35643"
FT                   /db_xref="GOA:D4MPF7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPF7"
FT                   /protein_id="CBL35643.1"
FT                   /translation="MYSVIVVDGDTETVELLKTGVEWNRLGCRLAGTALSIKEGLFLVQ
FT                   TEKPDLVITDMRIGREKENDFLRILYERQQEKRPLVIILSACRDFEEACRAIRYEAALY
FT                   LTKPPRMDELEEGILWVLDRLEIKRRQIVRLAQEKQERRDGREEIMRSESGGLTKQKRL
FT                   SGNSSLPERTGAENQGERPETDDRGKEPGTKRAERKDARAVSDRTLSELQRIRSGMQNY
FT                   SPFIREALRFIDSHLEQELSLTVLCEELSLSHSYFSKKFKRETGTGYVTYVTMAKMERA
FT                   RTLMEDPRNRANEIAKQLGYYDYSYFFQNFRRYFGCSPREFKSHGRIPE"
FT   CDS             complement(382626..382754)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35644"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPF8"
FT                   /protein_id="CBL35644.1"
FT                   /translation="MTGVFLHGSPTAADNAGMMQKTREDRKQTENSTKDLIRLCTQ"
FT   gap             382962..383216
FT                   /estimated_length=255
FT   CDS             complement(384261..384959)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04340"
FT                   /product="Amidases related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35645"
FT                   /db_xref="GOA:D4MPF9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPF9"
FT                   /protein_id="CBL35645.1"
FT                   /translation="MKINPKYVSFYYQGMEEVPDMELDKKKTALLVIDMQKEFVNRDCG
FT                   DYLKAKEAGDEERWIPYHDRLDQVVVPNIRRLIDYFRENDMEVTYGRIACLKENGRDRS
FT                   RVQSTYGWNNIYLPINSREAEMVDELAPLPDEIVVNKTTDSVSLGTNYTQLLHNMGIDT
FT                   VVVTGIVTDQCVASSVRVLADQGFQIICVEDCCAAPDMELHDMELKIMNILYCNVLSTD
FT                   ETLEVLKTAK"
FT   gap             385010..385673
FT                   /estimated_length=664
FT   CDS             complement(385741..385902)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35646"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPG0"
FT                   /protein_id="CBL35646.1"
FT                   /translation="MNFIKGKAGAVLALICLVLILGVIWFCLFDMNYQSQMHGTFVEAG
FT                   QTDREMGA"
FT   CDS             complement(386135..386872)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04380"
FT                   /product="RNA polymerase sigma factor, sigma-70 family/RNA
FT                   polymerase sigma-70 factor, sigma-B/F/G subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35647"
FT                   /db_xref="GOA:D4MPG1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPG1"
FT                   /protein_id="CBL35647.1"
FT                   /translation="MEGTGKADGTIRLIMLAHGGDKAARDRLVEENMGLVWSIVRRFAG
FT                   RGCETEDLFQIGSIGLIKAIDKFDTSYDVRFSTYAVPMIAGEIRRFLRDDGMIKVSRSV
FT                   KEMGIKVSAAREKLAGTLGREPTLEEIAGSVGASREEVAASLEAGAQVESLYAPAGGDD
FT                   TNLSLLDRLSQESRENEEVLDRMVLKKLLGSLGEKERELIVRRYFYGQTQTKIAGQMGI
FT                   SQVQVSRMEKRILKKMREEFGLD"
FT   gap             387064..388218
FT                   /estimated_length=1155
FT   gap             389331..390507
FT                   /estimated_length=1177
FT   gap             394198..394923
FT                   /estimated_length=726
FT   CDS             394964..395404
FT                   /transl_table=11
FT                   /locus_tag="CL3_04450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35648"
FT                   /db_xref="GOA:D4MPG2"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPG2"
FT                   /protein_id="CBL35648.1"
FT                   /translation="MEQIENELLEELEEVLRRYRASDLLTNPAVVFTEVFHLVKENSGM
FT                   VSILIGENGDINFVNRLKDIVREKCLRDWMELFRPEVAKEEGVCQGSSAFEAYYAFTVT
FT                   GCIGLVQYWLDSGLKESPEELASLTEQIILKGIRMFEKEPDA"
FT   gap             396054..396478
FT                   /estimated_length=425
FT   gap             398901..399100
FT                   /estimated_length=200
FT   CDS             complement(399527..400144)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04510"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35649"
FT                   /db_xref="GOA:D4MPG3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPG3"
FT                   /protein_id="CBL35649.1"
FT                   /translation="MGHKMVNPNNKEYYYEGIVGGKTGYTSLAGNTLVTCVERNGTRLI
FT                   AVILKSRQTHYADTKALLDYGFSLSQAGETGTSGIQTGGTSGPGGSGSTSGPAGTSGHC
FT                   RWVQDASGWRFVKTDGSYAAGECLKINGEIYCFKQDTYMVSSGWYQIDGIWYYFRPSGG
FT                   LATSRWVETNGMWYYVDENGALFTGGTTPDGYRVDENGVWIR"
FT   CDS             complement(400156..401361)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04520"
FT                   /product="Aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35650"
FT                   /db_xref="GOA:D4MPG4"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPG4"
FT                   /protein_id="CBL35650.1"
FT                   /translation="MAESMLGLKRSHRCTELSTENIGENVTVMGWVQKSRNKGGIIFVD
FT                   LRDRSGLLQIIFEEADCGSESFAKAEKLRSEFVIAVTGKVEARSGAVNENLKTGAIEIR
FT                   ANALRILSESETPPFPIEENSKTKEELRLKYRYLDLRRPDLQKNLMTRSRVTTLTRAFL
FT                   AEEGFLEIETPTLIKSTPEGARDYLVPSRVHPGSFYALPQSPQLFKQLLMCSGYDRYFQ
FT                   IARCYRDEDLRADRQPEFTQIDMELSFVDVDDVLDVNERLLKKLFKEICGFDLQLPIQR
FT                   MTWREAMDRFGSDKPDLRFGMELKNVSETVKDCQFVVFKSALENGGSVRGINAEGQAGM
FT                   PRKKIDALVEFAKGFGAKGLAYLAVLEDGSYKSSFAKFMTEEELAALVKAMISLPLQAS
FT                   PL"
FT   CDS             complement(401523..402785)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04530"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35651"
FT                   /db_xref="GOA:D4MPG5"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPG5"
FT                   /protein_id="CBL35651.1"
FT                   /translation="MALKKKPVTGMKDILPAEMEIRDYVLAKIKETYRSFGFSAIETPC
FT                   VEHIENLTSKQGGDNEKLIFKILKRGEKLNLETAREEGDVVDGGLRYDLTLPLSRYYAN
FT                   NSANLPSPFKALQVGSVWRADRPQKGRFRQFVQCDIDILGDPTSLAEIELITATTTALS
FT                   RICPDNSFTVRINDRELLKAMASYCGFPEDDCDKVFITLDKMDKIGLDGVAAELMEMGY
FT                   AKESVDRYRELLASVKNDAAGVRALGETLKGVLKEGTAEGLANIMETVSSTAEAEFGIE
FT                   FDPTLVRGMGYYTGTIFEVSMEGFGGSVAGGGRYDKMIGKFTGMDTPACGFSIGFERIV
FT                   TILLDNGFKVPAASGKKAYLFEKNIGSEKLSQVLKEASEERKAGVQVLVAQMNKNKKFQ
FT                   KEQLQKDGYTEFKEFYREALK"
FT   CDS             complement(402959..404146)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04540"
FT                   /product="Coproporphyrinogen III oxidase and related Fe-S
FT                   oxidoreductases"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35652"
FT                   /db_xref="GOA:D4MPG6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023995"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPG6"
FT                   /protein_id="CBL35652.1"
FT                   /translation="MSGLTGRTLPWGTLTGIRPTKIALTRLYEGMSEEEIRDYMRETYL
FT                   TSREKIQLSLDVARREKELLSAVDYENGYSLYIGIPFCPTTCLYCSFTSFPIGKWQGRT
FT                   GLYLNALFREMDYVAEKMKGRPLDTVYFGGGTPTSLSPEDLDAILDKVERTFPMDQVKE
FT                   FTVEAGRPDSITEEKLQVLRNHGITRISINPQTMKQETLDLIGRRHTVEQVKETFRLAR
FT                   RMGFDNINMDLIVGLPEEDEEDVRNTMEQIKELRPDSLTVHSLAIKRAARLNMFRERYG
FT                   NLKITGTQEMIDMTARYAREMGMEPYYLYRQKNMAGNFENVGYSVPGKACIYNILIMEE
FT                   KQTIMACGAGTTTKVVFPRENRLERAENVKEVEQYIERMDEMLERKEKLIRQLEG"
FT   CDS             complement(404146..404445)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35653"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPG7"
FT                   /protein_id="CBL35653.1"
FT                   /translation="MAFCPGNKFTHEEEEAVSEAKLIVRGERAGDEFCLCVETRADENG
FT                   QSFAPPAGAKGDGRTAWYRRQRLLPGRLPGKAACRYLTGTAWRRRTGSRGSSTG"
FT   CDS             complement(404565..405212)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04560"
FT                   /product="Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35654"
FT                   /db_xref="GOA:D4MPG8"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPG8"
FT                   /protein_id="CBL35654.1"
FT                   /translation="MQIKKLTVGYVQTNCYIVSNEETREAVVIDPGDQGELIAEALKRD
FT                   SLQTRAILLTHGHSDHIGGLEAVKKATGAKVYALDQERELLADENLNLSKSLLGTIIRE
FT                   EADVWLRDGEKFSMIGYEFQVIGTPGHTTGSCCYYVESEKALFAGDTLFEGSYGRVDLP
FT                   GGSSVQLLHSVLDKLFELPDDVNVYPGHLGYTTIGDEKKYNPLAPYKGKLLE"
FT   gap             406557..407338
FT                   /estimated_length=782
FT   CDS             complement(408128..408223)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35655"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPG9"
FT                   /protein_id="CBL35655.1"
FT                   /translation="MTGRNRQDTAKQEKKGAVEPWESRGEQKEEF"
FT   CDS             complement(408732..408857)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35656"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPH0"
FT                   /protein_id="CBL35656.1"
FT                   /translation="MKKLEEYVRSIPDFPEPGIISGTLPRSCRIPTDFIWLWTAF"
FT   gap             410223..410508
FT                   /estimated_length=286
FT   CDS             complement(410636..412240)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04640"
FT                   /product="Bacterial membrane protein YfhO."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35657"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPH1"
FT                   /protein_id="CBL35657.1"
FT                   /translation="MREDEIAGISREFDRVLNQVAAGADREPGQNEERAAERKDTGPDR
FT                   EEGRVDEMEPAGIKEAAASQRRVRKPENGTEDRLRPGRGQREGQKAAVLDARERYPERS
FT                   RKQEEDRPGLLRARDCYAAAFLIPVIIMIIIFAQRGIFPFGEQSFLRTDMYHQYAPFFS
FT                   EFKHKLSQGGSLLYSWNIGLGVNFAALYAYYLASPLNWLIIFCPKEFIIEFMTGSIVLK
FT                   IGLAGLVFTWYLRKHCRTSDFGTCFFGIFYALSGYMAAYSWNIMWLDCIVLFPVILLGL
FT                   ERLVSEKKGLLYCVALGLSILSNYYISIMICIFMVLYFIALAVLDWDSFRDGWGKTIGL
FT                   FAGYSLLAGGLAAFVLLPEIYALQSTASGEMSFPETAESYFSILDMLARHIGNVQVEIG
FT                   LNHWPNIYCGVAVLMFFLLYLACRKIELKEKAVYCTLLLFFLASFSINVLNFIWHGFHY
FT                   PNSLPARQSFIYIALMLTVCCRAYTNLEGISSRSVSVAFWGSASFVLLDRISWKGTRPT
FT                   TLPYFTGRSFSWRSTQG"
FT   gap             412416..413542
FT                   /estimated_length=1127
FT   CDS             413551..413724
FT                   /transl_table=11
FT                   /locus_tag="CL3_04660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35658"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPH2"
FT                   /protein_id="CBL35658.1"
FT                   /translation="MFFSAKSKDGSLFSHMFPPFYFHAFKRMDKQTPMFHPRPYGLSHL
FT                   RFWQSSAKFCLN"
FT   CDS             complement(413721..415007)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04670"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35659"
FT                   /db_xref="GOA:D4MPH3"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024551"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPH3"
FT                   /protein_id="CBL35659.1"
FT                   /translation="MKPYSELTKEELVALSHELNAQYRAFQAKGLKLDMSRGKPSAEQL
FT                   DLSMGMMDVLNSSTDLTCDDGTDCRNYGVLDGISEAKELIGDMIEVPASNLIIYGNSSL
FT                   NVMYDTISRAMTHGIMGNTPWCKLDKVKFLCPVPGYDRHFAVTEYFGIEMINVPMTEDG
FT                   PDMDMVEELVAKDEAIKGIWCVPKYSNPSGVSYSDQTVRRLARLKPAAKDFRIFWDNAY
FT                   GIHHLYEDKQDQVTEILAECKRAGNPDLVYKFASTSKISFPGSGIAALATSQNNLEDIK
FT                   KQLKIQTIGHDKVNQLRHVRFFKDIHGMVEHMKKHADILRPKFEAVEEILDRELGGLEI
FT                   GSWTKPRGGYFICFDSLEGCAKAIVAKCKKAGVIMTDAGATYPYGKDPKDSNIRIAPSY
FT                   PPLQDLITATELFTLCVKLVSVEKLLSEL"
FT   gap             415399..415563
FT                   /estimated_length=165
FT   CDS             415638..416201
FT                   /transl_table=11
FT                   /locus_tag="CL3_04680"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35660"
FT                   /db_xref="GOA:D4MPH4"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPH4"
FT                   /protein_id="CBL35660.1"
FT                   /translation="MSLAELFILAVGVSMDAFAVAVCKGLSMKQLNWRHAVIIGVYFGG
FT                   FQAGMPFIGYLLGWHFKDAITSVDHWIAFVLLAAIGLSMIRESRSKDEDEESLDASVDF
FT                   KTMCVLALATSIDALAIGVTLSFLNVDIVPAVSFIGIITFSLSIVGVKAGNVFGIRYKS
FT                   RAELAGGTILLLIGSKILIEHLFL"
FT   CDS             complement(416277..417305)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04690"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35661"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPH5"
FT                   /protein_id="CBL35661.1"
FT                   /translation="MGRTGGKMKKRASTGKVQTKKQLEQAIAAYQKLAEEDWLTGLYNR
FT                   GAIEKRVDEQLKKNRAGSMIVMDIDQFKKVNDTYGHIIGDQLLREISSVLKKMMPPFCL
FT                   LGRTGGDEFVIFFPQTLGKEELERRCNQIRERFSRVEVNSRVLLRLSLSICSGTYHPGF
FT                   GYRELFDLADQQMVKEKRSRDAGKFGKGTVTDTEGDEIRIDMKILAKEMREEDPHPGAY
FT                   CQDYETFKSIYRFVERRMTRKDMGAFLILFTLTDTSNEFPTLEKRDYQLEVLGQEIQNN
FT                   LRMGDLYAQYSSCQYLVMLSDTTEENVEMIAERICRAFYSENGTEEELILHHTYPLKPA
FT                   GK"
FT   gap             417396..417615
FT                   /estimated_length=220
FT   CDS             complement(417818..419041)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04710"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35662"
FT                   /db_xref="GOA:D4MPH6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPH6"
FT                   /protein_id="CBL35662.1"
FT                   /translation="MKIYEELVARGLIAQVTNEEEIKNMVNEGKATFYIGFDPTADSLH
FT                   VGHFMALCLMKRLQMAGNKPIALIGGGTGYIGDPSGRTDMRSMMTPEIIQHNCDCFKKQ
FT                   MSRFIDFSDGKALMVNNADWLLGLNYVELLREVGPHFSVNRMLTAECYKQRMERGLSFL
FT                   EFNYMIMQSYDFYMLFQKYGCNMQFGGDDQWSNMLGGTELIRRKLGKDAHAMTITLLLN
FT                   SEGKKMGKTQSGAVWLDPNKTSPFEFYQYWRNVADADVLKCLRMLTFLPLEQIDEMDQW
FT                   EGSQLNKAKEILAYELTALVHGEEEAVKAQEASRALFTSGNAANMPTAKLKEEDFADGS
FT                   IDILSILQKSGLAPSRSEARRNVEQGGVSVDGVQVKDIKAAFTKDQLSGEGVVVKRGKK
FT                   NFKRVVLE"
FT   CDS             complement(419324..419572)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35663"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPH7"
FT                   /protein_id="CBL35663.1"
FT                   /translation="MTNRYQALTGKSSRPAPHTESRRMVRGAWRRGRRIHPRALHRREE
FT                   SGRAFDFSFTLSADRKASCVGCSGVAARYSGGSIAAG"
FT   gap             420526..420848
FT                   /estimated_length=323
FT   gap             422721..423571
FT                   /estimated_length=851
FT   CDS             complement(423647..424300)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04760"
FT                   /product="pyroglutamyl-peptidase I . Cysteine peptidase.
FT                   MEROPS family C15"
FT                   /EC_number="3.4.19.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35664"
FT                   /db_xref="GOA:D4MPH8"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPH8"
FT                   /protein_id="CBL35664.1"
FT                   /translation="MKILMTGFEPFGLHKLNPSWEAVNALPDRIEGAEIIKLRLPVSFG
FT                   RFTSPLEEAVRRECPDCLISVGLAGGERQISIERVGINLEEARIPDNDGEQPFDIPVRR
FT                   DGQNAYFSTLPVKRIAKEIEKEGIPVCVSYSAGTFVCNAVMYTGLYLAEQENRNMRCCF
FT                   IHVPYDETMEEAGKGEPFLPRAEMVKALKAAVRVAVKAAGEGAGDLREAAGTIF"
FT   tRNA            424610..424689
FT                   /locus_tag="CL3_T_35330"
FT   gap             424742..424777
FT                   /estimated_length=36
FT   gap             425479..426693
FT                   /estimated_length=1215
FT   CDS             complement(427081..427722)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04800"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35665"
FT                   /db_xref="GOA:D4MPH9"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPH9"
FT                   /protein_id="CBL35665.1"
FT                   /translation="MRIGQGYDVHRLVEGRDLILGGVKIPYEKGLLGHSDADVLVHAVM
FT                   DALLGAAALGDIGQHFPDTDPAYAGISSIELLRHVGRLLSEHSYIIENIDATVIAQRPK
FT                   LLSYRPKMAENIAEALGISPGQVSVKATTEEGLGFTGTGEGISAQAITLLTEVENYCYD
FT                   KEMMASPGCGGCCPGRGCVSKRGLREKGQESRKSTGKAEAPDLQTLARHD"
FT   CDS             complement(427789..428715)
FT                   /transl_table=11
FT                   /locus_tag="CL3_04810"
FT                   /product="Sphingosine kinase and enzymes related to
FT                   eukaryotic diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35666"
FT                   /db_xref="GOA:D4MPI0"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPI0"
FT                   /protein_id="CBL35666.1"
FT                   /translation="MYYFIVNPQSRHGYGLKIWKKIEQQLKREGTEYRAFLTERPGQAS
FT                   EIADDLTRGRKEELTIVVVGGDGTFGEVLDGINFAGALTFGYIPAGRGNDLARSLRLPK
FT                   SPARSLRRILHPRNYRYLDYGLVTYGEETLRHRRFMVSAGIGLDAAVCHSLLYEKSGFL
FT                   RRHFPLPHRGYLTAGLWQLLKARPSKGYLLLDGTRKVEFNHIYFISAQIHPSEGGGFYF
FT                   APRTEPGDGKLTLCAVSQAGKFSLLLLFLRTRLPIFRKKKGVRTYECREALIHTEQPMA
FT                   VHTDGESCQYQNDLEIRCIERKIRMIV"
FT   gap             430587..431528
FT                   /estimated_length=942
FT   CDS             431531..432004
FT                   /transl_table=11
FT                   /locus_tag="CL3_04840"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35667"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPI1"
FT                   /protein_id="CBL35667.1"
FT                   /translation="MQSQELFSEELLVAVPPLSPLNEKAVWVEGSRYRRLELKWLNGQD
FT                   IILPYPGQSLRAEAEAAFRRAGVTPGRIENIRNIEMAMQMVAEGLGVGFNREYYAMNMK
FT                   YRKRVNYYTVGDAASKSAFVAGYRRDLHVPEPMQRFIALCREQAFTEWENGDR"
FT   gap             432147..432430
FT                   /estimated_length=284
FT   CDS             433647..433856
FT                   /transl_table=11
FT                   /locus_tag="CL3_04860"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35668"
FT                   /db_xref="GOA:D4MPI2"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPI2"
FT                   /protein_id="CBL35668.1"
FT                   /translation="MSEKTKKPFKMPHTFVIIFTIILAAVALTWIIPAGEYARFENAEG
FT                   IKVIDPSQFSYIARTPVNPLLIPL"
FT   gap             433990..434196
FT                   /estimated_length=207
FT   CDS             434517..434915
FT                   /transl_table=11
FT                   /locus_tag="CL3_04870"
FT                   /product="Bacterial mobilisation protein (MobC)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35669"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPI3"
FT                   /protein_id="CBL35669.1"
FT                   /translation="MRKRYNTPHRSRVVKTRMTEEEYAEFAERLSAYNMSQAEFIRQAI
FT                   TGAAIRPIITVSPVNDELLAAVGKLTAEYGRIGGNLNQIARTLNEWHSPYPQLAGEVRA
FT                   AVSDLAALKFEVLQKVGDAVGNIQTYQL"
FT   gap             435099..435859
FT                   /estimated_length=761
FT   CDS             436191..436685
FT                   /transl_table=11
FT                   /locus_tag="CL3_04900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35670"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPI4"
FT                   /protein_id="CBL35670.1"
FT                   /translation="MAATVTAYQQYGFSSPEELDEACSAAYAAMRESLTELKQVEKTLN
FT                   GKKELQRQVLAYSKTRPVRDGLKQQKNAKAKAAYRQKHESDFIIADAAARYFRENGISK
FT                   LSSYKSLQAEIESLIKEKNSGYNDYRAKREEYRRLQTVKGNIDQILRRERKPVKRQEQE
FT                   R"
FT   CDS             436879..437082
FT                   /transl_table=11
FT                   /locus_tag="CL3_04910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35671"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPI5"
FT                   /protein_id="CBL35671.1"
FT                   /translation="MSKKRRLEWSFFLRQVKIGNTTCDRITYNDLCRSCTHSCKQSFRA
FT                   VIILCPRYYSKRRKKEDRDNGR"
FT   gap             437747..439681
FT                   /estimated_length=1935
FT   CDS             440150..440695
FT                   /transl_table=11
FT                   /locus_tag="CL3_04930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35672"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPI6"
FT                   /protein_id="CBL35672.1"
FT                   /translation="MKNKLFILLLAFVLLLSACSNNSPPDDNTKEVLPELESAGSIESR
FT                   GEKFIENFPQDYPSFELLEYVFGSAENAPIQLVAIARNKETGSSATLFVLDENGVGQVV
FT                   LASGYSATYCKEDGLQLDKNVISISLNLEISSTNSEIHDFNITVTQEENQGKVNTVYSS
FT                   QENIRSKVANPAEPVNGK"
FT   gap             441501..442525
FT                   /estimated_length=1025
FT   CDS             443236..443442
FT                   /transl_table=11
FT                   /locus_tag="CL3_04980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_04980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35673"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPI7"
FT                   /protein_id="CBL35673.1"
FT                   /translation="MPRMSKKRRLEWAFFLNERNRITFNALCRGCTHDCKQSFRAIVVL
FT                   CPRYYSKRWKARPADKENQDYVR"
FT   gap             443963..444039
FT                   /estimated_length=77
FT   CDS             444209..444853
FT                   /transl_table=11
FT                   /locus_tag="CL3_05000"
FT                   /product="phage DNA replication protein (predicted
FT                   replicative helicase loader)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35674"
FT                   /db_xref="GOA:D4MPI8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPI8"
FT                   /protein_id="CBL35674.1"
FT                   /translation="MEREAAEQQRKHRDKVEELKRRGFTDPAMREWTFANDNGRNPQMK
FT                   TAHFYVEHWEDMKAGNIGYLLWGSVGTGKSYLAGCIANALMEKEISVRMTNFALILNDL
FT                   AATFEGKNEYISNLCRYPLLILDDFGMERGTEYGLEQVYNVIDSRYRSGKPLIVTTNLT
FT                   LTELQNPQDTPHARIYDRLLEMCAPVCFSGENFRRESAQNKLNRLKQLMND"
FT   CDS             444867..445049
FT                   /transl_table=11
FT                   /locus_tag="CL3_05010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35675"
FT                   /db_xref="InterPro:IPR026990"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPI9"
FT                   /protein_id="CBL35675.1"
FT                   /translation="MTDKKEHIRHSMKSTAPADCVTEIRIGNSVLVVSGFFKQGAKETA
FT                   ADKMAKVLEAEAATK"
FT   CDS             complement(445107..445496)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35676"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPJ0"
FT                   /protein_id="CBL35676.1"
FT                   /translation="MKKYISLFLCLTCILTLVACGKKAAPIQLPQTSDITSVDVTVGEN
FT                   TTNHSDTAWISEIISDISSSEPTSKQSVQDFPQTESYIKIDFQFETGTSTIFAYEENGK
FT                   QYIEQPYQGIYKIDSQLYERLQETN"
FT   gap             446373..446970
FT                   /estimated_length=598
FT   gap             449235..449948
FT                   /estimated_length=714
FT   CDS             450798..451085
FT                   /transl_table=11
FT                   /locus_tag="CL3_05070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35677"
FT                   /db_xref="InterPro:IPR025464"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPJ1"
FT                   /protein_id="CBL35677.1"
FT                   /translation="MAESADSAGKGETMGIKLEKIGADLEKARKKRAEWDAKVKDLERR
FT                   YREEENTEIHEMVHAANLTPEQLAELIRKSAAFMPQVMAEEAKEDGQYDE"
FT   gap             451517..453351
FT                   /estimated_length=1835
FT   gap             453895..453895
FT                   /estimated_length=1
FT   gap             454773..455383
FT                   /estimated_length=611
FT   CDS             458117..459016
FT                   /transl_table=11
FT                   /locus_tag="CL3_05120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35678"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPJ2"
FT                   /protein_id="CBL35678.1"
FT                   /translation="MSEEKRKTEAAFLIDDKSFLHLQEIEEGYYFAFYDKASYEKQYDG
FT                   DISREDLHCCPVKNPMAAARILAVEVAGFDGLRAERVSLRMLEPCVESGIRRRSLWEPE
FT                   TLPKRDIRFITPDYKEKFRIPDGGTIEVVYPDRAFTARCRFLDEYHLTVSGSVYHICEY
FT                   AEKLKLSGGSCRPEAELDADKGCWKIGNDRYLAVQYCDDGWTYLLLNGQYCEMEKGKLE
FT                   KPESSLIEAREEVLDSVGLGDKTRYRAVYDVILDRAAEIKERNSAGKRESAVEKLNGMK
FT                   RTGAEYHSSSIKRREESR"
FT   CDS             459013..459333
FT                   /transl_table=11
FT                   /locus_tag="CL3_05130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35679"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPJ3"
FT                   /protein_id="CBL35679.1"
FT                   /translation="MSRRYHLTLAEQETVILWDNELDTASVYTHDQRLINKLKALSDKY
FT                   PAQYRLERRGPQRAVTYTVPKKSIGIRPPYGEGRRQRDIENARKNGLPFMKPLREENDV
FT                   EG"
FT   CDS             459320..459934
FT                   /transl_table=11
FT                   /locus_tag="CL3_05140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35680"
FT                   /db_xref="InterPro:IPR025465"
FT                   /db_xref="InterPro:IPR025923"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPJ4"
FT                   /protein_id="CBL35680.1"
FT                   /translation="MSRDKIEKWDEVNGITAPERNLEAFLESSTDTYAILQLRDSEDTR
FT                   YERFASYSALQRQGKEPEIDHYDVVYLAPLPPFQDRGRMLEQMFVRFNFNHPADFRGHS
FT                   LSVSDIVALNTGGEVSCHYVDSVGFVELPGFFSGKNHLRSAEDSLEQNDNSLDGVINNL
FT                   PEGKADHSSPEEKPSVLEQLKGLQQPGRTMAPHQPTERSRE"
FT   gap             460500..461754
FT                   /estimated_length=1255
FT   gap             463237..464052
FT                   /estimated_length=816
FT   CDS             465843..466175
FT                   /transl_table=11
FT                   /locus_tag="CL3_05200"
FT                   /product="Bacterial mobilisation protein (MobC)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35681"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPJ5"
FT                   /protein_id="CBL35681.1"
FT                   /translation="MEKKDQELHFFVTKSDQERIHQKMAEMGIRSKSAYLRKMALDGYC
FT                   VKLDLQDVKELVSLLRRCSNNLNQYAKRANEAGSIYQEDIRDLQARLDEIWQCTRELLS
FT                   RLATIR"
FT   gap             467611..468468
FT                   /estimated_length=858
FT   CDS             complement(469236..469748)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05240"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35682"
FT                   /db_xref="GOA:D4MPJ6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPJ6"
FT                   /protein_id="CBL35682.1"
FT                   /translation="MKIFPNLFRQKFQVKAPNLVWCTDFTYIRLSNGKMRYNCAVMDLY
FT                   DRSVVSSLNSEYINTKLAKAAVEQALGAEKPGKGLILHSDQGSQYTSWKFVDYCKKSGI
FT                   RQSMSKAGCPYDNVPVEHFYNTFKNELIYPNSFSSAANFSCHHHLTTMKHRQRKNLRQL
FT                   PILALRL"
FT   CDS             complement(469874..470122)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05250"
FT                   /product="ParA/MinD ATPase like."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35683"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPJ7"
FT                   /protein_id="CBL35683.1"
FT                   /translation="MLHIPVLGLVENMAYFECPSCHDRHFIYGKSNIEKPAVEHHIEQM
FT                   AQIPIEPQLAKACDQGKIYDFEAPWFKDLTDGLEQLL"
FT   CDS             complement(470153..470938)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05260"
FT                   /product="Predicted DNA-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35684"
FT                   /db_xref="GOA:D4MPJ8"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPJ8"
FT                   /protein_id="CBL35684.1"
FT                   /translation="MPRPKKCRRVCRFPQNLVFIPKDGDRDRVAVVLTVDEYETLRLID
FT                   KEGMSQEQCSEFMQVARGTVQQMYKNARRKLADMLVDGLPLRIEGGDYRLCDGNGHPCS
FT                   CMTCFKQKIDSMYAKTKGDAVMRVAVTYENGMVFQHFGHTSQFKLYDIENGRVTASEIA
FT                   DTNGSGHGALAGMLTAMKADVLICGGIGGGAQTALAAAGIRLYGGVSGEADQAVADFLS
FT                   GSLNFDPDVHCEHHEDSHGEHHCGEDKHGCAGNGGECHE"
FT   gap             471397..471808
FT                   /estimated_length=412
FT   CDS             472143..473210
FT                   /transl_table=11
FT                   /locus_tag="CL3_05290"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35685"
FT                   /db_xref="GOA:D4MPJ9"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPJ9"
FT                   /protein_id="CBL35685.1"
FT                   /translation="MLTSGGDCQSLNATMRGVAKALYKTYDDEVEIIGFEDGYKGLMYA
FT                   DYRIMKPSDFSGILTQGGTILGTSRQPFKLMRTPDENGLDKVASMKHTYYKLKLECLVV
FT                   LGGNGSQKTANLLREEGLNVIHLPKTIDNDLWGTDMTFGFQSAVNVATNAIDCIHTTAA
FT                   SHGRVFIVEVMGHKVGWLTLHAGIAGGADIILIPEIPYDLDVVVDAIKKRTKAGKNFTI
FT                   LAVAEGAISKEDAALTKKELKEKRKTGPVYPSVAYELGAKITEKTGQEVRVTVPGHMQR
FT                   GGEPCPYDRVLSTRLGASAAQLIEKGEYGYMVAVKNNGIVKVPLSEAAGKLKTVDPSCD
FT                   MIREAKAVGISFGDK"
FT   gap             473531..475035
FT                   /estimated_length=1505
FT   gap             477394..477654
FT                   /estimated_length=261
FT   CDS             479159..479650
FT                   /transl_table=11
FT                   /locus_tag="CL3_05360"
FT                   /product="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35686"
FT                   /db_xref="GOA:D4MPK0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPK0"
FT                   /protein_id="CBL35686.1"
FT                   /translation="MNIRLIALDLDGTLLTSDKRLSERNKRALEECIRRGIYIVPCTGR
FT                   TFEGIPKPVRMIDGIKYAILTNGACIQDAETGEILERRGLFWEKAMQVIDRIEDFTLMY
FT                   DCYIEGRGKADRRFLDTLECYEIRPEICRLIRETRDPLPSLKDYLAKKQPLLDKTNTLL
FT                   "
FT   gap             481167..481779
FT                   /estimated_length=613
FT   gap             484240..485018
FT                   /estimated_length=779
FT   gap             486142..487625
FT                   /estimated_length=1484
FT   gap             488713..489497
FT                   /estimated_length=785
FT   gap             491933..492718
FT                   /estimated_length=786
FT   CDS             495114..495200
FT                   /transl_table=11
FT                   /locus_tag="CL3_05460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35687"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPK1"
FT                   /protein_id="CBL35687.1"
FT                   /translation="MAGKTLAQRLKEKNLVSKKRESVQRMAV"
FT   CDS             495239..495379
FT                   /transl_table=11
FT                   /locus_tag="CL3_05470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35688"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPK2"
FT                   /protein_id="CBL35688.1"
FT                   /translation="MYAGIVLLLAVSVSAVTGDAAGRDSGSLQAGLPFARERQTSQVRF
FT                   F"
FT   CDS             complement(495485..496684)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05480"
FT                   /product="Membrane-bound metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35689"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPK3"
FT                   /protein_id="CBL35689.1"
FT                   /translation="MGKRSIKTGLIALAAVLAVIPVQAAGKGDIDSAKDKISSLEEEKK
FT                   KTEETIQELEKLKADTESYVKELDGELARLDDELSSLDSRITDKEADIEETKAQLEEAK
FT                   KTEEEQYASMKLRIKYMYEKGDTSYLDLLLESGSMSEMLNRAEYIQQISSYDRKKLTEY
FT                   GEIKEKIADDEEKLEAEHEELLTLQEQTKAKQDSVEKLVGEKSRELQKYQNQIAANESQ
FT                   LASYQADIEAQENRIQQIEAELKRQEEEARKKAQEKGEEYKTVSIGNISFIWPCPSSSR
FT                   ITSGFGGRSSPTEGASSNHKGIDIGASSGSDIVAAADGTVTISTYSYSAGNYIMINHGG
FT                   GVSTVYMHCSKLLVSVGETVKKGQVIAKVGSTGCSTGPHLHFGVRVNGAYVNPSQYVSP
FT                   "
FT   CDS             complement(496697..497605)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05490"
FT                   /product="cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35690"
FT                   /db_xref="GOA:D4MPK4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPK4"
FT                   /protein_id="CBL35690.1"
FT                   /translation="MRVGTFWYCLKEGIKNIGKNIWFSLASVAVVSACIFLFCIFFSLV
FT                   ANVRYMVKNVETTVGITVFFDENLTQEEIQAIGAEIVKQPNVKECVYTSPEEAWESFKA
FT                   DYFAGMEDLAEGFEQDNPLADSASYEIFLTDLTSQEHMVSWLQSLDGVRRVNYSKDVAA
FT                   GMTDFNKILGLVSLGIIILLLAVSIFLISNTIRTAAAFRKNENRIMRLIGATNFMIRSP
FT                   FVVEGIIIGLVGAAIPLGLIYMVYRQVISYLGEHFEMLSNIVVFIPLHVIFPYMVGVAM
FT                   LLGVGIGFVGSFFTIRRHLKV"
FT   CDS             complement(497602..498573)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05500"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35691"
FT                   /db_xref="GOA:D4MPK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPK5"
FT                   /protein_id="CBL35691.1"
FT                   /translation="MIEIINLNKTYDNKNKALKNINIRIEEGEFVFIMGRSGSGKSTLM
FT                   KILLKEVEPTSGKVIVNDMELGKMPRRYVPKYRKMLGVVFQDFRLLKDMTVYENVAFAQ
FT                   RVLGIPTRKIKENVPAILRQVGLSSKYKSYPNQLSGGEQQRVAIARALINNPAVLLADE
FT                   PTGNLDAHNSMEIMGLLEQINRRGTTVVVVTHSHEIVEKMGKRVITIDRGCVVSDEVME
FT                   PWDYGELQVEEIHSRRGPVVKESESTKRAVRDEREKYERSVRSQAESRSGRGLGREEYG
FT                   SGAKSYGGAMEVPVDSQSADKTVSFSQVREQRGRDRGRGKQI"
FT   CDS             complement(498570..498878)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35692"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPK6"
FT                   /protein_id="CBL35692.1"
FT                   /translation="MFCLFPAEFPDSEKSGERCPGKVLRNTVREVLGNAARESFKKPGL
FT                   VCTAENSECLRRYCSGPPGQCEKKYKQKADCCNMWGSNCAEMGPMCCSSLHNLRRRA"
FT   CDS             500615..501061
FT                   /transl_table=11
FT                   /locus_tag="CL3_05530"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35693"
FT                   /db_xref="GOA:D4MPK7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPK7"
FT                   /protein_id="CBL35693.1"
FT                   /translation="MSKIDVVRKAMVEAMKAKDKARKDSLSMLLSALKNAEIDKREPLT
FT                   EDEENAVVKKEIKQTRETMELAPADREDIRNEAAARLAVYEEFAPADLTPDQIREVIGE
FT                   VLRELSIDEPKKSDKGAVMKVLMPRVKGKADGRVVNEVLAGMLK"
FT   CDS             501156..501875
FT                   /transl_table=11
FT                   /locus_tag="CL3_05540"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35694"
FT                   /db_xref="GOA:D4MPK8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPK8"
FT                   /protein_id="CBL35694.1"
FT                   /translation="MYREEIEKYIDSHRGEMLEDIKSLCRINSEKMPYQEGMPYGEGAC
FT                   QALGTALAMAEGYGFSICNYDNYVGTVDWGGEESQLDILAHLDVVPAGEGWTVTEPFEP
FT                   VEKDGRLYGRGTADDKGPAVAALYALRAVKELGIPLKKRVRLILGTDEECGSSDIKHYY
FT                   AVEKEAPMTFSPDGAFPVVNIEKGHLEGEFEAEFEASQELPRVKSIKAGTKINVVPGKD
FT                   LEPEHAAQGSVLCVQGI"
FT   CDS             501835..502521
FT                   /transl_table=11
FT                   /locus_tag="CL3_05550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35695"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPK9"
FT                   /protein_id="CBL35695.1"
FT                   /translation="MPLRDLFYVSREYEMLLANQSIYSSSLLKLPAPRFVVFFNGSYDM
FT                   GEQCVLKLSDAYEKKVEDPDLELKVTVLNINAGWNDELMNTCRLLKEYSLYVARVRAYA
FT                   KEMELAEAVSRAVDECIKEGILRDFLMKYRAEAISVSIFEYDEEREKELLRKTEYEFGR
FT                   QEGLSQGREEGLSQGIKEGMAQGVSAMIRHCRKAGASREDTLSILMEEFSISKGDAEEY
FT                   LQKYWK"
FT   CDS             502865..503542
FT                   /transl_table=11
FT                   /locus_tag="CL3_05570"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35696"
FT                   /db_xref="GOA:D4MPL0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPL0"
FT                   /protein_id="CBL35696.1"
FT                   /translation="MEMKRVLLKLSGEALAGEKKTGFDEDTVKEVARQVKLAVDAGTEV
FT                   GVVIGGGNFWRGRQSNAIDRTKADQIGMLATVMNCIYVSEIFRSTGMETEILTPFACGS
FT                   MTKLFSKDRANKYFRQGKVVFFAGGTGHPYFSTDTGVALRAIEMEADCILLAKAIDGVY
FT                   DSDPKINPNAKKYDTITIQEVIDKQLAVVDLTASIMCMENHVPMAVFSLNEKDGIANAM
FT                   QGK"
FT   CDS             503580..504125
FT                   /transl_table=11
FT                   /locus_tag="CL3_05580"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35697"
FT                   /db_xref="GOA:D4MPL1"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPL1"
FT                   /protein_id="CBL35697.1"
FT                   /translation="MQEKMKIFEEKMDKSYDALLNEFSSIRAGRANPHVLDKLRVDYYG
FT                   APTPLQQVANISVPEPRMIQIQPWEKSLVKAIEKAILTSDLGINPSNDGSVIRLIFPEL
FT                   TEERRKELAKDIKKKGEGAKVAVRNIRRDANDTFKKMEKANEISEDDLSDAEEKIQKMT
FT                   DKMIDKIDKAVETKTKRL"
FT   gap             504132..505208
FT                   /estimated_length=1077
FT   CDS             505418..506584
FT                   /transl_table=11
FT                   /locus_tag="CL3_05600"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35698"
FT                   /db_xref="GOA:D4MPL2"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPL2"
FT                   /protein_id="CBL35698.1"
FT                   /translation="MKYTEEDMKKIAVLGSTGSIGTQTLEVVRTNKDIEITALAAGRNV
FT                   ELLEQQIREFRPKLAAVWEEEAAGRLRESVRDLDVKIVSGMDGLIEVCTEPSAEIVVTA
FT                   IVGMLGIRPTIAAMEAGKDIALANKETLVTAGHLIMPLAEKMGVRILPVDSEHSAVFQC
FT                   LNGEGGSRIHKILLTASGGPFRGRTREQMRQIQVEDALKHPNWTMGRKITIDSSTMVNK
FT                   GLEVMEAKWLFGVTMDQVQVVVQPQSIIHSMVEFEDGAVIAQLGTPDMKLPIQYALYYP
FT                   ERRFLPGERLDFTKFGQITFEAPDYENFRGLALAREAGVRGGSLPTVFNAANELAVARF
FT                   LDRKISYLAITDMIEAAMRQHKVIDNPSVDEILAAEQETYDYLNSCNF"
FT   gap             508263..508528
FT                   /estimated_length=266
FT   gap             510969..511825
FT                   /estimated_length=857
FT   gap             513128..513262
FT                   /estimated_length=135
FT   CDS             513273..514139
FT                   /transl_table=11
FT                   /locus_tag="CL3_05660"
FT                   /product="Response regulator containing a CheY-like
FT                   receiver domain and an HD-GYP domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35699"
FT                   /db_xref="GOA:D4MPL3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPL3"
FT                   /protein_id="CBL35699.1"
FT                   /translation="MKEMNLLEHMPVFLVTAETGDEVTREAYALGVMDVIGKPVVPHIV
FT                   TRRVNSIIELFQARKRLGNVVERQREELFEQTKKMYRMSVGMVESLSTAIEFRSDESGE
FT                   HVRRIHDITDFLLRNTRFGDGLSENEIELIALAAIMHDVGKIAIPDAILKKPGRFTPEE
FT                   FEIMKTHTIQGGRLLAKIPQMKEHESYSYAYDIALHHHERWDGRGYPDGLKGDEISVWS
FT                   QVVSLADVYDALISKRCYKDACSCDEAVRMIVNGECGVFNPELIDSFLQVEGELRRMYQ
FT                   EKINQNV"
FT   gap             514493..515212
FT                   /estimated_length=720
FT   CDS             515350..516177
FT                   /transl_table=11
FT                   /locus_tag="CL3_05690"
FT                   /product="transcriptional antiterminator, BglG family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35700"
FT                   /db_xref="GOA:D4MPL4"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPL4"
FT                   /protein_id="CBL35700.1"
FT                   /translation="MKIDKIINNNIVSALDADGKEVIVMGRGLGFGMKAGREIPQAKIE
FT                   KIFRLDSQNSMDRFKELLSNLPLEHIQVSSEIISYAKTVLNRSLNQNIYITLTDHINFA
FT                   VERFRQKIRFSNPLLNEIRAFYKEEYLIGEYAVALIERRVGVRLPVDEAGFIALHVVTA
FT                   EYNTAMRETIDITNLIQKVVKIVTEYFGMSLDETSLNYQRFVTHLRFLAQRIVAGELLD
FT                   SGNPEFNRLISEMYPEEYECSLKLREYIKDAYSHDVTEEETAYLAVHIRRIRT"
FT   CDS             516206..516691
FT                   /transl_table=11
FT                   /locus_tag="CL3_05700"
FT                   /product="PTS system IIA component, Glc family (TC 4.A.1)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35701"
FT                   /db_xref="GOA:D4MPL5"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPL5"
FT                   /protein_id="CBL35701.1"
FT                   /translation="MFSLKKMFGGKDDKKVILAPVEGKAVSLKEVNDPTFSQEILGKGV
FT                   AVIPSKGRVVAPADGVVSVFFETKHAVSITADNGAEIIVHVGLDTVNLKGEHYTAHKKQ
FT                   GDKVKAGELLLEFDMEAIKAAGYDVITPVIICNTPDYPNMVCHTGMDVKELDPIIEL"
FT   CDS             516729..516983
FT                   /transl_table=11
FT                   /locus_tag="CL3_05710"
FT                   /product="Phosphotransferase system, HPr-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35702"
FT                   /db_xref="GOA:D4MPL6"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPL6"
FT                   /protein_id="CBL35702.1"
FT                   /translation="MKTLTARIKVPEGLHVKPASKIFMEARKYGCRITAFGSERQADCK
FT                   NIMELLSLEAAFGEELRFEFDGAGEEKAREAFKLLLRET"
FT   gap             517450..518899
FT                   /estimated_length=1450
FT   CDS             519060..519386
FT                   /transl_table=11
FT                   /locus_tag="CL3_05740"
FT                   /product="Putative transcriptional regulator, homolog of
FT                   Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35703"
FT                   /db_xref="GOA:D4MPL7"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPL7"
FT                   /protein_id="CBL35703.1"
FT                   /translation="MIYPGLGVSLDSLTSHASQLGGISLEAPPERVIGRNTIDCMKSGV
FT                   IYSAAAAMDGIIDRIEEELGEKVTVVATGGLARRIVPHCRREIILDDDLLLKGLQILYE
FT                   KNKR"
FT   CDS             519415..520260
FT                   /transl_table=11
FT                   /locus_tag="CL3_05750"
FT                   /product="rRNA methylases"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35704"
FT                   /db_xref="GOA:D4MPL8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPL8"
FT                   /protein_id="CBL35704.1"
FT                   /translation="MTRRREGMPDIIEIKDLEAPELDVYARIPEGQLLHLYEPEPGIFI
FT                   AESPKVIERALDAGYEPISLLMETKNVEGQGREVIARCGHIPVYTAQFDVLTRLTGFQL
FT                   TRGVLCAMRRKRMPEACSICAGARRIVVLENVMNPTNVGAIFRSAAALGMDAVLLTLGC
FT                   SDPLYRRAVRVSMGTVFQIPWTFFDGKKVKWPENGQELLREMGFKTAAMALSDDSVSID
FT                   EPALRREEKLAVIMGTEGEGLCAQTIRESDYVVRIPMSHGVDSLNVAAASAVAFWQLGR
FT                   "
FT   CDS             520257..520298
FT                   /transl_table=11
FT                   /locus_tag="CL3_05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35705"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPL9"
FT                   /protein_id="CBL35705.1"
FT                   /translation="MTEKERLIRDEQL"
FT   gap             520347..521041
FT                   /estimated_length=695
FT   CDS             521049..521303
FT                   /transl_table=11
FT                   /locus_tag="CL3_05770"
FT                   /product="Fatty acid/phospholipid biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35706"
FT                   /db_xref="GOA:D4MPM0"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPM0"
FT                   /protein_id="CBL35706.1"
FT                   /translation="MMTSLRSKIGALLVKPALKATLKDFDASRFGGAPLLGLKGLVVKT
FT                   HGSSKRTEVKNSIIQCLTFTEQRINEKILESLKETKENA"
FT   CDS             521365..521595
FT                   /transl_table=11
FT                   /locus_tag="CL3_05780"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35707"
FT                   /db_xref="GOA:D4MPM1"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPM1"
FT                   /protein_id="CBL35707.1"
FT                   /translation="MEFEKLQSIIAEVLNAEPEEIKASASFVDDLGADSLDIFQIVMGI
FT                   EEEFDIEIPADAAERIATVGDAAQQIRNALN"
FT   CDS             521679..522383
FT                   /transl_table=11
FT                   /locus_tag="CL3_05790"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35708"
FT                   /db_xref="GOA:D4MPM2"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPM2"
FT                   /protein_id="CBL35708.1"
FT                   /translation="MPREHFRELEDKIHYCFKDKSLIELAMSHSSYANEKHLGKLGCNE
FT                   RLEFLGDAVLEIVSSDFLFHRFPDMPEGDLTKTRASMVCEPTLAYCAEQIGLGGYLLLG
FT                   KGEDATGGRTRNSVVSDAMEALIGAIYLDGGFSCAKEFILNYVLNDMEHKKLFYDSKTI
FT                   LQEMVQARGTELLSYELLKEEGPDHNKTFEVAALIGEREVSRGAGRTKKAAEQMAAYQA
FT                   ILKLKREAGEGI"
FT   gap             522683..523649
FT                   /estimated_length=967
FT   CDS             complement(525611..526759)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05820"
FT                   /product="Imidazolonepropionase and related
FT                   amidohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35709"
FT                   /db_xref="GOA:D4MPM3"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPM3"
FT                   /protein_id="CBL35709.1"
FT                   /translation="MVIKNGQVLLFEEGGFLNRDIRIRDGKITEVAEQIIPDEGEEMVE
FT                   ASGKYVTPGLIDAHSHICISEEGMGAVGDDCNDYSDAVMPYLDTLDAINPFDLAVKSAV
FT                   KAGVTSVCVCPGSDSVIGGMCSVISLSGTVADQMLLMGKAAVKCSFGENPKNAGYGFKS
FT                   RMGNAWLLRKCIEDALEYRRRKEESIKAGSHFRTDIGMEHMLPLLERKIPLHAHAHRAD
FT                   DICTAVRIAREYDLKLVIVHCTDGVSVLDYLKQFDYPVILGPTINPRSKLECMAKGFET
FT                   AGIMSRAGFKVCITADHDVTPVYYLPVYAAQAVRAGMDETEGLKAITKNPAEVLGIGER
FT                   KGEIKPGKDADLVIWSGRPFAFDTKAESVFIMGKRAAGSEER"
FT   CDS             complement(526775..528187)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05830"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35710"
FT                   /db_xref="GOA:D4MPM4"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPM4"
FT                   /protein_id="CBL35710.1"
FT                   /translation="MSGAAKKKKWFENVKMPHTYVILITILVIMTILTHIIPAGQYQRV
FT                   EDPVSGTTVVVPDSFEFVDIEAPGFFDIFLALQRGYVDAADIMFLIIFAYGFVYMLVKN
FT                   GTMDAALGTLVRLVGKKIQLMIPITMIVLGLLSSTMGIFEEVYGLFPVFVGIAVALGYD
FT                   MVVGGAIVYLGVAIGYASGTFNPYTVGIAQDVAGVPLYSGLGLRIAVLIAFELLAILYI
FT                   MHYARKVKADPTKSVMYGVETDFAQRKSLEELTGARMNTRQKLCLLLFLGTLCGLLYGI
FT                   TQAGWGINEIAAMFLMMMIFVGIVSGYSATEICKTFIESTKSMLSSMLIVGFTRGILLI
FT                   MKDGMISDTIVYYLVNLLSGASKYVSAYGMLILQNIIKFFITGSSSQATITMPIMAPTA
FT                   ELIGLSKQIAVLAYQFGNGFAEMFWPTSCALGCGLMGVPINKWYKFVTPLFGLVLVLEF
FT                   VFMTIAVAIGYC"
FT   gap             528324..528919
FT                   /estimated_length=596
FT   gap             531248..531888
FT                   /estimated_length=641
FT   gap             532794..534391
FT                   /estimated_length=1598
FT   CDS             complement(535187..535795)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05890"
FT                   /product="electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35711"
FT                   /db_xref="GOA:D4MPM5"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPM5"
FT                   /protein_id="CBL35711.1"
FT                   /translation="MKELLLIAIGQALVNNVVLSQFLGLCPFLGVSKKVETSAGMGAAV
FT                   IFVITIASAVTNIIYTVFLNPETNIIVIGGQHVDLNYLQTIVFILVIAALVQFVEMFLK
FT                   KNMVSLYQSLGVYLPLITTNCAVLGVALNNVTDGYNFIQSVVSGIGISVGFTIAIILLA
FT                   GVREKIEHNDVPYNFQGSPIVLITAGLMSIAFFGFSGLI"
FT   CDS             complement(536057..536662)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05910"
FT                   /product="electron transport complex, RnfABCDGE type, E
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35712"
FT                   /db_xref="GOA:D4MPM6"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPM6"
FT                   /protein_id="CBL35712.1"
FT                   /translation="MGKCMERLYNGIVKENPTFVLMLGMCPTLAVTTSAVNGLGMGLST
FT                   TAVLIFSNLIIALLRNIIPDRVRIPAFIVIVASLVTIVQLLIQGYLPSLYTALGVYIPL
FT                   IVVNCIILGRAEAYASKNDALSSAFDGLGMGLGFTIALTCIGAVREILGSGGVLDLPLS
FT                   RKISAFPSLFWLQVLSSYFLFCRHCRTSLRLRLPQMVP"
FT   CDS             complement(536678..537292)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05920"
FT                   /product="Predicted NADH:ubiquinone oxidoreductase, subunit
FT                   RnfG"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35713"
FT                   /db_xref="GOA:D4MPM7"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPM7"
FT                   /protein_id="CBL35713.1"
FT                   /translation="MAGKSGFMKDAFILFAITLISGLALGGVYEVTKEPIEQATIAANN
FT                   ATYQSVLPEASSFEEDTSLASSIETCNTELAGMDFGNVGVDSVLIAKDSSGAEAGYVIN
FT                   THSNDSYGGPVEISVGFNAEGSISAIGFLAIDDTPGLGLKAKEPAFKDQYVGKNADALT
FT                   VTKSGNAGETEINSISGATITSSATTNAVNAALYFLHNYLN"
FT   CDS             complement(537292..538227)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05930"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35714"
FT                   /db_xref="GOA:D4MPM8"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPM8"
FT                   /protein_id="CBL35714.1"
FT                   /translation="MGKLFNVSSSPHVRNKITTQSIMFDVAIAMIPASVYGVWQFGMHA
FT                   LLVLIATVVACVLSEYVYEKLMKKPITISDGSAVVTGMILALNMPPQIPLWMPCLGGVF
FT                   AIIVVKQLYGGLGQNWMNPALAARCFLLISFAGKMTTFTEPFSDAVASATPLAQLKAGE
FT                   TVDVMAMFVGRIPGTIGEVSVIALLIGAAYLVWRRVISLRIPLTYIATVAVFAAIYSGF
FT                   DMYYVAAHICGGGLIFGAFFMATDYVTSPITPKGQYVFGICLGLLTALFRIFGGSAEGV
FT                   SYAIIFCNILTPLIEKYTLPTAFGKKGGKK"
FT   gap             538465..538943
FT                   /estimated_length=479
FT   CDS             complement(539209..542205)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05950"
FT                   /product="ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35715"
FT                   /db_xref="GOA:D4MPM9"
FT                   /db_xref="InterPro:IPR027050"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPM9"
FT                   /protein_id="CBL35715.1"
FT                   /translation="MMRSQSALPKQETRVELVFSDRGEVYRIVRSPSYERPSLRKKKDG
FT                   EQAMTTQPARVSLFLPDGSEFPGKISDVNEKIREIVGVDRGQFSQTAMIAQGEYMRLLT
FT                   AGSRERKEIFSRIFDTGVYERIQRKLRERNSELAKKLEDNGKFCLREAERIRVPEESGL
FT                   ASRWEQAVSSLESCPEEILAVSKEACSFSRMEAEKERREDERLVDELHRLGSRIERARR
FT                   VSELKEQEKAAEEHLRLLQSSQEVFEEKKRRLKLGRQAAPVWQKEDEARKKEGEWIEAG
FT                   ERLGEIKEKLSALSEDFLQAEKDSEEAESRYRAEQPGLLEQEQELKRSLPLYRELEQCM
FT                   ASIRAEEVRRERTKREEEAAAEGQEDCLKRLAALKAEREEKRDSGLNLERCRAEIERLK
FT                   KRKDEVTQLGRKLKELEEREKRLKEEQDILGRESRNYEQAADDYDRLYRIFILSQAGLL
FT                   AEELREGKPCPVCGSLSHPCPARLLDERVTAEQLDRANKVRETADRAARERLACVRALK
FT                   AETGVVKSQCEAMYEAIRKPGADEVKEHAVFDRQNAFQEMRELFFELQEEQRQREREEK
FT                   EWEKARIRLSEIDVLMEKEEKKREDLERKRKELSGELAGTESRLSSLKARYEEQKKQLL
FT                   FETGEQAEERLSRIQEAAGKLLAEKEKAEKRKEELGRQTGLLKGRLASEEEKERKLLSQ
FT                   KEQIYGEWQELLQKMGFSGEEEYRRAIFKEGEQERLEADISQYEQSLTAASSALLQCQK
FT                   SLEGLEEEALSPLLEKEEAMKQERRLASFRLSESASRLAENEGACRELERLLGKRGRLL
FT                   EEYGPVNRLCLAADGKVSGTARMDFQTYVQRQYFSQMIHAANLRLRRMTQGQFLLRCRE
FT                   FGDLSLRGEAGLDLDVYSVDTDSVRDVKTLSGGEAFLAALSMALGMADVIQNTAGSVEM
FT                   DALFIDEGFGSLDDEARARAISVLKELSGGKRMIGIISHVAELREQMGRKIVVKKGEEG
FT                   SFIRLETEE"
FT   CDS             complement(543574..544140)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35716"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPN0"
FT                   /protein_id="CBL35716.1"
FT                   /translation="MQKPEETKGSPAEKTVWQKDSAAEKQQGQRKEQGVKRHRFRFTIY
FT                   SGVLVLILLFLALQGKRPDKQLMFDENSRTDIYIHTETGQEPAIDPADFFPDVEGLSLD
FT                   LFEYDLSGCSLEQPGEYTVPVYYDGKKTNAVLRIIVEDGSTGGEETAGVLSDTAGQEMA
FT                   GEVREKPLPGNFVYEGSGEEREVEP"
FT   CDS             complement(544242..544568)
FT                   /transl_table=11
FT                   /locus_tag="CL3_05990"
FT                   /product="Cupin domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35717"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPN1"
FT                   /protein_id="CBL35717.1"
FT                   /translation="MEIERRENANGGKGTIFVKRILNEEELNGKCKMFAEVTIPAGCSL
FT                   GYHVHSRESETYYIVKGQGEYNDNGTTRIVNPGDRTFTPDGCGHGIANNTEEELVFMAL
FT                   IIPD"
FT   gap             545095..546927
FT                   /estimated_length=1833
FT   CDS             complement(547215..547265)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35718"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPN2"
FT                   /protein_id="CBL35718.1"
FT                   /translation="MKAFLAFMMAENGETL"
FT   gap             548569..549651
FT                   /estimated_length=1083
FT   CDS             complement(550245..552035)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06050"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35719"
FT                   /db_xref="GOA:D4MPN3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPN3"
FT                   /protein_id="CBL35719.1"
FT                   /translation="MEREKQRLAKSQKISKVSGWVLVVLLSVFVLFTIFSVRHLMERLD
FT                   DIRRHPFQVMDAGGTLQNDMDRIRNSFEQLKHINTPKVVEEIRNEISLIYEDTDRQMAI
FT                   LRGSYLGDQEDLENLSELMDEIGKEQDAFLDYAAADDRSEDEIVSYSTRHLEELYQEFD
FT                   SRLGKVLDFARNKVGYFYSEADRFCFFAILTSCLVFAAALIILFIYKYLLGRQTEQLKR
FT                   QNQLFELLSRNIDNIFMINDLHHPERNYISENAGRILGFKPDPKKVSPTLLFEYMDEQD
FT                   REKVKQVFDTVGESYWSCTFHYRHPALAGERIFLLQTYRIWTEGEDRFITVLTDQTQIL
FT                   STQKELEAAIQQAEKANRAKSEFLSRMSHEIRTPMNGIIGMGMIAMQNLGDSSRVEDCI
FT                   RKINLSSRHLLTLINDVLDMSKIESGRIEIKRDVFDFRLFLESVSNVISGQARDKGLNF
FT                   DVIFLGDMEEELFGDALRVNQILMNLLSNALKFTPEGGSIVLRIAKMDEDSTTVWLKFE
FT                   VSDTGCGIEEKNYEKIFMPFEQEHEDISHVYGGTGLGLSISRRFAELMDGRLTVSSQVG
FT                   KGSTFTLTMPLWPCGEEGKL"
FT   gap             552146..553520
FT                   /estimated_length=1375
FT   CDS             complement(554165..555547)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06080"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35720"
FT                   /db_xref="GOA:D4MPN4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPN4"
FT                   /protein_id="CBL35720.1"
FT                   /translation="MSKTMRETLTAGRSIDLTSGPVARSMWLFALPLMTGNLLQQFYNV
FT                   ADTLIVGRFLGAGALAAVGSSYTVMTFLTSVILGLCMGSGVLFSMLCGAGETERMKNSF
FT                   VQSFFFIALVTGLVEGLALLLIDPMLAVFQIPADILKDTKAYLQIIFIGLVFTFVYNYF
FT                   AALLRALGNSLVPLMFLAVSALGNIVLDLVLILEFHMGTAGAAWATITAQFLSALGIGI
FT                   YVWVKMPHLLPGRRHFYRDSEILKKITRYSLLTCVQQSVMNFGILMVQGLINSYGVTVM
FT                   AAFAAAVKIDSFAYMPVQDFGNAFSTFIAQNHGAGRKERIRLGLRAAVLSSGAFCLVIS
FT                   FVVVAFGGRLMTIFISPEETQIIRIGAQYLHVEGACYVGIGCLFLLYGLYRGLGHAGVS
FT                   VILTVISLGTRVALAYLLSPIPSVGLLGIWWAVPIGWFLADIAGFAYFWKLDRKEKREA
FT                   IS"
FT   CDS             555912..556370
FT                   /transl_table=11
FT                   /locus_tag="CL3_06090"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35721"
FT                   /db_xref="GOA:D4MPN5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPN5"
FT                   /protein_id="CBL35721.1"
FT                   /translation="MFLGNLDDTDQKIITLLTENARMSYSDIGVRVGLSRVAVKSRIQA
FT                   LEERGIIEEYTTIINPQKISGAVSCYFEMEFSPDGFSESCRKLKDCDTVTQIYQVSGRC
FT                   RLHVHAVAASQEELESFLNETVLTLPGLSDLSCNIILSRIKDIKGLRL"
FT   CDS             556601..556960
FT                   /transl_table=11
FT                   /locus_tag="CL3_06100"
FT                   /product="Phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35722"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPN6"
FT                   /protein_id="CBL35722.1"
FT                   /translation="MYTVEFYETADGVSELWDFLEELRLKSKKSKDARIQLKQIFLYIQ
FT                   LLQENGTRISDNITKHLEDGIWELRPGNNQVFYFYFKDDTFVLLHQFRKKSQKTPRREI
FT                   EKAKAERNDWLSRKE"
FT   CDS             556966..557253
FT                   /transl_table=11
FT                   /locus_tag="CL3_06110"
FT                   /product="Predicted transcriptional regulator with
FT                   C-terminal CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35723"
FT                   /db_xref="GOA:D4MPN7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPN7"
FT                   /protein_id="CBL35723.1"
FT                   /translation="MKTWNDYKAHVRSVDPEVARDIDEAENISSIVTAMVKQRNAMGLS
FT                   QRELADMCGIPQSSVARIESLKTTPNLDTLLKIFCQLGLKLTVTQSKPMV"
FT   gap             557494..559047
FT                   /estimated_length=1554
FT   gap             560520..561449
FT                   /estimated_length=930
FT   CDS             complement(562119..562250)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35724"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPN8"
FT                   /protein_id="CBL35724.1"
FT                   /translation="MKNESRKAGSRRRINCSQKEAELAMGQYKSIREFSQLFWIPWE"
FT   CDS             complement(562247..562405)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35725"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPN9"
FT                   /protein_id="CBL35725.1"
FT                   /translation="MLYFIGKSVKPARLERQKEKALETKQTQKANKNESARKKRPIEKR
FT                   KRRKKRP"
FT   CDS             complement(563378..563497)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35726"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPP0"
FT                   /protein_id="CBL35726.1"
FT                   /translation="MSQAAADGRPGSGKDHGLSFLGHQAVLSGFCLRAGAERN"
FT   CDS             complement(563757..565208)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06230"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35727"
FT                   /db_xref="GOA:D4MPP1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017145"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPP1"
FT                   /protein_id="CBL35727.1"
FT                   /translation="MGKKETLLYIDSKAELITEVSDKIWGYAELSLMEHQSSELYVKVL
FT                   REEGFSVETPVCGIDTAFIATYGSGKPVIGILAEYDALSGLSQEAGAVERKERIPGGCG
FT                   HGCGHNMLGAGAMAAALAVKHYLEEKGEGSGTVKFYGCPGEEGAASKAFMAKAGRFDVL
FT                   DAALTWHPGTENEVTSGTCNSCIQTEYKFTGLASHAAGAPELGRSALDAVELMNIGVQF
FT                   LREHMGSECRIHYSITDAGGQSPNVVQPKAQVLYMVRAKLMKEAMELQARVDKIAEAAA
FT                   MMTETTVKKKFIDGCSNTVTNRPLEKLFYKNFEEIGVPSYTEEELAFAEKLNASCELGK
FT                   TALPGSFTDESFELQEFVDKASNHGTKAMNDFLIPYFYSEKMKAGSTDVGDVSWNTPTA
FT                   QIRVACFPSAAPGHSWQNVSCGATSIGHKGTLTAGKVIAGTAIDLFENQEILAAAREEF
FT                   EKKTKGGYYCPIPDGAKPVLAGEQM"
FT   CDS             complement(565259..565996)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06240"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family (TC 3.A.1.3.-)"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35728"
FT                   /db_xref="GOA:D4MPP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPP2"
FT                   /protein_id="CBL35728.1"
FT                   /translation="MSDNIITVENLHKKFGSLHVLKGVTEHIARGEVVSVIGPSGGGKS
FT                   TFLRCLNLLETPEEGRILFEGTDITDKHVDINIHRQKMGMVFQHFNVFPNMSVGKNVTM
FT                   APVLLRKKTQKEADEMARELLNRVGLLEKFDEYPGKLSGGQKQRLAIVRALAMEPEVML
FT                   FDEPTSALDPEMVGEVLDVIKGLVDTGMTTVIVTHEMGFAKEVSDRVFFMDGGVIAEKG
FT                   TPKEIFENPQNVRTREFLGKVLY"
FT   CDS             complement(565986..566630)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06250"
FT                   /product="amine acid ABC transporter, permease protein,
FT                   3-TM region, His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35729"
FT                   /db_xref="GOA:D4MPP3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPP3"
FT                   /protein_id="CBL35729.1"
FT                   /translation="MLFMQGLGVTLLLSLVIVIVGTLLGFLLAMLRLSNWKIVKIRPLN
FT                   TLAGIYVEIVRGTPMLLQLYFFYFMLPMAFPSMNLSPIVCCAVALCLNSAAYVSEVIRS
FT                   GIQAVDKGQMEAARSLGLNHRQAMVKVILPQAIKNIMPALGNEFVMMIKDTSLASTFFV
FT                   GELMTVWQTVRGVLYLSLETLIIVGCIYFIVTFSLSKGINFMERRMRANER"
FT   gap             567499..568011
FT                   /estimated_length=513
FT   CDS             complement(568176..569192)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06280"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35730"
FT                   /db_xref="GOA:D4MPP4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPP4"
FT                   /protein_id="CBL35730.1"
FT                   /translation="MQTPEDIIDQAHSYIFIIFAGIPVTYLYNMTAGIIRSLGDSRTPV
FT                   YFLLLSSVINIVLDLFTIIVLKMGPAGAAWATVISQGVSGVLCLLYMKKHFEILRLQKD
FT                   ERKIDGQIMKILCKMGIPMGLQYSITAIGSVILQASVNTLGSMAVAAVAAGSKVSLFFC
FT                   CPFDALGGTMATYAGQNVGAKKLERIRQGVKSASVIGCIYSAAAFLVLLLFSGKIALLF
FT                   MDAGETETISRVSLFLTANSAFYIPLVFVNVVRFAIQGMGYSTFAILAGVFEMAARGLV
FT                   GLFLVPVFGYIAACFGSPLAWVFADIFLIPAFSHCLRRMKKNFEENEEKYTAGQLSK"
FT   CDS             complement(569120..569572)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06290"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35731"
FT                   /db_xref="GOA:D4MPP5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPP5"
FT                   /protein_id="CBL35731.1"
FT                   /translation="MKNMAKSEIRDMTTGSPFKLILGFAVPMLLGLLFQQFYSMVDTII
FT                   VGKYLGVKALAAVGSTGSINFMIIGFCTGVCSGFAIPVAQRFGQEIIEGLESLRQTRPG
FT                   CPCFFLQQWLSRSACSAAGSFSGCRRRRTLLTRRTATSLLYLREFR"
FT   CDS             complement(569689..571338)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06300"
FT                   /product="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35732"
FT                   /db_xref="GOA:D4MPP6"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPP6"
FT                   /protein_id="CBL35732.1"
FT                   /translation="MNEKKGQAVGNFLLQGSILAAAGILVRLIGLLYKIPMTRILGDEG
FT                   IGYYNTAYEIYNIGLILSSYSLPLAVSKLIAKKEQEGRRRDAGRVFCCGIFVGVFAGGV
FT                   MSAFLILCADWIASGIFNSPGSALPLRVMAPTILVFAVMGVFRGFFQGHGNMIPTSVSQ
FT                   VAEQVVHAAVSIWASWDFMNRYAGTENPASCGAAGGTLGTLVGALAAFIILAFWMAKSH
FT                   GNTGGYWRAAKGSGAQKEREDREDVSGYGEIMKLLLLTFVPIIMSQFVYQLSGSVDNSM
FT                   FGIIMGGKGLSEAERLSLLGIYGGKYRLLTNVPVAIASSLGASMIPSIVASRVMKRPGE
FT                   VKEKIYMTIKFNMLLAIPCAAGMFALSSPIMRLVFADGRKMTSDLLMLGSCAVIFFSLS
FT                   TVTNAVLQGIDQMRKSVTHSAVSLAIHVVFVYVMLERLNWGVYGLVIGNVTFALAVCIL
FT                   NWVSIGRTLRYRQEVKTTFLLPLACSAVMGAAARLVYEGICHFVPSNTLGVLAAAGVGA
FT                   LLYGWLLVVTRAVSEKELRGMPMGRLLLRFMR"
FT   CDS             571686..571763
FT                   /transl_table=11
FT                   /locus_tag="CL3_06310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35733"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPP7"
FT                   /protein_id="CBL35733.1"
FT                   /translation="MFLHLKTAGRLQGGQAEIHLDFHFK"
FT   gap             572359..572813
FT                   /estimated_length=455
FT   CDS             complement(573584..573796)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06340"
FT                   /product="Collagen triple helix repeat (20 copies)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35734"
FT                   /db_xref="GOA:D4MPP8"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPP8"
FT                   /protein_id="CBL35734.1"
FT                   /translation="MLGVEGIEGVVGVEGVVGVEGVEGVVGADGVEGVAGSSGVTEKPG
FT                   SISSSNGGMDEPPGIEKPGSTSSIS"
FT   CDS             complement(574446..575594)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35735"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPP9"
FT                   /protein_id="CBL35735.1"
FT                   /translation="MTALLVRDVLLVAFAIVFILFLTSVFGQENSSMAVIIFCILLSIR
FT                   FVSFGYKAKHSVINLAAVFGILTVSPVYAQHLGPLAGFAVHFISLSLILVITCEYPEMG
FT                   NGGLYLFGYIFLAGNPVEGSALAGRAMMALVGFGLCGALLFFRHRKKHKNVSFLHVVGR
FT                   MSIYDPKCQWQLRLALGLSLLFLLNRALNLNRFMWAGFACSSLLSSYPVNLRGRLAERA
FT                   GGIVLGSLLFAAVYRHIPESFLFMVGPAAGLCLGICSSYFAKTFLNCFGALLMAAGTYG
FT                   LSAAVSVRIVNNLLGIAFGLLFFKVYEKAVRAVCALLERLKKREADSMQRENQGPAGRP
FT                   GKKLSSLPPPFCQNSDDLEQPYDGRRSLSSPVRSEKGLDGIW"
FT   gap             575683..575990
FT                   /estimated_length=308
FT   CDS             complement(576179..576496)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35736"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPQ0"
FT                   /protein_id="CBL35736.1"
FT                   /translation="MKDAGERNVESPDGRSASPDWRVMWKWMQQIHCFSRNMTKQQQNR
FT                   ELTMGEMEVLAVVSLESETTPMRLSRATGMKLEAVSRTLRSLEAKGCIRRKNFCLMPEV
FT                   S"
FT   gap             577956..578989
FT                   /estimated_length=1034
FT   CDS             complement(579711..579959)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35737"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPQ1"
FT                   /protein_id="CBL35737.1"
FT                   /translation="MLPMNAVMEKFTDNLMIPVGAFFFCIFTGWVWGIGKAEAEIEAEG
FT                   SCRFGLKRLWGAIVKFVAPAFILVILYFTVGKGQGLS"
FT   CDS             581340..581675
FT                   /transl_table=11
FT                   /locus_tag="CL3_06460"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35738"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPQ2"
FT                   /protein_id="CBL35738.1"
FT                   /translation="MKMIIAIIGSEDADDLVYELNQNSFFVTKLSTMGGFLKKKSTTLM
FT                   LGVDNARVDEAISIIKKMSGQREQLVYTPPTMAGNCCPTVNMTVPMNMKVGGATVFVLD
FT                   VENFQKF"
FT   gap             583323..583566
FT                   /estimated_length=244
FT   CDS             complement(583696..583971)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35739"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPQ3"
FT                   /protein_id="CBL35739.1"
FT                   /translation="MSKKNHCELHKDGTFNQEAPGTHITAEMAGACSCDGPAEGPALEG
FT                   KGNTPVGPGLEGKGNTPVGPGAEGQGNTPAGPAAEGQGNTPAGPGK"
FT   CDS             complement(584096..584356)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35740"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPQ4"
FT                   /protein_id="CBL35740.1"
FT                   /translation="MDFGIASVAGITVICYLAGMGMKASEKVKNEVIPVACGCAGAALG
FT                   VAGMFIMPDFPAQDVINAAAIGIVSGLAATGINQAAKQLRK"
FT   gap             585438..586423
FT                   /estimated_length=986
FT   CDS             complement(586527..587438)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06570"
FT                   /product="Uncharacterized protein conserved in bacteria
FT                   (DUF2313)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35741"
FT                   /db_xref="InterPro:IPR018755"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPQ5"
FT                   /protein_id="CBL35741.1"
FT                   /translation="MAGSEKELMRQLPEYFRSILEFQKLMKIHGAASDCFEGALQQVSD
FT                   NCFIATCDERTLAYYEALMQIPDNGKSLEERRQLVILQWGMQTLYTLPKLKELLASAVG
FT                   TGNFSVLCDYNHYQVTIAISEQDTSMILGLFDTVFKMIPAHIILVMRGRYSGVYLVPIS
FT                   YGNAVRFSTGFYPRYNLGHLKLDGRWALDGTRKLNGYDSNQLLDFYPVRMRVQASGKAD
FT                   IRAGASEIRMASKAQAQAETREALSVRAEASEDAKVQERIGIQTAVKWQAGTESSMTKH
FT                   RYLNGVWELSGSRKLDGGQYIL"
FT   gap             587664..588455
FT                   /estimated_length=792
FT   CDS             complement(589283..589579)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06600"
FT                   /product="Protein of unknown function (DUF2634)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35742"
FT                   /db_xref="InterPro:IPR020288"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPQ6"
FT                   /protein_id="CBL35742.1"
FT                   /translation="MDAGLPAMRQAVEIILANERYRWQIYNSNFGCELADLPGEESDYI
FT                   VSELPRRIRDAFSVDNRILSAENFVFSALGGGRMAVSFDVITVFGTFSEEVRV"
FT   gap             589656..590135
FT                   /estimated_length=480
FT   gap             591228..592562
FT                   /estimated_length=1335
FT   gap             593998..594500
FT                   /estimated_length=503
FT   CDS             complement(595260..595307)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35743"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPQ7"
FT                   /protein_id="CBL35743.1"
FT                   /translation="MWELLQKEMKEVRKK"
FT   CDS             complement(595412..595840)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06670"
FT                   /product="Phage XkdN-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35744"
FT                   /db_xref="InterPro:IPR014986"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPQ8"
FT                   /protein_id="CBL35744.1"
FT                   /translation="MMGDIKAFLQPPVMNEEKEVVISKRFRGEDGKPVPFVIRVIDQET
FT                   NGKLLKQAMRKTKLNGQIVQELDSDKYGKLLVQACVVSPDFRDAEVCAHYKTSDPLDVP
FT                   GRMMTVGEYNRLVKAIKELNELITSDEELTALEEEVKN"
FT   CDS             complement(595850..596320)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06680"
FT                   /product="Protein of unknown function (DUF2001)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35745"
FT                   /db_xref="InterPro:IPR018989"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPQ9"
FT                   /protein_id="CBL35745.1"
FT                   /translation="MSFLLEHDALNGKEGSAFMTINGRNIEMFGMKKFQSDAEFQEADF
FT                   KVVGTRLVQKKTTGVSLTGSMTIYYGTPHFLRLLQEYIKTGRLPYFTLQITNEDPSTSV
FT                   GTQTVVFYNVKLQKLPVAMLDADADFLEMEVSFSYTSLEVLNYFNDVPEQLG"
FT   CDS             complement(597374..597706)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06700"
FT                   /product="Phage tail sheath protein."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35746"
FT                   /db_xref="InterPro:IPR007067"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPR0"
FT                   /protein_id="CBL35746.1"
FT                   /translation="MAGGTWTSQNKVLPGVYINVKSQGNIYANVGKRGIVAIAEPLSWG
FT                   PANVVQTIIPGEDVRPYIGYDITKPQALFLREMMKGSDTTAGPSKILLYRPWEPAASRR
FT                   RLPSGL"
FT   CDS             complement(597884..598339)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35747"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPR1"
FT                   /protein_id="CBL35747.1"
FT                   /translation="MNFTIQNLLGSLAGVLKKEYPSYPVYVSPNQQGTDFPCFFISLMP
FT                   SSIEDEVGGRFFRDLGIDLVFVQQRNPVNGNAEIQGVQEFLDCSLELFPYRDESGTEVL
FT                   LHTYERQASVEDGELHYKFHVRQRVSLPEHESCMREMEENRVRIEER"
FT   CDS             complement(598336..598836)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35748"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPR2"
FT                   /protein_id="CBL35748.1"
FT                   /translation="MSSFGSQIRKRLAELRRAGEDVPKIMMEVAERATIEAVRVANENT
FT                   PPNGGAAIAGTNTRSGQMAQHWAADSQTKPVYTKGSVRTVLANNMQYASYVNDGHNVDE
FT                   HFTSHVAIEGGILVGKPDGDGGLMVGTKTTYVPGLYMKEKAIGKYRSVVRSELQRKVRE
FT                   RFR"
FT   CDS             complement(599236..599769)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35749"
FT                   /db_xref="InterPro:IPR025127"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPR3"
FT                   /protein_id="CBL35749.1"
FT                   /translation="MWPYDFMNPMGPCFRAARAAAANVPQPGEQGSYSQVMFQADFPQF
FT                   WQVYKEIGSEEERYKLLLPESMLQVFIEQANDSVLPSRWGSLWRYAAGLYVAHFAAMYL
FT                   KTYTSGSQNAAQAANKAAQTGVVKSAAMGDTSISYDNSAVTAGTEKWGAWNATQYGQQL
FT                   VTMARQVGMGGMLV"
FT   CDS             complement(599782..600105)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35750"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPR4"
FT                   /protein_id="CBL35750.1"
FT                   /translation="MFIISKRNFLVRRADGSSYLVKRDFVGDIPQDVFESTVIQGAVKG
FT                   GLVATPDTGKDKDLYKADEAAQEKEKSADIRPDAREKAEEPETEEPEPEKTDQEEKARK
FT                   AKK"
FT   CDS             complement(600123..600473)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06770"
FT                   /product="Uncharacterized protein conserved in bacteria
FT                   (DUF2184)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35751"
FT                   /db_xref="InterPro:IPR020049"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPR5"
FT                   /protein_id="CBL35751.1"
FT                   /translation="MPYVQYKYLATTRVSELAEKTILTFLLENNVAKQNGSDLFIGATS
FT                   WCKGAAADGSSDRMAVYCNKERYLAMDELVPLTRAMTSPNTQQFCYDTAYAGNVSEVEV
FT                   FYDQTILYVDKI"
FT   gap             601126..601301
FT                   /estimated_length=176
FT   CDS             complement(602151..602993)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06810"
FT                   /product="Uncharacterized protein conserved in bacteria
FT                   (DUF2213)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35752"
FT                   /db_xref="InterPro:IPR016913"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPR6"
FT                   /protein_id="CBL35752.1"
FT                   /translation="MISYYGYTISPNQIETGEGFLICRNVPIARTGDQEYLGREIGLSG
FT                   QNAERMIIVHRSPEEVFSQAALASFEGKPATNDHPPDLIGPDDVGMYEKGHAQNVHRGT
FT                   GEWADYMVADLHIHDRELIDAIQSGKREISCGYECEYVPNGDGTYSQKNIRGNHVAVVD
FT                   RGRAGKRAAILDSEIQKPAAEPPERKGKGMKHTFLNLFGLAAKDKTPEEIAKLAMDTAD
FT                   AMEEESSKPKEEKAGEGKKEGGSEGMDESVIDSIVDKVLARMLEEKAAESQEEKKGSL"
FT   gap             603077..604058
FT                   /estimated_length=982
FT   CDS             complement(604538..605998)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06830"
FT                   /product="phage-related protein, HI1409 family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35753"
FT                   /db_xref="InterPro:IPR006445"
FT                   /db_xref="InterPro:IPR024459"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPR7"
FT                   /protein_id="CBL35753.1"
FT                   /translation="MTKKKRALQRAEKHNIENQAPVSTMDAFSNPAARIGWGTMDLMNG
FT                   TSYPMTRMTQNYELLTSMYRDNWIIQNIVATVPNDMIRKWYQIKSSITPEQMDQLTKLE
FT                   RKIQLRKRLLLGMYWGRLYGGAVGVILVKGQDDLSQPLDLDAVLPGSFLGMQILDRWSG
FT                   VYPEGELVKEPSDPDYGLPAFYTIRDDTTGYMAARVHHSRIVRFIGRELPWMEQVAELY
FT                   WGESEIEAIYNEVVRRDNVAANIAALTFRANVNYMETEGLDQLLGTANTEMQRRFWNVM
FT                   AAQAMMESNFGTRIINKGDAIHNTQYTFTGLPEVYDRVMMDVAGAARIPVTKLFGRSPA
FT                   GLNSTGESDMQNYYDYIDGLRENELRPVIERLLPLMALSALGEIPDDLEIDFPPMQTAD
FT                   AKEQAEITERNTNSILAAYQNDLIDAATAQQELQAMGEETGIFSRISDETIEAARGQTY
FT                   TKSRLMADPMAGLEIAGTPPEEPVGKEW"
FT   gap             606515..607528
FT                   /estimated_length=1014
FT   CDS             complement(607825..608052)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35754"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPR8"
FT                   /protein_id="CBL35754.1"
FT                   /translation="MEGEKKMPIGKPNAQTIASEKYQKKAGYMTKGFKIKRDVADRFER
FT                   ACEAAGVSQAAQITELMLSFAKEQEEKNRK"
FT   CDS             complement(608207..608329)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35755"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPR9"
FT                   /protein_id="CBL35755.1"
FT                   /translation="MRGESRKKKKSHSRLKAWLAELLKDLIVAITAAIVSKLLE"
FT   tRNA            complement(608522..608594)
FT                   /locus_tag="CL3_T_35580"
FT   gap             609088..609853
FT                   /estimated_length=766
FT   CDS             complement(610369..610653)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35756"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPS0"
FT                   /protein_id="CBL35756.1"
FT                   /translation="MTIVYDVLLEQYEHYKPVIGYCGEPKYICIFYDEDKRKALKEMQK
FT                   YVKDNGFVTPDKKYTVADVVLREREATGKIISITPYCKLFNTVTDELIK"
FT   gap             610976..611526
FT                   /estimated_length=551
FT   CDS             complement(612084..612236)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35757"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPS1"
FT                   /protein_id="CBL35757.1"
FT                   /translation="MRGKKQTSVAGIYDISRTMMPLVIQPAGDLTVPRLLKKERRESLE
FT                   LYRRD"
FT   CDS             complement(613135..614058)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06950"
FT                   /product="Protein of unknown function (DUF1351)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35758"
FT                   /db_xref="InterPro:IPR009785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPS2"
FT                   /protein_id="CBL35758.1"
FT                   /translation="MELKIYNPQDNGFLTSIEWNFEELKAEITAASQEYAASVYTDENI
FT                   RGAKADRAKLNKFVDALNGKRTEIRKKLLAPDEQFGREVKELTGIIQGAIENIDAQIKD
FT                   YERRQREEKTKKVREIYEDNIQDLEKYLPFERVFRPEFANAGTTLKSIREEITGKIQQV
FT                   AEGLAVLNEIDSPYAEEMKESFLKSYDLNTALAEGNRLAAAEQRRKEYAAAQEKERAER
FT                   EARRKEEASRVIAAGREEKPREQNGNLAAGVREETCAAEQKTEEEVVEKPVHILDFRVH
FT                   ATAEQLTGLRRYLKENRIRFERVPEK"
FT   CDS             complement(614039..614692)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06960"
FT                   /product="Site-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35759"
FT                   /db_xref="GOA:D4MPS3"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPS3"
FT                   /protein_id="CBL35759.1"
FT                   /translation="MQYIYTYRNNELIRRIEFQNGNSYVSSIHIDNLHEGIVLTSNDDF
FT                   FQRWLQCKTKPELLETRGDIRVVDLFCGCGGMSLGIAEACRALDYRFVPVLGADMDPVA
FT                   LQVYKENFKPHHVISEPIENQIDSEIGAEISEAEKSFINLVGEVDILIGGPPCQGNSDL
FT                   NNHTRREDPRNLLYLNRGREAVLGLCAVRPSAGSDSSGDLRKFQKRRRNGIKNL"
FT   CDS             complement(614707..614907)
FT                   /transl_table=11
FT                   /locus_tag="CL3_06970"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_06970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35760"
FT                   /db_xref="GOA:D4MPS4"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPS4"
FT                   /protein_id="CBL35760.1"
FT                   /translation="MMANVSNSDKWINIDDAAEYLGVKPGTIRDWIRKEKGIPAHKIGK
FT                   QWKFKRSELDDWVNSGKSAIN"
FT   gap             615265..615770
FT                   /estimated_length=506
FT   CDS             complement(616642..617109)
FT                   /transl_table=11
FT                   /locus_tag="CL3_07000"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35761"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPS5"
FT                   /protein_id="CBL35761.1"
FT                   /translation="MGAEKILSEILDPLREKYDYILIDTCPSLGMLTINALAAADEVII
FT                   AVDPQLLAMMGLKDYLRTVTKIRRRINPKLKIAGILMTMCEARTNLCRTLTEQVTESFQ
FT                   GQIRIFDTRIPHTVKVGESIYYSMPVERYSPKASAGIAYRKFAEELISIEG"
FT   CDS             complement(617054..617431)
FT                   /transl_table=11
FT                   /locus_tag="CL3_07010"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35762"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPS6"
FT                   /protein_id="CBL35762.1"
FT                   /translation="MMGKIYVIGSQKGGVGKTTSTLNLAYALRKQGKKVLAVDFDSQAN
FT                   LTACYGIENTGELENTIGHLMMAAIEDRKTSGHEEVHPDRGRRRFYSFFYLSVCGGRKA
FT                   AAGNGSGKDPVGDPGSAQGEI"
FT   gap             617493..618488
FT                   /estimated_length=996
FT   gap             620080..620513
FT                   /estimated_length=434
FT   CDS             complement(621114..621440)
FT                   /transl_table=11
FT                   /locus_tag="CL3_07050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35763"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPS7"
FT                   /protein_id="CBL35763.1"
FT                   /translation="MTEVNKLSKQKKFGLVFEEHLPECTPLYDVEIRRDSKVALKTEQV
FT                   SDIYIVRSINGDKAMCEHKTDHAEAEFALDELVAVAEFGEPIYPYLKPIDTVSMLLIPI
FT                   CGIR"
FT   CDS             complement(621869..622285)
FT                   /transl_table=11
FT                   /locus_tag="CL3_07070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35764"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPS8"
FT                   /protein_id="CBL35764.1"
FT                   /translation="MKVAGYIERKSMLYQTGVEYGDYTMNHVLGCSHGCKYPCYAFLLK
FT                   KRFGQVKTYEEWCRPFLVSNTLELLDREIPRLKEKIQSVQLCFTTDPFMYGYPEIQEMS
FT                   LAAIRKLNEEHIKCCVLTKGLLPMELKDLYSENE"
FT   gap             622763..624345
FT                   /estimated_length=1583
FT   CDS             complement(624949..625344)
FT                   /transl_table=11
FT                   /locus_tag="CL3_07100"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35765"
FT                   /db_xref="GOA:D4MPS9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPS9"
FT                   /protein_id="CBL35765.1"
FT                   /translation="MTLGEFIKNKRTELGMSRNLLATKTGISHTEVQRIETNARKMPSL
FT                   KVLCALANALNVSQEDLLKVAGYAPGDDMSATQRAFPGLKSKKQQETVEKIADGLSRNA
FT                   DLKDEDLDDLYKQVEMFIEYVKREKDS"
FT   gap             625368..627040
FT                   /estimated_length=1673
FT   CDS             627410..627727
FT                   /transl_table=11
FT                   /locus_tag="CL3_07120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35766"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPT0"
FT                   /protein_id="CBL35766.1"
FT                   /translation="MSRMSDMAQTIEELRSAAAAISDAADWLTKVFSSEPQAEDAPASP
FT                   PEPELTLEQVRAVLADKSRQGHTAEIRALLQKYGASKLSQIDPAHYKALLAEAEVLTNG
FT                   S"
FT   CDS             627717..628844
FT                   /transl_table=11
FT                   /locus_tag="CL3_07130"
FT                   /product="Protein of unknown function (DUF2800)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35767"
FT                   /db_xref="InterPro:IPR021229"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPT1"
FT                   /protein_id="CBL35767.1"
FT                   /translation="MAVKHAVLSASSSERWLNCPPSARLCEAYEDKGSDYAAEGTDAHS
FT                   LCEFRLKQALGIPADDPIENLSWYNEEMEDCAAGYAAYVSELLETAKQTCADPVILIEQ
FT                   RVDFSRWVQDGFGTADCIVIADGELNIVDYKHGKGVEVSAVDNPQMMLYALGALEIFDG
FT                   IYDIDSVRMTIYQPRKSNISVCVMEKDGLLEWAQNDLTYKAKLAYEGGGDFHCGEWCRF
FT                   CKAKAECRERAEANLALARYDFEEPPLLTDEEIAGILDKVDALTAWAADVKEYALQQAV
FT                   SGTAFPGWKLVEGRSNRKYTSEAAVAAAVEGAGFNPYEKKLLGITAMQKLLGKSRFEEL
FT                   LAPYIEKPQGRPTLVRSSDKRPEWNTAKNEFMEEM"
FT   gap             629283..629994
FT                   /estimated_length=712
FT   CDS             630251..632191
FT                   /transl_table=11
FT                   /locus_tag="CL3_07160"
FT                   /product="DNA polymerase I-3'-5' exonuclease and polymerase
FT                   domains"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35768"
FT                   /db_xref="GOA:D4MPT2"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPT2"
FT                   /protein_id="CBL35768.1"
FT                   /translation="MQTLSIDLETYSDQPLAKTGVYRYVESPDFEILLFAYSVDGAPVQ
FT                   QIDLACGEKIPSEILCALEDDKVTKWAFNANFERICLSRFLGYPTGDYLEPDSWKCSMV
FT                   WAAYMGLPLSLEGAGAVLGLEKQKLAEGKDLIKYFCQPCAPTKSNGQRTRNLPKHSPDK
FT                   WLAFKKYNIRDVETEMSIQARLLKYPVPDSVWEEYHLDQEINDRGVGLDMELVRQAIQM
FT                   DGRSRSELTQAMKELTSLDNPNSVQQMKQWLADNGVETDTLGKKAVAELLKTAPQQLQK
FT                   VLTLRQQLAKSSVKKYQAMETAVCADGRARGMFQFYGANRTGRWAGRIIQMQNLPQNHL
FT                   DDLTEARGLVRAGGFDALEMLYEDVPDTLSQLIRTAFVPQGNRKFIVADFSAIEARVIA
FT                   WLADEKWRQDVFAEGKDIYCASASQMFGVPVEKHGVNGHLRQKGKIAELALGYGGSVGA
FT                   LKAMGALEMGLSEDELPALVSAWRQANPKIVQFWWAVDRAVMDAVTRKTTTKTHGIIFS
FT                   ARNGMLFITLPSGRSLSYVKPKIGENRFGGDCITYEGVGGTKKWERIDSYGPKFVENIV
FT                   QATSRDILCYAMKTLRCCSIVMHIHDEVVIEADRRMSLQAVCDQMGRTPPWANGLQLRA
FT                   DGYETDFYKKD"
FT   CDS             632205..632636
FT                   /transl_table=11
FT                   /locus_tag="CL3_07170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35769"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPT3"
FT                   /protein_id="CBL35769.1"
FT                   /translation="MSINKFNSEGYYDPTTYEALTNIEKEKRALRAFRPIVYICSPYAG
FT                   DVTANVENARRYSRFAVDAGYIPIAPHLLFPQFLSDDDPKERQLGLFFGNALMSKCSEV
FT                   WVFGEYISSGMEAEIRRAKWKNYRLRYFTTTCEEVTDYA"
FT   gap             633564..634017
FT                   /estimated_length=454
FT   gap             635258..637055
FT                   /estimated_length=1798
FT   gap             637583..637879
FT                   /estimated_length=297
FT   CDS             637970..638755
FT                   /transl_table=11
FT                   /locus_tag="CL3_07230"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35770"
FT                   /db_xref="GOA:D4MPT4"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPT4"
FT                   /protein_id="CBL35770.1"
FT                   /translation="MFEKVNPSHPDKMADRIAGAMVDAAYRKENNPRIAVEVLLGHGVC
FT                   HIIAETSVYIPQDEVESIVHRIAGRLRTDYVEVPQDRHLADNQEGKIRCGDNGIFKGMP
FT                   VNREQKALCEIARCVYHTYPYDGKYILDGARLILCQSNARSQHLKELYPHAEINPLGDW
FT                   TGGTDVDSGATNRKLGSDMADSVTGGGLHGKDLSKADVSVNIYAWLKAQETGKPVQLVC
FT                   AIGDETVDGITYAEIVETARKYIQSLGGFEKFAEWGLVR"
FT   CDS             638752..639987
FT                   /transl_table=11
FT                   /locus_tag="CL3_07240"
FT                   /product="DNA modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35771"
FT                   /db_xref="GOA:D4MPT5"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR015840"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPT5"
FT                   /protein_id="CBL35771.1"
FT                   /translation="MKTTTEMQLVPIAKLVPYVNNARTHSPEQIKKLRSSLREFGFINP
FT                   VIIDREYGVIAGHGRILAAKEEGIREVPCVFADHLTEAQKKAYIIADNRMAMDAGWDEE
FT                   LLRVEIEALQGMDFDPLLTGFDEKELAALFDDGAEAKDDEFDVDEELEKPVFSKTGDVW
FT                   TLGRHRLVCGDSTKAETYEVLMQGKKANLVVTDPPYNVNYEGTAGKIKNDNMAAEKFYQ
FT                   FLLDAFTNMEKVMAEDASIYVFHADTEGLNFRRAFTDAGFYLSGCCIWKKPSLVLGRSP
FT                   YQWQHEPVLYGWKKNGKHQWYSDRKQTTIWEFEKPRKNADHPTMKPIPLLAYPITNSSM
FT                   SNTLILDPFGGSGSTLIACEQTDRSCCTIELDEKYCDVIIKRYVELKGSAEDVSVERDG
FT                   KTLRYADVVPEE"
FT   CDS             640135..641013
FT                   /transl_table=11
FT                   /locus_tag="CL3_07250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35772"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPT6"
FT                   /protein_id="CBL35772.1"
FT                   /translation="MEISYNVTGAKRKELVNVISKATGMKAVYKFMPTCNFEIGSFTVN
FT                   KEGTLLIDAHADNEEVARVLEAIAAASFEGETQDTQESPAEDASAEEVLAEEESLPSQE
FT                   DATEAAELMETDTTEETDNNKAEAADSMEEAETTEAEESSTPEAASERTGLTVEIPLDK
FT                   VDVGNLTKLLDAKGGLIKKALGISELPIEVLEEKAAFPWFGELPDNDAVQAYTHFISAL
FT                   CQMSKNAKRVTVTEKAVDNEKYAFRCFLLRLGFIGAEYKTERKILLKNLTGSSAFRNGG
FT                   KKHEASEQGDH"
FT   CDS             640985..641209
FT                   /transl_table=11
FT                   /locus_tag="CL3_07260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35773"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPT7"
FT                   /protein_id="CBL35773.1"
FT                   /translation="MRLPSKAIIEQLRQQFPTGTRVELVRMEDAQAPPVGTQRTVLGVD
FT                   DTGSLIMRWDNGSGLNVVYGEDVVRKISE"
FT   CDS             641206..641304
FT                   /transl_table=11
FT                   /locus_tag="CL3_07270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35774"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPT8"
FT                   /protein_id="CBL35774.1"
FT                   /translation="MRCFLPGMYFAIRYTRNCLLLPLIFVYIMTAN"
FT   CDS             641379..641741
FT                   /transl_table=11
FT                   /locus_tag="CL3_07280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35775"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPT9"
FT                   /protein_id="CBL35775.1"
FT                   /translation="MKRIELFERAIAEKARNLKDYGINSTMFWAYRKSMEAGNDSIDFG
FT                   EVIWDEDIEAITECMKENGITEFTISSTFSSLIPTLAAFEKHGFAMDGLTEVNATYTDW
FT                   QTGQRARIPAIRMRQK"
FT   gap             642085..642697
FT                   /estimated_length=613
FT   CDS             642995..643741
FT                   /transl_table=11
FT                   /locus_tag="CL3_07310"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35776"
FT                   /db_xref="GOA:D4MPU0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPU0"
FT                   /protein_id="CBL35776.1"
FT                   /translation="MMTVHEVSQISGVSIRALHHYDKIGLLPATKVTDAGYRMYDDTAL
FT                   ERLQQILFLKELQFSLKDIKAILDSPDFDRNKALEQQIHLLELRREHLDNLIDLARGIK
FT                   MIGVKHVRKMSFEAFDTRKLDEYARQAKASWGSTDAYKEYEKKSAGQSKEEQYYLNSKM
FT                   MEIFLEFGKIKDQSPESNAAVELAKRLQDFITEHFYTCTDKILLGLGAMYSGGGDITAN
FT                   IDKAGGPGTAVFADKAIQAYCKKEVM"
FT   CDS             643818..645185
FT                   /transl_table=11
FT                   /locus_tag="CL3_07320"
FT                   /product="phage portal protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35777"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPU1"
FT                   /protein_id="CBL35777.1"
FT                   /translation="MGILSGLFRSRDKPENRTSGSAFSFFFGGSTSGKCVNERSAMQMT
FT                   AVYSCVRILAEAVAGLPLHLYRYKEDGSKEKALTHPLYLLLHDEPNPEMSSFVFRETLM
FT                   THLLLWGNAYAQIIRNGRGEVIALYPLMPDRMAVDREVNGQLYYEYTTSADDAPTVKGS
FT                   IVRLKPSEVLHIPGLGFDGLVGYSPIAMAKNAIGLAIATEEYGSKFFANGAQPSGVLEH
FT                   PGTIKDPQRVRDSWMSQFGGSANSNKIAVLEEGLKYTPIAISPEQAQFLETRKFQINEI
FT                   ARIFRVPPHMVGDLEKSSFSNIEQQSLEFVKYTLEPWLVRWEQSIQRTLFSTEEKKTYF
FT                   VRFNVEGLLRGDYASRMNGYAVGRQNGWMSANDIRELENLDRIPAEEGGDLYLINGNML
FT                   PLKDAGAFADTQANDDGKEEKPDEEVLEVEESGSNGDGSGGEDAVLKRHHRRGELV"
FT   CDS             645082..645822
FT                   /transl_table=11
FT                   /locus_tag="CL3_07330"
FT                   /product="Protease subunit of ATP-dependent Clp proteases"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35778"
FT                   /db_xref="GOA:D4MPU2"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPU2"
FT                   /protein_id="CBL35778.1"
FT                   /translation="MKKFWKWKNQAATETAPAERTLFLNGTIAEESWFDDDVTPQLFKE
FT                   ELMAGSGNITVWINSPGGDCVAAAQIYNMLMDYKGDVTVKIDGIAASAASVIAMAGTQV
FT                   LISPVGMMMIHNPATIAWGDTAEMRKAIEMLASVKDSIINAYEIKTGLSRAKLSHLMDA
FT                   ETWMDAHKAVEFGFADGILGRTDLPEDMEPPAVTMLYSKAAMVNSLMDKIAAKCKTNPK
FT                   KTEDVKPQGRSVDSLYERLNLLKN"
FT   gap             646322..646862
FT                   /estimated_length=541
FT   CDS             647777..648109
FT                   /transl_table=11
FT                   /locus_tag="CL3_07370"
FT                   /product="phage head-tail adaptor, putative, SPP1 family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35779"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPU3"
FT                   /protein_id="CBL35779.1"
FT                   /translation="MDIALLNQKILVQKNEVTVDAIGNHLNEWVDFYSCYATISGESPN
FT                   ESTSAGTVVDNTKADFTVRWCKAVSEITSDGYRVVYADEIYNILGIDHQNYKKKSVKLK
FT                   CQKVRR"
FT   CDS             648088..648492
FT                   /transl_table=11
FT                   /locus_tag="CL3_07380"
FT                   /product="Bacteriophage protein of unknown function
FT                   (DUF646)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35780"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPU4"
FT                   /protein_id="CBL35780.1"
FT                   /translation="MSESEAVRMGRNVQIGDLADAIMETLEDYADLAAEDVKRAVREAG
FT                   DTVRDEIRSHAPKDTGDYAKSWAVKKRKETSNSLTLVVHSRNRYQLAHLLEFGHAKRGG
FT                   GRVSAQPHIAAAEAKGMEQLEDEIRKALEG"
FT   CDS             648464..648814
FT                   /transl_table=11
FT                   /locus_tag="CL3_07390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35781"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPU5"
FT                   /protein_id="CBL35781.1"
FT                   /translation="MRSGKHWRDEMERLVSIIKEMGIPYAYDHFAEGEAPDPPFLCYLL
FT                   PGSDNFSADGKVYHRISEVRLELYTDFKDLSSEQRVETVLDAEGIFYNKTETWIDSERL
FT                   YEVLYSFEMEGL"
FT   CDS             649011..649418
FT                   /transl_table=11
FT                   /locus_tag="CL3_07400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35782"
FT                   /db_xref="InterPro:IPR006490"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPU6"
FT                   /protein_id="CBL35782.1"
FT                   /translation="MGYEGDLELAMVPESFRTDVLNESLDTNQVLVENANVETANFALL
FT                   FEFDGDVKKIRHVLYNCSAARPNIESSTNEEEIEVQTETLALTAAPLANGYVKARTGDS
FT                   TTDEVYNGWYGAVYMPTTASTSTSEAGGGTA"
FT   gap             649760..650043
FT                   /estimated_length=284
FT   CDS             650078..652300
FT                   /transl_table=11
FT                   /locus_tag="CL3_07420"
FT                   /product="phage tail tape measure protein, TP901 family,
FT                   core region"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35783"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPU7"
FT                   /protein_id="CBL35783.1"
FT                   /translation="MEAADQLSVVGDKIQDIGDKAVSAYAETENAVTKVNVYFGETGAA
FT                   AEASAEIVKDVYGAGVGDSMESVADAVIMVKKNLGELSDTDLTNLTQQALTLDELYGID
FT                   MNETLRGVNALMKQYGMTAQEAMDYIVKGTQNGLDKTNELGDNLSEYSGKFAQAGYSAS
FT                   EYFQLLQNGLQGGAYNLDKVNDAINEVTTRLADGTIAGSIDLYSQKTQGLFLAWQNGEA
FT                   TQKQVIDSIVADIANCTSEQQALNMAAEAFGTMAEDGNLKFITSLTSVGETYDSVAGSA
FT                   QNLFDQTGTPMQEMEANTRKLQQALVPLGEKIVELANVVLPPLVAIITAVSEVFGVLPE
FT                   PVQNFVVILGALLVAFTALVPIIAALAVSFGALNISLLPIIGIIAAVAAAIAVIIAVVK
FT                   NWGAITEWFGQLWETVSAKLMELWDKVVVFFTETIPAATQKFVDFFSAIPQWWSNLWSQ
FT                   ISAFFVNIWNNIKNTASQIWNAIKQTAVNAANGLKQGVQNVFSALSQFISQIWNTLKQT
FT                   ASNIWNGIKTTVVNIATGLKDAAVNAFKNLVSGIRSALSGLTSVIQNGFSGAVSFITSL
FT                   PGKALQWGKDFIQGLINGIKSMVQSVIDTVSGIASKIASFLHFSAPDEGPLSDYEKWMP
FT                   DFMKGLAGGIERNRKLVENAVKDVASDMVITPKVNASGYGYTDGLMAGGSMADMISGIS
FT                   SAISEALNGFAGQQGNIVIPVYVGGTLLDELVVTAQARQNLRSGGR"
FT   CDS             652304..652666
FT                   /transl_table=11
FT                   /locus_tag="CL3_07430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35784"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPU8"
FT                   /protein_id="CBL35784.1"
FT                   /translation="MAFIRYLTFDGTALPLPDSYEVQMNDVEADSGGETEAGTVQRDVV
FT                   RLGVVSIPVSFSVSAKWLQILTEFKQKEKISVGYFDTETLAVKTAEMYVEGFKVALVKD
FT                   TSRKGLWTVSFTLREF"
FT   gap             653635..654113
FT                   /estimated_length=479
FT   CDS             complement(654954..655277)
FT                   /transl_table=11
FT                   /locus_tag="CL3_07460"
FT                   /product="HSP20-like domain of unknown function (DUF1813)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35785"
FT                   /db_xref="GOA:D4MPU9"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPU9"
FT                   /protein_id="CBL35785.1"
FT                   /translation="MKQKNIKVAYTSRCTGGSYTQVPKIQMEGRWLEELGFSIGSTIVV
FT                   EYDEGSICIRQMTGEELADCRREQLKKELAAKSASIRKLQKSLNGDLQALSLVAESPHG
FT                   YRS"
FT   CDS             complement(655274..655573)
FT                   /transl_table=11
FT                   /locus_tag="CL3_07470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35786"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPV0"
FT                   /protein_id="CBL35786.1"
FT                   /translation="MFAAKELKNIDAGYFSVIASGGCTLTIQSKNTRHCWHILLQEYPH
FT                   FRSCLIYHTHHRGTPYHEHGHGATLSGCLSQIRNHDACWLSRKSRRKLHKEVRQ"
FT   CDS             655769..656191
FT                   /transl_table=11
FT                   /locus_tag="CL3_07480"
FT                   /product="toxin secretion/phage lysis holin"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35787"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPV1"
FT                   /protein_id="CBL35787.1"
FT                   /translation="MKEFWNTIQFIFTAVGGWLGYFLGGCDGLLYALIAFVAIDYITGV
FT                   MCAVIDRKLSSAVGFKGIFRKVLIFLLVGIANIIDVQVVGTGAVLRTAVIFFYISNEGV
FT                   SLLENAGHLGLPIPERVKTVLEQLHDRAENGKEGNE"
FT   CDS             656184..657131
FT                   /transl_table=11
FT                   /locus_tag="CL3_07490"
FT                   /product="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35788"
FT                   /db_xref="GOA:D4MPV2"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR013168"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPV2"
FT                   /protein_id="CBL35788.1"
FT                   /translation="MNNGLHKQFTGILYNLSPNHSGQRTHSIDRITPHCVVGQLSAESI
FT                   CGCFTSPSREASCNYGIGKDGKIALCVEEKNRSWCSSSNTNDQRAVTIECASDKTHPYA
FT                   MNDAVYQSLIRLCVDICKRNGKKKLLWLGDKNKTLNYSPKSDEMVLTVHRWFANKSCPG
FT                   DWLYGRLGDLAAKVTAQLGEMAADSSGTLYRVQTGAFSKKSNADALEEKLKARGFDTCM
FT                   VQNGGLYKVQVGAYSIRANAETMMEKVKAAGFDAFITTVSGSAVSSSNAKSIDTLAREV
FT                   IRGDWGNGAERKQRLSAAGYDYAAVQQRVNELLS"
FT   CDS             657260..657520
FT                   /transl_table=11
FT                   /locus_tag="CL3_07500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35789"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPV3"
FT                   /protein_id="CBL35789.1"
FT                   /translation="MILSTGSDITHTAALEGISTEHLFTPEQFQQDVDYYRAQCITKSL
FT                   LDSGLISLSQFNKLTALNRKSFSPFLAEIMPEPVDITSIQR"
FT   gap             658043..658354
FT                   /estimated_length=312
FT   CDS             659173..659463
FT                   /transl_table=11
FT                   /locus_tag="CL3_07530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35790"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPV4"
FT                   /protein_id="CBL35790.1"
FT                   /translation="MAQGYIDQILYNEENNLLLAQADQYKTEISALNKSISGDATLVKS
FT                   TLDLLRFAEKGVMLDAFDEALFENVVTRIRVLSRQKIVFELKCGLTLTERM"
FT   CDS             659468..659884
FT                   /transl_table=11
FT                   /locus_tag="CL3_07540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35791"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPV5"
FT                   /protein_id="CBL35791.1"
FT                   /translation="MGHTPYGYRIENGVAVIDEAAAGRLRKLYKNYLSGMGLQMAAAEA
FT                   GIQTYHGTAKRLLMTQHYLGDDFYPAIIDEETYHKAQEELITRAAALGRLNRTTKQKPI
FT                   KTPTLFTIRDIEKHFDNPAAQAEYLYSLIDCEVG"
FT   CDS             659884..660927
FT                   /transl_table=11
FT                   /locus_tag="CL3_07550"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35792"
FT                   /db_xref="GOA:D4MPV6"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPV6"
FT                   /protein_id="CBL35792.1"
FT                   /translation="MGNVMVIPARRQVGNNVKRSEKPKLRVAAYCRVSTDSDEQAISYD
FT                   AQIEHYTEYISKNPDWTLAGIFADDGITGTNTKKREEFNRMIDECMAGNIDMIITKSIS
FT                   RFARNTLDCLKYIRQLKEKNIPVFFEKESINTMDAKGEVLLTIMASLAQQESQSLSQNV
FT                   KLGLQYRYQQGHVQVNHNRFLGYTKDADGHLVIDQDQAEIVRRIYREYLEGSSMDKIAA
FT                   GLEADGILTGAGKTKWHTSTINKILRNEKYIGDALLQKTYTTDFLTKKRIKNNGIVPQY
FT                   YVEGDHEAIIPKDIFLLVQEELVRRRRVHTSKSGKRHCYSCFETEDQKEGMAAFLEKRK
FT                   EKQFKNR"
FT   CDS             661011..661847
FT                   /transl_table=11
FT                   /locus_tag="CL3_07560"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35793"
FT                   /db_xref="GOA:D4MPV7"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPV7"
FT                   /protein_id="CBL35793.1"
FT                   /translation="MKIGVIGAGTMGSGIAQAFAQTEGYEVVLCDINEEFAANGKKKIA
FT                   KGFEKRIAKGKMTQEDADKILAKITTGVKDICGDCDLVVEAAIENMEIKKQTFKELDAI
FT                   CKPDCIFATNTSSLSITEVGSGARPVVGMHFFNPAPVMKLVEVIAGLNTPKEMVDKVIE
FT                   ISKAIGKTPVQVEEGAGFVVNRILIPMINEAVGIYADGIASVEGIDTAMKLGANHPMGP
FT                   LALGDLIGLDVCLAIMEVLQHETGDTKYRPHPLLRKMVRAGYLGQKTGKGFYDYSK"
FT   CDS             661952..663106
FT                   /transl_table=11
FT                   /locus_tag="CL3_07570"
FT                   /product="Acyl-CoA dehydrogenases"
FT                   /EC_number="1.3.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35794"
FT                   /db_xref="GOA:D4MPV8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPV8"
FT                   /protein_id="CBL35794.1"
FT                   /translation="MDFTLSKEHEMARTLFHDFAEKEVKPLAQEVDETEHFPTETVKKM
FT                   QKLGFMGIPVPKEYGGQGCDPLCYAMCVEELSKVCGTTGVIVSAHTSLCCDPIQTYGTE
FT                   EQKQKYLVPLAKGEKLGAFGLTEPGAGTDAQGQQTKAVLDGDEWVLNGSKIFITNGKEA
FT                   DIYVIIAVTGTKEDARGRKKKEISAFIVEKGTPGFTFGTKEKKMGIRGSATYELIFTDC
FT                   RIPKENLLGQQGKGFNIAMHTLDGGRIGIAAQALGLAEGALERTIEYVKERKQFGRALG
FT                   QFQNTQFQLADMATKVKAAQLLVYRAAMAKATQKTYSVEAAMAKLYAAEVAMEVTTKAV
FT                   QLHGGYGYIREYDVERMMRDAKITEIYEGTSEVQRMVISGALLK"
FT   CDS             664071..665120
FT                   /transl_table=11
FT                   /locus_tag="CL3_07590"
FT                   /product="Electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35795"
FT                   /db_xref="GOA:D4MPV9"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPV9"
FT                   /protein_id="CBL35795.1"
FT                   /translation="MNLEAYKGVFVFAQQVDNEISGIAFELIGKGKDLAKDLGTEVTAV
FT                   LVGSDVKGLADELAEYGADKVIVVDDPELKEYRTEPYTHALASVINEFKPEIFLIGATA
FT                   IGRDLGPRVCARIHTGLTADCTQLEIGDFPINPMPGKEQKHNQLLMTRPAFGGNTIATI
FT                   ACPDFRPQMATVRPGVMQKLPKQAGVKANVVEYNPGFTPNKNYVEILDVVKAVADTVDI
FT                   MDAKILVSGGRGVGSPENFKLLDDLAEAIGGTVSCSRAVVDAGWKPKALQVGQTGKTVR
FT                   PNVYFAIGISGAIQHVAGMEESDIIIAINKDETAPIFDVADYGIVGDLNKVVPLLTEKL
FT                   KAAKAAQNA"
FT   CDS             665206..665370
FT                   /transl_table=11
FT                   /locus_tag="CL3_07600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35796"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPW0"
FT                   /protein_id="CBL35796.1"
FT                   /translation="MDRGIRPAGHALPCRAASCRKLSAQHLAQPGLRRIRLGQDVVLRR
FT                   DKNPLSLRR"
FT   gap             665496..665722
FT                   /estimated_length=227
FT   CDS             complement(666102..666833)
FT                   /transl_table=11
FT                   /locus_tag="CL3_07610"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35797"
FT                   /db_xref="GOA:D4MPW1"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPW1"
FT                   /protein_id="CBL35797.1"
FT                   /translation="MARKTVLVTGASRGIGKAIAVKFAKKGYNVVISCVRREEQLLQTK
FT                   KEIESFQVSCLSYLGDMGVAENCAELFKKIRKQFGGLDVLVNNAGISYIGLLQDMKPED
FT                   WELILRTNLTSVFNCCKLAIPMMLEKKQGKIINISSVWGVCGASCEAAYSATKGGVNAL
FT                   TKALAKELAPSNIQVNAIACGAIDTEMNHFLDDEELIGLIEEIPAGRLGRAEEVADLAY
FT                   HLGYKENYLTGQIIGLDGGWV"
FT   gap             667422..668245
FT                   /estimated_length=824
FT   gap             669441..670612
FT                   /estimated_length=1172
FT   CDS             670622..670717
FT                   /transl_table=11
FT                   /locus_tag="CL3_07660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35798"
FT                   /db_xref="GOA:D4MPW2"
FT                   /db_xref="InterPro:IPR013802"
FT                   /db_xref="InterPro:IPR022384"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPW2"
FT                   /protein_id="CBL35798.1"
FT                   /translation="MQALIDCAEYYLQVENFDSAQVMENRLLEEE"
FT   CDS             670720..671358
FT                   /transl_table=11
FT                   /locus_tag="CL3_07670"
FT                   /product="Formimidoyltetrahydrofolate cyclodeaminase"
FT                   /EC_number="4.3.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35799"
FT                   /db_xref="GOA:D4MPW3"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPW3"
FT                   /protein_id="CBL35799.1"
FT                   /translation="MAELKDLSIEEFAALAASDAPAPGGGSVSAVAGALAAALAEMVAN
FT                   LTVGKAKYADAEEEMKEIAAKGAEIRKTLVDDIERDSESFTLYMKALGMPKDTEEQKAV
FT                   RREAMQNGLKEAARVPLSVARTAAEIFPLAEAVIARGNTNAVTDGLVAAMMARTAVIGA
FT                   LFNVKNYLGSIKDEEFRAEMEKEVSRLEAEAVEYEKRILKSSELSDSLC"
FT   gap             672293..673196
FT                   /estimated_length=904
FT   CDS             673204..673791
FT                   /transl_table=11
FT                   /locus_tag="CL3_07690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35800"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPW4"
FT                   /protein_id="CBL35800.1"
FT                   /translation="MIFERLVRPVCLKAVLDPEQPASVEMGSFLKAVAQLSPWIELQLL
FT                   ERGEDSEADGALDTEHLPSTGLFGENGYLGAAFLGVPGGKEINSFVAAILNAAGPEKEL
FT                   DQKLLKKIAKLKKKNVIRVFVSLSCHHCQSVVTAGQTLALLSPNVECTMVDARLYPDLV
FT                   EKYKLSRVPAILIGEAMYMGEKSLEELLALLR"
FT   CDS             674077..674643
FT                   /transl_table=11
FT                   /locus_tag="CL3_07710"
FT                   /product="Glycerol-3-phosphate responsive antiterminator
FT                   (mRNA-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35801"
FT                   /db_xref="GOA:D4MPW5"
FT                   /db_xref="InterPro:IPR006699"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPW5"
FT                   /protein_id="CBL35801.1"
FT                   /translation="MEQKLYDTVTDCPVIAAVKDEAGLEKCLSSDIQIVFVLYGDIVGI
FT                   PEIVERIKEKGKFAMIHVDLISGLSGKEIAVDFLHRNTRADGIISTKLPLIRRAKELGM
FT                   ATVFRFFVIDSMAFDNIKKQYDAALPDFVEILPGIMPKIITRVTKMVSAPVIAGGLIGE
FT                   KADIYAAIEAGAISISSTNQNTWFI"
FT   CDS             674658..675245
FT                   /transl_table=11
FT                   /locus_tag="CL3_07720"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35802"
FT                   /db_xref="GOA:D4MPW6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPW6"
FT                   /protein_id="CBL35802.1"
FT                   /translation="MSDTKRRLAQALKELMAEKPIKKITIQDIVERSHMTRQSFYYHFQ
FT                   DIYEVIELICQYELIDQIAYRQEESFSHWLEHLMALIEENRWFYRKMLQEMEWDRVANH
FT                   LKPAVEAQIRRLVGNMLTESETRSLSGGRELLVDFLTESVIQYIFRYVSCRKVPKEQNA
FT                   QNLRELLQVCSLICAKCASSSKKARKSILKTG"
FT   CDS             675352..676848
FT                   /transl_table=11
FT                   /locus_tag="CL3_07730"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35803"
FT                   /db_xref="GOA:D4MPW7"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPW7"
FT                   /protein_id="CBL35803.1"
FT                   /translation="MAKYVMALDAGTTSNRCILFNEKGEMCSVAQKEFTQYFPKPGWVE
FT                   HNANEIWSSQLSVAVEAMAQIGATAEDIAAIGITNQRETTIVWDKETGEPVYNAIVWQC
FT                   RRTSEYCDSLKEKGLTDKFREKTGLVIDAYFSGTKLKWILDNVPGVRERAEKGELLFGT
FT                   VETWLIWKLTKGAVHVTDYSNASRTMLFNINTLQWDDEILAELNIPKCMLPEAKPSSCV
FT                   YGESDPSWFGGPIKIGGAAGDQQSALFGQTCFNPGEAKNTYGTGCFMLMNTGEKPVFSK
FT                   NGLVTTIAWGLDGKVNYALEGSIFVAGAAIQWLRDEMRLIDSSPDSEYMAKKVKDTNGC
FT                   YVVPAFTGLGAPHWDQYARGTIVGITRGVNKYHIIRATLESLAYQTNDVLQAMQADSGI
FT                   HLGALKVDGGASANNLLMQIQSDIIQAPVHRPKCVETTAMGAAYLAGLAVGYWASKEDV
FT                   IKNWAIDRVFAPQIEAEERDKKVKGWNKAVKYSFGWAKED"
FT   gap             678344..679280
FT                   /estimated_length=937
FT   CDS             679484..679714
FT                   /transl_table=11
FT                   /locus_tag="CL3_07770"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35804"
FT                   /db_xref="GOA:D4MPW8"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPW8"
FT                   /protein_id="CBL35804.1"
FT                   /translation="MREIQYEIVKEIAVLSTGDSGYTKEINLISWNGKEPKYDIRSFSP
FT                   NREKCGKGITLNADEAAALLKALQKELNSED"
FT   CDS             679714..679977
FT                   /transl_table=11
FT                   /locus_tag="CL3_07780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35805"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPW9"
FT                   /protein_id="CBL35805.1"
FT                   /translation="MVSDWQGGDISKLFPALSGKEDLSMGEDKKADKKRKRIVPKAPVQ
FT                   MIISREYVGTQTVTEAFVPIISEDIRKKIAEGDTFDNEGLSA"
FT   gap             681707..682051
FT                   /estimated_length=345
FT   gap             683987..685204
FT                   /estimated_length=1218
FT   CDS             685937..686491
FT                   /transl_table=11
FT                   /locus_tag="CL3_07830"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35806"
FT                   /db_xref="GOA:D4MPX0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003562"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPX0"
FT                   /protein_id="CBL35806.1"
FT                   /translation="MREKSQLTTLCYIEKDGKYLMLHRVKKEKDVNKDKWIGIGGHFEE
FT                   GESPEECLLREAKEETGLTLLSWQFRGIVTFIADGWPTEYMCLYTADAFEGELRECSEG
FT                   TLEWVKKEELDKLNLWEGDRIFFGLLAENRPFFSLKLRYEGDHLAEWSLDGERKKDDRN
FT                   FCKCRHNFGRKPDRKCGKQGD"
FT   gap             686888..688330
FT                   /estimated_length=1443
FT   gap             689618..690380
FT                   /estimated_length=763
FT   CDS             690429..691763
FT                   /transl_table=11
FT                   /locus_tag="CL3_07870"
FT                   /product="Predicted metallopeptidase (DUF2201)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35807"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPX1"
FT                   /protein_id="CBL35807.1"
FT                   /translation="MEKSPIVWEQEKAEALTGVCTDILKNARNELYLNMRFLDVALSSL
FT                   LFSPDFKAEGIGTDGFVLRYNPNRLSELFRKGRVYVNRAYLHMIFHCLFVHMDTRGRRA
FT                   KPYWDLACDIAVESMIDGLLIRALRVPPSPARRELYQRIQGKIPVITAQAVYAFLQKEG
FT                   LTEGRYLSLAREFYVDSHALWEDEKNRKPRAQERKNRWDDIRQSMETEMETFSKLASDK
FT                   AGDLLEQVKIENRGRVNYREFLRKFSVMRETMQVDTDAFDYIYYDYGLRTYGNMPLIEP
FT                   LETKEIKKIEEFAIVIDTSMSCSGELVHRFLTETYSVLSEAESFFTSVNIHIIQCDEKV
FT                   QSDKRIADRKELSDYMEHMELRGQGGTDFRPAFEYVDQLIAEKQFTNLKGLIYFTDGYG
FT                   MFPVKMPAYETAFVFMREDYSDADVPPWAIKVILGPEEIEASEEI"
FT   gap             692060..693031
FT                   /estimated_length=972
FT   CDS             693759..694505
FT                   /transl_table=11
FT                   /locus_tag="CL3_07900"
FT                   /product="Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35808"
FT                   /db_xref="GOA:D4MPX2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPX2"
FT                   /protein_id="CBL35808.1"
FT                   /translation="MNEGKDRQQFVRALIYLGEIAILIAAVALAVRFLPGQKGGGDDGG
FT                   TEASGETGPLTELTEPAETDRELPKETEEVQEPGTEEIFWEEQWKPAHQTEEEPGEPPY
FT                   EPPFFIVASDIHYQSPKMTDFVGEAFCQFVRWDDGKVIPYLDTITDAFLEEAAEKQPDA
FT                   LILSGDLTQNGELVNHEELAEKLRKVEEQGVPVLVIPGNHDINHPEASYFEGAERKKAD
FT                   NITADDFIPSTGNSDMTRPWIGTRPL"
FT   CDS             694481..694819
FT                   /transl_table=11
FT                   /locus_tag="CL3_07910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35809"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPX3"
FT                   /protein_id="CBL35809.1"
FT                   /translation="MDRDEASLSYMYRADDRYWLMMLDSCQYDPENKIGGRIRKETLAW
FT                   MSGWLEKAREENVLVIPIAHHNLLKESTLYPEDCTLENSSQAAELLESYGLPVYISGHL
FT                   HLQRIKKI"
FT   CDS             694879..695457
FT                   /transl_table=11
FT                   /locus_tag="CL3_07920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35810"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPX4"
FT                   /protein_id="CBL35810.1"
FT                   /translation="MAIPPCQYGELRWQEDGSFDYRTCRIDVESWARDHGITDENLLNF
FT                   KQYSEDFLVETIQSQVYGQLSGIPNDRKFHMAKLYGQLNSAYCAGTPVNRRGVKENQMY
FT                   FYWERYLGTSAWYDQMQAILKDVGRDNNSLSLKAGADFPYQYREEKDSSLAGGEEGEIS
FT                   GAQAAEEPEPQSEAPEKDDASGPAGETKQ"
FT   CDS             695516..696388
FT                   /transl_table=11
FT                   /locus_tag="CL3_07930"
FT                   /product="Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35811"
FT                   /db_xref="GOA:D4MPX5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023970"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPX5"
FT                   /protein_id="CBL35811.1"
FT                   /translation="MKYEGIVYRPPSEARSLIVQVTIGCAHNTCTFCNMYKAKDFRVRS
FT                   MDEIMEDLREAHDGYGAYVQKVFLADGDALVLQTEKLLAILDAVRELFPNCVRVASYGT
FT                   AQDILRKSEEELRQLKEAGLGIVYVGAESGDDEILREINKGVTARELKEVGQKLKRCGI
FT                   QTSVTLISGLGGRKKVKEHALACAELITAMNPEYASFLTLRLYEGTPMYEDVVEGRFER
FT                   ITADEIVDEMKIFLENVDSPGTVFRTNHASNYVVLAGTLNEDIPSMLTQLDEAKKNHHY
FT                   RRFRETGDL"
FT   CDS             696441..696614
FT                   /transl_table=11
FT                   /locus_tag="CL3_07940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35812"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPX6"
FT                   /protein_id="CBL35812.1"
FT                   /translation="MREKRRTRSLLEIRNRSRMIRQGSFASQKAEPPYLSQNAGNEKAE
FT                   IQDIKGKTEMIF"
FT   CDS             696756..697298
FT                   /transl_table=11
FT                   /locus_tag="CL3_07950"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35813"
FT                   /db_xref="GOA:D4MPX7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPX7"
FT                   /protein_id="CBL35813.1"
FT                   /translation="MIILASMIDEPGDLVKFQTLYSLYSGAMYTTAFNILENADDAEDA
FT                   VQISSLKIIKNLNRLEMEEIHDIKTKSFLLTIARNTALDIWRKRKKEPVSVEEVEMDGL
FT                   APSAEKIYFDKVSVNNLAEAIGRLDGIYQDVLRLYYVHELPSKEIGKILNINHLTVNTR
FT                   LKRAREKLFKMLKEEGA"
FT   gap             697756..698360
FT                   /estimated_length=605
FT   CDS             699122..699325
FT                   /transl_table=11
FT                   /locus_tag="CL3_07980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35814"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPX8"
FT                   /protein_id="CBL35814.1"
FT                   /translation="METEMGQPGREEKKKRQRKRGEKKGVRKKGRKKGEKGDREKTGGK
FT                   AEERKAQASDKIIEENRLRNPV"
FT   CDS             699322..699810
FT                   /transl_table=11
FT                   /locus_tag="CL3_07990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_07990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35815"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPX9"
FT                   /protein_id="CBL35815.1"
FT                   /translation="MILYTCIRFFRTGIQTSEGLGMRQRGRRNMIFIGGISSAVKQLNY
FT                   LKTVICSRCGGYGRYQVFMTYTYFSFFFIPVFKWNRQFYVKMSCCGSVYELDREVGMKI
FT                   LRGESVDIREEDLTLIKAGGRSFELSDFEEERTCPGCGASVSEDYSYCPYCGEPLDRR"
FT   CDS             699997..700392
FT                   /transl_table=11
FT                   /locus_tag="CL3_08010"
FT                   /product="Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35816"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPY0"
FT                   /protein_id="CBL35816.1"
FT                   /translation="MLEVGIKGREEVMVTEENSAAAVGSGLLPVFATPAMVALMEQTSW
FT                   KSVAPYLNEGEGTVGTSLTISHSSATPLGMKVWCESELTEVDRRRLVFHVTCYDAAGVI
FT                   GEGTHERFIVGNEKFLAKAQAKKDAEK"
FT   CDS             700477..701268
FT                   /transl_table=11
FT                   /locus_tag="CL3_08020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35817"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPY1"
FT                   /protein_id="CBL35817.1"
FT                   /translation="MKTDAGYRLWRRFVQADLSGGEKMKITYIHHSGVSVETEHAVLLF
FT                   DYFKGQLPAWDEKKPLFVFASHFHEDHYSPVIFELLEDREDVHYILSKDIRGRRIPPRA
FT                   EGKIRFVKPGEVFASAADRGGITLRVQTYKSTDEGVAFWVTADGQEIYHAGDLNNWWWE
FT                   GEDKAWNHNMAANYRREVEKIAADHPEGADAAFIPLDPRQEQWFYLGMDDFLRRVKAET
FT                   VFPIHFWKDYTVVKKLRELPCSEPYRSRIKEIEREGEEFEI"
FT   CDS             701265..701642
FT                   /transl_table=11
FT                   /locus_tag="CL3_08030"
FT                   /product="Lactoylglutathione lyase and related lyases"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35818"
FT                   /db_xref="GOA:D4MPY2"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPY2"
FT                   /protein_id="CBL35818.1"
FT                   /translation="MKFTFAHNNFNVMNLEKSLKFYEEALGLKEVRRKEAADGSFILVY
FT                   LGDGVTPHQLELTWLRDWEKDSYNLGDNEFHLAFEVDDMEEAHKKHEEMGCICFENPSM
FT                   GIYFIADPDNYWLEIVPRKMK"
FT   gap             701795..702005
FT                   /estimated_length=211
FT   CDS             703638..705137
FT                   /transl_table=11
FT                   /locus_tag="CL3_08060"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35819"
FT                   /db_xref="GOA:D4MPY3"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPY3"
FT                   /protein_id="CBL35819.1"
FT                   /translation="MTTMLKRGAGILMPISSLPAPYGIGTFGKSAYEFADSLKRARQSY
FT                   WQVLPLGPTSYGDSPYQSFSAFAGNPYFIDLDALLEEELLTKEEIDACYWLDSEEEVKY
FT                   DAVYYYRFPLLKKAYERSRHGETEEYRAFCAKNSHWLDDYALYMALKGHFGNKEWMKWE
FT                   EPIRLRKPEAVKRYEELLREEIGYWKFLQFKFYEQWEQLKNYVNGLGISIIGDIPIYVA
FT                   LDSADVWTHPELFQLDPDTLTPLRVAGVPPDAFSDDGQLWGNPLYDWDKIEETGFAWWK
FT                   DRMRASARLYDVVRIDHFIGVVQYYSIPYGAEDGKTGEWKQGPGKKLTDAINEAAGDAK
FT                   IIAEDLGIFCPAVKELLRKTGYPGMKIIEFAFSGDRFNEHLPHCYEPNSVVYGGTHDNE
FT                   TLVGYFKPEARQWWELQYIADYLGAAHHEEVPDKVFRAAYGSVASVAVFQMQDVLGLGN
FT                   EARMNTPGTVGGNWKWRMKPGAFGERETGYLAFLVDTFGRF"
FT   CDS             705259..705903
FT                   /transl_table=11
FT                   /locus_tag="CL3_08080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35820"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPY4"
FT                   /protein_id="CBL35820.1"
FT                   /translation="MKKRDRWLMTAALTVGVLTFAAGCGRQEETKPASASQSAVEEAED
FT                   DTSETSGTLSQEEEGKTQGTETVSVMTGTVLDAAMNSIVIQNQEYPDGIIFSKEDSAAS
FT                   FTDGLTLGLDATLFYTGRIQGDDTTETEVVLVRDGRDGDDGLAAFLVSGTVSAVSGEEL
FT                   TVEADDKTEVTVKRGSELMELEGEPQEGDLVTVLYSCPESGTEQKQAELIR"
FT   CDS             705943..706152
FT                   /transl_table=11
FT                   /locus_tag="CL3_08090"
FT                   /product="Predicted nucleic-acid-binding protein containing
FT                   a Zn-ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35821"
FT                   /db_xref="InterPro:IPR018652"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPY5"
FT                   /protein_id="CBL35821.1"
FT                   /translation="MEKMQYRCPKCGGGEYVSDQFQATGGNFAKIFDVQNKKFITISCR
FT                   SCGYTELYRAETDGAMNILDFLMG"
FT   CDS             complement(706285..706959)
FT                   /transl_table=11
FT                   /locus_tag="CL3_08100"
FT                   /product="3-Cys thioredoxin peroxidase"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35822"
FT                   /db_xref="GOA:D4MPY6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPY6"
FT                   /protein_id="CBL35822.1"
FT                   /translation="MEDMEMNRLPLIGDTAPSFKALTTKGTVNFPEDYKGKWVLFFSHP
FT                   SDFTPVCTTEFMTLASMAEEFRALNTELLGLSVDSLYSHIAWVRRIEELSWNGIDHVHV
FT                   DFPVIADLNMKVSHKYGMLQPNVSSTQAVRAVFIIDPQSVIRAIIYYPLNLGRNFDEIK
FT                   RAVQALQKADAEHCSTPANWRPGDDVLIPSPTTCDEAKERMEHTPEGEYALDWFLNFRK
FT                   ES"
FT   gap             707340..707759
FT                   /estimated_length=420
FT   CDS             complement(708691..709278)
FT                   /transl_table=11
FT                   /locus_tag="CL3_08130"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35823"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPY7"
FT                   /protein_id="CBL35823.1"
FT                   /translation="MNQSICDHYTAILNTELITALGCTEPIAIAYAGATVRKVLGTMPD
FT                   RCVTACSGNIIKNVKGVTVPNSGGMKGIDTAAVLGIVGGNPEKVLAVLEDVTAEQIEQT
FT                   KRLTASGFCRCELVEGVENLYIVITACKGSDWAQVEIRNFHSNITKNHKKRPHPLCISK
FT                   AGRHFLPGTVPVSGQIASERQRYPGLCRIGGA"
FT   gap             709639..710061
FT                   /estimated_length=423
FT   gap             711160..711781
FT                   /estimated_length=622
FT   CDS             711783..712313
FT                   /transl_table=11
FT                   /locus_tag="CL3_08170"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35824"
FT                   /db_xref="GOA:D4MPY8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPY8"
FT                   /protein_id="CBL35824.1"
FT                   /translation="MLVLLFSVNLGILPAFGMGTSGFGDTVLHMIMPCICLTVAPAATF
FT                   TRITRSSMLEVINNDSIKALRARGMSEKAILWKHALKNALPPIVTVFGLQLATAFTGAI
FT                   LTETIFSWPGMGSLIVGAIDNRDYSLIQGAVVLVAFAFVFINLITDIIYMIINPKFAAE
FT                   AQKEVSRAWRTAK"
FT   CDS             712295..713206
FT                   /transl_table=11
FT                   /locus_tag="CL3_08180"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35825"
FT                   /db_xref="GOA:D4MPY9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPY9"
FT                   /protein_id="CBL35825.1"
FT                   /translation="MENSKVTKAGALSQESHAAMIRKERRSNDALHKFLRNKTAVFGFI
FT                   VIFIMTVFAVCSPLIATHDPNALSLANAYLPPGTDGHLFGTDELGRDLFSRIVYGARIS
FT                   MAVAWGGTLMGGVLGSILGMIAGYNGKWADSIIMRIMDGMFAFPFILLAIFLMTIFGSG
FT                   LFNVIMAIGIADVPKFARIVRGQVVILKNEEYCNAEKVLGASGFRILVHHILPNAISPI
FT                   IVYATLNIATAILAESSLSFLGLGILPPTASWGNILRAGKDCLNTAPHIATLSGGFIML
FT                   TVLAFNLFGDGVRDVLDPKMKK"
FT   gap             713727..714469
FT                   /estimated_length=743
FT   CDS             715579..717207
FT                   /transl_table=11
FT                   /locus_tag="CL3_08210"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35826"
FT                   /db_xref="GOA:D4MPZ0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPZ0"
FT                   /protein_id="CBL35826.1"
FT                   /translation="MKKRIAKMMLLAAAAFSLTACGGSGGNQEAEETEETSLALVEKET
FT                   VAEEDLVPQKGGMLKIGLEGSPKNLDPKNRTSVYESRIISQVCDTLIIYNNDQTEYLPS
FT                   LAESWEISDDGLEYTFHLRDDVHFHKGEFQDGRLMTAEDVKYSLERAKEAKNVTLVMLD
FT                   HVEVIDEHTAKCVLTEPNAVFLDVLTGPTNVIVPKEEVEGWGDQFGEHLIGTGPFKLQE
FT                   FKLDQEATIVRNEDYWGPEPYLDGAVFKVITDINQHVNGLKTGEIDFSCKISGEAVKLV
FT                   NEDPNLRLLVAPNTSINFVGFNTEKGITADPKVRQALAEAVDLEDLCAGLYQYEEAVYA
FT                   GQPMPPASWGYDPSMDEYKQKYDPEHAKQLLTEAGYPDGFEITITLSNSSTNTSLATIL
FT                   QQYWKQNLNVDLKINMSEWAVYSQTVTSGNHEIYAVGIDSTVDPHNFTGKCLGSDYIGT
FT                   LPAGCRLNDPEMDELIRQSLEVTDQTARKEIYKEIVKKTMELTPALYYSNNNLLWGTTD
FT                   KVHGLCQKTYWNLCNSEVNVWMEQE"
FT   gap             717510..718285
FT                   /estimated_length=776
FT   CDS             complement(718405..718785)
FT                   /transl_table=11
FT                   /locus_tag="CL3_08230"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35827"
FT                   /db_xref="GOA:D4MPZ1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPZ1"
FT                   /protein_id="CBL35827.1"
FT                   /translation="MTIAEVSKKYDISADTLRYYERIGLIPPVPRNKSGIRDYGEDSCR
FT                   WIELMKCMRKAGVQIEALIEYVALFQQGDDTAEARKAILVEQRERLMERMADMQASLER
FT                   LNQKIERYEQVIIPAEKELKRF"
FT   gap             719739..721150
FT                   /estimated_length=1412
FT   CDS             721828..721983
FT                   /transl_table=11
FT                   /locus_tag="CL3_08260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35828"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPZ2"
FT                   /protein_id="CBL35828.1"
FT                   /translation="MNAQAQCDAALEAMQKLVAGETLEEKEIYVEPLLVTAENLEEYRA
FT                   SHEGNY"
FT   gap             722436..723471
FT                   /estimated_length=1036
FT   CDS             724360..724560
FT                   /transl_table=11
FT                   /locus_tag="CL3_08290"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35829"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPZ3"
FT                   /protein_id="CBL35829.1"
FT                   /translation="MSLLGNILWFLMGGLISGLGWVLSGCLWCITIIGIPVGLQCFKFA
FT                   SLSFFPFGRKCSTAAGPVPFC"
FT   CDS             724934..725044
FT                   /transl_table=11
FT                   /locus_tag="CL3_08310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35830"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPZ4"
FT                   /protein_id="CBL35830.1"
FT                   /translation="MQEYVILFIEINLETAASGVCFEIADGARAGEMGES"
FT   CDS             725189..725326
FT                   /transl_table=11
FT                   /locus_tag="CL3_08320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35831"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPZ5"
FT                   /protein_id="CBL35831.1"
FT                   /translation="MKTLRGDRTAAERKIRPDCADSCPAAGPASCTGDRRREWICHRFR
FT                   "
FT   CDS             725308..726912
FT                   /transl_table=11
FT                   /locus_tag="CL3_08330"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35832"
FT                   /db_xref="GOA:D4MPZ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPZ6"
FT                   /protein_id="CBL35832.1"
FT                   /translation="MSQIQVKNLTFYYDGSGEDIFANVSFTIDTDWKLGFIGRNGRGKT
FT                   TFLKLLMGQYEYRGTIASPEAFEYFPYPVKDMEKNTIDVVEEVKPDYEFWKLCREMNLL
FT                   SVKEEVLFRPFRTLSKGEQTKVLLALLFSSENRFLLIDEPTNHLDSEGRKQVSQYLSRK
FT                   KGFILVSHDRRFLDGCIDHVLALNRKNIEVVQGNFSSWWENREKREAFELQKNEKLKKE
FT                   IGRLKESAARASSWAEHSENLKIGTGSYVNGKFIGSRSYLGEKSRKMQQRRKSMEQRRE
FT                   KAIQEKEGLLEDREEAEILKLMPLSHFREELVSFEHVKLGYDPQSTKEAIFRELNFSVR
FT                   QGERVILTGKNGSGKSTVLKAILQACGYDVRRGEAGREKPAADDGEPMKGAKQRQQPAQ
FT                   PCLLAGTVRTAPGLVISYVPQDASGLWGLLSDFQEQRGLDRTLFLAVLRKLGFSRELFS
FT                   KPMETYSEGQKKKVLLAAGLCTSAHLYVWDEPLNFIDVFTRMQLEQLLSESKAAMVLVE
FT                   HDEAFAEKIAAKKVELS"
FT   gap             727224..727785
FT                   /estimated_length=562
FT   gap             728841..729181
FT                   /estimated_length=341
FT   gap             730687..730950
FT                   /estimated_length=264
FT   CDS             731179..731991
FT                   /transl_table=11
FT                   /locus_tag="CL3_08380"
FT                   /product="ABC-type spermidine/putrescine transport systems,
FT                   ATPase components"
FT                   /EC_number="3.6.3.31"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35833"
FT                   /db_xref="GOA:D4MPZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPZ7"
FT                   /protein_id="CBL35833.1"
FT                   /translation="MLILKNIKKSYDGVTILHDINLEIKDGEIVSILGPSGCGKTTLLN
FT                   LILGLTDPDEGQILFNGQEMTGVPMEKRGFNIVFQDYALFPNLNVYKNITYGLKNKPGI
FT                   STRQEVEELIDLLGLREHLTKKIEQLSGGQKQRVALARTMVMKPKILLLDEPLSALDGV
FT                   IKESIKEKIRQIARDYHLTTIIVTHDPEEALTLSDKVLIVNQGEISQYGTPEEIVFHPG
FT                   NRFVEEFILNQLEIKRKNIFRLFNKTVDTQNREAVSLSADVKLREQAV"
FT   CDS             731996..732997
FT                   /transl_table=11
FT                   /locus_tag="CL3_08390"
FT                   /product="ABC-type Fe3+ transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35834"
FT                   /db_xref="GOA:D4MPZ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPZ8"
FT                   /protein_id="CBL35834.1"
FT                   /translation="MTGRKEYEIKGIYAAVVAIFAVFLAVPVIRLLMESFMADAGVSVR
FT                   NYAQVLTERGFAAALANSVKVSVSSALIATALAFFLAYTIQYTRVPGKFKSLIRLAAVL
FT                   PMLLPTLTYGFAIIYSFGKQGLLTKLFGRQFFEIYGFGGLLFGYVIYTLPVSFLLILNT
FT                   MGYIDKKFSVVSRIMGDSPFKNFLQTVVRPLLGTLAASMVQCFFLCFTDYGIPASVGGE
FT                   YDVVATVLYNEMLGSVPNFNRGAVVAMMMLIPSVISIALLHYLERYNIRYTKISAVDLR
FT                   KNRVRDGIFMAGLCNDSADADLGVRRDLCGSSGERVALSDKLYHGACHRYTD"
FT   gap             733198..734404
FT                   /estimated_length=1207
FT   CDS             734454..735095
FT                   /transl_table=11
FT                   /locus_tag="CL3_08410"
FT                   /product="Isopropylmalate/homocitrate/citramalate
FT                   synthases"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35835"
FT                   /db_xref="GOA:D4MPZ9"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MPZ9"
FT                   /protein_id="CBL35835.1"
FT                   /translation="MQALSKRTDGIWEVPYLPIDPSDIGREYEPVVRINSQSGKGGVAF
FT                   VMDTFYGFKLPKGMHKEFADIIQEIAERQGEVAPEEIFDEFKKNYMDRKEPIHFRKCQI
FT                   TDRELDEGEFATVANVIYTDHGQEKQFEGVGNGPIDAIQRGLEDALGIEIRVLDYSEHA
FT                   LRSGSGAQAASYIHLLNVKTGETTYGVGISSNITRSSIRGIFSAVNRLFY"
FT   CDS             735377..736486
FT                   /transl_table=11
FT                   /locus_tag="CL3_08420"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35836"
FT                   /db_xref="GOA:D4MQ00"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ00"
FT                   /protein_id="CBL35836.1"
FT                   /translation="MTGKKYDYLLVGSGLFSAVFACMARRHNKSCLVLEKRNHIGGNIY
FT                   CEEMEGIRVHKYGAHIFHTSDREVWEFVNQFTEFNRYTNSPVANYKGEMYNMPFNMNTF
FT                   SKMWNISTPAQARAIIEEQRAVIAGEPKNLEEQAISLVGTDIYEKLVKGYTEKQWGRDC
FT                   RELPGFIIRRLPVRYTYDNNYFNDTFQGIPVEGYNALIEKLFEGCEIRTGVDYLQCRDK
FT                   YRDAAERVVYTGTIDGYFGFRYGNLEYRSLKFETETLDTDNFQGVAVVNYTDRETPFTR
FT                   IIEHKHFEFGTQEKTVITREYPADWKPGMEPYYPVNDEKNQALYERYRVLAEKEENVIF
FT                   GGRLAEYKYYDMDKVIRSALDRAKEEFGE"
FT   gap             736538..737176
FT                   /estimated_length=639
FT   CDS             737657..738748
FT                   /transl_table=11
FT                   /locus_tag="CL3_08440"
FT                   /product="Serine-pyruvate aminotransferase/archaeal
FT                   aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35837"
FT                   /db_xref="GOA:D4MQ01"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ01"
FT                   /protein_id="CBL35837.1"
FT                   /translation="MINFAVGPVQMEEDIRALGAEEIPYFRTPEFSGIMKENEALMKKF
FT                   MKAGEDSRAVFLTGSGTAAMEAAVLNVFTGEDRVLIVNGGSFGARFVKICQVLGIPHEV
FT                   ICLEAGKALKREHLLPFEDRGFTGFLVNVHETSTGVHYDMELIGEFCRRNRLFLVVDAI
FT                   SSFLADDFEMEKWGVDLVLTGSQKALALPPGLSVLVLNGKAAERIRNNQVKSIYFDLKE
FT                   YLKDGERGQTPYTPAVSILLQLNLRLRKIDRAGLSKEQERIRAQAEDFREKIKELPFEI
FT                   VSESLSSGETPLHPTGRAADGTAVSAHRIFEILKDEYEIFVCPNGGELADRIFRVGHMG
FT                   NLTFEDNDRLIAALKDMQNRGLL"
FT   CDS             739476..739718
FT                   /transl_table=11
FT                   /locus_tag="CL3_08460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35838"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ02"
FT                   /protein_id="CBL35838.1"
FT                   /translation="MQFWRKPLEGQEPDKQEPERSKPEGQKPDKQEKGSQKPEGQKPDK
FT                   QQPEKKRLGKNQAEKKRPEKRKPGQGAGRQTEGCS"
FT   gap             740710..740940
FT                   /estimated_length=231
FT   CDS             740944..741702
FT                   /transl_table=11
FT                   /locus_tag="CL3_08480"
FT                   /product="Glycosyl transferase family 2."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35839"
FT                   /db_xref="GOA:D4MQ03"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ03"
FT                   /protein_id="CBL35839.1"
FT                   /translation="MASVKRQSCSSEVICCTSTPSPYISRLAEKYGIPLYVREGKSGIR
FT                   EDWLFAYEKAGGKFVTIAHQDDRYRKNYTETLLAMYRKYPDMTVFCSDYAAVMMEPKPD
FT                   GSLRARLQTVNRVWLVKKFLRLPLRLRFLADRTGVKRAALLFGNSICCPSCAYNKEELG
FT                   NRLFESSFEFALDWDNLYELAGRKGRFVCSERPLIYYRVHPGATTKQCIEDNRRKEDET
FT                   AMFRKMWPEPAVRLLMHFYRKAYDAYGKQD"
FT   CDS             741712..742665
FT                   /transl_table=11
FT                   /locus_tag="CL3_08490"
FT                   /product="Glycosyltransferases, probably involved in cell
FT                   wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35840"
FT                   /db_xref="GOA:D4MQ04"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ04"
FT                   /protein_id="CBL35840.1"
FT                   /translation="MENIAWRKAETDMELKKAEERAEGRKKSVDLIIPVYRPGKSFKEL
FT                   LKRIREQDYPIRRIIIMNTEEQFWKPEYEEIFEKKGTQETEMEVHHLSREEFDHGGTRD
FT                   RGIRLSDADVCILMTHDAVPADRKLVGNLIKALESGPDIAAAYARQLPFEDCSLMEKYT
FT                   RAFNYPAESRIKSAADLKELGIKTFFCSNVCAAYDTAIYRSLGGFIKKTIFNEDMIYAA
FT                   KAVENGYRIAYAADARVFHSHNYTAVEQFHRNFDLAVSQADHPEVFFRDPVRGRGNPAG
FT                   QAHRGLSRQTGKVDVPTEAGCSQRLQVCRIPAWETV"
FT   gap             743013..743517
FT                   /estimated_length=505
FT   CDS             743835..744260
FT                   /transl_table=11
FT                   /locus_tag="CL3_08520"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35841"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ05"
FT                   /protein_id="CBL35841.1"
FT                   /translation="MTMLLRAVLIVVSILTTVLILRKIRQSKLQIEDSLFWIGFSFMLI
FT                   LFSVFPVVPTVLSELAGTYSTSNFIFLFVIFLLIVKLFHMSIKQSQMETRLKELVQKIA
FT                   IEDKEQRDRQAGKVDCREQTDREGRDSCGEKEIGKKG"
FT   CDS             744398..744952
FT                   /transl_table=11
FT                   /locus_tag="CL3_08530"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35842"
FT                   /db_xref="GOA:D4MQ06"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ06"
FT                   /protein_id="CBL35842.1"
FT                   /translation="MGKIKVTPCDIKGLYVIEPTVFKDERGYFVETYNQNDFKEAGLDM
FT                   VFVQDNQSMSVKGVLRGLHYQKQYPQGKLVRAIRGTVFDVAVDLRADSETYGKWFGVVL
FT                   SAENKKQFYIPEGFAHGFLVLSDEAEFAYKCTDFYHPGDEGGLAWNDPEIGVEWPIEEG
FT                   MKLIISEKDQKWGGFKDTFRF"
FT   CDS             745005..745820
FT                   /transl_table=11
FT                   /locus_tag="CL3_08540"
FT                   /product="ABC-type polysaccharide/polyol phosphate export
FT                   systems, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35843"
FT                   /db_xref="GOA:D4MQ07"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ07"
FT                   /protein_id="CBL35843.1"
FT                   /translation="MNYYTSLFKGIIEKRKLIWDLAKADFKKRFVGSYFGVVWMFVQPL
FT                   VTILIYAFLFGEYGFKSPPPVPGASYVIWMVPGIVPWFYFSEALNSGTNCLQEYHYLVK
FT                   KVVFQVEMLPIIKLISCFMVHACFLAIMVGFYLVGGYFPIATWIQVLYYSFAVSMLALA
FT                   VTYITSSIQVFFKDMAQIVGICLQFGMWLTPIMYHESMFTDAHPWLLPIFKLNPFYYIS
FT                   TGFRDSMLQGNWFFERPTLTLYFWAVTLVLMFLGLRIFRKLRPHFSDVM"
FT   gap             746009..746339
FT                   /estimated_length=331
FT   CDS             748422..748553
FT                   /transl_table=11
FT                   /locus_tag="CL3_08570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35844"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ08"
FT                   /protein_id="CBL35844.1"
FT                   /translation="MQEKRGYLTILLSAVLYRFLQKAFSQKIQIHLLTKRRLSYILF"
FT   gap             748883..749449
FT                   /estimated_length=567
FT   CDS             749459..750493
FT                   /transl_table=11
FT                   /locus_tag="CL3_08590"
FT                   /product="Bacterial extracellular solute-binding proteins,
FT                   family 5 Middle."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35845"
FT                   /db_xref="GOA:D4MQ09"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ09"
FT                   /protein_id="CBL35845.1"
FT                   /translation="MKQWDRGQQVIFEANPDYYGEEPRMKKVTVLFMEEDAAFAAALAG
FT                   QADVVYTAASYTDQEVTGYHLLACESVDNRGFNLPAVPRYTDENGIERGNDFTADVRVR
FT                   RAISMGLDRQAMIDHVLNGYGSPAYSVCDKLPWYNEEAETAYDPEQAKALLDEAGWTPG
FT                   ADGIRTRDGVRAELEFIYPADDSVRQALAADTANQLKALGIDASARGVGWDTAYTEAYS
FT                   QPLLWGWGAHTPMELYNIYHTSPDTGTAQYSPYSNETVDRYMDEALACSDLEESYELWK
FT                   KAQWDGQTGVTEQGDVPWVWLVNVDHLYWVRDGLTVAEQKIHPHGHGWSIVNNVDQWSF
FT                   DGQQ"
FT   gap             750703..751470
FT                   /estimated_length=768
FT   CDS             752560..752667
FT                   /transl_table=11
FT                   /locus_tag="CL3_08620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35846"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ10"
FT                   /protein_id="CBL35846.1"
FT                   /translation="MSREKAQAKSQASFLGEEAKNTAVKGLYRKGKRRE"
FT   CDS             752664..752963
FT                   /transl_table=11
FT                   /locus_tag="CL3_08630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35847"
FT                   /db_xref="GOA:D4MQ11"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ11"
FT                   /protein_id="CBL35847.1"
FT                   /translation="MRMDESRRAETAEHPCRGRDDIPLLLVKGLSVTFTQYDRGLRRKL
FT                   LHPITDLSLQVRRGEVTALAGASGSGKSLLAHAVLGFFPTMLCAAGVWNIRGNC"
FT   gap             753017..754037
FT                   /estimated_length=1021
FT   CDS             754622..755392
FT                   /transl_table=11
FT                   /locus_tag="CL3_08650"
FT                   /product="NCAIR mutase (PurE)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35848"
FT                   /db_xref="GOA:D4MQ12"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ12"
FT                   /protein_id="CBL35848.1"
FT                   /translation="MDVKEMLRQVQSGRMSVESAEEMLKNLPYEDLGYAKLDLHRKLRS
FT                   GFPETVFCQGKPDEYLANIFQVLYRENGEVLGTRATQAQYLLVKEAVPDIVYDPISRIL
FT                   TARRPDCPARQEGCVAVCTGGTADIPVAEEAARTAEFFGCHVERIYDVGVAGIHRLLAQ
FT                   RERIEKANCIVAVAGMEGALGTVIAGLVENPVVAVPTSVGYGASFHGLSALLTMLNSCA
FT                   NGISVVNIDNGYGAGYLAAQINRLAAGKGDSQIK"
FT   gap             755579..756599
FT                   /estimated_length=1021
FT   CDS             complement(756918..757580)
FT                   /transl_table=11
FT                   /locus_tag="CL3_08680"
FT                   /product="channel protein, hemolysin III family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35849"
FT                   /db_xref="GOA:D4MQ13"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ13"
FT                   /protein_id="CBL35849.1"
FT                   /translation="MLMNIHVKDPGSALTHFIAMLGAAAAAAPLLMKAAAEPGQNGLQV
FT                   AALAVFIVSMILLYGASTIYHTLDISEKVNRRLRKLDHMMIFILIAGTYTPVCLIVLGN
FT                   RAGFLLLALVWGIAAVGILINALWISCPKWFSSLIYISMGWVCITAIREILNALPPAAF
FT                   GWLLAGGIIYTIGGIIYALKLPIFNSRHKNFGSHEIFHLFVMGGSLCHYVMMYAFVA"
FT   CDS             757846..758235
FT                   /transl_table=11
FT                   /locus_tag="CL3_08690"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35850"
FT                   /db_xref="GOA:D4MQ14"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ14"
FT                   /protein_id="CBL35850.1"
FT                   /translation="MDQRSKDNTALENIYSRKSVRLFEKRPVSEPDRAAILRAALEAPS
FT                   PANMSLYTIIEITDQELKNRTASLCHGQAFIGEAPMVLLFAADFKKWNDFFHIYAPDSR
FT                   TPGLGDMMLAWEDSYIAMQNAVTAA"
FT   CDS             759835..759906
FT                   /transl_table=11
FT                   /locus_tag="CL3_08730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35851"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ15"
FT                   /protein_id="CBL35851.1"
FT                   /translation="MKFDETETGLLLCRAKEADPHLL"
FT   gap             760397..760605
FT                   /estimated_length=209
FT   CDS             760948..761418
FT                   /transl_table=11
FT                   /locus_tag="CL3_08760"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35852"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ16"
FT                   /protein_id="CBL35852.1"
FT                   /translation="MFSREFALFSRRLVMTGNTWLRTQLIIMFITSCLCILGLVMIRNP
FT                   YCILLGLGIGILDALPLFGTGAVLVPWSLILLVQKQWYEGIVLAGLFIVCCLVREFLEA
FT                   RLMGDGMGLSPLETLAAIYVGLKLFGILGVLLGPIGLLIIEDLVEEYAGTEK"
FT   CDS             761475..761864
FT                   /transl_table=11
FT                   /locus_tag="CL3_08770"
FT                   /product="Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35853"
FT                   /db_xref="GOA:D4MQ17"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ17"
FT                   /protein_id="CBL35853.1"
FT                   /translation="MKLYYEETGNGEPMVLLHGNGEDSSYFKNQVEYFSKNYRVIAVDT
FT                   RGHGKSERGTAPFTLKQFAGDLKKFLDRMQLRDIILLGFSDGGNIALIFTILYPGYVKK
FT                   LILNGANLNPSGMKWESENLSPSLI"
FT   CDS             761870..762223
FT                   /transl_table=11
FT                   /locus_tag="CL3_08780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35854"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ18"
FT                   /protein_id="CBL35854.1"
FT                   /translation="MWRVKRGTCREKRGKLTADQKYLLERARRKKELLELMIKEPHISG
FT                   AYLKQLNVPTLVIAGTRDMIKTGHTKKIHSLIPASRLCLVEGTHFIASENSLEFNQAVE
FT                   RFLNQTGRKEDGR"
FT   gap             762502..763266
FT                   /estimated_length=765
FT   CDS             763490..764494
FT                   /transl_table=11
FT                   /locus_tag="CL3_08800"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35855"
FT                   /db_xref="GOA:D4MQ19"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ19"
FT                   /protein_id="CBL35855.1"
FT                   /translation="MTGRIRKSCGAVKSSEAGPGKGREKGKRELSSHGTAEFPCAGYAF
FT                   PVSAQSPVPWHWHEEMEIIGLKSGEIKVLVPGKEFHLKAGGCIVINSNVPHSAEGEGEG
FT                   ELRSIVFHPLLAAGTWESVFAKKYITPLTEEERFLACMGEAGGEGRQESGKNRELAEHF
FT                   WRAFQGLEKAETGFEFTVREELSRICLLLYQELGIGWEQHEYEPGHDSVRIRKMLGFIH
FT                   SHYASGLTLSEIAASAGIGERECLRCFQRSIRTPPVQYLLKYRIMQGAAMLLAEPEKSI
FT                   AQVAADCGFDSPSNFSMMFRRFYGQAPREYRRGLKGGRRVGAEKLQPACPPGD"
FT   gap             765285..765350
FT                   /estimated_length=66
FT   CDS             complement(765657..766793)
FT                   /transl_table=11
FT                   /locus_tag="CL3_08830"
FT                   /product="ABC-type sulfate/molybdate transport systems,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35856"
FT                   /db_xref="GOA:D4MQ20"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ20"
FT                   /protein_id="CBL35856.1"
FT                   /translation="MSLIVDIKKRLGDFLLEVSFETEDRVTGLLGPSGCGKSMTLKCIA
FT                   GVEKPDSGRIILDGETLFDSSRGICLSPQKRRVGYLFQNYALFPNMTAAQNILCGMRAG
FT                   ASEAEHSGADAESGKRQTSFSPGRLLNSHIQRKKEEQERLHKLSQLFHLEPCLHLHPRS
FT                   LSGGQAQRTALARILAGRPRLLLLDEPFSALDSYLKDQLQPEFKHLLSSLDCRTVMVTH
FT                   SRDEAYHLCSRLCVMVSGRILRNGSVKEVFAEPEYEAAARLTGCKNIVPAVKEGPFLVR
FT                   IPSWNITLQTERPVPDNLSFVGLRAHSFSPDISKNQFPICLCDVVEEPFEWMVLFFYET
FT                   QKRDSAPVWWRVPKEKISGDFPSRLGISPAQVLLLKSS"
FT   CDS             complement(766790..767464)
FT                   /transl_table=11
FT                   /locus_tag="CL3_08840"
FT                   /product="molybdate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35857"
FT                   /db_xref="GOA:D4MQ21"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ21"
FT                   /protein_id="CBL35857.1"
FT                   /translation="MDWYPLWNSLRIAAVSSVFVFFLGIAAAYWAARLPRVLKGVLDVV
FT                   LTLPLVLPPTVVGYFLLLLFGNRRPLGMALESIGVRFVMNWYGGILAAFVVAFPLMYRT
FT                   ARGAFESFDETLAQAGQTLGLSNFYIFWRIRMPACRQGILAGIVLAFARALGEYGATSM
FT                   LIGYTPGRTATISTTVYQLWRTGKDGEAFLWVAVNLAISAAVLLAVSLIERRQKEGGVK
FT                   RK"
FT   gap             768665..769762
FT                   /estimated_length=1098
FT   CDS             complement(770181..770678)
FT                   /transl_table=11
FT                   /locus_tag="CL3_08880"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35858"
FT                   /db_xref="GOA:D4MQ22"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR023046"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ22"
FT                   /protein_id="CBL35858.1"
FT                   /translation="MDFTHIDRNGNAVMVDVSEKAATERTAVARGRIRMSRQCFEAVKN
FT                   RTAKKGDVLGVAQIAGIMASKHTADLIPLCHRLNLTKSTVDFSLSEESEEKCYVEAVCT
FT                   VRCTDRTGVEMEALTGVCAALLTVYDMCKAIDRGMVIEQVHLVEKHGGKSGDFSFQDGG
FT                   HD"
FT   CDS             complement(770700..770909)
FT                   /transl_table=11
FT                   /locus_tag="CL3_08890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35859"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ23"
FT                   /protein_id="CBL35859.1"
FT                   /translation="MSYLPDGRPVCGLPGCVMYAGRTIFDLVLPRLLADVPVTSDWLSG
FT                   LGHGGLCLNCPECHFPNCGFGKGI"
FT   CDS             complement(770909..771724)
FT                   /transl_table=11
FT                   /locus_tag="CL3_08900"
FT                   /product="Molybdopterin biosynthesis enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35860"
FT                   /db_xref="GOA:D4MQ24"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ24"
FT                   /protein_id="CBL35860.1"
FT                   /translation="MKLMRTEDAVGQVLCHDITQIIKGVTKDAVFRKGHIIRPEDIPVL
FT                   LSVGKEHVYIWENDDTMLHENDAAEILRQLCQGPGMHATAPKEGKIELIADRDGLFMAD
FT                   TERLRSINQLGDMMIATIAGGFPVRAGDRLCGTRVIPLVIKKGRMEEARAAAGTEPLLS
FT                   VLPFRAKSFGVVTTGSEVYRGLIEDTFTPVIEEKLAEYGCVMAAHEICDDRDEEITKAI
FT                   RRMADEGIEMIFCTGGMSVDPDDRTPLAIRTPEPELSATELRFFREPCS"
FT   CDS             772124..772903
FT                   /transl_table=11
FT                   /locus_tag="CL3_08910"
FT                   /product="N-terminal domain of molybdenum-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35861"
FT                   /db_xref="GOA:D4MQ25"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ25"
FT                   /protein_id="CBL35861.1"
FT                   /translation="MIEWWKHNFGAGKIRMCPGKKQGRAGSRRNGEQEKQKMERRFKIQ
FT                   SNLRIVNCEKKEKAFGPGIAALLEGVETHGSLRKSAALMNMSYSKAWTVLHGCEAQLGF
FT                   ALLNSRIGGRCGGGAELTEEGKKLLENYRAFEKEAGRELGDLAKKYFPGYFSEDFPEEL
FT                   RGESGGRNCRGPREPGNGESQESLQGTASGGFKRPWILVRGAGDLATGIILRLWSCGFR
FT                   VAVTECRKPSAIRRRAALCEAVWEGDILCGGSPLPQG"
FT   CDS             774526..774678
FT                   /transl_table=11
FT                   /locus_tag="CL3_08940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35862"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ26"
FT                   /protein_id="CBL35862.1"
FT                   /translation="MNRRRINRHVNSYKYIIFKSSGFQQERQAPESAFPERTGQKWDGN
FT                   EAQTA"
FT   gap             775022..776256
FT                   /estimated_length=1235
FT   CDS             777897..778013
FT                   /transl_table=11
FT                   /locus_tag="CL3_08980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_08980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35863"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ27"
FT                   /protein_id="CBL35863.1"
FT                   /translation="MPAEALCLSEKGAGGRRDFCSAGSFSGRARLDFEAEGA"
FT   gap             778502..779645
FT                   /estimated_length=1144
FT   gap             781684..782550
FT                   /estimated_length=867
FT   CDS             782644..783846
FT                   /transl_table=11
FT                   /locus_tag="CL3_09040"
FT                   /product="carboxynorspermidine dehydrogenase"
FT                   /EC_number="1.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35864"
FT                   /db_xref="GOA:D4MQ28"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ28"
FT                   /protein_id="CBL35864.1"
FT                   /translation="MGKALIIGCGGVASVAIHKCCQNSEVFEEICIASRTKSKCDALKE
FT                   KLEGTTSTKITTAQVDANDVDALVALINEVKPDVVLNLALPYQDLTIMEACLATRTHYV
FT                   DTANYEPEDTAKFEYSWQWAYRERFEKAGITALLGSGFDPGVTSVFSAYALKHEFDEIN
FT                   YIDILDCNGGDHGYPFATNFNPEINIREVSAKGSYWEDGHWVETEPMEIKRVYNFDGVG
FT                   EKDMYLLHHEEIESLALNIPGIKRIRFFMTFGQSYLTHLKCLENVGMTSIEPIMYEGKE
FT                   IIPLQFLKAVLPDPSSLGPRTKGKTNIGCIFRGKKDGKEKNYYLYNICDHQECYKEVGS
FT                   QAVAYTTGVPAMIGAMMVMTGKWQKPGVWNMEQFDPDPFMEALNKWGLPWKESHDPVLV
FT                   D"
FT   gap             784051..785275
FT                   /estimated_length=1225
FT   CDS             complement(787085..788107)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09080"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35865"
FT                   /db_xref="GOA:D4MQ29"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ29"
FT                   /protein_id="CBL35865.1"
FT                   /translation="MKQLTIKDIAAQANVSTTTISRFLNGKYDSMSLETKTRIEQIIKE
FT                   SGYRPNNIARSLKSKYSRLIGVIISDISNPFFSTLLDTINQRALKAGYSLLISISNNSA
FT                   SSELKLLRKHLDNSVDGLLINTVGGNNEVISQISQSLPVVLLDRDIEGLGLPVVTSNNR
FT                   QLMEDILLHLKEEQFDQVVLLTEALDTSSIRKLRADAFQEICARLDFEGKVFEIEPKNR
FT                   KQIEKLTAALVSKDRITAFIAANTLVLQALLEQISKKGWQIGSDLGIVSFDDFPWSSFI
FT                   GISSVQQDSVKIGSEAFKILLNAINTDNASGKKGSECEKIVPGRFHIRQSSINKKRLEP
FT                   "
FT   CDS             788557..789723
FT                   /transl_table=11
FT                   /locus_tag="CL3_09090"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35866"
FT                   /db_xref="GOA:D4MQ30"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ30"
FT                   /protein_id="CBL35866.1"
FT                   /translation="MKKLSGLTKLPQSGIRRMFDLAKDKQGVVSFCLGEPDFATPDYIV
FT                   EAGKNSLLAGNTHYTDNAGLLETRKVIAAYLQEFDGITYDPVSEICMRTGAMEGLYLTM
FT                   VTLFNQGDEVIVADPCYPNYLGQIAMTGAVPVPVPVYEEDGFVFRRKELEKAVTPKTKA
FT                   ILLNSPTNPTGGVTKGEDLQAVADIAVKYDLYVILDAVYKQLIYDDDSYENIASLEGMR
FT                   ERTLYIDSFSKSHAMTGWRIGYICGPKEVISQMPKLQENVVSCISAFIQDAAAEALRDK
FT                   KRSDECVKAMRDEYRRRRDVFVDGLNSIDKISVVKPKGAFYLFVNIKETGLTSEEFCIR
FT                   LLEEQNVLTSPGSAFGTMGEGYIRISYATSMDTIKEGLKRIRAFVAAL"
FT   gap             790160..790440
FT                   /estimated_length=281
FT   gap             791274..792563
FT                   /estimated_length=1290
FT   gap             793519..793856
FT                   /estimated_length=338
FT   gap             794809..796389
FT                   /estimated_length=1581
FT   CDS             796504..796923
FT                   /transl_table=11
FT                   /locus_tag="CL3_09160"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35867"
FT                   /db_xref="GOA:D4MQ31"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ31"
FT                   /protein_id="CBL35867.1"
FT                   /translation="MDYIQMTDFGTLLEESDAISVHCPADGNRNLFAEAQFRRMKKEAV
FT                   IINVSRGGIINERALDQALSEERIAGAGLDCLEKEPMEAGNPLLRHENLIVTPHMAWYS
FT                   EEAAKELKRKVAEEAVRFVKGEAVRYPVNQAGRKK"
FT   CDS             complement(796978..797121)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35868"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ32"
FT                   /protein_id="CBL35868.1"
FT                   /translation="MNCRKRLENIKGFRVWPMKPKWLFVCLTESDLLYGADRPAHTEDR
FT                   FC"
FT   CDS             797315..797521
FT                   /transl_table=11
FT                   /locus_tag="CL3_09180"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35869"
FT                   /db_xref="GOA:D4MQ33"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ33"
FT                   /protein_id="CBL35869.1"
FT                   /translation="MKEGIHPAYYQAKVVCNCGNEFVTGSTKKDIHVEVCSKCHSFYTG
FT                   QQKAASARGRIDKFNRKYGINAN"
FT   gap             797763..798265
FT                   /estimated_length=503
FT   CDS             799245..800261
FT                   /transl_table=11
FT                   /locus_tag="CL3_09210"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35870"
FT                   /db_xref="GOA:D4MQ34"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ34"
FT                   /protein_id="CBL35870.1"
FT                   /translation="MSKEEKKEPVKGQDSLQNPTWQEVLDEGVRVLSQAGIEEAQLDAW
FT                   YLFSESFPIDRVHFLIDRNRPMHREIFEKGWPLFAERIEKRASRIPLQHILGSQEFMGL
FT                   SFRVNEHVLIPRQDTETLVEEVLRDCPDRNADILDMCTGSGCIGLSLAVLGRYRSVTAA
FT                   DVSEDALRVAAGNAKRLFLIQKDVVRAESKNFPGLPLRTELTVWAGKNRENAETRQFRL
FT                   VRSDLFSEFAAERYDVIVSNPPYIPSGEVEKLEPEVREHEPRLALDGSADGLHFYRILA
FT                   EECRKHLKEGGRVYFEIGCEQASAVTELLAQQGYTKIQVVKDAPGLDRVVKAVWTQH"
FT   CDS             800419..801495
FT                   /transl_table=11
FT                   /locus_tag="CL3_09220"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35871"
FT                   /db_xref="GOA:D4MQ35"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ35"
FT                   /protein_id="CBL35871.1"
FT                   /translation="MFDRLDDLLIRYEELMEELNNPYVVEDQKKFRKLMKEQADLAPIV
FT                   EAYKNYKQAHQDVEDSVALLEEESDEEMRELAKEELADAKKRIEELEQELKILLLPKDP
FT                   NDEKNVMVEIRAGAGGDEAALFASELYRMYVRYAERKRWKTEIVSLNENGIGGFKEVVF
FT                   MVTGQGAYSKLKYESGVHRVQRVPETESGGRIHTSTATVAVMPEAEEFDIEIDMNDCRI
FT                   DVMRASGNGGQCVNTTDSAVRLTHMPTGIVIYSQTEKSQLQNKEKAFRLLRSKLYDLEL
FT                   ERRQSEESEARRSQIGTGDRSEKIRTYNFPQGRVTEHRIKLTLYKIDSVMDGELDELID
FT                   SLIAADQAAKLAKLNEEV"
FT   CDS             802526..802957
FT                   /transl_table=11
FT                   /locus_tag="CL3_09240"
FT                   /product="conserved hypothetical nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35872"
FT                   /db_xref="GOA:D4MQ36"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ36"
FT                   /protein_id="CBL35872.1"
FT                   /translation="MKIIETYSPEETFEAGRRMGEKAKAGEVYCLNGDLGVGKTVFTQG
FT                   FARGLGIQGTVNSPTFTIVQQYDEGRLPLYHFDVYRIGDISEMDEIGYEDCFYGEGVCL
FT                   IEWSTLIEEILPEHATEIRIEKDLNQGFDYRRISVEERK"
FT   gap             803383..803492
FT                   /estimated_length=110
FT   CDS             803931..804425
FT                   /transl_table=11
FT                   /locus_tag="CL3_09270"
FT                   /product="[SSU ribosomal protein S18P]-alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35873"
FT                   /db_xref="GOA:D4MQ37"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ37"
FT                   /protein_id="CBL35873.1"
FT                   /translation="MEAGGQTKLLVRPMTERDLPETASLERLSFSVPWSETLLSECLDS
FT                   RLDLVWVLEEERGSELQKGEGRKKIAGYCNLRIIAGEAELMRIAVHPDLRGRGYARILM
FT                   DTLVRSARKQGASVITLEVRNSNQAARNLYKSYGFVEEAVRKSYYTEPVEDAVIMGLRL
FT                   S"
FT   gap             806046..806577
FT                   /estimated_length=532
FT   CDS             806986..807759
FT                   /transl_table=11
FT                   /locus_tag="CL3_09340"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35874"
FT                   /db_xref="GOA:D4MQ38"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ38"
FT                   /protein_id="CBL35874.1"
FT                   /translation="MKEKEISSGKKEREGRRGLISAIVLAAGSGKRMGTKVQKQFLDLG
FT                   GYPVLYYSLRAFEESPVDEVILVTGERQIDFCRREIVEKYGFQKVKEVTAGGAERYHSV
FT                   FRGLNCLSDEASLVLIHDGARPFVDRGIIERTIADAEKYGACVAGMPSKDTVKIADEGG
FT                   FAATTPDRSLVWTVQTPQAFRRELICRAYKAMMESEALQQGITDDAMVVERMTGEPIRL
FT                   TEGSYENIKVTTPEDMAVAEAILKRNQDRNGEKTL"
FT   CDS             807821..807967
FT                   /transl_table=11
FT                   /locus_tag="CL3_09350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35875"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ39"
FT                   /protein_id="CBL35875.1"
FT                   /translation="MAAMMIEYLSLPLRATAESLENTEKSEGLRRESFMEMKFLKKKKL
FT                   QKR"
FT   tRNA            808019..808104
FT                   /locus_tag="CL3_T_35340"
FT   tRNA            808142..808230
FT                   /locus_tag="CL3_T_35350"
FT   gap             809507..810814
FT                   /estimated_length=1308
FT   gap             812469..813180
FT                   /estimated_length=712
FT   CDS             complement(814899..815867)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09410"
FT                   /product="Predicted Zn-dependent peptidases,
FT                   insulinase-like"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35876"
FT                   /db_xref="GOA:D4MQ40"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ40"
FT                   /protein_id="CBL35876.1"
FT                   /translation="MRVLTEFYTYSNCLIVLYGDMDYGRVLSFLDREHLSLHPAPLNGG
FT                   SLISLLREPPIPGFRCSIEESPAYSGSRGSQASVIDYALDLSDCDEEELICFDLFSDLL
FT                   DHSASPLHQTAKREGLNHVIQAFLDTLLIHPVFKFRLYNGDEGDRDRLLRAVRMTLEEI
FT                   CEKGISPELYRACVKEHSLTDRLVREGVHLGCHAAEEIGRYWSLTGKTDYFALYERACA
FT                   RFAEEANKDRQSQTLIRNLAQRLLKPFAGALTVTVPVPGLAEQLESQRSSFLERKKDVH
FT                   DRRGNLLPCGCHPLPSRLEQQRVWLPQFSHKSQGSSRPFGT"
FT   CDS             complement(815867..816523)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35877"
FT                   /db_xref="GOA:D4MQ41"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ41"
FT                   /protein_id="CBL35877.1"
FT                   /translation="MEISMTKLPEPGQLCCGFTAVSQGRIESLSASTAEFFHPLSGAQV
FT                   LCIQNDDRELGFSLIYRTPQLDETDACHMAEHLVLSSCKKYRSRDVFFDMDSMSYSTFM
FT                   NGITDTSYTCYPICSRSEEQLLKLMDVGSLLYGGSRTPRQSLTFSSGRPSAMRWKRRTA
FT                   PSFWPEPSSARTGPTLPIWMRMQTAIRQEPCTLAVSRPTFPDAPISTMKMSPENR"
FT   CDS             817016..817195
FT                   /transl_table=11
FT                   /locus_tag="CL3_09430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35878"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ42"
FT                   /protein_id="CBL35878.1"
FT                   /translation="MNREKIEENGKMREKYSSFQKICAMATKGHSHKNTPDPILAQIAL
FT                   LVQSQGLIFTRLPI"
FT   CDS             817288..817470
FT                   /transl_table=11
FT                   /locus_tag="CL3_09440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35879"
FT                   /db_xref="GOA:D4MQ43"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ43"
FT                   /protein_id="CBL35879.1"
FT                   /translation="MTQYQLYMKSGVPKSTIGNIINCSYDSVKLRIIHEMCQGLGIGIG
FT                   TFFASPLFQEDNLEP"
FT   CDS             complement(817506..817817)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35880"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ44"
FT                   /protein_id="CBL35880.1"
FT                   /translation="MNIVIGLLKLILKIVAAPVVVVLTVAIWMCVGIVYVCGLVLGLLS
FT                   TVVALLGVAVMITYSLQNGIILLVMSFLISPYGLPMAAIWLLGKAQDLKFTIRDLVYR"
FT   CDS             817845..818426
FT                   /transl_table=11
FT                   /locus_tag="CL3_09460"
FT                   /product="Major Facilitator Superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35881"
FT                   /db_xref="GOA:D4MQ45"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ45"
FT                   /protein_id="CBL35881.1"
FT                   /translation="MGSSVLMPLYVQSVMGYSAVISGLVTLPGSLATTLVSPFAGRIYD
FT                   KMGIKRLFVIGSAIMLFSNIGMYFLTMSTPLWTAAVLNVIRNVSIGSLMMPLLTWGTSS
FT                   IQIKKVADASSLLTSFRTIAGSIGSAVFVGIMTAVSEGSAAAYGEGALMHGMNIAFLCM
FT                   AAGSVILLLISVFGVRKENICNREGTETNG"
FT   gap             818597..819445
FT                   /estimated_length=849
FT   CDS             complement(819546..820556)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09470"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35882"
FT                   /db_xref="GOA:D4MQ46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ46"
FT                   /protein_id="CBL35882.1"
FT                   /translation="MGSFMGWNLFFQGMMYLVTLVYGGYLIAHGAMDAADLAMYALYIG
FT                   IFISPIQILVELTEMMQKGLSGFCRFLAVMDTEPEIKNLPGAVPLTDVKGDVEYRHVSF
FT                   SYLEEEPVLSDISFHIPAGRSVALVGPSGGGKTTICSLLPRFYDVTEGAVFIDGKDIRS
FT                   LTLESLRGQIGIVQQDVYLFCGTVRENIAYGKPGASEEEIIEAAKKANIHQFIESLPDG
FT                   YDTFVGERGTRLSGGQKQRISIARVFLKNPPILILDEATSALDNESERHIQKSLEELSK
FT                   NRTTITIAHRLSTIRNADEIIVINESGIAERGNHRELLEQDGIYSHYYSMQFEGL"
FT   CDS             complement(823766..825475)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09500"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35883"
FT                   /db_xref="GOA:D4MQ47"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ47"
FT                   /protein_id="CBL35883.1"
FT                   /translation="MKQKFIRTILCFFLTAAVSAHPAYASQEWPSDVSIEADAGIVMDA
FT                   DSGTVLYGKNIHDTYSPASITKVLTSIIVLENCDLDEMVTFSKNAVYNVEADSSSAGYD
FT                   TGDQATVRDCLYALLLKSANEAANALAEHVAGTTEAFAEMMNEKAKELGCVDSHFANPS
FT                   GLNDENHYVSAYDMALITRYAFENEIFEEIISTTYYELPPNARNPEGLGVSPGNKLIKK
FT                   NFPEYRPDVIGGKTGYTSIALNTLVTGARQDDTTLITVVLHSRGTTYSDTSRMLDFGFG
FT                   NFRSVSLENNDTTYSSLNSNLTIAGLPTSSAPSLTVDPDSRIILPNNAEFEETTSSVSF
FT                   DLPENAPDNAIAAVCYSLGEHQVGTAWLTLGAERSESPAIPEELLSAVPTTIAQVSYED
FT                   EAAAENSSEKDRNMEEAADSQSTSDSASEPDQNTLSSGEQSQNTPDENPTGGALSDGFS
FT                   VTPILIFTAAAAVIALLGTALAVWIGKSRRREEAERMERRRKRMERLKETGVSEEEFNE
FT                   MMKNRRLSIPLEPDKRSPRRKGSSKSSLLSQPKKKRTRDSEFTLKKRRRWKR"
FT   gap             825912..826131
FT                   /estimated_length=220
FT   CDS             826579..826821
FT                   /transl_table=11
FT                   /locus_tag="CL3_09530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35884"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ48"
FT                   /protein_id="CBL35884.1"
FT                   /translation="MLRGERTAAESPASQDSFLQYGAESDKASARGQSALKNGRLSCFK
FT                   YTTKAAGRKWDKGKFIKVLEFTGKDCEMEAGTAME"
FT   CDS             complement(826998..827813)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09540"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems, periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35885"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ49"
FT                   /protein_id="CBL35885.1"
FT                   /translation="MWGTDHIATMLVPVTNGVEMTFVAGAHMGCKSIYVFNDSDIQTAE
FT                   DLKGKTIAIHDGIGNSDQNIIYRMLDGEGVDPTTEVEYLDIADSAASVAAMESGEIDAS
FT                   IFSDYFVIANYSDKMRKVCSITPDEQFEGEVCCVTAMNNDFMEKNPVHAKYIVKAIKRA
FT                   GQYARLHSEDAVQLMFDTDKMTGEFEDQLEFWDSLDFGLSDAITEEALKNIAADYIRLG
FT                   VIQKEGLTADDVMEMAWSGICPDEEVEGLTVGDPKEVEGRTVEVQHKGE"
FT   CDS             complement(827973..828212)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35886"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ50"
FT                   /protein_id="CBL35886.1"
FT                   /translation="MKKSNAKRVLTAALAGMMALSLAACGEQGGGNPAESQKSAAETTA
FT                   PAQSQAAGGEESGADSTANRPEAVSEEDWAAMQK"
FT   CDS             complement(828366..829142)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09560"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35887"
FT                   /db_xref="GOA:D4MQ51"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ51"
FT                   /protein_id="CBL35887.1"
FT                   /translation="MAEHTVILRLDNVSKSFAKVEQDEVTHALNEVNLSMESGEFISLV
FT                   GPSGCGKSTILRLVAGLIPPTTGHLTVNGREIDGPSPERGMVFQKPTLFPWLTVEKNIS
FT                   FSLKLQGKLKGNEEKVERMLKIIGLESFRNDYPGQLSGGMAQRVTLVRSLINEPDILLL
FT                   DEPLGALDAFTRMNMQDEILRMWQEKKQLAIMVTHDVDEAIYMGTRVIVMDAHPGRIVS
FT                   DIQISQAYPRDRSSDSFVSCRNEILNCLHFGRTGAK"
FT   CDS             complement(829142..829570)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09570"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35888"
FT                   /db_xref="GOA:D4MQ52"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ52"
FT                   /protein_id="CBL35888.1"
FT                   /translation="MVVATSLFRGAVFIIALGSWFAVTVASMSGIQNVDKDYFDAARTL
FT                   GASERQLVFQVAIPHAMPSILQGCTQAMSSSCVAIMIAEMMGVKAGLGWYMNWAKSWAA
FT                   YDKMFAALFVICFIFTVVTKVLDLIKRRALRWQNGVVK"
FT   CDS             complement(829615..830217)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35889"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ53"
FT                   /protein_id="CBL35889.1"
FT                   /translation="MSTKKDDTPVSESRLEDSLGHLTRQQLKELEEKEKTRSQKILDFI
FT                   VMILPVICGFIAIIEYWEVPNGSPNSQPYTYVGVVAAFMAVYVLCALAAAVKYRRGDRR
FT                   TAESLRYRAPLCSAFFLLLTGYDYLTLKTGILSQPFVPCMNSILNIAWEDRAYLLECTL
FT                   HTLRLLFLGILSELSWGLSQELPAAIRRRRDTGSLLS"
FT   gap             831238..831570
FT                   /estimated_length=333
FT   CDS             831810..832112
FT                   /transl_table=11
FT                   /locus_tag="CL3_09600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35890"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ54"
FT                   /protein_id="CBL35890.1"
FT                   /translation="MKKTVLFAAAALTAFALTACGSTETTTETTAAVETTAAAEETTAA
FT                   VEEETTEAAEEETTEAAEEETTEAAEEETTEAAADEETEAAADEAEETTEAETEA"
FT   CDS             complement(832293..833213)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09620"
FT                   /product="Bacterial SH3 domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35891"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ55"
FT                   /protein_id="CBL35891.1"
FT                   /translation="MNTDNINTGSWERIQNGFQDTERLLGQKRYNECMIRARQTLEFMV
FT                   KCLCERFDVSEATLVDMIDALYENGIINKTTCEHYHKIRMIGNKAVHEEDNLAYNAGQA
FT                   YHLLSQEIYTFANDFTGKKKKPLPRQREDISREDASSREQLSRPSRGSASRSRGAVSRA
FT                   GGSSSARRRRPRSSGPVIDPGSLLKIFIPIAIIIILIFIIRLVHPGDENGAETTAPIEL
FT                   ETIAPTEKATTEENTTEAAPAKRYRTSDTLNVRSEPSTSASKLGQLAPGTEVEYIEDYD
FT                   DTWVKITFEGQEGYVSKEYLELIAE"
FT   gap             833720..835183
FT                   /estimated_length=1464
FT   CDS             complement(835357..835710)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35892"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ56"
FT                   /protein_id="CBL35892.1"
FT                   /translation="MLHVQVQKKKRGFAGYLLSFLIFFAVLFFSLFCMNAMQRRSEEES
FT                   LMSLRDAIRRASVQCYAIEGRYPPSVEYLEEHYGIVIDRDRYHVFYDGWASNVMPDITV
FT                   LPVAEEEKGDETW"
FT   CDS             complement(835845..836891)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09670"
FT                   /product="Type II secretory pathway, component PulF"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35893"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ57"
FT                   /protein_id="CBL35893.1"
FT                   /translation="MKQSVPFTGLSLSGFCMQISILLKSAVPLYEGLSVMAEDASSPRE
FT                   KEILTAMSDKLRMGFPFSEAVSEAGCFPAYVTQMTVLGERTGTLDETMEHLSRFYEREY
FT                   RLGENLRRAVTYPAIMIVMLLVILFILFTRVMPIFSGVYEQLGTSIPDAAQAAIQFGGI
FT                   LSGAALVFAAVLIAAFAVVRLTSRPGQESSLSHRLLRSIKNHSSIAKLSALRRFCSVMA
FT                   MTLHCGMNMAEGCRMAATLVDNDSVLPGVRACERELESGKAFYDSIEPSGLFSGFDLQM
FT                   IRIGSRAGQLETVMRELEEDYDERSSDALDSLIARLEPAIVSVLAVAVGLVLLSVMLPL
FT                   AGILSSIG"
FT   CDS             complement(836925..837833)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09680"
FT                   /product="Transglutaminase-like enzymes, putative cysteine
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35894"
FT                   /db_xref="GOA:D4MQ58"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ58"
FT                   /protein_id="CBL35894.1"
FT                   /translation="MFRKTLRRSLQKGLKKTRNAVILGLSAAALICTPVFAQVRTPESS
FT                   GSVTYSNGNAVIDASNASQGYVMVKYTGGTSRIKVRITKGTDYTYDLNASGNYEVFPLT
FT                   EGSGTYTVKVFQQVQGTSYAQVMSQTINVNLADELSPFLYPNQFCNFRADSAVVSTAAS
FT                   ITAGVSDPLSKVQAIYNYAVDNISYDYQKAATVQSGYLPVPDSTLASKTGICFDYAAVM
FT                   TSMLRSQDIPTKLVIGYTGGAYHAWVSVYVTGQGWVDNIIYFDGVNWRYMDPTFASSGK
FT                   GNAAITSYITNPANYQAKFTY"
FT   CDS             837948..838043
FT                   /transl_table=11
FT                   /locus_tag="CL3_09690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35895"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ59"
FT                   /protein_id="CBL35895.1"
FT                   /translation="MKRKAAEAVRKQAVAICLKEGCLICEFICMN"
FT   CDS             838222..839619
FT                   /transl_table=11
FT                   /locus_tag="CL3_09700"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35896"
FT                   /db_xref="GOA:D4MQ60"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ60"
FT                   /protein_id="CBL35896.1"
FT                   /translation="MSQAVKAKKKTCSMLTDHPGKALLLFAFPMILGNLFQQFYNIMDS
FT                   VVVGQFVSENALASVGASYAITNVFIAVAIGGGTGSSVIISQFLGAGQITKMKTAVSTT
FT                   LLNFLVISVFLGVFGLAYSDRILALMNVPGNIFEDAALYLSIYFLGLPFLFMYNVQASV
FT                   FNSLGDSRTPLWLLIFSSLLNIVLDLLFVIQFGMAVRGVAVATLIAQGLSAVLSFCLLM
FT                   RKLRGYEHRREEFRFYDRGMMLSMVKVAIPSILQQSIVQMGILLVQSVVNTFGSSAIAG
FT                   YSAGTRIESISIVPMLAIGNAMSTFTAQNIGAGNEKRVREGYRTCYFALAAFAAALCVL
FT                   TQSFGSLFISAFLDAEVSEEAFSVAMSYADFISFFYILIGLKATTDGLLRGAGDVTVFT
FT                   VSNLANLTIRVFVASFFAPRYGLEFVWYAVPLGWATNYAISFGWYLTGHWKRIRLIEGG
FT                   EKRPYRA"
FT   gap             839642..839808
FT                   /estimated_length=167
FT   CDS             complement(839816..842209)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09710"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35897"
FT                   /db_xref="GOA:D4MQ61"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ61"
FT                   /protein_id="CBL35897.1"
FT                   /translation="MMNRRLNLKNHKTIVCVIHLLFLALMFAGVGTMYLNDNLGVGITR
FT                   IHSSVYEDTDEFTQYFNDDLADIFQYMEYNEIFATGGSIDISKTMLEMTFGPNDTRSYS
FT                   LNDIIKYLQSLGYSLNGDFECIPVSVDENRKPAMGYVAWSASEPDIYYTSLKDGMRHCS
FT                   LEEISLEIINTLNRYYSTYKRLIESPSNLHFRIEYIDSESEPKRITSFSNDSTLTLEQA
FT                   KTYGRYACLQGNSVFYDTNFRFIDLDTVSALSAGNPYDTKTYYLLAALDTSYPVSDPYA
FT                   DNYNHYVRMQNYYFLGFALMVVGGLTAAASLLYLLSVSGKQEYGDSRITLSPFDQTSTE
FT                   TGLILLILLAGASLLAGRYTLVRIAHLTLPEESWDVGEKVIYTAIVYLVCLIGLFSLLR
FT                   RCKAGILWKNSLIRKLGDRLSVFFTGQTFAGQLSAAFIAYQIANTVLLVTASYLYLKWH
FT                   ILTLTLKIIIGMLLFLWLCVNLWIFYLMFRRAADRDRLDLAIRHLAGGETTYQVDISQF
FT                   SGKIRETAENLNNVSQGLEAALSEKVKSERLKADLITNVSHDIKTPLTSIINYVDLIKR
FT                   ENIQDEKIQRYLEVLEQKSHRLKNLTEDLVEASKASSGNLKLDISRLDFIELIYQTNGE
FT                   FEEKFISRRLDLITSAPERSVFIEADGRRLWRVLENLYNNAFKYALEGSRIYADVSVEN
FT                   SMAVFTIKNISASPLNIKAEELTERFVRGDVARTTEGSGLGLSIARSLTQLQGGSFEIY
FT                   IDGDLFKVRVAFPVAEVPPKVLPKTAEAKTEDDEGRAESEGQTP"
FT   gap             842567..843611
FT                   /estimated_length=1045
FT   CDS             843871..844104
FT                   /transl_table=11
FT                   /locus_tag="CL3_09740"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35898"
FT                   /db_xref="GOA:D4MQ62"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ62"
FT                   /protein_id="CBL35898.1"
FT                   /translation="MLEKMKEIIAEQLSVDADSITEASSFKDDLGADSLDLFELVMALE
FT                   DEYSVEIPAEDLQNLLTVGDVMNYLKEKGVEA"
FT   CDS             844104..845027
FT                   /transl_table=11
FT                   /locus_tag="CL3_09750"
FT                   /product="putative enoyl-(acyl-carrier-protein) reductase
FT                   II"
FT                   /EC_number="1.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35899"
FT                   /db_xref="GOA:D4MQ63"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017569"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ63"
FT                   /protein_id="CBL35899.1"
FT                   /translation="MKTRVTELLGIECPIIQGGMAWVAEHHLAAAVSEAGGLGLIGGAN
FT                   APGEVVRDEIRKARELTKKPFGVNVMLMSPHADDVAKVVVEEGVKVVTTGAGNPGKYME
FT                   MWKNAGIKVIPVVASVALARMMEKGGADAVIAEGTESGGHIGEATTMTLVPQVVDAVSI
FT                   PVIAAGGIGDGRGIAAAFMLGAEAVQMGTRFVVAKESIVHPNYKEKIIKAKDIDSTVTG
FT                   RTHGHPVRCLRNQMTREYIKMEQEGKSFEELEYLTLGTLRKAVMDGDTSNGTVMAGQIA
FT                   GMVKKEQTCKEMMDEMMAEAGKLLHW"
FT   gap             845369..845583
FT                   /estimated_length=215
FT   CDS             846398..847141
FT                   /transl_table=11
FT                   /locus_tag="CL3_09780"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35900"
FT                   /db_xref="GOA:D4MQ64"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ64"
FT                   /protein_id="CBL35900.1"
FT                   /translation="MLLEGKIALVTGASRGIGRQIALTLAKEGAVVIVNYNGSAAKAEE
FT                   VVKEITEAGGTAEAVQCSVSDYAKTEEMMKDLIARYKRIDILVNNAGITKDNLLMKMSE
FT                   EEYDAVLDTNLKGTFNCIKHVSRQMLKQKGGRIINISSVSGVMGNAGQANYCASKAGVI
FT                   GLTKSVARELGSRGITVNAIAPGFIDTEMTAVLPEDVKKSMGEQIPMKKFGKTEDVANL
FT                   AAFLASDLAGYITGQIIGVDGGMAM"
FT   CDS             847193..848431
FT                   /transl_table=11
FT                   /locus_tag="CL3_09790"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase 2"
FT                   /EC_number="2.3.1.179"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35901"
FT                   /db_xref="GOA:D4MQ65"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ65"
FT                   /protein_id="CBL35901.1"
FT                   /translation="MANRVVITGMGAITPVGNDVETFWNSLKEKKTGFGEITYFDTADF
FT                   KVKLAAQVKDFDPKNYMDAKTARRMEPFSQFAVAAASQALAQSGLDMEKEDPFRVGVSI
FT                   GSGIGSLQSVEREYKKLLEKGPNRVNPLLVPMMICNMAAGNVSIQYGLKGKCINVVTAC
FT                   ATGTHSIGEAFRSIQCGEAEVMLAGGTESSITPIGVAGFTALTALSTNPDPATCSRPFD
FT                   KDRDGFVMGEGAGVVVLESLEHALNRGATILAEIVGYGATSDAYHITSPAEDGSGAAKA
FT                   MEYAIRDAGITPEQIDYVNAHGTSTHHNDLFETKAIKLALGDHAYKVKINSTKSMVGHL
FT                   LGAAGGVEFITCVKSVMEDYVHATAGLAESEPECDLDYTKGEGVHTTVNYAISNSLGFG
FT                   GHNASLVVKKYEA"
FT   CDS             848450..848965
FT                   /transl_table=11
FT                   /locus_tag="CL3_09800"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35902"
FT                   /db_xref="GOA:D4MQ66"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ66"
FT                   /protein_id="CBL35902.1"
FT                   /translation="MDIKDIVTLIEAVSKNNLTSLVIEENGTKLSLKREKEREIVTAVP
FT                   PVAAPAVSAMGLAPGLAGAGVTGIPVTPEASLAGSVSAQAAETKEDIPSGNVVKSPLVG
FT                   TFYSAPAPDADSFVKVGDTVKKGQVLGIIEAMKLMNEIESEYDGVVEAILVNNEEVVEY
FT                   GQPLFRIK"
FT   CDS             849025..849447
FT                   /transl_table=11
FT                   /locus_tag="CL3_09810"
FT                   /product="beta-hydroxyacyl-[acyl carrier protein]
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35903"
FT                   /db_xref="GOA:D4MQ67"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ67"
FT                   /protein_id="CBL35903.1"
FT                   /translation="MLGIKEIQEIIPHRHPFLLIDCIEEIRPGEGATDYKSVTYNEPFF
FT                   AGHFPQEPVMPGVLIVEALAQVGAVAILSEEENRGKVAYFGGINSAKFRKKVVPGDRLK
FT                   LECQIIKRKGPVGIGSATASVDGKVAVSAELTFMIG"
FT   gap             849880..849921
FT                   /estimated_length=42
FT   gap             850732..851554
FT                   /estimated_length=823
FT   gap             853092..853535
FT                   /estimated_length=444
FT   CDS             complement(855995..856351)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09880"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="1.20.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35904"
FT                   /db_xref="GOA:D4MQ68"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ68"
FT                   /protein_id="CBL35904.1"
FT                   /translation="MSVLFIEYPKCTTCQKAKKWLDDAGVSYEDRHIKENNPTAEELRK
FT                   WHKISGLPLKKFFNTSGLLYKSMALKDKLPSMSEDEQYELLATDGMLVKRPLIISEDFV
FT                   LVGFKEAEWEARLK"
FT   CDS             complement(856369..857850)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09890"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35905"
FT                   /db_xref="GOA:D4MQ69"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ69"
FT                   /protein_id="CBL35905.1"
FT                   /translation="MLMMIKRILKISGAYSGKIKLGIFFNLMKTVSMSLILIAVYVVAE
FT                   NLNHLTMNTVWSALGIVIVSILLRILFQWLMDITMSARGFDMFRDYRLTIGDRMRAAPM
FT                   GYFSEQKLGSIQTVLTSTVTELEQYSMMAIMDLTGGVLMALAVTAFFLIVQPLFALITL
FT                   VGLGLGMLILHIIQWEAVKHTPNVLAAQENMTIQALEYIRGISVLRAFSQADGSEGAVY
FT                   AAFDRKRQADLDQEYASLPLLKIYSAVYKLTGCVMMFAAAALYVAGSISLSYCLLFIIS
FT                   SFIVYSEMEQMGDGAFMARKITTELNRLEAVTDMPRMDTSNRKLEPECFDIELRDISFG
FT                   YDSRTVIEHVSLTVPEGTSCAIVGPSGSGKTTLCNLIARFWDVQEGKILLGGQDVKEFT
FT                   ADSLMSYISMVFQNVFLFHDTIENNIRFGNPSATEEEVIEAAKRAQCHEFISALPDGYQ
FT                   TMVGEGGSTLSGGEKQRISIARAILKNANKSIQKN"
FT   CDS             complement(857856..859031)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09900"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35906"
FT                   /db_xref="GOA:D4MQ70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ70"
FT                   /protein_id="CBL35906.1"
FT                   /translation="MVSSENNALVEYVNGIQVIKAFGQTGVSFGKYSNAVKFFHDSTLA
FT                   WWRQCWFWMAAVKAIIPSTMVGSLPVGTWLYMNGEISLPILIACIVIPFGFMAPLMKLA
FT                   FGSEQLTVIAANLRPIREFLAIPEQVRPTQPVLLKSSGFSFENVSFSYNHSREVLHNVS
FT                   FSAEPGKMTAIVGPSGSGKSTIAKLMAGFWDAGKGIVRYGGVDLKQIPFDQLMGEISYV
FT                   AQDNFLFDRSIRENIRMGRPEATDHEVEEAAKAANCHEFIMQLPNGYDTPAGEAGDRLS
FT                   GGERQRITIARAMLKPSRTVILDEATAYADPQSEAQIQEAVGRLVQGKTLIVVAHRLST
FT                   IQNADQILVVDEGHIAASGTQKELLDSCPLYRRMWENHLGAQSQGRNRKEE"
FT   CDS             complement(858992..859144)
FT                   /transl_table=11
FT                   /locus_tag="CL3_09910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35907"
FT                   /db_xref="GOA:D4MQ71"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ71"
FT                   /protein_id="CBL35907.1"
FT                   /translation="MNTPTTETERLILRKFTEDDLEALYQIYCDEEVNAFLPWFPLKTM
FT                   PWWNM"
FT   CDS             859911..860729
FT                   /transl_table=11
FT                   /locus_tag="CL3_09930"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35908"
FT                   /db_xref="GOA:D4MQ72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ72"
FT                   /protein_id="CBL35908.1"
FT                   /translation="MSKEILICSGLGKRFGTRYALRDVELRVESGKIIGLLGPNGSGKT
FT                   TLMKLANGLLKPEEGWIEIDGSRPGLHTKSVVSYLPDQMYFADWMRVSDLLAMFSDFYR
FT                   DFDRGKAGSMLRALDISEKERMKTLSKGSKEKVQLVLVMSRQAKLYLLDEPIGGVDPAA
FT                   RDYILKTILTNYSEDASVMISTHLIADVEKVLDEAIFLKEGRLVRHSSVDDIREKEGKS
FT                   VDRLFREIFAVRGPQMGRNPLFEPAVKPGLHDQEEEKTEKTVHEDQKEES"
FT   CDS             861002..861355
FT                   /transl_table=11
FT                   /locus_tag="CL3_09940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_09940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35909"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ73"
FT                   /protein_id="CBL35909.1"
FT                   /translation="MFTLPVKTWQLVFSKACVSLAATFCSLTVGILSLGMFGGIDFFGA
FT                   LFQIPGLIVEFIQEGMAADRTLFLHCMVFGVELLLALAVGTLSSIYELYFPWLLDRCRE
FT                   ITRLYGLSCGSWQ"
FT   gap             862764..864300
FT                   /estimated_length=1537
FT   gap             866221..867974
FT                   /estimated_length=1754
FT   CDS             complement(868007..868894)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10000"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35910"
FT                   /db_xref="GOA:D4MQ74"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ74"
FT                   /protein_id="CBL35910.1"
FT                   /translation="MWGICGYFSISSSQQAVRESGLQYTHIVFLFSFGLFAEANATKLL
FT                   QAKGNTVLPMLAQIAGAVLNILLDPILIYGLFGLPAMGIRGAAVATVLGQWLAMFIVIL
FT                   PVFRRFPVFSGRVLPADCIRIYRAGLPAIAMQSLNTLYIVGLNLVLKQFSESAVLVLGI
FT                   YYKLQTFFFIPLMGLQQVILPLISFYHGAEQPQRERQVLGCSIKLSLAVMLTALGAFMI
FT                   RPRRPSFHLHSRTGCPLHRLHRASDHLPQFPVRRPGNDVYRIFSERRARENQPAGDCAS
FT                   PGRSPGPPGLAVPL"
FT   gap             870465..871497
FT                   /estimated_length=1033
FT   CDS             complement(871532..871960)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35911"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ75"
FT                   /protein_id="CBL35911.1"
FT                   /translation="MDTAERMKRWRLILGAESEGQFQTMEGYGGARLSEEQLMMDQALA
FT                   AIYNSAAYGGFQAQGGAGQGGGKGPSNPQITRWLGDVRTLFDRELVKIVQGDAMERCGL
FT                   KQLLFEPEILENLEPDMSLASTLLLLKDQTTQNARRTV"
FT   CDS             complement(872104..872496)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35912"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ76"
FT                   /protein_id="CBL35912.1"
FT                   /translation="MIFLDGERLDRVLQEIAGRDDLNTKLSGFAAAILLEKGKMMEEEL
FT                   LREVSRRLSPGIPAELGAGWFEGLSMKNHYALIARLSLWESLSGYLDELDDREFKRALV
FT                   FLRRAFADFTSEEKTGLRKIWEKSGR"
FT   gap             873177..874550
FT                   /estimated_length=1374
FT   CDS             complement(874642..875730)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10080"
FT                   /product="MoxR-like ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35913"
FT                   /db_xref="GOA:D4MQ77"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ77"
FT                   /protein_id="CBL35913.1"
FT                   /translation="MGKENIQRLPAEELFQKEIDALIDAERESVPSGWRMSPRSVLTYI
FT                   CGGKAKGVEITPKYIGHRRLVEIAIATLVTDRALLLIGDPGTAKSWLSEHLTAAINGDS
FT                   TKVIQGTAGTTEEQIRYSWNYAMLIAGGPSREALIPSPVYRAMETGTIARMEEISRCAC
FT                   EVQDALISILSEKRISVPELGIEIPAKKGFSIIATANTRDKGVNDMSSALKRRFNTVVL
FT                   PAPESLDAEMDIVRTRVTQLSENLDLNAAVPDSEVVEKVCTIFRELRMGMTLDGRQKLK
FT                   STSGVLSTAEAISLLGGSMALAGSFGDGTVTDCDLAAGLQGAIVKDEDRDSKAWVEYLE
FT                   NVMKKRGSRWLGLYRECRELNS"
FT   CDS             complement(875785..877929)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35914"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ78"
FT                   /protein_id="CBL35914.1"
FT                   /translation="MNLSALYELKEQLEAAAVYGTGLMTEDFRLKKAAAQMGPLAQAAP
FT                   VFKKIEQAAQAAIAPECQDRPGALMDALALVNAVVYTQGTVGAAGEFLPLEGGGCEQNR
FT                   VCAGEAGSLSDETGREDREEKSLSFLQNIPYSRMAPLVAALTGTGGGRYAVLESAVREE
FT                   PELLSDWRLLRLMIEALGDSYGEIGNLVYRRLLEMGSSIVPMLCQGFDSNGKRGMLLRL
FT                   RLIGELAGASENQLYRKAAMDGEKSIREEAIGLLRFDSENVPLLYDMLKTEKGGMRNRV
FT                   LWTLSFMELEEPEEYLAAMKKKKPSEAAGILCGACNVRSADLMADVLEQFRKSVITEME
FT                   KAGEEYRRTESLLASLGKNGTLEDGTTASQLRKKRDQLFKQMQWDRRQSGKDLNWPAWG
FT                   TDEEKIWRAAEGKCSDKLFEWLRRAYAETPGFFPPFFFYDSFCDSPTEEMASFIERMFR
FT                   EFGDSDRQDERRSGIEEAVFARALLTETAEAVYEKFSPCLAGGRASAILQVLCQIQYSE
FT                   EKKQYVFMKQSRGKDSGGRTEEPVCFENLDRRWYGWLLLPGNRTFVRKNVKVYTGQMPG
FT                   QGYALERASKASEWSCLEQALVQLYCPEAEGLSEAYRAHFESLIHMGLEIDSRLLRILR
FT                   RCGFRDYDFVVERVLRENQSQYLWRVKCLLEEIPLPASELSESLGRALEKDRKGTIAGR
FT                   DRIQIWREQLADGACMGELA"
FT   gap             878097..878626
FT                   /estimated_length=530
FT   CDS             878929..879384
FT                   /transl_table=11
FT                   /locus_tag="CL3_10110"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35915"
FT                   /db_xref="GOA:D4MQ79"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ79"
FT                   /protein_id="CBL35915.1"
FT                   /translation="MGIQRNTTYLKHISTIQRCTQRYFEAALTGFSIGYGQQFFLLRIS
FT                   EQEGISLQELAKRGNYDKTTVTKAVQKLTEEHLVCSVPDPRDRRIHHLYLTDTAKALIE
FT                   RLYEVRDRWKNQLTEGFSEQEKAQMEDFLSRMASRAWEMTEKGEYRL"
FT   CDS             879381..880799
FT                   /transl_table=11
FT                   /locus_tag="CL3_10120"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35916"
FT                   /db_xref="GOA:D4MQ80"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ80"
FT                   /protein_id="CBL35916.1"
FT                   /translation="MKHETKALQSGNPLEYKPIPQLLLAFSVPAIISCLINSIYNIVDQ
FT                   IFIGQGVGYLGNAATTIAFPVMTIILAFGTLIGAGSSANAAISLGERRNRRAEIILNNA
FT                   FALALVSGIILMAVGLLFLRPILSLFGATEASMPYAVDYTSIILLGTPFNLIGIVLSNL
FT                   ARTDGHPRLSMYGMMIGAGLNTILDPIYIFIFHWGVKGAAIATITSQIISAIILTAYFL
FT                   RANKNPQHMRLRLRSMRFAGPIVSRSLTLGVSSGITQSVACIMQVVLNNSLVHYGNLEA
FT                   AGGGDIALSAMGIVSKISMILASLAIGFGIGAQPILGFNRGAGKYDRIKTTYKICSIMA
FT                   SVCLITGWVLCQLFPEQIISLFGHESAAFTDFAVKCMRIYLFGIFCAGFQIVSTNYFQA
FT                   TGQPLKAAILSSLRQLVLLIPLILILPLFWGLDGILFAGPVADISSTIIVSLFVIPEMK
FT                   KLNQKISEMRTAAQ"
FT   CDS             complement(881074..882267)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10130"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /EC_number="3.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35917"
FT                   /db_xref="GOA:D4MQ81"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ81"
FT                   /protein_id="CBL35917.1"
FT                   /translation="MAKAKFERTKPHCNIGTIGHVDHGKTTLTAAITKTLHDRLGTGEA
FT                   VAFENIDKAPEERERGITISTAHVEYETNNRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVAATDGVMAQTREHILLSRQVGVPYIVVFMNKCDMVDDPELLELVEMEIRELLNEYE
FT                   FPGDDTPIIQGSALKALEDPSSEWGDKILELMDAVDSYVPDPVRDTDKPFLMPVEDVFS
FT                   ITGRGTVATGRVERGTLHVSDEVEIVGIHEETRKVVVTGIEMFRKLLDEAQAGDNIGAL
FT                   LRGVQRTEIQRGQCLCKPGSVKCHNKFTAQVYVLTKDEGGRHTPFFNNYRPQFYFRTTD
FT                   VTGVCELPAGTEMCMPGDNVEMTVELIHPVAMEQGLRFAIREGGRTVGSGRVVSILE"
FT   gap             885460..885648
FT                   /estimated_length=189
FT   CDS             885777..886718
FT                   /transl_table=11
FT                   /locus_tag="CL3_10170"
FT                   /product="Lactate dehydrogenase and related dehydrogenases"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35918"
FT                   /db_xref="GOA:D4MQ82"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ82"
FT                   /protein_id="CBL35918.1"
FT                   /translation="MKLVIIEPLGVEKEKLLSMAAGRLPESVEIVCYDTRVTDTEALIE
FT                   RGKDADIIAVSNLPLNAQVIDGCKNLKMLSVAFTGIDHIAMDACRKSGVLVSNCAGYST
FT                   AAVADLVFGMLISLYRNIPACDEAVRREGTKDGLIGFELEGKKFGVIGTGAIGLRVAAI
FT                   DQAFGCEVLAYSRTEKDIPGITYTDLDSLLSQCDIVSLHTPLNDSTRGLIGREQLALMK
FT                   RSAVLINTSRGPVVDSEALAEALNEERIAGAAIDVFETEPPIRKEHPLLNAKHVIATPH
FT                   VAFATKEALIKRAAIVFDNITAWIDGKPQNVM"
FT   CDS             complement(886678..886860)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35919"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ83"
FT                   /protein_id="CBL35919.1"
FT                   /translation="MEMRKSEQEWAESGKKRKRPGKSSTKTAPESRQEAFRRRFLPGGG
FT                   PGLTLHSEVFRLSRP"
FT   CDS             886996..888591
FT                   /transl_table=11
FT                   /locus_tag="CL3_10190"
FT                   /product="Choline-glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35920"
FT                   /db_xref="GOA:D4MQ84"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ84"
FT                   /protein_id="CBL35920.1"
FT                   /translation="MNRISKNSGAPLKSQLDWIPIALPFAVILLLCGCFFAAPESSRQT
FT                   LDSVRAFLGDQFGVWYLAVGLGFFLLSIYLAFSPYGSIRLGKPGEKPQYPAFVWGSMMF
FT                   TSGLAADILFYSLCEWILYANDPHLAEMGSIQDWSSVYPLFHWGPIPWSFYLVLAVSFG
FT                   FMLHVRNCRKQKYSEACRPILGSLVDKAPGKLIDLLAVFALLAGTATTFSLATPLMGQA
FT                   LASLLGLDASGWLAAPGPFGIACSKWLTILILAATCAVYTFSVVRGMKGVAKLASSCVY
FT                   LFFILLAYVFLAGGETRYIVETGFSALGNLAQNFLTLATYTDPARTTSFPQTWTIFYWA
FT                   YWMVWSVASPFFIGSISRGRTVKQTILGGYLFGLGGTFTSFIVLGNYSLGLQVSGRLDV
FT                   MAIYGAAQDLYSTIIAILQTLPLASLVLVVLLLAMIAFYATSFDAIALVAASYSYKELP
FT                   DSHEPHMGVKVFWSLMLILLPIALVFSDSSMANLQTVSIIAAFPLAFVIVLIAASFLKD
FT                   AGRYLREQNTKERP"
FT   gap             889241..889481
FT                   /estimated_length=241
FT   CDS             complement(889547..890017)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10210"
FT                   /product="Flavodoxins"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35921"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ85"
FT                   /protein_id="CBL35921.1"
FT                   /translation="MSKTLIAYFSASGVTAQAAKEMADAVGADLYEIRPEQPYTSADLD
FT                   WMDKNSRSTLEMNDPASRPAIAEPVQDMGQYDTVLVGFPIWWYVEPRIVDTFLESYDFS
FT                   GKTMIAFATSGGSGIGKAEKSMQAHCPKANWKSGQLLNGSGAGDWAKRILKG"
FT   CDS             complement(890036..890932)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10220"
FT                   /product="Uncharacterized Fe-S center protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35922"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ86"
FT                   /protein_id="CBL35922.1"
FT                   /translation="MIMGSKVYFTREITPQAVVRLYHELGIELPGRVAVKVHSGEKGNQ
FT                   NFLHPEFWKPMVEEVHGTIVECNTAYGDATAGVRDHTESHLKLMDEHGWTKYFPVDLMD
FT                   AEGPDVVWPVLNGRVLKENRLGRHIENYDSMLVLAHFKGHPAGGYGGALKQLAIGCASR
FT                   AGKALIHSGGRTDDRFETWKLHADNTVFPEAMADAASSVTAHFKGKIAFINVMKNLSVD
FT                   CDCCAVAEDPCMRDIGILASLDPVAIDQACIDLVSGSDDSGREHFMERVNSRNGIHTIE
FT                   AAAALGMGQREYELIER"
FT   gap             892391..892519
FT                   /estimated_length=129
FT   CDS             893686..894063
FT                   /transl_table=11
FT                   /locus_tag="CL3_10250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35923"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ87"
FT                   /protein_id="CBL35923.1"
FT                   /translation="MEYYDDYDNRELKEANGPSRQPKPPANNMAIVSMILGIFAILLLC
FT                   MCIAFPVSILLGAGAVCLSIMSKKGGPFSGFAVAGLVLGILAIVFGIIEFLYLIFVSQL
FT                   LNDPYFTGILEEMMEQYPLSD"
FT   CDS             complement(894190..894609)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10260"
FT                   /product="Protein of unknown function (DUF2752)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35924"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ88"
FT                   /protein_id="CBL35924.1"
FT                   /translation="MNTAAELLMKLGQGEIPRLFHMITGLYCPGCGGTRAALALLRGQV
FT                   VKSLLYNPIPAYLLFGGLWCIAAVLLEAAGKTEGKAEEKDRAQFLRKSALPRPVLCFLW
FT                   GLLAVTAAGFLIKNLLLVMGLDLHSVAAGWPGRAW"
FT   CDS             complement(894622..895098)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10270"
FT                   /product="Aspartokinases"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35925"
FT                   /db_xref="GOA:D4MQ89"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ89"
FT                   /protein_id="CBL35925.1"
FT                   /translation="MEKMLVSGVAADKNTARISVIGVADEPGIAFKVFNLLARHHINVD
FT                   IIIQSIGRDGRKDISFTVARTDLQEAMTILNDNRESLTAQSVECATGVAKISIIGAGMT
FT                   SNPGVAARMFEALYSANINIRMIATSEIRITVLINEEDTNRAMRVVHDAFSLAD"
FT   gap             895119..895827
FT                   /estimated_length=709
FT   CDS             complement(896711..897712)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10300"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35926"
FT                   /db_xref="GOA:D4MQ90"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ90"
FT                   /protein_id="CBL35926.1"
FT                   /translation="MEEPGFWDDPEMSTRLMREAKNLKDTVESYRKLEQEYEDIQVMLE
FT                   MGYEENDPSLIPEIQGMMDDFVEKLEAIRIQTLLSGEYDNNNAILKLNAGAGGTEACDW
FT                   CSMLYRMYQRWADKKGFTTAVIDYLDGEEAGIKSITLQINGENAYGFLKSERGVHRLVR
FT                   ISPFNSAGKRQTSFVSCDVMPDIKEDLDVEVNPDELRIDTYRSSGAGGQHINKTSSAIR
FT                   ITHLPTGIVVQCQNERSQFQNKEVAMQMLKTKLYMMKQEEHAEKLSDIRGDVKDINFGN
FT                   QIRSYVMQPYTLVKDHRTGAESGNVNAVLDGDIDLFISAYLKWVNLDSKKSD"
FT   gap             897956..899017
FT                   /estimated_length=1062
FT   CDS             900876..901403
FT                   /transl_table=11
FT                   /locus_tag="CL3_10340"
FT                   /product="SSU ribosomal protein S30P/sigma 54 modulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35927"
FT                   /db_xref="GOA:D4MQ91"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ91"
FT                   /protein_id="CBL35927.1"
FT                   /translation="MRYTITGRNIDVTPGLREAVIEKIGKLERYFNQDTEAIITLSVTK
FT                   DRQKIEVTIPVKGHIIRAEEQSTDMYVSIDLVEEIIERQLKKYKRKLIDKKQAPVDFSE
FT                   LFVQEESEPDDEIKIEKVKKFAMKPMDPEEACVQMELLGHSFYVFLNAETEEVNVVYKR
FT                   KGHTYGLIEPEF"
FT   CDS             complement(901558..902082)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10350"
FT                   /product="Uncharacterized protein involved in copper
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35928"
FT                   /db_xref="GOA:D4MQ92"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ92"
FT                   /protein_id="CBL35928.1"
FT                   /translation="MFEEARELLENGSDGLAFGFLTEDRCVDLEKTGRMTELIHSYGRE
FT                   AVFHRAFDCTEDPVRAIEELIGLGADRILTSGQQEKAEQGKELLRQLQAAYGSRIQLLA
FT                   GSGVNAGNARALAEYTGIRQLHSSCRYWERDITTVGEGVNYSIAPAPHERDYDRVSERL
FT                   VRELAEAFRER"
FT   CDS             complement(902019..902537)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10360"
FT                   /product="Uncharacterized protein involved in copper
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35929"
FT                   /db_xref="GOA:D4MQ93"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ93"
FT                   /protein_id="CBL35929.1"
FT                   /translation="MLQKKLKFWYDKKQGVFPCFLSFRKHPGPSGRKRLTYALGRVVKE
FT                   RNTHDRQPESRLFGKMKILKTEERKRDRMAENREMTIEICCGSYEDALAAARGGAERIE
FT                   LNSALALGGLTPSAACLRMVKRCTDLLVVSMVRPRGAGFCYTEARRSRCLRRRGSFWRT
FT                   EATDLPLDF"
FT   gap             903364..905210
FT                   /estimated_length=1847
FT   gap             906124..906763
FT                   /estimated_length=640
FT   CDS             complement(907342..907761)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35930"
FT                   /db_xref="InterPro:IPR025375"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ94"
FT                   /protein_id="CBL35930.1"
FT                   /translation="MGNIPDNSIIESQSINILKPALQRCHRLKAQITENDKTLSWDGTV
FT                   EVYHSDRFSKSTLDGIVSVQVKGKWCDEIPKNDTVKFYVSTKDLNNYIKSNGVIFFVVY
FT                   CNDDGGKVYYNSLLPLDLYVLLKGVSPLHPQNLSN"
FT   CDS             complement(908282..908809)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35931"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ95"
FT                   /protein_id="CBL35931.1"
FT                   /translation="MRFEPSEEAMYRRMDQKERILYLIAACGLIGSLVFLLCVINQNWY
FT                   VAGGAVCFAVCFIAVMVWRYRALGQRIMPLTGCFLEVRQDRLLVRQPQRQERYETCRIF
FT                   CPEIEQLVWSSRKDGFYIRFHDNGKSSVLLHGKQSGPIFHIQSFGYREEEMKSVYQAIK
FT                   ERLPASASVFEP"
FT   gap             909567..909758
FT                   /estimated_length=192
FT   gap             912300..912378
FT                   /estimated_length=79
FT   gap             914880..915408
FT                   /estimated_length=529
FT   gap             917636..918453
FT                   /estimated_length=818
FT   gap             919540..921025
FT                   /estimated_length=1486
FT   CDS             complement(921508..921687)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35932"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ96"
FT                   /protein_id="CBL35932.1"
FT                   /translation="MSNIEAAKQLYKICRNMDRDEAMQLILSADNEEEQEFFSMLSDLI
FT                   LQQRQKEVIQQKRL"
FT   gap             922269..923231
FT                   /estimated_length=963
FT   CDS             complement(924288..924518)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10550"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35933"
FT                   /db_xref="GOA:D4MQ97"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ97"
FT                   /protein_id="CBL35933.1"
FT                   /translation="MRVKGTVKWFNARRGFGFVCDEDGLEHFVHYSQIQMEGFKRLGEG
FT                   QSVTFEIGEDEKGRSVALEVIPEEQAPVEEL"
FT   CDS             complement(924555..924785)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35934"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ98"
FT                   /protein_id="CBL35934.1"
FT                   /translation="MQLRRQGKYVGTVTDVYRGTYFLCLDCKVNAVAHSCNTASLPGQG
FT                   DEVGFLVTRVNEEREVAEGIITRIIKRRSSI"
FT   gap             924793..925386
FT                   /estimated_length=594
FT   CDS             complement(925424..926398)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10570"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35935"
FT                   /db_xref="GOA:D4MQ99"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQ99"
FT                   /protein_id="CBL35935.1"
FT                   /translation="MGLSVVDYLLALPEMLHFIKVPELSTANMFIYRMLTDYGTGYFKM
FT                   IRFENNQLLILTADYTPNCTFEKVAEVSEEYIEISQFETDSSSFKVGGKKLQQVHKGIF
FT                   CYVNTQKTTYVYCEKGQPVRFTKVFLTRTYFDTYFQSHYGRNYQESISAQDYILRHPNQ
FT                   PELNFVFQQIRDCQADSQILRMYLEGKVLEMLSLIIKGMSQPQRHIPVKLDYKDIRNLK
FT                   KTVTLMRNDLAAYPSGEKLAQIAGMSPTRYQLAFKKHYGTTPYEYLKELRLNQALFLLK
FT                   NSDYSITEIAAKVGYHTSGYFAKLFKNAYGLGPREYRRMQGIK"
FT   CDS             926682..928022
FT                   /transl_table=11
FT                   /locus_tag="CL3_10580"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35936"
FT                   /db_xref="GOA:D4MQA0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQA0"
FT                   /protein_id="CBL35936.1"
FT                   /translation="MKTNRMQLMSEGDVSKSLFKLGIPMVVSMLVTALYNVVDTYFVSG
FT                   LGTQQVAAVSVAFPISFIFSGIGLTFGVGAGSYISRLLGKQDMEKAHQVASTAMFSSVL
FT                   TSIIAAGIIYAMLTPVLTFMGATETIMPFAKKYAVIFIISTVFSAVNVTSGNLAVSQGA
FT                   SNISLTAMLTGAILNMVLDPILIHPFHLGVEGAAIATLISQIVTLGIYIRFFAAGKTAI
FT                   KIGMSYFKPSRETYSEMIKIGISTLLLQLFQSLSMSLISNTASHYGDEAVAAMGIVLRI
FT                   VTIGANVVFGYMKGFQPMAGFNYGAKNYPRLLTAIKSCIKWTTGFCIIFTMIIFLFASP
FT                   LLSLFSNDVRVLEIAVPALRANTIMFFTFGLQFTYSTLYLAMGKALVGGILNVCRQGIL
FT                   FIPVIMVLPTIWGMNGVIYSQAVADLLTTFVTIYFAFKIHNQLKQAI"
FT   gap             928373..930099
FT                   /estimated_length=1727
FT   gap             932080..933295
FT                   /estimated_length=1216
FT   CDS             complement(933994..934653)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10640"
FT                   /product="ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35937"
FT                   /db_xref="GOA:D4MQA1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQA1"
FT                   /protein_id="CBL35937.1"
FT                   /translation="MAATQGTALLFGLLAVAVVLNLSRIKKHSELFVLVLSGVIVKSMF
FT                   DAMVSFIKYIADPEDKLPAITMWLMGSLANVSYRDVALCSVIVLPCLIIAMVLRWKMNL
FT                   LSLDQEEARSLGINVKKLRLAAILLSTLMTAVTVSVCGIIGWIGLVIPHIARLFIGNDH
FT                   RTLIPASALMGAIYLLLIDTVARAATANEIPLSILTAMIGAPFFAALLRKTLGGRA"
FT   gap             934700..935155
FT                   /estimated_length=456
FT   CDS             complement(935311..936201)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10650"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35938"
FT                   /db_xref="GOA:D4MQA2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQA2"
FT                   /protein_id="CBL35938.1"
FT                   /translation="MTLQQLKYYCAVYECRSITKAARKNFVTQPAVTAAIRELEKEYAV
FT                   RLIDKDGKYIRITRAGDRFYEYASQMLTHAQEFDDQVQDMVSHSRSLRLGLTKSAGSSV
FT                   YMEYLSGRSEEYSDMEFKLTVGSTSELLEGLWERKLDAALILNHGNVSIDNFEWAELRT
FT                   TEMLYCVSVIHPLARANRLTVPMIANEKMVSTKHDDCKTEALKQLFLQYGCEAGPQVIW
FT                   QFDQQSTAMKMVAFNLATGYFPADGIRQYDGIVGKLLEGDKPIPICAVWTKDAWKQEHV
FT                   QQFIKGIVKFYEAAQ"
FT   CDS             936496..936741
FT                   /transl_table=11
FT                   /locus_tag="CL3_10660"
FT                   /product="Phd_YefM."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35939"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQA3"
FT                   /protein_id="CBL35939.1"
FT                   /translation="MSIITTATATEMQNNFGRYLNLVLSGQEIIVTKNGKEVGRFIPKD
FT                   SAISYLTDSLTGILKGDYDLDKEKAERLKEKYEITD"
FT   CDS             936725..937132
FT                   /transl_table=11
FT                   /locus_tag="CL3_10670"
FT                   /product="PIN domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35940"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQA4"
FT                   /protein_id="CBL35940.1"
FT                   /translation="MRLLIDANVILDVLQNREPHVKDSSIIWKLCETRQAEGFISALTF
FT                   ANLVYVMRKELNPEQIEEVLQKLSLIFTFTELSPSDLTSAAHLKWDDFEDALQSVTAER
FT                   IHVDYIVTRNIRDFLKSKVVAFTPSELFGRM"
FT   CDS             937342..937488
FT                   /transl_table=11
FT                   /locus_tag="CL3_10680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35941"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQA5"
FT                   /protein_id="CBL35941.1"
FT                   /translation="MEEFADELRREGFQEVHYIPFIERERWIPKYVQAPWMLYGVGLLY
FT                   GKK"
FT   gap             939327..939460
FT                   /estimated_length=134
FT   CDS             complement(939967..940224)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35942"
FT                   /db_xref="GOA:D4MQA6"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQA6"
FT                   /protein_id="CBL35942.1"
FT                   /translation="MNFEQLLKRAKNKDPEAKEQLYEMFRPLLIHQAMISGRFSEDLYQ
FT                   ELSLTFLFCIDSFKIEKALRLIKDNENRQKKSKNKGMESF"
FT   CDS             complement(940214..940645)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35943"
FT                   /db_xref="GOA:D4MQA7"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQA7"
FT                   /protein_id="CBL35943.1"
FT                   /translation="MNETANDPLKNIFIKYLDTALNRTKDRFVKQMERQGKYEIALPEE
FT                   ELPYDFYRFLEEEADIQRLPAGTEASQIRSWICGQTQWNLAHAFQRLNDREVVIVYLKV
FT                   FEKLTFAEIGEKLGEDWKKTASSYTYARKKLRKGIENEF"
FT   CDS             940945..941268
FT                   /transl_table=11
FT                   /locus_tag="CL3_10750"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35944"
FT                   /db_xref="GOA:D4MQA8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQA8"
FT                   /protein_id="CBL35944.1"
FT                   /translation="MKSPDHELGYRLKAARENRHLTQERLAEMVGIAASYLSEIENKRT
FT                   VPSFNVLSSLCQTLNVSLDDLIFHTESDQIESITRLLSQCNDKQLLIIKAVIETLLQFN
FT                   NEL"
FT   CDS             complement(941719..942936)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35945"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQA9"
FT                   /protein_id="CBL35945.1"
FT                   /translation="MKGWQSTGRIERGKYKTGSSPKRGERSDKNFSRYFKTVSRKKIGA
FT                   FAAVLLAISVPAEPVWASDLIGTVKVEFSEAGNTYENGLPEIEGETNSNKYSLSEMTTL
FT                   EEYMSQWEDIDEEEDEEENDRKDNSDLLAYNETYQVLQDYSQVVYAVIIDAEEEYYFSS
FT                   SLDRIQVSGLGAECVRAERINDKHTLVLFVRFEELDYLPGELSETGWQEPGRALWNCSG
FT                   NPKAYHLRLYLDGKPVCGIKETGGPSYDFQPLMQKAGEYHYQIRTVSVDGTKGDWVESE
FT                   HIFISDEQARQYQTVYEVIPILAEETEQTGPAQIVGYENTGWQDGGDGRFWYRETDGSY
FT                   PQNSWSSIDGAWYFFDRAGYMCVNAYISWGDQTFYVAEDGRMLVEGKAPDGRNVQADGS
FT                   LAWPES"
FT   gap             944566..944819
FT                   /estimated_length=254
FT   CDS             complement(946146..946556)
FT                   /transl_table=11
FT                   /locus_tag="CL3_10800"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35946"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQB0"
FT                   /protein_id="CBL35946.1"
FT                   /translation="MKRIINGVCVVLAFICIGLGCIGIVLPILPTTPLFLLAVVLFAKG
FT                   SKRFHRRFLSTGLYQKYLADFVATRSMTKRTKIRILAFVTVLIAIGFWFSPVFAKVILA
FT                   AVLLFHYAYFLFGIKTIDEKADKVKNREIRVE"
FT   gap             946720..947952
FT                   /estimated_length=1233
FT   gap             948784..949174
FT                   /estimated_length=391
FT   gap             950146..950729
FT                   /estimated_length=584
FT   gap             952776..954276
FT                   /estimated_length=1501
FT   CDS             956667..956741
FT                   /transl_table=11
FT                   /locus_tag="CL3_10870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35947"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQB1"
FT                   /protein_id="CBL35947.1"
FT                   /translation="MAFLTNLERLSAERARKRPRKSEI"
FT   CDS             957267..957572
FT                   /transl_table=11
FT                   /locus_tag="CL3_10900"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35948"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQB2"
FT                   /protein_id="CBL35948.1"
FT                   /translation="MGECCKGEERHKHRNLTEQKDLMTRLNRIEGQVRGIKAMVEDERY
FT                   CVDILTQVSAVQAALNGFSRVLLSNHIKTCVVDEIEAGDAEETVEELCRTIQKLMK"
FT   tRNA            complement(958002..958074)
FT                   /locus_tag="CL3_T_35570"
FT   gap             958106..958538
FT                   /estimated_length=433
FT   CDS             958679..958957
FT                   /transl_table=11
FT                   /locus_tag="CL3_10910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35949"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQB3"
FT                   /protein_id="CBL35949.1"
FT                   /translation="MGTIVQKLRFSARSVSCRLNLERGKRQPGERDGCIRETAASERNS
FT                   RGREKWPRQRPVAGYPGSRGCQRAPENADRWKAEEKCTGISTIEKMR"
FT   CDS             959044..960963
FT                   /transl_table=11
FT                   /locus_tag="CL3_10920"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35950"
FT                   /db_xref="GOA:D4MQB4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQB4"
FT                   /protein_id="CBL35950.1"
FT                   /translation="MGKAQYDADSITVLEGLEAVRKRPGMYIGGVGTKGLNHLIYEIVD
FT                   NSVDEHLAGECTSIWVTLEADGSCTVRDNGRGIPVEMHKKGVSAERVVLSTLHAGGKFD
FT                   NSAYKTSGGLHGVGSSVVNALSEHLDIKIYKNGQIHHDAYERGIPVVELVDGLLPVIGK
FT                   TKETGTCINFLPDDTIFEKTKFKAEWLKSRLHETAYLNPALTIYYENRRAGEEEKIVYS
FT                   EPDGIIAYVKEINAGKTPVHEPIYFKGSMEGIEVEAAIQFVDTFEENILGFCNNIFTQE
FT                   GGTHLAGFKTKFTMLINSYARELGILKEKDSNFTGADTRNGMTAVIAIKHPDPIFEGQT
FT                   KTKLASADATKAVFTLAGEELQRFFDRNLETLKAVIGCAEKSAKIRKAEEKAKTNMLTK
FT                   SRFSFDSNGKLSNCESRDAEKCEIFIVEGDSAGGSAKMGRNRQYQAILPIRGKILNVEK
FT                   ASMDKVLANAEIKTMINAFGCGFSEGYGNDFDISKLRYNKIILMTDADVDGSHIDTLLL
FT                   TFLYRFMPDLITEGHVYIAMPPLFKVIPKKGEEQYLYDEKALEKYKKTHAGGFTLQRYK
FT                   GLGEMDAEQLWETTLNPENRVLKQVEIEDARMASEITEMLMGSDVPPRRQFIYDHAEEA
FT                   EIDA"
FT   CDS             961028..961156
FT                   /transl_table=11
FT                   /locus_tag="CL3_10930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35951"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQB5"
FT                   /protein_id="CBL35951.1"
FT                   /translation="MGRTRHGTQITGYNQAPPAEKQAQQERNRHSRQEREKWLKKS"
FT   gap             962061..963490
FT                   /estimated_length=1430
FT   CDS             963531..964502
FT                   /transl_table=11
FT                   /locus_tag="CL3_10950"
FT                   /product="Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35952"
FT                   /db_xref="GOA:D4MQB6"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQB6"
FT                   /protein_id="CBL35952.1"
FT                   /translation="MAYVMKLLKDRGIVEASGGRVSFIATPAEEFIDFESRERLKKEGK
FT                   IRYLSGKQNMIAEGVFDDVDCVISMHINGDSGNRLFDIDSTLAGFTVKKALFHGKNAHS
FT                   GAAPHLGRNALHGASLAMDAIAYMKDQFPAEAGIQIHPVITACGGSVNTIPEEVVMESY
FT                   IRANTLEALLEANKKFDDCVIHCAQALGLTAEVEDRTGYMPFSQSPWLTEVIHRQMLSL
FT                   CREEQIVKHVISGASGDIGDLGYLIPSVQFGFSGMKGRIHSSEFEIVNEENAYFNTARV
FT                   VAGAVEEILTTPQLQIKNTDYAEKKQFYLNRWLHDTPGADEA"
FT   CDS             964620..965345
FT                   /transl_table=11
FT                   /locus_tag="CL3_10960"
FT                   /product="purine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35953"
FT                   /db_xref="GOA:D4MQB7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQB7"
FT                   /protein_id="CBL35953.1"
FT                   /translation="MKMEENRVPTPHIGAQAGEIAETILLPGDPLRAKYIAENFLTDVK
FT                   QFNGVRNMFGYTGFYKGKRVSVMGTGMGCPSIGIYSYELIHFYGCKNLIRVGTAGALQE
FT                   NVKIRDIVIGMGACTTSNYVKQFRLPGDYSCICSFELLEKAVKAAREKGLKVHVGNILS
FT                   SDMFYNPDLPQTGMSWAQMGVLAVEMEAAALYSNAAAAGVNAICILTVSDSAVTGEATT
FT                   AEERQTSFTNMMEVALELA"
FT   gap             966786..967528
FT                   /estimated_length=743
FT   CDS             968148..969308
FT                   /transl_table=11
FT                   /locus_tag="CL3_10990"
FT                   /product="Uncharacterized ABC-type transport system,
FT                   periplasmic component/surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_10990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35954"
FT                   /db_xref="GOA:D4MQB8"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQB8"
FT                   /protein_id="CBL35954.1"
FT                   /translation="MNNQLTKKEEIMKKLLKKAAAVTLTAAMAASLTACGGGSDADSSS
FT                   KAAEGQDGEKIKLTLCIGRKTDLSFQQSAYEGSVRVQEELGDKYEINVVEMGDDTTKWQ
FT                   AAFYDAADSGADIIVGTGFQNKENFETIPLEYPDTKFILFDQDLDFSSGELTNTLGVLF
FT                   DSNQSGFLAGAVAAYYTSSENAANTDKTIGFVGGVESTTVSNFLVGYAEGAKYVDPDIN
FT                   ILTAYVGDYMDTAKAKDLANAQISEGADIIFQVAGGAGNGVIEAAAEKDGVMAIGVDSD
FT                   QYKALEGSNLQSAVITSSLKRLDNALFNICKAYAEDPSSVPFGENVTYGLAEDAVGIVF
FT                   NDNLTNSIGQENVDNVQEILGKIQSGEIEVTEAAGLSAEEIDAIVH"
FT   gap             970888..971670
FT                   /estimated_length=783
FT   gap             973093..973988
FT                   /estimated_length=896
FT   gap             975494..976316
FT                   /estimated_length=823
FT   gap             977576..978232
FT                   /estimated_length=657
FT   CDS             978460..979638
FT                   /transl_table=11
FT                   /locus_tag="CL3_11080"
FT                   /product="AICAR transformylase/IMP cyclohydrolase PurH
FT                   (only IMP cyclohydrolase domain in Aful)"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35955"
FT                   /db_xref="GOA:D4MQB9"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024050"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQB9"
FT                   /protein_id="CBL35955.1"
FT                   /translation="MNELELKYGCNPNQKPSRIFMENGGELPIRVLSGRPGYINFLDAF
FT                   NGWQLVRELKKATGLPAATSFKHVSPAGAAVGLPMDETLRKIYWVDDMGELSPLACAYA
FT                   RARGADRMSSFGDFISLSDVCDGDTARLIKREVSDGVIAPGYTEEALAILKSKKNGNYN
FT                   VIEIDPEYEPEQIERKQVFGITFEQGRNELDINKEMFSNIVTENKDLPDSARIDMMVAM
FT                   ITLKYTQSNSVCYVKDGQAIGIGAGQQSRVHCTRLAGQKADNWFLRQAPQVLNLSFVDG
FT                   IKRADRDNAIDVYIGEEYMDVLAEGAWQKNFKEKPPVFTREEKRAWLDKMQGVTLGSDA
FT                   FFPFGDNIERAYKSGVKYIAQPGGSVRDDNVIDTCNKYGMVMAFTGIRLFHH"
FT   tRNA            979831..979913
FT                   /locus_tag="CL3_T_35360"
FT   gap             980676..981192
FT                   /estimated_length=517
FT   CDS             983486..984073
FT                   /transl_table=11
FT                   /locus_tag="CL3_11120"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35956"
FT                   /db_xref="GOA:D4MQC0"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQC0"
FT                   /protein_id="CBL35956.1"
FT                   /translation="MKVIGITGGVGSGKSEVLGILKRDFGAELLIADETAHQVMEPGMP
FT                   AYRRIVEALGTDFLSADGSIDRKALAKRLFGDGEALGTVNSIVHPTVWQAIEESIRCSR
FT                   KELVIVEAALFDEEHNGLFDQVWYIFTSEENRISRLMKSRGYSREKCLDIMRSQKSESE
FT                   FRAMADRVIDNNKTVADVKRQIETILKEEAEA"
FT   CDS             984628..985443
FT                   /transl_table=11
FT                   /locus_tag="CL3_11130"
FT                   /product="ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35957"
FT                   /db_xref="GOA:D4MQC1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQC1"
FT                   /protein_id="CBL35957.1"
FT                   /translation="MIKKIGIYLFLILAAFLSLFPFYFMFVSGTNTNQDILAAPPRLLP
FT                   GSMLAENFSVLIEKMDIFRVAFNTLFISIVFTVLALMLYSAAGYVLAKFDFKGKGLIFG
FT                   FIMVSMMIPPQVMYVPLFQLFVATNMTNTYVAVILPALANAFGIFLMRQNMMNFPTALV
FT                   EAARIDGYSEFGIFCRIVLPNVKPALSALVIYMFTSMWNNFMWPLIVLETKDMYNFPVA
FT                   LAVLDGNPTNKDFAVILLATAIATLPILIIFMVFQKQFVAGVMGGAVKE"
FT   gap             985783..986964
FT                   /estimated_length=1182
FT   CDS             987075..988178
FT                   /transl_table=11
FT                   /locus_tag="CL3_11160"
FT                   /product="transposase, IS605 OrfB family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35958"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQC2"
FT                   /protein_id="CBL35958.1"
FT                   /translation="MLKAYKYRIYPNSKQRTQIAKTFGCCRFVYNRTLVYRKEIYEKEK
FT                   KSVSKTDCNNYCNRELKKDYEWLKEVDKFALTNAIYNMDSAYQKFFREHAGYPKFKSKH
FT                   DSHKSYTTNYTNGNIAVDFENGKVKLPKLKDVKAKLHRDFRGQIKSATVSRVPSGKYYV
FT                   SILVETEHKELAHTKDSIGIDLGIKDLCITSDGKIYENPKIIRKYERQLVKLQRQLSHK
FT                   EKRSKNYYKIKKKIALCHEKITNTRKDYLHKVSHEIISENQVVVSENLQIKNMVKNHHL
FT                   AKAISDVSWYELTRQLEYKAKWNGRKYIKIDTFYASSQICSVCGYQNPDIKDLSVRTWI
FT                   CPECGAEHDRDINAAKNILAEGLRRIA"
FT   CDS             988351..988470
FT                   /transl_table=11
FT                   /locus_tag="CL3_11170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35959"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQC3"
FT                   /protein_id="CBL35959.1"
FT                   /translation="MAAKEMCIQNEAVKYSVSMGMKPSRGSGRSAQRYENSFF"
FT   gap             989640..990801
FT                   /estimated_length=1162
FT   gap             992601..994217
FT                   /estimated_length=1617
FT   CDS             995466..995822
FT                   /transl_table=11
FT                   /locus_tag="CL3_11230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35960"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQC4"
FT                   /protein_id="CBL35960.1"
FT                   /translation="MSTTLNDEHWLNLITQCRSSGLTDRQWCIENGIPVSTFYYHVRAL
FT                   RKKACEVPEAVDAAAQKQEVVQIPLWEREQHSDTAAFHTPSICLEMQGIRIEIHEQAGA
FT                   DVIRNTLLALRQLC"
FT   CDS             996468..996644
FT                   /transl_table=11
FT                   /locus_tag="CL3_11250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35961"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQC5"
FT                   /protein_id="CBL35961.1"
FT                   /translation="MPQSEMEALIQLQKETIESLRQLVDSQRHTIEQMTKSHEEQTAQL
FT                   NRRSQISMRQSNI"
FT   gap             996855..998476
FT                   /estimated_length=1622
FT   CDS             complement(998542..999009)
FT                   /transl_table=11
FT                   /locus_tag="CL3_11270"
FT                   /product="Alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35962"
FT                   /db_xref="GOA:D4MQC6"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQC6"
FT                   /protein_id="CBL35962.1"
FT                   /translation="MNWKYLKRDCWLEIDLDTIRSNFAALRSMAGPGIKIMPAVKANAY
FT                   GHGIVESCRALEEAEADYLGVGNIDEAILLREIGIQTPILIFAGNLVEEVADLYIRYSL
FT                   IPTIFSVKAAQAISRLSKAEHPVFLGICLVYNKNTQNCRGDSPKLQREIPQ"
FT   CDS             999706..999912
FT                   /transl_table=11
FT                   /locus_tag="CL3_11290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35963"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQC7"
FT                   /protein_id="CBL35963.1"
FT                   /translation="MEENYNRIIKRINLISIQNSSQKHRMEDSITEHQAIIEGFEKKDL
FT                   NKIVEAIETHIMNGYLNLTKMYQ"
FT   CDS             complement(1000029..1001090)
FT                   /transl_table=11
FT                   /locus_tag="CL3_11300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35964"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQC8"
FT                   /protein_id="CBL35964.1"
FT                   /translation="MSGDTSFSLFDKLYSCYYLAVRRILEEAALSPVDSRRMEEICRAC
FT                   AFDESALSIVPELTRPDGAWSALLSAKRGGLFSSSLGSASLKPPLSRLQKAWLKAICSD
FT                   PRFLLFFSEEERDRLSAALEEDGQVTELYRQEEFYYYDQFRDGDDYESVMYRRHFATIL
FT                   EGILNRQMLRLSYRGKRQLLDPMKVFPVSLQYSAKDDKFRLLCIRQRSGRPGLGYTLNV
FT                   SKILSCELCRETPPAGGIQAASALPFSAASGSGSPFVRKAEEPAVIEIDGRRNSLERCM
FT                   LKFADYEKRTEYDEKRGVYICSICYDIQDETELIIDLLSFGPVIRVVSPERIVRQIRER
FT                   VMRQHEWLFGAVE"
FT   gap             1001308..1001594
FT                   /estimated_length=287
FT   CDS             1002832..1003014
FT                   /transl_table=11
FT                   /locus_tag="CL3_11330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35965"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQC9"
FT                   /protein_id="CBL35965.1"
FT                   /translation="MIGQEKFTRIGHVKARQTKNAVQREKDPKSKQTAGRRKRPMKITR
FT                   IRQRGSVESDVCIIR"
FT   CDS             1002995..1004035
FT                   /transl_table=11
FT                   /locus_tag="CL3_11340"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35966"
FT                   /db_xref="GOA:D4MQD0"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQD0"
FT                   /protein_id="CBL35966.1"
FT                   /translation="MFVLSDESGKWPVRVWLEKKEDIEESCLLQASHLAELPFLHKWVC
FT                   LMPDTHTGKGMPIGGVIAAKNVLIPNAVGVDIGCGMAWTGTNVKAEELRGILTGNGNLL
FT                   QGIVGDILRNIPTGFAHHKIQMPSYTLDRAFEEFDKYEEDGELLGQLDAGYFQIGTLGG
FT                   GNHFIELQEDEEGYLSVMIHSGSRHFGKAVCDYFHQKARELNARWYSQVPDEYRLAFLP
FT                   LDSREGRQYLNWMQLSMDFAMENRAKMMLAVKAILEKWIGKYTDLHLAFTEEINCHHNY
FT                   AALENHYGENVWVHRKGATRAREGELAVIPGAMGSFSYIVRGKGNRNPSAPPPTEPGAD
FT                   IPEKEL"
FT   CDS             1004032..1004406
FT                   /transl_table=11
FT                   /locus_tag="CL3_11350"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35967"
FT                   /db_xref="GOA:D4MQD1"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQD1"
FT                   /protein_id="CBL35967.1"
FT                   /translation="MSAFSCEEVIKDLREKQVILGKRNKSDVAEESRFAYKDIDEVMKN
FT                   QSDLVEPVKKTSHRWCGQGLIPLGLPAGKPFQAAGLGWILCLPPGRCRKIESLHSGEQK
FT                   PSYIDFSRVRIPPDTERICS"
FT   gap             1005364..1006485
FT                   /estimated_length=1122
FT   CDS             1006651..1009059
FT                   /transl_table=11
FT                   /locus_tag="CL3_11380"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35968"
FT                   /db_xref="GOA:D4MQD2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQD2"
FT                   /protein_id="CBL35968.1"
FT                   /translation="MNTALSWIKAYVPDLDVTAQEYTDAMTLTGTKVEGYECLDKNLDK
FT                   IVVGQITEIERHPDADKLVVCQVDLGGTSTQIVTGAPNVKVGQKVPVVLDGGRVAGDHD
FT                   GGRPEGGIRIKKGKLRGVESNGMMCSIEELGSSREMYPEAPEQGIYIFPEDTEVGSDAI
FT                   EALGLRDVVFEYEITSNRVDCYSVIGIAREAAATFGKTFCEPEIKKTGNGEDIHDFLKV
FT                   SVENTELCPRYCARMVKNIKLGPSPDWMRRRLAASGIRPINNIVDITNYVMEEYGQPMH
FT                   AYDYDQIAGQQIVVKCAQDGEVFETLDGQERKLDSQILMINDGEKAVGIAGIMGGENSK
FT                   ITDNVKTMVFEAACFDGTNIRLSAKRVGLRTDASGKFEKGLDPNTAELAINRACQLIEE
FT                   LGAGEVVGGMIDVYPVKREGNRVPFEPEKINRLLGTNIDRADMISYLKSVELEYDAATE
FT                   EIVVPSWRQDVHRMADVAEEVARFYGYDVIPTALPTGEATAGKLSFKLRVEEVARRIAE
FT                   FCGFSQSMTYSFESPKVFDRLLIPEDSTLRRVVTISNPLGEDFSIMRTTPLNGMLTSLS
FT                   TNYNRRNKDVKLYELATIYLPAEDSVSKEYLEQTGLPMLPDERQQFTLGMYGEGDFFTM
FT                   KGVVEEFLEKIGLNKKPRYNPEAGKSFLHPGRQAEISYGDTVIGYMGEIHPDVADNYKI
FT                   GEKAYVAVLDMPNLIPLATFDHKYEGIAKYPSVTRDISMVMKKEVLAGQIEEIIEQRGG
FT                   KILESYKLFDVYEGSQITAGYKSVAYSITFRSKDHTLEEKEVASAMQKF"
FT   CDS             complement(1009067..1009162)
FT                   /transl_table=11
FT                   /locus_tag="CL3_11390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35969"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQD3"
FT                   /protein_id="CBL35969.1"
FT                   /translation="MAEKRRILQSFLPLRNPSFSFYQLLSSIPSP"
FT   CDS             1009208..1009963
FT                   /transl_table=11
FT                   /locus_tag="CL3_11400"
FT                   /product="conserved hypothetical protein TIGR00266"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35970"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQD4"
FT                   /protein_id="CBL35970.1"
FT                   /translation="MLRKKKTTQKISVIQYIYMRREEQDMKYEIHGETLPAVVCELEKG
FT                   EAMITEKGAMAWMSPNMQMETNVGGIGKAFGRLFSGESMFRNTYTAKGGPGMIAFASSF
FT                   PGSIRAFEVGPGQEYIFQKSAFLASEAGVDLSVYFHKKLGSGLFGGEGFIMQKLSGRGI
FT                   VFAEFDGHIMEYDLEAGQQMVIDTGYLAAMTAGCQMEIQSVPGVKNMLFGGEGLFNTIV
FT                   TGPGHIWLQTMPISSVAGTLLPYFPSSGK"
FT   CDS             1010062..1010298
FT                   /transl_table=11
FT                   /locus_tag="CL3_11410"
FT                   /product="protein translocase, SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35971"
FT                   /db_xref="GOA:D4MQD5"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQD5"
FT                   /protein_id="CBL35971.1"
FT                   /translation="MLRGILTFVFVAICVFLTIVVLLQEGKSAGLSGTINGMADSYWGR
FT                   NKSRSMEGKLEKLTKYGAILWLILALVLNLKIL"
FT   gap             1012179..1012731
FT                   /estimated_length=553
FT   CDS             1013489..1014421
FT                   /transl_table=11
FT                   /locus_tag="CL3_11450"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35972"
FT                   /db_xref="GOA:D4MQD6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQD6"
FT                   /protein_id="CBL35972.1"
FT                   /translation="MERTAENDFSKGSVVKNILGLAVPMTLAQLINVLYNIVDRIYIGR
FT                   IPEHATLSLTGIGLSLPMITMVIAFANLFGMGGAPLCSIERGRGNLEEAEKIMGNSFTM
FT                   LVVFGVFLTMLGLLFKKPLLYAFGASDSTYPFADAYITIYLLGSIFVMVGLGMNSFINS
FT                   QGFGKVGMCTVLLGAVANIILDPIFIFRPWHGSPGGCPGDDYLPVFFRCLDCAFPDRKK
FT                   NHTAPPAVLPASAVEENPGYCGTGNERFYHGNHQLYRADRVQCDASDIRRGSLCGRYDS
FT                   HQLPAGGGVHAGAGRHKQRPAGYGLQLWG"
FT   CDS             1014360..1014866
FT                   /transl_table=11
FT                   /locus_tag="CL3_11460"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35973"
FT                   /db_xref="GOA:D4MQD7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQD7"
FT                   /protein_id="CBL35973.1"
FT                   /translation="MPVQGVTNSAQPVMGFNYGAKEYGRVKKAIVFTSLFSIAYTTLAW
FT                   AFLHGFPEFFIRIFNQDQALIEAGVPALRLYFFGFFMMSLQFAGQAVFVALGMSRQAIF
FT                   FSIFRKVVIVVPLTLLLPSVFGMGTNGVFLAEPISNFIGGAACFGTMLLLVWTELTRRE
FT                   RAKTV"
FT   gap             1015954..1016838
FT                   /estimated_length=885
FT   CDS             1016895..1016999
FT                   /transl_table=11
FT                   /locus_tag="CL3_11480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35974"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQD8"
FT                   /protein_id="CBL35974.1"
FT                   /translation="MAKGDTEMKITLKDGSVKEYASAMSVLDIAKDLS"
FT   CDS             1017030..1018847
FT                   /transl_table=11
FT                   /locus_tag="CL3_11490"
FT                   /product="threonyl-tRNA synthetase /Ser-tRNA(Thr)
FT                   hydrolase"
FT                   /EC_number="6.1.1.3"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35975"
FT                   /db_xref="GOA:D4MQD9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQD9"
FT                   /protein_id="CBL35975.1"
FT                   /translation="MDGEVVDLRTVIDKDCQLNILTARDEKGLAALRHTASHVMAQAVK
FT                   RLYPDTKLAIGPSIADGFYYDVDPASPMTAEDMGKIEAEMKKIVKENLPIERFTLPREE
FT                   AIAFMKEKEEPYKVELIEDLPEGAEISFYRQGEFVDLCAGPHLMSTKDVGKAYKLLNLA
FT                   GAYWRGSEKNKMLTRIYATAFFKKEELEAYITMMEEAKKRDHRKLGKELGLFMMHDAGP
FT                   GFPFFLPKGMQLKNTLLDYWREIHKKAGYVEISTPIILNRSLWETSGHWDHYKNNMYTT
FT                   VIDEEDYAIKPMNCPGGVLVYASEPRSYRDLPLRMGELGLVHRHEKSGQLHGLMRVRCF
FT                   TQDDAHIFMTPEQIKDEIKGVATLINEVYTLFGFKYHVELSTRPEDSMGSDEDWELATE
FT                   GLRSALDELGLPYVVNEGDGAFYGPKIDFHLEDCIGRTWQCGTIQLDFQLPQRFELEYT
FT                   GADGEKHRPIMIHRVVFGSIERFIGILIEHFAGAFPTWLAPVQVKVLPISDKYADYAAK
FT                   VYESLSEAGIRAEVDTRSEKIGYKIREAQTNKIPYMLVVGQKEEEEGTVSVRSRFAGDE
FT                   GASSLESFIEKIQKEIASKEMRKMEEKKN"
FT   gap             1018889..1019592
FT                   /estimated_length=704
FT   CDS             1019644..1020027
FT                   /transl_table=11
FT                   /locus_tag="CL3_11500"
FT                   /product="Domain of Unknown Function (DUF1540)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35976"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQE0"
FT                   /protein_id="CBL35976.1"
FT                   /translation="MGRAETDNGVFQNKIARIKEEYVMTRLDCNVTGCVHNAENCCCRG
FT                   SITVDGKTAMEKCDTCCASFDEKKGGVFTNLFKTPESQLQVACEAENCIYNKDKFCVAE
FT                   HIGITGGNATEAYQTECSSFKAR"
FT   CDS             1020139..1020312
FT                   /transl_table=11
FT                   /locus_tag="CL3_11510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35977"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQE1"
FT                   /protein_id="CBL35977.1"
FT                   /translation="MKELGVRIRNRKKYAANTENLLTERNGHSIIAKVVRNNIRKAGIR
FT                   LTLAQGSDQWFI"
FT   CDS             1020560..1021054
FT                   /transl_table=11
FT                   /locus_tag="CL3_11520"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35978"
FT                   /db_xref="GOA:D4MQE2"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQE2"
FT                   /protein_id="CBL35978.1"
FT                   /translation="MINEQIRDREVRLIGEHGEQLGIMSAKDAYKLAREAELDLVKIAP
FT                   TAKPPVCKIIDYGKFRYEQARKEKEAKKKQKVIEVKEVRLSPNIDDNDLNTKVSAARKF
FT                   IEKGNKVKITLRFRGREMAHMSKTKYILDDFAEKLSDIAVVDKPSKVEGRSIVMFLTAK
FT                   R"
FT   CDS             1021087..1021284
FT                   /transl_table=11
FT                   /locus_tag="CL3_11530"
FT                   /product="LSU ribosomal protein L35P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35979"
FT                   /db_xref="GOA:D4MQE3"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQE3"
FT                   /protein_id="CBL35979.1"
FT                   /translation="MPKMKTSRAAAKRFKTTGTGKLVRNKAYKSHILTKKSTKRKRNLR
FT                   KDIVTDATNAKVMKKILPYL"
FT   gap             1021618..1022291
FT                   /estimated_length=674
FT   CDS             1022926..1023054
FT                   /transl_table=11
FT                   /locus_tag="CL3_11560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35980"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQE4"
FT                   /protein_id="CBL35980.1"
FT                   /translation="MDEIQKTLLEEVADLHGIPAGAYNIRATARRLREIRRPTSTL"
FT   gap             1023961..1024763
FT                   /estimated_length=803
FT   CDS             1025283..1026992
FT                   /transl_table=11
FT                   /locus_tag="CL3_11600"
FT                   /product="Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35981"
FT                   /db_xref="GOA:D4MQE5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017310"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQE5"
FT                   /protein_id="CBL35981.1"
FT                   /translation="MNDQKIENILNLALDATENERERSGQLGVGFNPVDNKWELIVKYN
FT                   GSLEKVAEALPGTEVEELSNEYAILVVPEPLIDALASFSEIEYIEKPKSLNFAVVQARA
FT                   ASCINPVQTGARGLTGKGTIVAIIDSGIDYYHEDFRNQDGTTRILEMWDQSLDRVFTRE
FT                   EINEALSRGSRSGAEEVVPSRDLSGHGTAVAGIAAGNGRESGGRNRGVAYESDLLVVRL
FT                   GTPRENSFPRTTELMKALDYVVRRGLSYGEPVAVNLSFGNSYGSHDGTSLLETYIDDIS
FT                   NYWKTVIVTGTGNEGSSRGHTSGRFSMGKDTEIELSVADYETGFGVQLWKLYSDIVEIA
FT                   IISPGGLTTGVISDKLGPQRIRFGETTVLLYYGKPSPYSQAQEIYLDFIPDRDYVQSGI
FT                   WKIRLTPRKVAVGQYDLWLPGGGVLNRSTRFLKPEPNTTLTIPSTAFRVISVSAYDDSY
FT                   PSFADFSGRGFTRLDTRVKPDLAAPGVGILAPRAGGVYEAVTGTSFAAPFVSGSAALLM
FT                   QWGIVENNDPFLYGEKIKAYLIRGAKPLPGENVYPNERLGFGILCLEDSFPL"
FT   gap             1027779..1028118
FT                   /estimated_length=340
FT   gap             1029720..1030519
FT                   /estimated_length=800
FT   CDS             1030745..1031542
FT                   /transl_table=11
FT                   /locus_tag="CL3_11660"
FT                   /product="conserved hypothetical protein TIGR00486"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35982"
FT                   /db_xref="GOA:D4MQE6"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQE6"
FT                   /protein_id="CBL35982.1"
FT                   /translation="MKCREIIEILNRLAPESMACDWDNPGLLVGRRDKEVKRVLVAVDA
FT                   DDAVVEEALRLGADMLLTHHPLIFSPLKKINDDDFIGRRILKLIQGDISYYAMHTNFDA
FT                   APGCMAELAAERLQLGETEVLEPMGETEEKVPYGIGAFGMLPREMTVREAAEHVKRAFG
FT                   LPCVSVYGGDKTGQKIQKAAVCPGAGGGTLKQALACGAQVYITGDISHHTGIDAAAEGL
FT                   IVIDAGHFGVEQIFMDFIKEFLEREIPGLEAVKSAQGLPNCVI"
FT   CDS             1031584..1031856
FT                   /transl_table=11
FT                   /locus_tag="CL3_11670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35983"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQE7"
FT                   /protein_id="CBL35983.1"
FT                   /translation="MAFVTVEGERREYPEGTPYSAIAADFREKVSHDILLVRANGRLRE
FT                   LSKKLKGDCEISLITAADREGWQTYQRSAVFLMLKAFYDTVGGIK"
FT   CDS             1031976..1033238
FT                   /transl_table=11
FT                   /locus_tag="CL3_11680"
FT                   /product="Uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35984"
FT                   /db_xref="GOA:D4MQE8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQE8"
FT                   /protein_id="CBL35984.1"
FT                   /translation="MCLPIVKQSINTSEAVEQFHRHGMYDKEKLFRFRRASRVNVYSIG
FT                   NFQDYFYGYMVEHTGFIKYYDLALYESGFVLLLPGRSAPEQIKELVPRKKLFDVQRESE
FT                   EWGERLGISDVGSLNEAITAGRMNELILMQEAFQEKKIGDIAEAVAARPDRKLVMIAGP
FT                   SSSGKTTFSRRLSIQLQALGLRPHPISVDNYFVNRVNSPRDENGNYDYEALECLDVRQF
FT                   NEDMTALLAGEMVELPRYNFISGEREYRGDFLKLGAEDILVIEGIHCLNDRLSYSLPKE
FT                   KKFRIYISALTQLNIDEHNRIPTTDGRLLRRMIRDARTRGASAQETIRMWDSVRRGEEK
FT                   NIFPFQESADVMFNSALLYELAVLKQYAEPLLFGIPSDSPEYAEAKRLLKFLDYFLGVG
FT                   SELIPHNSMIREFIGGSCFRI"
FT   misc_RNA        1033333..1033691
FT                   /locus_tag="CL3_35620"
FT                   /product="Bacterial RNase P class A"
FT   CDS             complement(1033869..1034297)
FT                   /transl_table=11
FT                   /locus_tag="CL3_11700"
FT                   /product="Aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35985"
FT                   /db_xref="GOA:D4MQE9"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQE9"
FT                   /protein_id="CBL35985.1"
FT                   /translation="MLNISGLSEGIVLDHIEAGKSMDIYFKLGLDKLDCQIAIIKNAKS
FT                   SKMGKKDIIKIDGGLDVVDLDVLGYIDHNITVNIIRDSRIVEKRSLDLPRKITNVIQCR
FT                   NPRCITSIEQELPHVFYLADEKKEIYRCLYCEEKYEKK"
FT   gap             1034453..1035331
FT                   /estimated_length=879
FT   CDS             1036953..1038305
FT                   /transl_table=11
FT                   /locus_tag="CL3_11740"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35986"
FT                   /db_xref="GOA:D4MQF0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQF0"
FT                   /protein_id="CBL35986.1"
FT                   /translation="MRFLDLLTMSVNNLRRRKLRTFLTVLGVVIGTASIVVMVSLGIGL
FT                   NNFTMENIRSSGSLTAIEIYNYQNMNGEDVSEDKFMTDETIKSFAEIPHVTSVYPMLTM
FT                   SVLMKQGAYEGYVTMTGVPLDFMKDIPLGKGSRPSPNAEGLEMVVGNMVARNFSNSKTG
FT                   KGYWDTGEEPDVDFMNRPMFVIFDMNAYYQSQSGGTGADGENVQPPKKYMLNTAALVEG
FT                   GPEDYNEYSYSVYVDLEKLKAQLKQVFKKDPIPGQPTNKKGKPYPYFIYEQAVVNVDDM
FT                   DNVKEVQQQLITMGYEASSRMDWLESSQKQSSMVQAVLGGIGAVSLFVAAIGIANTMMM
FT                   SIYERTKEIGVLKVLGCAMGNIRSMFLIEAGFIGFMGGVIGLILSYGVSALVNRFLAPS
FT                   LTAGMSSRLSMIPPWLALAAVGFAVLIGMIAGFFPAQRAMKLSPLAAIRNE"
FT   CDS             1038298..1038423
FT                   /transl_table=11
FT                   /locus_tag="CL3_11750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35987"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQF1"
FT                   /protein_id="CBL35987.1"
FT                   /translation="MSRRLLGEGIRLFGPFQGERKLRLTETQNENGIVEAVYDRR"
FT   CDS             1038675..1039103
FT                   /transl_table=11
FT                   /locus_tag="CL3_11760"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35988"
FT                   /db_xref="GOA:D4MQF2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQF2"
FT                   /protein_id="CBL35988.1"
FT                   /translation="MKLYLEMLLYRVFHAQRKRLRPFMAQIKLAPGQPKILGYLVSHEG
FT                   CMQKDVAEYCDIEPATVSRILDTLEKGGLIRRTVAENNRRAGSLSLTETGLRQYKLWET
FT                   RCQEVEEEMLAGFSEKEKRELTEYLKRIYKNLSGKDAL"
FT   gap             1042089..1042933
FT                   /estimated_length=845
FT   CDS             1043582..1044145
FT                   /transl_table=11
FT                   /locus_tag="CL3_11800"
FT                   /product="peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35989"
FT                   /db_xref="GOA:D4MQF3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQF3"
FT                   /protein_id="CBL35989.1"
FT                   /translation="MSLIGREISEFRVQSYGGGAFREVTKADVLGRWSIFFFYPADFTF
FT                   VCPTELGDLADKYEEFQKLNCEIYSVSCDTHYVHKAWHDASQTIQKIQYPMLADPTGAL
FT                   ARAFDVMIEEEGVAERGSFIVNPEGKIVAYEVIAGNVGRNAEELLRRLQASQFVYEHGD
FT                   EVCPAKWQPGEETLKPSLDLVGLL"
FT   gap             1044742..1045172
FT                   /estimated_length=431
FT   CDS             1046131..1046280
FT                   /transl_table=11
FT                   /locus_tag="CL3_11850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35990"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQF4"
FT                   /protein_id="CBL35990.1"
FT                   /translation="MFLYRIALSIFSLAVCLLFAGTKCEMNMPDRIKTECIKQEVRSIR
FT                   SDTV"
FT   gap             1046775..1047659
FT                   /estimated_length=885
FT   gap             1049736..1050788
FT                   /estimated_length=1053
FT   CDS             1050796..1051203
FT                   /transl_table=11
FT                   /locus_tag="CL3_11890"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35991"
FT                   /db_xref="GOA:D4MQF5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQF5"
FT                   /protein_id="CBL35991.1"
FT                   /translation="MILIDYKDRRPIYEQVVEKMADLMVRGILPQDSQLPSVRSLAMEL
FT                   AINPNTIQRAYAELERQGYIYSVKGRGSFVAENHRILEQKKREVYQKLEALIQDARAAG
FT                   ITMLEFQDRVIELYGTLNRADREEGGGKEFD"
FT   CDS             1051956..1052198
FT                   /transl_table=11
FT                   /locus_tag="CL3_11910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35992"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQF6"
FT                   /protein_id="CBL35992.1"
FT                   /translation="MKGAVLMKCPKCGKDMKSGYLQTTKIVAFNKRKHKISLNPECEDD
FT                   VMIARKTFTGTDFPGFICKERGLILFDYKNDTFRL"
FT   CDS             1052361..1053014
FT                   /transl_table=11
FT                   /locus_tag="CL3_11920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35993"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQF7"
FT                   /protein_id="CBL35993.1"
FT                   /translation="MKKAAISIAVTFGVAFFLFFPWKIEHYEDGGTVTYSSLTYKICVW
FT                   NSLSGKRDISEIYYFPENFKNLTELNDMETLDEKEEAHVMAEDSDGYYALCRLIVATYG
FT                   YVEEEDCFVSDSGPRLHNLIFDGDTEELPVIRWSEDFSLIIPHEVELGSITVLNEKGEK
FT                   VLGLDSESSDGKYFSELPAGTYYVAVEIDRKGDYIEARDEYTYSVEQYAFCLKK"
FT   gap             1053036..1054444
FT                   /estimated_length=1409
FT   CDS             1054717..1055118
FT                   /transl_table=11
FT                   /locus_tag="CL3_11940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35994"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQF8"
FT                   /protein_id="CBL35994.1"
FT                   /translation="MKNKEPVISEKNHTTYIEAIEIDLSSATNEEWKTIVSEKLKSAGR
FT                   FEIHCWNEEEKEIEMALRYGRLKETGWSYGKVIEGKVTEKMADFLLSLPKPTDTEVYNK
FT                   MTPFFSIFLENGFSSEHYGTELNQRERGR"
FT   CDS             1056082..1056702
FT                   /transl_table=11
FT                   /locus_tag="CL3_11970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_11970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35995"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQF9"
FT                   /protein_id="CBL35995.1"
FT                   /translation="MRNVWNRDPYRWYKYKKDWKAIIGQFRLDLRCCRQRITKGYCEKD
FT                   LWSIRDWFLDVVPDMLEEYKKSHHGSTGILGENYQNEEGFLVNDTCHGEWDRILDEMIF
FT                   LFREADERQCRCKNPYEEEHSKAFSLFMDKYGLLGEKLRTPEERKRDSEQNVITYHGMR
FT                   ELPEYKELCKRYDEEEKKLEQYREECKNKAFDLFSKWFYDLWD"
FT   gap             1057130..1057448
FT                   /estimated_length=319
FT   CDS             complement(1059075..1059404)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35996"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQG0"
FT                   /protein_id="CBL35996.1"
FT                   /translation="MERHTYYPVENLITLKAENNALFSQMLAVTGRVYRLCQPAETAIA
FT                   AAVTFMDVAEYLDLLDSLAELLHGINQFFKKQLGRPFFNRIPDYNQWRVKIAVAAALFQ
FT                   EASAL"
FT   CDS             1059403..1059585
FT                   /transl_table=11
FT                   /locus_tag="CL3_12010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35997"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQG1"
FT                   /protein_id="CBL35997.1"
FT                   /translation="MGFLLPYVKIKRGQAGIDTLHALSWYLSVKIMGKDVSRKNQDDRF
FT                   SRKGSEKWVKKAKSN"
FT   gap             1060565..1060786
FT                   /estimated_length=222
FT   CDS             1061320..1062078
FT                   /transl_table=11
FT                   /locus_tag="CL3_12050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35998"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQG2"
FT                   /protein_id="CBL35998.1"
FT                   /translation="MIFEREIGMNDTLLDALWLEGYSISFAVGALKTILDQSGEERVRK
FT                   YCPDITDEILAALKELGKDCTDDEYNLFEKKYEADIMKMQIYEKAYAQAERALEAKKIR
FT                   SWRESSVRESARFLKEMRDNDEEHYDDSVPVAIFTEYEEAPIVPSQFGTECPQKTEDRI
FT                   RLARFFLELEDRSPFSMAELEDFLYSQIREGENTAICRCKTRAVVIRDNYWTQWRIVYV
FT                   SPQEPWYIGYYKGRERVKEIELDEYGRLMD"
FT   CDS             1062236..1062427
FT                   /transl_table=11
FT                   /locus_tag="CL3_12060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL35999"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQG3"
FT                   /protein_id="CBL35999.1"
FT                   /translation="MPANGNGSDIGRRHINASIGNRMAASIFGCIGGGYEYCFTPTAIG
FT                   MLAEIRCACGAKLDVDRI"
FT   CDS             1062464..1063387
FT                   /transl_table=11
FT                   /locus_tag="CL3_12070"
FT                   /product="Nucleoside-diphosphate-sugar epimerases"
FT                   /EC_number="5.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36000"
FT                   /db_xref="GOA:D4MQG4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR008089"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQG4"
FT                   /protein_id="CBL36000.1"
FT                   /translation="MKTLKYWYITGFRKGEWKGCMAHGIVLIQADVADEKAVAQIFEDY
FT                   KPSLVLHLAAQAGVRYSVDHPKEYIRTNIAGFFNILEACRSLREKGEPLHLVFASSSSV
FT                   YGDNQKIPYSVDDKTDSPASLYAATKKSGELLARAYSRLYKIPATGLRFFTVYGPFGRP
FT                   DMAYFKFTERMVKGIPITLYNYGDMRRDFTYVDDVVGCILKISGHPPKSENGCVPFRIF
FT                   NIGNSHPEKLEDFVCLLEESLKRHGVIKKDTEREYLPMQPGDVYQTYADMSEYEKEFGA
FT                   VSFTRLREGLDRFAGWYAEYQRQKRA"
FT   gap             1063988..1064941
FT                   /estimated_length=954
FT   gap             1066059..1067572
FT                   /estimated_length=1514
FT   CDS             1068162..1068470
FT                   /transl_table=11
FT                   /locus_tag="CL3_12120"
FT                   /product="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36001"
FT                   /db_xref="GOA:D4MQG5"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQG5"
FT                   /protein_id="CBL36001.1"
FT                   /translation="MYAIIATGGKQYKVAEGDIIKVEKLGAGAGETVTFDQVLAVNNGE
FT                   LKIGCPTVDGATVSATVVKEGKGKKVIVYKYKSKTGYHKKNGHRQLFTQVKIEKINA"
FT   CDS             1068477..1068806
FT                   /transl_table=11
FT                   /locus_tag="CL3_12130"
FT                   /product="Predicted ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36002"
FT                   /db_xref="GOA:D4MQG6"
FT                   /db_xref="InterPro:IPR007422"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQG6"
FT                   /protein_id="CBL36002.1"
FT                   /translation="MIRVNVFKDSDGNCRGIQLKGHAGYDDYGRDIICASVSALALNMA
FT                   NSVEQFTDDGFDGSVEEESGAFEFSFTGNISAESKLLMDSLILGLRNIAETYGEQYIKI
FT                   RFEEV"
FT   CDS             1068810..1069100
FT                   /transl_table=11
FT                   /locus_tag="CL3_12140"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36003"
FT                   /db_xref="GOA:D4MQG7"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQG7"
FT                   /protein_id="CBL36003.1"
FT                   /translation="MFKMNLQLFAHKKGVGSTKNGRDSESKRLGAKRADGQFVLAGNIL
FT                   YRQRGTKIHPGVNVGRGGDDTLFAKVDGVVRFERKGRDKKQVSVYPRAINE"
FT   gap             1069768..1070752
FT                   /estimated_length=985
FT   CDS             1071076..1071399
FT                   /transl_table=11
FT                   /locus_tag="CL3_12170"
FT                   /product="conserved hypothetical protein TIGR00253"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36004"
FT                   /db_xref="GOA:D4MQG8"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQG8"
FT                   /protein_id="CBL36004.1"
FT                   /translation="MPLPADRGIDMTSKQRAYLKGLAMTIDPIFQIGKSSVTPELTAAV
FT                   AEALEARELIKLSILKNCLDDGKSVAAVLAERTHSEVVQVIGKKIVLYKPAKDEKKRKI
FT                   VLP"
FT   gap             1072315..1073210
FT                   /estimated_length=896
FT   gap             1073825..1074041
FT                   /estimated_length=217
FT   CDS             complement(1074594..1074989)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12240"
FT                   /product="Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36005"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQG9"
FT                   /protein_id="CBL36005.1"
FT                   /translation="MRKGALNQAAKNLGCNKIAYAHHRDDLIDTMLLSLIYEGRFHSFS
FT                   PKTYLDRMDLFVIRPFLYIPEADIIGFKNRYSLPVCKNPCPVDGKTKREYVKQLIKTIN
FT                   MEASGVKDRLFHAIITGNIPGWPERSR"
FT   CDS             complement(1074986..1075264)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12250"
FT                   /product="Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36006"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQH0"
FT                   /protein_id="CBL36006.1"
FT                   /translation="MIESGDKIAVGLSGGKDSLALLYALKHIQKFYPKSFDLCAITVDL
FT                   GFGNFNLEAAQEFCSSLCVPYTIVPIEISQVVFETRKESNPVRSVRK"
FT   CDS             complement(1076205..1076273)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36007"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQH1"
FT                   /protein_id="CBL36007.1"
FT                   /translation="MNLLLFVQTVLEGRNLMLKEIG"
FT   gap             1076965..1077030
FT                   /estimated_length=66
FT   CDS             complement(1077680..1077829)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36008"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQH2"
FT                   /protein_id="CBL36008.1"
FT                   /translation="MTNQLRTYIAAAAALAAASILPVKISQYTDISGLAAFEENEGGED
FT                   EKKI"
FT   CDS             1078068..1078469
FT                   /transl_table=11
FT                   /locus_tag="CL3_12300"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36009"
FT                   /db_xref="GOA:D4MQH3"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQH3"
FT                   /protein_id="CBL36009.1"
FT                   /translation="MNEVVKFLQENPVQYLATVGRDGKAKCRPFMFAGELDGRLWFCTN
FT                   STKEVYKDMQANPNIEISVSSPAYAWIRLNGEAVFENNMAAKEMCIRNPIVKGQYGEAA
FT                   NPIFEVLYLKNAHAVIADFSGNPPKEYDL"
FT   CDS             1078810..1078989
FT                   /transl_table=11
FT                   /locus_tag="CL3_12310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36010"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQH4"
FT                   /protein_id="CBL36010.1"
FT                   /translation="MPLDQLIASFGQFIPFIRTKLDVVLFSAFPFSLLKGIGISLATIP
FT                   LYKRLAPILKGRQK"
FT   CDS             1079000..1079629
FT                   /transl_table=11
FT                   /locus_tag="CL3_12320"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase, alpha
FT                   and beta subunits"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36011"
FT                   /db_xref="GOA:D4MQH5"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQH5"
FT                   /protein_id="CBL36011.1"
FT                   /translation="MQTRNYLKYIAEEIHSSAFATVDSQGRPVTCAIDIMDYDESGLYF
FT                   LTAKGKNFYDRLKANKNIAFTAMKGEDPLSCVAVSVQGKAKEIGPDKLPDLFRKNLYME
FT                   KIYPDIPSRSALTVFKIYEGAGEWFDLSKRPIDRASFSFGGAQAKETGYFVTDKCIGCK
FT                   LCYSKCPQKCIDITQKPVAIEQEHCLHCGNCFEICPAGAVERRQSP"
FT   gap             1079901..1080478
FT                   /estimated_length=578
FT   CDS             1080510..1080791
FT                   /transl_table=11
FT                   /locus_tag="CL3_12340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36012"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQH6"
FT                   /protein_id="CBL36012.1"
FT                   /translation="MTFVEDEGWHRAAKRYEDFLRRHERLHILYLELGVGGNTPSIIKY
FT                   PFWRMTCQNPKAAYACVNLSEAYCPKEIQRQAICIEGDIGRTLNALHS"
FT   CDS             complement(1080939..1081589)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12350"
FT                   /product="hypothetical protein"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36013"
FT                   /db_xref="GOA:D4MQH7"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQH7"
FT                   /protein_id="CBL36013.1"
FT                   /translation="MKHNLVITIGRESGSAGRHIGQLLANELGVKCYDRELLTLAAKHS
FT                   GLCEELFKSHDEKPTNSFLYSLIMDSYSVGYSGGGYLDMPLNQKVFLAQFDAIKKLAEE
FT                   ESCVIVGRCADYALADYPGMVSVFICGNEEDKIRHLMERHNIERSKAKEIMIKTDKRRS
FT                   SYYNYYSSKRWGDCKSYDLCINSSAVGYEGAVKIIKAFAETKMEYRKNKPSEK"
FT   CDS             complement(1081781..1081978)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36014"
FT                   /db_xref="GOA:D4MQH8"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQH8"
FT                   /protein_id="CBL36014.1"
FT                   /translation="MASIGHPLLGDSVYGPSKSPFKLQGQTLHAGVLGIVHPRTGNYME
FT                   FSAPLPEYFSELLDKLRKIG"
FT   gap             1082035..1082751
FT                   /estimated_length=717
FT   CDS             complement(1082888..1083409)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12370"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36015"
FT                   /db_xref="GOA:D4MQH9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQH9"
FT                   /protein_id="CBL36015.1"
FT                   /translation="MNQKARQLIFFVAGLIVSIGFDQWTKALAVAKLKGKEPFVLIDGV
FT                   FEFYYSENRGAAFGIMQGKQILFFIITAAVLLVVILALVRMPASRRYLPLTACLFLLAS
FT                   GAVGNMIDRVSQGYVVDFLYFKLIDFPIFNVADCYVVIATFLLIILAFFVYSEEELSFL
FT                   SSKKGRADSV"
FT   gap             1084518..1084728
FT                   /estimated_length=211
FT   CDS             complement(1084913..1085443)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12400"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36016"
FT                   /db_xref="GOA:D4MQI0"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQI0"
FT                   /protein_id="CBL36016.1"
FT                   /translation="MSILNKIMDTMRLNEPDTDEDDGYFDEEYEEEKPARRRLFNKQHS
FT                   EDYAYEEEPEQKPRFLSRPSSNNKVVPMRRGMEVSLIKPVSMEDSHEICDCLLEGKAVV
FT                   LNMEGIHMEVAQRIIDFTCGATYSMNGNLQKISNYIFIATPETVELSGDFRELLSGTST
FT                   GGNMNIAGLNFHL"
FT   CDS             complement(1085440..1085550)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12410"
FT                   /product="Predicted enzyme with a TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36017"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQI1"
FT                   /protein_id="CBL36017.1"
FT                   /translation="MGMTGDYEVAIEEGATMIRVGTGIFGARTRNGESRA"
FT   CDS             complement(1085541..1086143)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12420"
FT                   /product="pyridoxal phosphate enzyme, YggS family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36018"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQI2"
FT                   /protein_id="CBL36018.1"
FT                   /translation="MIRENLEGVRERIRLACERSGRRVEDVTLISVSKTKPVEMLQEAY
FT                   EAGSRDFGENHVQEILEKHGQMPEDVRWHMIGHLQKNKVRQVIDKVVLIHSVDTVGLAE
FT                   QIEKEAAKRDLDIDILLEVNVAGEESKFGFCPEEVEEAVRKISLLPHVHIKGLMTIAPF
FT                   VVNSEDNREVFKKLYNLYVDIRGKNIDNVSMVCCPWE"
FT   gap             1087042..1087845
FT                   /estimated_length=804
FT   CDS             complement(1089226..1089621)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12460"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36019"
FT                   /db_xref="GOA:D4MQI3"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQI3"
FT                   /protein_id="CBL36019.1"
FT                   /translation="MNIGLVAHDSKKKLMQNFCIAYRGILSRHSLYATGTTGRLIEEVT
FT                   NLNVYKYLPGHLGGTQQLSSQIEHDQMDLVIFLRDPSTAKSHEPDVNNVVMICDMYNIP
FT                   VATNLATAELLIKSLERGDLEWREMYR"
FT   gap             1089948..1091412
FT                   /estimated_length=1465
FT   CDS             complement(1091717..1091998)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12490"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36020"
FT                   /db_xref="GOA:D4MQI4"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQI4"
FT                   /protein_id="CBL36020.1"
FT                   /translation="MIIFRLLGRSNSGEIARRRLKLLLVSDRAGCSPEVLEMIRTDLLH
FT                   AVSRYMEVKEEDVTVQMMRTLPDGRNVPALCATIPVHDINQNKETFTA"
FT   gap             1092123..1092683
FT                   /estimated_length=561
FT   gap             1094443..1094925
FT                   /estimated_length=483
FT   CDS             complement(1095417..1096247)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12520"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36021"
FT                   /db_xref="GOA:D4MQI5"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQI5"
FT                   /protein_id="CBL36021.1"
FT                   /translation="MKNSKYILAGLSLFCIVLIAVTSINNSILAPLRTGVGYVLVPFQS
FT                   GVNAVGTSLYNGIRDLSTLREAQAENEDLKNRVAELTEENNRLQAEQYELERLRELYEL
FT                   DQDYMQYEKVAARVIAKDSGNWFQIFRINKGADDGIRENMNVIAGGGLVGIVTDVGANY
FT                   ATVRSIIDDSSRVSCMSMRSGDNCIVSGDLTLYKEGLLGLDHVKKEADIQEGDKIVTSN
FT                   ISDVFLPGILVGYAKELTTDSNNVTKSGEIVPVAQFDNLQEVLVITQLKDGGEE"
FT   CDS             complement(1097006..1097260)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36022"
FT                   /db_xref="InterPro:IPR025470"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQI6"
FT                   /protein_id="CBL36022.1"
FT                   /translation="MGRAKNFWILLLLLMAGIVLGGFIGEVASGFPALAWLNFGESFGV
FT                   KEPIVLNFGILVITFGLTIRITMASIIGVAVAIIAYRLL"
FT   gap             1097943..1099412
FT                   /estimated_length=1470
FT   gap             1099958..1101266
FT                   /estimated_length=1309
FT   gap             1102441..1102918
FT                   /estimated_length=478
FT   CDS             complement(1104115..1105050)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12610"
FT                   /product="Mismatch repair ATPase (MutS family)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36023"
FT                   /db_xref="GOA:D4MQI7"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQI7"
FT                   /protein_id="CBL36023.1"
FT                   /translation="MCGVPYHAVESYLNKLVQKGYKVAIAEQMEDPKTAKGLVKREVIR
FT                   VVTPGTITNSQALEESKNNYLMGIVYMDGMFGISSVDISTGDYLVTEVKSERTLLDEIF
FT                   KFAPSEIICNEAFYMSGVDLEELKNRLHVVVTALENRFFSDDSCRRLLREHFHVNHLDG
FT                   LGLSEYEAGTIAAGAVLSYLYETQKSTLDHLTAITPYTTGQYMMLDTSTRRNLELTETL
FT                   REKQKRGTLLWVLDKTKTAMGARMLRSFVEQPLIDREGILARQNAIEELNMNYISREEM
FT                   AEYLKRHLRPGTADWPDQLQDGQSEGPDCL"
FT   CDS             complement(1105086..1105214)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12620"
FT                   /product="Mismatch repair ATPase (MutS family)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36024"
FT                   /db_xref="GOA:D4MQI8"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQI8"
FT                   /protein_id="CBL36024.1"
FT                   /translation="MMTHYLETKKQYPDCILFYRLGDFYEMFFEDAKTASRELRSP"
FT   gap             1106009..1106370
FT                   /estimated_length=362
FT   CDS             complement(1107157..1108530)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12650"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36025"
FT                   /db_xref="GOA:D4MQI9"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023970"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQI9"
FT                   /protein_id="CBL36025.1"
FT                   /translation="MERCREAVEAWKAEEGKEAVTFHIETFGCQMNAHDSEKLEGILLE
FT                   AGFVKTDTEEADLVLYNTCTVRENANQRVYGRLGYLNSLKKKNPRMLIGLCGCMMQEDQ
FT                   VVEKIKKTYRFVDVIFGTHNIYKLAELLFARLHTGKMVIDIWKDTDKIVEDLPSERKYP
FT                   FKSGVNIMFGCNNFCSYCIVPYVRGRERSRRPEDIIKEIEGLVADGVVEVMLLGQNVNS
FT                   YGKNLPEPITFAELLRRVEQIEGLERIRFMTSHPKDLSDELIEVMRDSKKICRHLHLPL
FT                   QSGRSRILGQMNRRYTKEQYLALAEKIKTAIPDISLTTDIIVGFPGETKEDFEETLDVV
FT                   RKVRYDSAFTFIYSKRTGTPAAVMENQVPEDVIKERFDRLLSEVQRISNEISGRDVHTV
FT                   QKVLVEEPDTHAEGMVTGRLSNNITVHFEGSRELIGKIVDVYLEESKGFYYMGKLCNR"
FT   CDS             1108730..1108918
FT                   /transl_table=11
FT                   /locus_tag="CL3_12660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36026"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQJ0"
FT                   /protein_id="CBL36026.1"
FT                   /translation="MEIPKNLLISYRIITDRLFLCKKTAKRPVILSAFFAKAEALRPFQ
FT                   ILFGFLIVCLPFFVPTP"
FT   gap             1109893..1109912
FT                   /estimated_length=20
FT   CDS             complement(1110799..1111026)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12700"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36027"
FT                   /db_xref="GOA:D4MQJ1"
FT                   /db_xref="InterPro:IPR009242"
FT                   /db_xref="InterPro:IPR023218"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQJ1"
FT                   /protein_id="CBL36027.1"
FT                   /translation="MNQEKIDRINALYHKSQSVGLSPEEQEEQAALRKEYIEAIRKNLR
FT                   GTLNSIQIKEKDGSITDLGRKYGNVGTVKS"
FT   CDS             complement(1111785..1111910)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36028"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQJ2"
FT                   /protein_id="CBL36028.1"
FT                   /translation="MTAEREALREKKRIVIKIGSSSLTHPETGDLNLQKIKSWFG"
FT   gap             1112767..1113484
FT                   /estimated_length=718
FT   CDS             complement(1114476..1115009)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36029"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQJ3"
FT                   /protein_id="CBL36029.1"
FT                   /translation="MKRYYYIAVIAAAALLIGGIGAGVFLLSKRPEPVSPVPGAVLESE
FT                   TVTQEHEADSSGRESEKDQTGAGKAYGDQSGGGMAAGLPGSLVKAQQAEGRISEDSLSQ
FT                   AGTPGMERETGEEYCLVSENGFLLVFAKDRSSVFLDTHMPLAEFPLAEQERLLDGIWFS
FT                   SMIEVLNYLESFTS"
FT   gap             1115384..1115712
FT                   /estimated_length=329
FT   CDS             complement(1116059..1117609)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12790"
FT                   /product="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36030"
FT                   /db_xref="GOA:D4MQJ4"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQJ4"
FT                   /protein_id="CBL36030.1"
FT                   /translation="MRRKNAGKRQKDHRPEKTVLTVEDIQAVLESQSGSSRQKVQHSRP
FT                   EQGTAALRGNGDMRRPGSGAYGTGSSRGRREPPGGPMQERRQKAGPAARQREDGFSMEE
FT                   GRSRLFSEPRRSRGKGQAHAGRPMSSEGRSERELRPSERARQAEGLRRRPETGEKRGRE
FT                   ASRMAAARPKSRTGSFVVQGTILAAAGIIVRLIGLLYRIPMTNIIGDEGMGYYSTAFNV
FT                   YNIVLILSSYSLPLAVSKLVSARLAKGEFRNASRVLCAALVYATCAGGLACGVVWHFGS
FT                   FFAGTVFKTPFCVYALRTLAPTIWIMAYLGVLRGYFQGHGTMIPTAVSQIFEQIVNAAI
FT                   SVTAAGVLFKVGLDSNRVFETTGYPEAFGAAGGTIGTGAGALTALLFMLFLFAVYRPFM
FT                   KKKIRRDRQGSRESYGHISGVFFMTVMPVILSSAVYNINAVLDNSIMAYGMDALGRGEE
FT                   FLALWGIYNNKYLLLVHVPLAMANALSSSLIPSLAAAVARKQRGKRPERREWLSVFPW"
FT   CDS             complement(1117622..1118119)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12800"
FT                   /product="conserved hypothetical protein TIGR00043"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36031"
FT                   /db_xref="GOA:D4MQJ5"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQJ5"
FT                   /protein_id="CBL36031.1"
FT                   /translation="MTIQIEYEAEKKLNLPYETIIREVVLAALDYEACPYEAEVNVLLT
FT                   DDEEIHRINREFRGIDRATDVLSFPMADYEQPAEFEKLEERPEDYFNPETGELLLGDIV
FT                   ISVDKVEEQAEKYGHSEARELAFLTAHSMLHLFGYDHMEEEERLVMEKKQEAILSLKGY
FT                   TR"
FT   CDS             complement(1118153..1119241)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12810"
FT                   /product="Phosphate starvation-inducible protein PhoH,
FT                   predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36032"
FT                   /db_xref="GOA:D4MQJ6"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQJ6"
FT                   /protein_id="CBL36032.1"
FT                   /translation="MAKGEERQKMSVMETIIDIPMEHERNVCGQFDVYLKKIERTLHVT
FT                   MIARDGALKIIGPEHAIRQAKSVFNNLLELSRRGNAITEQNVDYALSLSFTENDDKILE
FT                   IDKDIICRTINGKPVKPKTLGQKQYVDLIRKKMIVFGIGPAGTGKTYLAMAMAIQAFKN
FT                   GEVNRIILTRPAIEAGERLGFLPGDLQSKIDPYLRPLYDALYQIMGAESYMHNSEKGLI
FT                   EVAPLAYMRGRTLDNAFIILDEAQNTTPAQMKMFLTRIGFGSKVIVTGDQSQKDLPAGA
FT                   ASGLDTAIRVLKGIDDIGFCYLTSGDVVRHPLVQKIVEAYDAYEKKEQRADRQKEKERE
FT                   KKSGRLTLNRGRLAEVKKGRKK"
FT   CDS             complement(1119297..1119653)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36033"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQJ7"
FT                   /protein_id="CBL36033.1"
FT                   /translation="MPDFEEREWSYTAQTFQARIGKNFYLPFFGGTIRADEQVSYWTKY
FT                   TEEELSAMAEEYRRETEAKLIEKGVQIIENNVTILDNDSACLFRLEMITEEPAGSPAPI
FT                   ETGMEQEQPSEGES"
FT   CDS             complement(1119653..1120615)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12830"
FT                   /product="Predicted nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36034"
FT                   /db_xref="GOA:D4MQJ8"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQJ8"
FT                   /protein_id="CBL36034.1"
FT                   /translation="MHVTGLITEYNPFHNGHLFHIRRAREVAGADFLIVLMSGSFVQRG
FT                   APAIFDKYSRARAALLCGADVVAEMPVTFSTASAREFASYGIALFTALGAVDSICFGSE
FT                   CGEIGPLFQTARLLAQEPEGFKEALGNALRQGKTYPEARAAALSSFLPGSDLLSTPNNI
FT                   LGIEYCQAVLRQNSPLSCLTIKREGSGYHDSSISGTLGSALAVRSALEEQVPAPHLASL
FT                   VPPCTMESIKKDVPVFLNDFSSLLNYRLLTEKQPEQYAELKPELASRIRKLSPSPASFD
FT                   ERIKELKSRQFTYTGISRYLPADREGGCLSRRLGRILRF"
FT   CDS             1120936..1121937
FT                   /transl_table=11
FT                   /locus_tag="CL3_12840"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36035"
FT                   /db_xref="GOA:D4MQJ9"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQJ9"
FT                   /protein_id="CBL36035.1"
FT                   /translation="MAFIDLMKAKAKQDKQTIVLPESKDKRTLIAAAKVLEEGTADLIM
FT                   VGKEEKIMDGAGWLEVDLTGLKVVDPDTDPKFDHYAETLFELRKHKGMTKEKAEEILRT
FT                   DYITYGVMMVKEKDADGLVAGACHATADTLRPALQILKTAPGTELVSGFFIMDVPNCEY
FT                   GANGTFLFADCGLNQDPNSEELAAIADSSAKSFRALVGEKPVIAMLSHSTKGSAKHALV
FT                   DKVVKAVEIAHEKYPQLDLDGELQLDAALVPEVAKSKAKGSTVAGHANVLIFPNLDCGN
FT                   IGYKLVQRLAKAEAYGPMLQGISRPVNDLSRGCSAEDIVGVVALTAVQAQMS"
FT   gap             1122550..1122800
FT                   /estimated_length=251
FT   gap             1123577..1123933
FT                   /estimated_length=357
FT   CDS             1124152..1124316
FT                   /transl_table=11
FT                   /locus_tag="CL3_12870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36036"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQK0"
FT                   /protein_id="CBL36036.1"
FT                   /translation="MHCGGKEKCRFRDPPQAENPAKQDFFLFSGTAEQERKYLPQAQSA
FT                   SFCKNIKGL"
FT   CDS             1124636..1125499
FT                   /transl_table=11
FT                   /locus_tag="CL3_12880"
FT                   /product="selenium donor protein"
FT                   /EC_number="2.7.9.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36037"
FT                   /db_xref="GOA:D4MQK1"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQK1"
FT                   /protein_id="CBL36037.1"
FT                   /translation="MIQTVDFFTPIVDDPYMFGQIAAANSLSDVWAMGGEPAVALNIVG
FT                   FPNCLDPAILGEILAGGADKVKEAGAVLVGGHSVQDDEPKYGLCVSGFVHPDKIFKNYG
FT                   CRPGDVLVLTKQIGSGIINTAIKADIASASAVREAQTVMASLNKKAKRAADGCRISACT
FT                   DITGFGLLGHCAEMASASEVTFELKVRDIAYFEDAIDYAKMGLVPAGTYKNRGYSGQKV
FT                   DAGSVEEYYLDLLYDPQTSGGLLFSVAREDLGTLLQNLEKAGMDTAVSVIGTVEPKSDK
FT                   LIRLSL"
FT   CDS             1126011..1126418
FT                   /transl_table=11
FT                   /locus_tag="CL3_12900"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36038"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQK2"
FT                   /protein_id="CBL36038.1"
FT                   /translation="MKYPGEQLKITEMDSSQVVEQIAERRADIGFTGTVLEKKHCKYLP
FT                   FYRDEMVIITPNTEKYRSIKNTSKDISWIRKEHMILREEGSGTRKEAEKQFRSLGIMPE
FT                   ELNVVASIGNQETIKKSVIQGLGISVIQAWP"
FT   CDS             complement(1126510..1126809)
FT                   /transl_table=11
FT                   /locus_tag="CL3_12910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36039"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQK3"
FT                   /protein_id="CBL36039.1"
FT                   /translation="MFFINFFYKSEYLIFIEGLQNFYGLFSAKKQRLCSPGKHVLPLQS
FT                   LCCLFRFITLIFLLYYNKLYLCLSFVISGISYFSPFTLYTSFTVFKNLFAERES"
FT   CDS             1127026..1127715
FT                   /transl_table=11
FT                   /locus_tag="CL3_12920"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36040"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQK4"
FT                   /protein_id="CBL36040.1"
FT                   /translation="MNRKKIWIFAVCIGAALIIGRLSGGAELIQSQKAAAILEKAVEEN
FT                   LLLASGLYLLFTVFGSLFLALPGVTFAVLAGFLFGPVLGTVLCVTAATAGACAAFLAGR
FT                   FFLRDSIRPLAVKNRYLKKWLFDENGRNQMFVLMITRLIPVFPYNLQNFAYGVTDMGFV
FT                   PYTVGSFLFMLPGTAMYTVGAAGLADGKNRALCLGIAAGLAAFAAAAGFYLKKRYVDGE
FT                   NREETAG"
FT   gap             1127772..1129361
FT                   /estimated_length=1590
FT   CDS             1129423..1129815
FT                   /transl_table=11
FT                   /locus_tag="CL3_12930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36041"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQK5"
FT                   /protein_id="CBL36041.1"
FT                   /translation="MRDYRAGCFGIAFHSRNFFMFTCRVISNHRVKDRKVMFGDQGIFV
FT                   DRDLFFEVRMFPEIPIMEDYQFSLTLKEKGVRLGMAGKRIYTSDRRFPKGTIPKLRVMW
FT                   SMNRLRKMYREQVPIEEIARLYQDVR"
FT   gap             1130968..1131448
FT                   /estimated_length=481
FT   CDS             1131464..1131889
FT                   /transl_table=11
FT                   /locus_tag="CL3_12950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36042"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQK6"
FT                   /protein_id="CBL36042.1"
FT                   /translation="MGLGPVGGACYAAAASAVLNNIGMGSGVIPYVLLFQMAEAAAVGI
FT                   LWHGKRFHIVRCLLTVLGGTFLLKPLSFLLYYGFNRQFLGGLSLGEYMAGSYENYLRTG
FT                   WTDTLLLYATGILTGYLLKLLIDYLIEKRNTRKEERS"
FT   gap             1133585..1133907
FT                   /estimated_length=323
FT   CDS             1133920..1134108
FT                   /transl_table=11
FT                   /locus_tag="CL3_12980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_12980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36043"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQK7"
FT                   /protein_id="CBL36043.1"
FT                   /translation="MYELAVNEMNKEKPVYLLCYSGNNCAKTAVSVMKDAGFDTNNLFI
FT                   IENGAKDADVQAAFVTE"
FT   gap             1135399..1137203
FT                   /estimated_length=1805
FT   CDS             complement(1137316..1138422)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13000"
FT                   /product="Uncharacterized Fe-S center protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36044"
FT                   /db_xref="GOA:D4MQK8"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQK8"
FT                   /protein_id="CBL36044.1"
FT                   /translation="MTPSNVYFTTFRTTFHENLLQKLERLVKKAGMLDQIDFSNKYAAI
FT                   KIHFGEPGNLAYLRPNYSRVLVDLIKKNGGKPFLTDCNTLYVGGRKNALDHLDSAYMNG
FT                   YNPFATGCHVLIADGLKGTDDILVPVDGEYIKEAKIGRAIMDADIFISLNHFKGHESTG
FT                   FGGALKNIGMGCGSRAGKMEMHNATSPFILQDQCIGCHACERDCAHGAISFPEKKAFID
FT                   ESKCVGCGRCIGVCPVDAVANHCDESNDILNKKIAEYTLAVLKGRPHFHVSLVVDVSPY
FT                   CDCHAENDVPIVPNVGMFASFDPVALDMACADAVNRQPVMAGSVLSEREHCHHDHFTDV
FT                   HPETNWMVALEHAEKLGIGTREYNLITI"
FT   CDS             complement(1138800..1139150)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36045"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQK9"
FT                   /protein_id="CBL36045.1"
FT                   /translation="MQSFLMFFYILDQCYEQCPENDLGGFLGSISPELWEDGKPMDKAV
FT                   YNDWKDRNDVALLNNQNIISATLDFLQFYQTKFGFDFSKTQSILENTGESEMLEKAATK
FT                   TDLMYKKHNYHD"
FT   gap             1139241..1141098
FT                   /estimated_length=1858
FT   CDS             complement(1141412..1141741)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36046"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQL0"
FT                   /protein_id="CBL36046.1"
FT                   /translation="MNVERLIKRIESRPGMYVGKPSLEAIFHFINGYLYNNIEANRADD
FT                   VDMAFKNYFHEWVKVSLEKDYSIKFDEQRNYIFYINQIFQDTEQRITAFFQLSNNFFSE
FT                   IDKHK"
FT   gap             1141987..1143256
FT                   /estimated_length=1270
FT   CDS             1143466..1143870
FT                   /transl_table=11
FT                   /locus_tag="CL3_13040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36047"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQL1"
FT                   /protein_id="CBL36047.1"
FT                   /translation="MDKITHQVRAEHWAKIMNECINSGMSKTAWCRVNGISVKQFFYWQ
FT                   RILRREAFENSRNSLLPAAAGPHREMAPMVPATQRTVSFTEIKLPSSSQSTAPVFHPDL
FT                   VIRKGSLILEISNSASDELLSRIGGILGAE"
FT   gap             1145095..1146079
FT                   /estimated_length=985
FT   gap             1149466..1150345
FT                   /estimated_length=880
FT   gap             1154799..1155737
FT                   /estimated_length=939
FT   CDS             complement(1156007..1156822)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13130"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36048"
FT                   /db_xref="GOA:D4MQL2"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQL2"
FT                   /protein_id="CBL36048.1"
FT                   /translation="MDRNAPIGVFDSGVGGLTVAREIMRQMPEEKLVYFGDTARVPYGT
FT                   KSQETVIRYSRQIIRFLRTKEVKAIVIACNTATACALETVEKDLDIPIIGVIHAGARAA
FT                   VEATKNRKIGIIGTEATIRSGVYTELMKQMNPAIEVTGKPCPLFVPLVEEGLLHDSVTD
FT                   EIASRYLASLKEKYIDTLVMGCTHYPLLRSTLARLMGEEVTLINPAYETARELKSLLGE
FT                   KELTCIPGEAGGEKYQFFVSDMAERFKSFATAILPGEVKETRKINIEEY"
FT   CDS             complement(1156846..1157952)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13140"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36049"
FT                   /db_xref="GOA:D4MQL3"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQL3"
FT                   /protein_id="CBL36049.1"
FT                   /translation="MTINIEKDTEGEERQMKTKVLVVFGGQSSEHIVSCMSAVNVINHI
FT                   DREKYDVVIVGITEEGKWLYVDSVESIRDESWRDKSVGAVFSPDATEKCVLIERERGVE
FT                   KVPVDVAFPVLHGLYGEDGTIQGLFELARLPYVGCGVLASAVSMDKLYTKIVADTLGVR
FT                   QAAYVPVMRGELSHMESVTERVEKHFSYPVFIKPSNAGSSRGVSKASDRSELENGLREA
FT                   AKHDRKILVEEMIVGREVECAVFGGGNGEVIASGVGEILAAADFYDFDAKYYNEESRTV
FT                   VNPELPGDAAEKVREAARRIFTAVDGYGMARVDFFVTEQGEVVFNEINTIPGFTAISMY
FT                   PMLFEAAGVDKTELVTRLIENGRVRYDS"
FT   CDS             1158169..1158972
FT                   /transl_table=11
FT                   /locus_tag="CL3_13160"
FT                   /product="Stage II sporulation protein R (spore_II_R)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36050"
FT                   /db_xref="InterPro:IPR014202"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQL4"
FT                   /protein_id="CBL36050.1"
FT                   /translation="MKSFSRFLKRCSDAGSYKCMYLSLAAACLAVSLTLYISSARKQEE
FT                   AVASSVAPQVLRFHVLANSDSNEDQKLKFGVRDLLLEEIRRGFSSDEEGEEQTSQKARL
FT                   QSYILLHRDELETLAESFLEEQGKPDQVQIRLESAYFPTRFYGDIVFPCGIYDAVRVII
FT                   GEGSGHNWWCVLYPSLCFTEEACAVVPSESRKELACLLDESVFEEISADRRLVFGESAG
FT                   IAQNEREGGKESPFSRQTPSGEDSRPDASEKPVVHISLRILEFFR"
FT   CDS             complement(1159100..1159180)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36051"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQL5"
FT                   /protein_id="CBL36051.1"
FT                   /translation="MNVPFRNTGGRADIRKGSADRKQEKA"
FT   gap             1159481..1159858
FT                   /estimated_length=378
FT   CDS             complement(1160098..1161255)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36052"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQL6"
FT                   /protein_id="CBL36052.1"
FT                   /translation="MKRKQAAAAALALLMTVGVPGAALAGPSGADGGAAEAREASLNDG
FT                   LLEYDELPELVESYNVTYKNTYSQTVNQSQNLDAARQLGKDANELMEEALDLKDDDMDE
FT                   ATRALYESYKESAKAMRKQAAELSTEELSGTVERSMKMLKNQQTMLAQNLLIQYQSAVS
FT                   GKELADKNEELAKASLDAVTAQASLGMASSEDVLKANQAWIQAQSAAVQLDSTIRNLKQ
FT                   NLLITCGWEGDADPEIAPLPAPDPARVDSMNLAADTETATQANYSFISLRQGAASGSVS
FT                   RNAKKRNVSQMRQSIAVGMEGLYAKAVAAKQAYEGAEANFQAAALDMQAADQKNAMGMM
FT                   SRTAYLQAQASYLAAKSERDTAQTELFTAIQNYDWALKGMMVSGS"
FT   gap             1162520..1162652
FT                   /estimated_length=133
FT   CDS             complement(1163331..1164431)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13250"
FT                   /product="RND family efflux transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36053"
FT                   /db_xref="GOA:D4MQL7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQL7"
FT                   /protein_id="CBL36053.1"
FT                   /translation="MKKSKIVIAAVVAVAAVMIVPRFLKPKEEVNSAAVPVVSVANPEI
FT                   GTIEIYTDLSGSIEPSEMASIIPKAAGEVTEIYVKAGDVVTEGQPICHIDTKMVDTAKN
FT                   SMDTAAVNLDNANRELERSRVLFESGNLSQQAYEQAQSSAELARLQYDSAKIAYDNQVE
FT                   YSSITAPIAGKVESVSVEVHDNVSTQNIICVISGEGAKQVNFAVTERVVGGLHVGDTVE
FT                   IDKNGTVYEGTISEVSTKIDDDTGLFNVKASLTEAQALATGSRVKLSVVSEHADNVLTV
FT                   PTDAVYYSGGKPNVYTYDNGTVHEVPFEVGIFDAEKTEVISGLTADDQVIVTWSSELYE
FT                   GSQVELAGADETTGETADETEEQAAE"
FT   CDS             complement(1164523..1165191)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13260"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36054"
FT                   /db_xref="GOA:D4MQL8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQL8"
FT                   /protein_id="CBL36054.1"
FT                   /translation="MPSERFYRLSEEKRKTICEAAIREFARVTMDKVSINQIIKNADIS
FT                   RGSFYTYFEDKWDIVSYIFEDIQEKLIILVKDRARKTGGDIFAVMDCIMQEILQFCCSR
FT                   PNFDFLKNIMLHMNSDDMFGGRLSKKKNEEYAKTGEQVERWLYEHADQAKTHFTKFEDF
FT                   HCLFALGMASVAMAIREIYDGVPLEDARRNYSQRMEILKYGSMRRDVQENPSLRMQNHT
FT                   "
FT   CDS             complement(1165566..1166786)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13280"
FT                   /product="Predicted oxidoreductases of the aldo/keto
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36055"
FT                   /db_xref="GOA:D4MQL9"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQL9"
FT                   /protein_id="CBL36055.1"
FT                   /translation="MTFKELYVSGQIEFEEIDRYISRWNRSDDERTLAKYLGLNAKEED
FT                   VWIDESDEALKELLDSYEKVKGTPVTLGRTGIFVNKNGFGALPIQRIGKEEAALLLRKA
FT                   FDAGVRYFDTARAYSDSEEKIGYALSDVRDQIFIATKTMADTPEKFWKDLEESLLKLKT
FT                   DYIDIYQFHNPPVCPKPGDETGLYDAMLEAKKQGKIRFIGITNHRIDVAEEAVESGLYD
FT                   TLQFPFNYLSTERETALAEKCLKKDMGFIAMKGLSGGLLTNAAAVYGYMAQFENVLPIW
FT                   GVQRESELDEFLHFIEQPPVLDDELKAVIEADRKALAGEFCRGCGYCMPCPAGIEINNC
FT                   ARMSLLLRRSPSAGHLSPEGQEKMKKIEGCLHCGQCRSKCPYGLDTPRLLEENYKDYME
FT                   VLAGKPL"
FT   CDS             complement(1166783..1167469)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13290"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36056"
FT                   /db_xref="GOA:D4MQM0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQM0"
FT                   /protein_id="CBL36056.1"
FT                   /translation="MRKMGNNFQVNMNEYLPLRDVVFNTLRQAILKGELAPGERLMEIQ
FT                   LAEKLGVSRTPIREAIRKLELEGLVLMIPRRGAEVARISEKSMRDVLEVRRSLEELAIE
FT                   LACQRMTDEEFKELQRAQEAFKSAVEHGSAMEIAETDEAYHDIIYNSTGNMRLVQILNN
FT                   LREQMYRYRLEYIKDEDKRQILLVEHNKIYRALCSRHVEEAKQAMREHIDNQEITVLKN
FT                   IKEQEE"
FT   CDS             complement(1167466..1168377)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13300"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36057"
FT                   /db_xref="GOA:D4MQM1"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQM1"
FT                   /protein_id="CBL36057.1"
FT                   /translation="MIKHLGLKAYGKINLGLDVVRRREDGYHEVRMIMQTVGLYDRIDL
FT                   YRREKPGIGIETNLYYLPNNENNLAVRAARLLMDEFGITEGIDIRIKKLIPVAAGMAGG
FT                   SADAAALLFGVNKMFSLGLSMEELMKRGVKLGADVPYCIMRGTALSEGIGEILTPLAPV
FT                   PQCQVLIAKPGVSVSTKFVYENLHVDRLPGEAHPDIDLLTEAIKERNLRKIASNMGNIL
FT                   ETVTIPAHPVIRDIKEKMMDMGAVGAMMSGSGPTVFGLFMSPGKAQAAYEEMRYGSGSA
FT                   MAKQVYLTRFYNRSTDAGQTGE"
FT   gap             1168737..1169668
FT                   /estimated_length=932
FT   CDS             complement(1169674..1171023)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13320"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36058"
FT                   /db_xref="GOA:D4MQM2"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQM2"
FT                   /protein_id="CBL36058.1"
FT                   /translation="MIQFLRDLVWGPWLMALFLLTGLYFTIRFRFFQVLRANVWWRETA
FT                   GSLAAGRRTREKKGQFASACTALAATVGTGNIAGVATAVTMGGPGAVFWMWASALLGMM
FT                   TAYAEVYLGRKYRYLGSDLRPICGPYAYLERGLGMRGLGCLYAVLCILSSLGMGSMVQA
FT                   NSVAESAAFSAGIPLTVTGFVLTALVMAVIFGGARRISQAAVGLVPFSAAFYMGLCAAV
FT                   ILANLPEIPSVFAGIFRDACSVDSAAGGMAGIFVSRAVRYGISRGVFSNEAGLGSLAVL
FT                   HGEADEEDQERSRERFACEQGMWAVFEVFFDTMVSCTMTALVILCGKNPMKGYSGSAGV
FT                   AACFSACFGDAGGILVSLSMSLFAFATIIAWFYLGRQALAYLTDGFSWQRTAVLCYGFF
FT                   YLNAVFFGCVARLTLVWNLSDIFNGLMAVPNLIGVFLLRREVRLPALRQK"
FT   gap             1171175..1172167
FT                   /estimated_length=993
FT   CDS             complement(1172389..1173159)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13350"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family (TC 3.A.1.3.-)"
FT                   /EC_number="3.6.3.21"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36059"
FT                   /db_xref="GOA:D4MQM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQM3"
FT                   /protein_id="CBL36059.1"
FT                   /translation="MNILEIKNIEKSFGENKVLRDISLSVKDGEIVSVIGPSGSGKSTL
FT                   LRCACMLETMDRGSVVYEGEPAVWNEGDGRVQYADKKRLRELRALYGLVFQNFNLFPHY
FT                   SVLRNVMDAPIHVQKRGRDEVKREAMALLEKMGLSDKADMYPCQLSGGQQQRVAIARAL
FT                   ALNPKILFFDEPTSALDPELTQEVLKVIKSLADLKIAMVIVTHEMAFAKDISDRVIFMA
FT                   GGVIEEEGSPEQVFASDNERTRAFLGKYYGKTEG"
FT   CDS             complement(1173236..1173886)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13360"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family (TC 3.A.1.3.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36060"
FT                   /db_xref="GOA:D4MQM4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQM4"
FT                   /protein_id="CBL36060.1"
FT                   /translation="MDLVQILKQLAGGMGTSIEIFAVTLIFSLPLGLLISFGRMSKNPV
FT                   IRTIVKFYISIMRGTPLMLQLMVVYFGPYYLLGIRVGNDYRLWAAFIGFVINYAAYFAE
FT                   IYRSGIQSMPAGQYEAAKMLGYSRTQTFFRIIFPQVIKRILPSITNEVITLVKDTSLAF
FT                   TISVMEMFTVAKALASSQVSMIPFVAAGLFYYVFNLLVAVVMEHAEKRLNYYS"
FT   CDS             complement(1173911..1174837)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13370"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family (TC 3.A.1.3.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36061"
FT                   /db_xref="GOA:D4MQM5"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQM5"
FT                   /protein_id="CBL36061.1"
FT                   /translation="MKKKVFSVMTAAALVFSLTACSTNAKTEEPETAAQSSASQTEAAG
FT                   AETAESSGGASAEAGEKAASGETKAAGDTFTVGFDQDFPPMGFVGDDGEYTGFDLELAA
FT                   EVADRLGLTFVPQPIAWDAKNMELESGNIDCIWNGFTMTGREDEYTWSEPYMENSQVVV
FT                   VLEDSGIESTADLAGKIVEVQADSSAEAALKEMPELTESFAALQTTPDYNTAFMDLEMG
FT                   SVDAIAMDVIVAGYQLQQRDGGFKILDDTLASEEYAIGFKKGNEALRDQVQTVLDEMAS
FT                   DGTMKESPRSGLEKILRQSANKRAASG"
FT   gap             1175220..1175346
FT                   /estimated_length=127
FT   CDS             complement(1175513..1176145)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36062"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQM6"
FT                   /protein_id="CBL36062.1"
FT                   /translation="MKKILVLLACAAALSGCAPKSNIVQPDSTEGTVAGEPDFDVKDDV
FT                   EIDWQQASTDAEDMFEDTDEYPYSVDFHFLLEPEKKEIMLVWVVKDDFPSSELAEYADT
FT                   LIKGFNDMIATQDFSIERSSDTSYGGLWKRYGLSFGIAAESTQDDESTWLISASYPAGT
FT                   EFVLPSAGEIQKAMDRAESGESAEETASAESTDAAGETQGASEAAAQ"
FT   gap             1177317..1178098
FT                   /estimated_length=782
FT   CDS             complement(1178270..1178605)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13420"
FT                   /product="Predicted pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36063"
FT                   /db_xref="GOA:D4MQM7"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQM7"
FT                   /protein_id="CBL36063.1"
FT                   /translation="MNEREARRQILDLVADYCREYHNKKAPFKAGDRIPYASRVYDEQE
FT                   MVNLVDSALEFWLTSGRYTDEFEEELAKYLGVRYCSLVNSGSSANLVAFMTLTSPLLGE
FT                   RRVKRRG"
FT   CDS             complement(1178732..1179868)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13430"
FT                   /product="CDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36064"
FT                   /db_xref="GOA:D4MQM8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR013445"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQM8"
FT                   /protein_id="CBL36064.1"
FT                   /translation="MPRGKPGKLTEEKENQSEERERKRQMKKKEVLDFYRGKKILITGH
FT                   TGFKGSWLSEILLLAGARVTGYSLNPPTEPSLFELLGLSERMNSVTGDVRDLRHMKQVF
FT                   EETQPEIVLHLAAQPIVRDSYKDPVYTYETNVMGTVNLLECARLTPSVRSLVNVTTDKV
FT                   YENREWEYGYRETDRLDGYDPYSNSKSCSELVTHSYVKSFFAGSSTAVSTCRAGNVIGG
FT                   GDFANDRIIPDCVRAAEKGQDIVVRNPHSTRPYQHVLDPLFLYLTVAMAQYEDPSFAGY
FT                   YNVGPDDADCLTTGELVDLFCSLWGENLRWMNRSDGGPHEANFLKLDCSRVKKTFGWKP
FT                   GMHVEEAVKKTVEWSKLWLSGGDVRAVTDQQIEEFSET"
FT   gap             1179930..1180989
FT                   /estimated_length=1060
FT   gap             1182160..1182179
FT                   /estimated_length=20
FT   gap             1182858..1183950
FT                   /estimated_length=1093
FT   CDS             complement(1185355..1186425)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13500"
FT                   /product="Predicted kinase related to galactokinase and
FT                   mevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36065"
FT                   /db_xref="GOA:D4MQM9"
FT                   /db_xref="InterPro:IPR001174"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014606"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQM9"
FT                   /protein_id="CBL36065.1"
FT                   /translation="MVIRAKAPLRVSFGGGGTDVEPFCVEQGGAIIGSTINKYAYCSII
FT                   PREDDQIVVHSLDFDMTVKYNTKENYVYDGKLDLVTAALKAMDIKKGCEVYLQCDAPPG
FT                   SGLGTSSTVMVALLSAMAKWKGIELDGYAMADLAYGVERLDLGIAGGYQDQYASTFGGF
FT                   NFIEFHGRNNVIVNPLRIKKDIIHELQYNLLLCYTGNIHVSANIIKDQVSNYRKQDAFD
FT                   AMCEVKALAYAMKDELLRGNLHSFGKLLDYGWQSKKRMSSKITNPQIDELYDEAKKAGA
FT                   LGGKLLGAGGGGFLLMYCPYNVKHKVAARMEQVGGQLMDWNFELRGVQSWCCDSERWKY
FT                   GEVSVRMPDRNYTFKL"
FT   CDS             complement(1186419..1187129)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13510"
FT                   /product="Nucleoside-diphosphate-sugar pyrophosphorylase
FT                   involved in lipopolysaccharide biosynthesis/translation
FT                   initiation factor 2B, gamma/epsilon subunits
FT                   (eIF-2Bgamma/eIF-2Bepsilon)"
FT                   /EC_number="2.7.7.13"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36066"
FT                   /db_xref="GOA:D4MQN0"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQN0"
FT                   /protein_id="CBL36066.1"
FT                   /translation="MQAILLAGGLGTRLRSVVSDRPKPMALIEGRPFMEYVVRGLARHG
FT                   IADIIFAVGYKGSMVEEHFRDGSNLGIRASYAYEEELLGTAGAIKNAGRFVTEERFFVL
FT                   NADTYYSLDYSRLAKLQAEKSLDMALVLREVDDISRYGAATLTDGMLTGFNEKLEGEKR
FT                   PGTINGGVYLMDRRLLKEIPEGKVSLEQEMIPRWMKEGKRLGGFVNEGYFIDIGIPEDY
FT                   FRFQEDVKKGVVSW"
FT   gap             1187475..1188049
FT                   /estimated_length=575
FT   gap             1189434..1190025
FT                   /estimated_length=592
FT   CDS             complement(1190440..1191606)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13560"
FT                   /product="Bifunctional PLP-dependent enzyme with
FT                   beta-cystathionase and maltose regulon repressor
FT                   activities"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36067"
FT                   /db_xref="GOA:D4MQN1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQN1"
FT                   /protein_id="CBL36067.1"
FT                   /translation="MQETVKYRDRKNTDCEKWDGLKEQFGKAELLPAWVADMDFEAPAC
FT                   VQEALRKYVDFNVYGYYKVPEDYWQSFISWERKYHSYQVEKEWIRFVPGVVPAIYWLIQ
FT                   MLTGEGDSVLVMPPVYYPFFHAAEETGRRLIRCPLRCRDGVYEMDTELFEKKIKEEKVR
FT                   LFILCSPHNPVGRVWTREELKTILDLCLENHVFVIADEIHQDLITGEREQTAAAAVGSY
FT                   DSILITLTSAAKTFNLSGCQNGFLIIPDSGLRQRYDETARRLHLTEGGAFGYIAVQAAY
FT                   QGGRQWLEKALCLVRDNYVCLKEALSQSLPEAVISPLEGTYLAWVDLSGAVKKERVKEL
FT                   VQNRCGLAVDFGEWFGGREYEGYIRINLATSRENVKEIADRLSLLIEG"
FT   gap             1191814..1192770
FT                   /estimated_length=957
FT   CDS             complement(1193448..1193519)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36068"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQN2"
FT                   /protein_id="CBL36068.1"
FT                   /translation="MKALPFYEKAGADCSENYRRRQV"
FT   CDS             complement(1194105..1194914)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13610"
FT                   /product="Retron-type reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36069"
FT                   /db_xref="GOA:D4MQN3"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQN3"
FT                   /protein_id="CBL36069.1"
FT                   /translation="MQVDELLPYLINHRDELVRQLREGKYKPNPVRRVEIPKEEKGKFR
FT                   KLRIPTVVDRMIQQAIAQELTPIYEEQFSDNSYGFRPGRSAHDALAKCRKYVDEGHVYA
FT                   ISMDLEAYFDTVNHSKLIEVLSRTMKDGRVISLIHRYLNAGVMEDGGFHATPEGVPQGG
FT                   PLSPLCGNVMLNELDKELERRGHKFVRYADDCIILCKSRKSAERTLKHIIPFITEKLYL
FT                   KINLEKTTVSHISKVKYLGYGFYRYKGKCRMRVHPRSIKKMKTISGN"
FT   gap             1194937..1195654
FT                   /estimated_length=718
FT   CDS             complement(1195861..1197072)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13630"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36070"
FT                   /db_xref="GOA:D4MQN4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQN4"
FT                   /protein_id="CBL36070.1"
FT                   /translation="MAKKKTQIPKYGTITLKGIQYYRTRITDADGKELSLYAATCEELY
FT                   EKQLEARKKVEEIIFHRQHPTVAEYGEKWLLMQSAKVSASTLRGYTRDMTNYIIKPLGE
FT                   MYMEEVTADDIRLALVPLSKKSEGLYNKVNMLLKCIFYAAERNQILEHNPCAGISGKGG
FT                   KPTKKKEALTDQQVAVLLDTVKGLPPYLFIMLGLYSGLRREEILALQWDCVFLDEDTPY
FT                   LSVRRAWRTEHNRPVVSTVLKTPAAKRDIPIPKCLVDCLRETKENSISDYVIADSKGEP
FT                   LAASQFQRVWQYVVVRSTKPRNYYKYVNGESIKYTVTPTLGMTQKNQPQIKYTLDFDVT
FT                   PHQLRHTYITNLLYAGVDPKTVQYLAGHENSKTTMDIYAKVKYNKPEELFGVVNGAFHQ
FT                   AIAE"
FT   gap             1197876..1198740
FT                   /estimated_length=865
FT   CDS             complement(1198774..1199142)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13650"
FT                   /product="Mn-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36071"
FT                   /db_xref="GOA:D4MQN5"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQN5"
FT                   /protein_id="CBL36071.1"
FT                   /translation="MKIHASGEDYLEAILVLQKKMGMVRSIDLARHMGFSKPSISHAVG
FT                   VLKNGGFLTVDDDGFLHLTVIGREIAEKIYERHLFFMEQFIAAGVDQETAEQDACRIEH
FT                   AISDTSFRKLKEKVQGTD"
FT   gap             1200571..1201911
FT                   /estimated_length=1341
FT   gap             1202979..1204539
FT                   /estimated_length=1561
FT   gap             1205334..1207520
FT                   /estimated_length=2187
FT   CDS             1207684..1207827
FT                   /transl_table=11
FT                   /locus_tag="CL3_13690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36072"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQN6"
FT                   /protein_id="CBL36072.1"
FT                   /translation="MIEQLIAEATECDFKVALEIKKPKSWLKSVSAFSNGIGGTLFFRS
FT                   LR"
FT   CDS             1207824..1209104
FT                   /transl_table=11
FT                   /locus_tag="CL3_13700"
FT                   /product="Predicted transcriptional regulator containing an
FT                   HTH domain and an uncharacterized domain shared with the
FT                   mammalian protein Schlafen"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36073"
FT                   /db_xref="GOA:D4MQN7"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQN7"
FT                   /protein_id="CBL36073.1"
FT                   /translation="MTGEPIGLSDVQKDAEAISRLIKERITPLPQFILKPLQEDGKNLL
FT                   ALEVSPGRSTPYYYKADGVMEAYIRVGNESVIAPDYIVNELILKGTNQSFDTLTTDAVK
FT                   KDYSFTLLEATYLERTGLRFEPSDYVSFGLADKNGVLTNAGKLMTDQHTVYNSRMFCTR
FT                   WNGLEKGSIFDDALDDKEYEGNLIYLLKSGSEFIRNNSKVRFVKEAQYRVDKPDYAERA
FT                   VTEALVNALIHRDYIVLGSEIHIDMFDDRVEITSPGGMFGGGSIQEYDIYSIRSMRRNP
FT                   VIADLFHRMKYMERRGSGLRKIVSETEKLPGYTAAYKPEFSSTATDFRVILKNVNYHLS
FT                   QKDLVSDQDCDQVSDQDKSQDILHAVLDFCITEKSKQEICSFIGYRNLTYFTRKYLNPL
FT                   LASGQLKMTIPDKPNSRKQKYITVRSE"
FT   gap             1209365..1210114
FT                   /estimated_length=750
FT   gap             1212473..1212884
FT                   /estimated_length=412
FT   gap             1215105..1215135
FT                   /estimated_length=31
FT   CDS             complement(1217140..1217484)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36074"
FT                   /db_xref="InterPro:IPR026989"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQN8"
FT                   /protein_id="CBL36074.1"
FT                   /translation="MTYIQNGDYLIPDLKLSQQPEKTLGKYGRMRKTYLKEHRPILYNQ
FT                   MLMSEKLYQHLLEIDETAQSRLEQMMPQLAKEAGATEELKASDPMKWVGLMNNCKAQAE
FT                   EILMAELINS"
FT   CDS             1217483..1218250
FT                   /transl_table=11
FT                   /locus_tag="CL3_13750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36075"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQN9"
FT                   /protein_id="CBL36075.1"
FT                   /translation="MGLFILFTPFLVGFALCISDGDADLPQHLLVDLADRCSQRPDGGR
FT                   GVEIKDRHEIFVVEVAFRLQSAAGHQSVSDADGGCCLELHSDVILIIFLQKGTVNDIEE
FT                   VLLMLRPVFLSQFSGYLGELSGKVITGNIIGALKHGLHGIQMALLQLPQPGSAGMFTGS
FT                   GVGNVKDIAQAGPVPGIVHQSNPFGAAPYIPAHLFIPQIVLCTGGSVRALGVDHQLLME
FT                   RVLVKSGSSGEKPCPFLPAPRELRCHLVRHLCI"
FT   CDS             complement(1218346..1218561)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36076"
FT                   /db_xref="InterPro:IPR025468"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQP0"
FT                   /protein_id="CBL36076.1"
FT                   /translation="MGNFTFEEMNLMCIYNTGSRTGLIDSLREMRGELAPEETELRELT
FT                   DSALGKLQAMSDAEFAELELYPDFDQ"
FT   CDS             complement(1218563..1221934)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13770"
FT                   /product="DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36077"
FT                   /db_xref="GOA:D4MQP1"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR025465"
FT                   /db_xref="InterPro:IPR025923"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQP1"
FT                   /protein_id="CBL36077.1"
FT                   /translation="MAENVFEAVKQSVSTRDAAAFYGIEVKRNGMACCPFHDDKNPSMK
FT                   LNEEYFYCFGCGATGDVIDFTAKLFDLSPKEAAEKLAQDFGLIYDSQAPPRRRYVRQKT
FT                   EAQQFREDRQRCYRVLSDYYYLLKKWEADNSPRTLEEEPHPRFVEAIQKKTYVEYLLDL
FT                   FLYESEEEQRAWIAEHTAEITHLERRLKIMAENKPTNRERLREITDGIEQGIKELFESE
FT                   KYMRYLSVMSRFHRYSVNNTMLIYMQKPDATLVAGYNKWKDQFERHVKKGEHGITIIAP
FT                   TPYKKKIEEQKLDPDTKAPILDKDGKIVTEEKEIEIPMFRPVKVFDVSQTDGKPLPELA
FT                   SSLSGNVPNYEAFMEALRRSAPVPITFEAMAADTDGYFSADHQKIAIRQGMSEVQTVSA
FT                   TVHEIAHSKLHNQKKIQIANDEQYQEIELFDKPGLFSNGRIARDNLPEGVYCYDLRGSD
FT                   YDPGEPVCVEEQVVVNHAGSVLLTEPLELAEDGRLMLTEEEGLNFVGGFSTLTQFLQEH
FT                   RKDRHTEEVEAESISYAVCKYFGIETGENSFGYIASWSQGKELKELRASLETINKTSGT
FT                   LISDIERHYKEICKERGIDPHAKAEPETAPIEQPTGNLTYYVAECMEFPNLGEYHDNLS
FT                   LEEAVRIYQEIPAERMNGIKGIGFELKDGSDYEGPFPILTGQTIDLDTIQAIDYYRDNP
FT                   LVQKAVKELAAAMPEMEVLGADANRQEALFLINDTTYLHIQPCDSGWDYTLYDAASMKE
FT                   LDGGQLDMPELSCMKVVLQICDDNDLDSTSLRRAPLSMVETLQEAAYEQMQAEASQMTA
FT                   SSQLPEAQEQALDEYPMPDEQVSTPDMQEYGYSYDGMLPVTRERALELDAAGLTVYVLH
FT                   EDNTESMVFDPQEIMDHGGLFGVDHEEWEKSPQFHEKVMERQEHQQEREQAFLSQNRDC
FT                   FAIYQVSRDDPQNVRFMNLDWLKSHDISIDRSNYDLIYTAPLRESGTVPEQLEKLYQQF
FT                   NLEKPVDFHSPSMSVSDIVAIRQDGKVSCHYCDSVGFTQIPGFLPENPLKNAEMALEDD
FT                   YGMIDGIINNGAKEPTVAELEQQARSGQPISLMELAAATHREEREKKKSVMEQLKGQPK
FT                   TEHKKTAPKKSAEREI"
FT   CDS             complement(1221941..1222219)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36078"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQP2"
FT                   /protein_id="CBL36078.1"
FT                   /translation="MKLSLVERETILLYNQAEPMAEIYTHDPRLMEKLDLLAKKHPDQI
FT                   TRKDAHNFTVPKRCVSVREPYSAERRKAASERAKAAGYQPPVRKSSS"
FT   gap             1224084..1224163
FT                   /estimated_length=80
FT   CDS             complement(1224346..1225029)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36079"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQP3"
FT                   /protein_id="CBL36079.1"
FT                   /translation="MSVLIIFIKLIAVFDLLVIAVYFGGDILSTMLNKLWRKPKQDDPF
FT                   DFSLDTTTVSLSIDSIRQLYSGDAADFVEEKILPNAEKTMAVLTEQEQTAAHLLLSALI
FT                   GFLAAEAPMDEQSFPLMMELLNCMEGEKEDGCQDAVDSLLEDAACNTRRHEEYYSNYQR
FT                   YQLMQVDKTRVILACRIIINDLLGKLYRYDYRFGYNLLLDEENSIEKKLHTPVREEWEA
FT                   EDDEI"
FT   CDS             complement(1225217..1225981)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36080"
FT                   /db_xref="InterPro:IPR025376"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQP4"
FT                   /protein_id="CBL36080.1"
FT                   /translation="MRNKRLLRTLSAFCLTMVVAFGFTIPAFAQGSEQAPAAPAEDSTN
FT                   DSNVIVEETEPAPALTPEGNAALVDDFGGNKQLITVTTKAGNYFYILIDRANEDKKTAV
FT                   HFLNQVDEADLMALMEDENVKEEPAAVCSCTTKCEAGAVNTACPVCATDKSKCTGKAPE
FT                   PPAETPEPEKEKPAGLNPAAIVLLLALLGGGGVFAYLKLIKNKPKTKGNDSLDDYDYGE
FT                   EDSEEWETEDEESDEPDADGGSTEEDDEDSVK"
FT   CDS             complement(1225971..1226222)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36081"
FT                   /db_xref="InterPro:IPR025464"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQP5"
FT                   /protein_id="CBL36081.1"
FT                   /translation="MAKNKIERIDQEITKVRKKIAEYQEKLKALEAQKTEAENLEIVQM
FT                   VRALRMTPTQLSAMLSGGTVPGSLADENNEQEENSYEE"
FT   gap             1228295..1228504
FT                   /estimated_length=210
FT   gap             1230098..1231148
FT                   /estimated_length=1051
FT   CDS             complement(1232694..1232852)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36082"
FT                   /db_xref="InterPro:IPR026990"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQP6"
FT                   /protein_id="CBL36082.1"
FT                   /translation="MNNTATNTATSPTVRKQIGKTTYIVRVHFSETAKETMEDKIKRML
FT                   REEVRKM"
FT   gap             1232915..1233064
FT                   /estimated_length=150
FT   CDS             complement(1233078..1234868)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13920"
FT                   /product="DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36083"
FT                   /db_xref="GOA:D4MQP7"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025054"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQP7"
FT                   /protein_id="CBL36083.1"
FT                   /translation="MNYTQAQIDRANAVSLEDFLRTQGETLIKSGREYRWKEHDSLTVR
FT                   GNKWFRHSQSKGGYPIDFVMEFYGKSFPEAVQLLTGESGEGQSEASTAPHTAFHLPLHN
FT                   RTADRAIQYLTESRGLNKTLVEAFLLSGDIYEDAKRHNVVFVGRDRSGTPRYAHVRGTA
FT                   DPFRQDIAGSDKSYPFHYEGNGNQLFVFEAPIDLLSFICLYPQDWQTRSYLALGGVSGK
FT                   ALDRFLSERKDTRKVFLCLDSDTAGSEACTRLAQDIPGEIAVIRLVPARKDWNDVLRQQ
FT                   GDIPSRKFIAETITLRELPTAQPVPMLRMADVELTSVDWLWFPYIPFGKLTIIQGNPGE
FT                   GKTYFAMRLAAACTNRKPLPGMETLEPFNIIYQTAEDGLGDTVKPRLMEAEADLERVLV
FT                   IDDRDTPLTLADERIARAIRENNARLVIIDPVQAFLGADVDMNRANEVRPIFRSLGDIA
FT                   QATGCAIVLIGHLNKAAGTQSTYRGLGSIDITAAVRSLLFIGKLKDSPTTRVLIHEKSS
FT                   LAPPGQSLAFSLGDEKGFEWIGAYDITADELLAGTDTAKTESKTAQAQMLILELLADGK
FT                   RMPSAELERRSMSVGFPHAP"
FT   gap             1235977..1237047
FT                   /estimated_length=1071
FT   CDS             complement(1238163..1238447)
FT                   /transl_table=11
FT                   /locus_tag="CL3_13950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_13950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36084"
FT                   /db_xref="InterPro:IPR024271"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQP8"
FT                   /protein_id="CBL36084.1"
FT                   /translation="MILEAMYNGEFYPCETVVPTSPEYRKAVIACEKLMEQLSQRLSKE
FT                   DYELVQELRAQTAIAQCEESESHFKYGFSAGLMFSRKPMNKCSRRKKNR"
FT   gap             1239269..1239747
FT                   /estimated_length=479
FT   gap             1243177..1243362
FT                   /estimated_length=186
FT   CDS             complement(1243908..1244630)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14010"
FT                   /product="Type IV secretory pathway, VirD4 components"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36085"
FT                   /db_xref="GOA:D4MQP9"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQP9"
FT                   /protein_id="CBL36085.1"
FT                   /translation="MKKKLNIKKLILLNLPYILMGLFSTNFGEAWRMAVGADASAKMLS
FT                   FFSMLPVALASWWPSLHPLDLLVGLCYGGGLRLAVYLKSKNAKKYRHGMEYGSARWGTH
FT                   EDIAPYIDPVFQNNVILTKTESLTMNSRPKDPKTARNKNVLVIGGSGSGKTRFWLKPNL
FT                   MQMHSSYVVTDPKGTILVECGKMLQRGAPKLGKDGKPMKDKHGKVIYEPYRIKVLNTIN
FT                   FKKSMHYNPFAYARHEVA"
FT   CDS             complement(1244627..1245127)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36086"
FT                   /db_xref="InterPro:IPR024234"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQQ0"
FT                   /protein_id="CBL36086.1"
FT                   /translation="MQEEVENRTLTLVVSGTKFTGRLMKAAITKYLAHRKEKKLQKQKS
FT                   RDTPVIPHGKQTVKQLIGQNQGVSNIEITDPSIKEFEKIARKYGVDYAVKKDRSSSPPK
FT                   YLIFFKGRDADALTAAFTEYTGKKVRKAEKSERPSVLAKLSQFKELVKHAVVDRNKRKE
FT                   LER"
FT   CDS             complement(1245227..1245538)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36087"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQQ1"
FT                   /protein_id="CBL36087.1"
FT                   /translation="MPERKTVGQLMEEVRLKAGAQNYHGHEYMDLERFAEDTRHMIIFD
FT                   VLTDDSPVGWKGERTRLFLTEAGYQKSLENQEKGHIKILSHAKVRQGHLYYDRSDQLR"
FT   CDS             complement(1245531..1245893)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36088"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQQ2"
FT                   /protein_id="CBL36088.1"
FT                   /translation="MKRPLAYITAPWSNSQYENAENAAAYCRQVYDAGYSPICPVLFLP
FT                   TFLKDEIPQEHKDGLDMARDYLRRSHVLVVCGHGIDETVKNDIATAERLRITATTLDGI
FT                   LTVKGQGRGKGGARHA"
FT   gap             1246493..1246590
FT                   /estimated_length=98
FT   CDS             complement(1246769..1246954)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36089"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQQ3"
FT                   /protein_id="CBL36089.1"
FT                   /translation="MCTVKEIQEAIREDCKSQHDMESTDIDRVMQTLPFAQEEPFTEAR
FT                   PRKPLFWFYARKFEKC"
FT   CDS             complement(1246984..1247259)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36090"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQQ4"
FT                   /protein_id="CBL36090.1"
FT                   /translation="MKDISARELKGHNILAVERFWDNTRWMIEFSVLRPSTAYGSPGDE
FT                   MRLFLTEDGYQAALQSQQRREIKIKRYARVIEGHILDFKPGKRRRS"
FT   CDS             complement(1248155..1248976)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14110"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36091"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQQ5"
FT                   /protein_id="CBL36091.1"
FT                   /translation="MNTQIIAIANQKGGVGKTTTCANLGIGLAQAGKKVLLIDGDPQGS
FT                   LTISLGNPQPDKLPFTLSDAMGKILMDQPIRTGEGILHHAEGVDLMPADIQLSGMEVSL
FT                   VNAMSRETILRQYLDTLKGQYSHILIDCQPSLGMLTVNALAAANRIIIPVQAEYLPAKG
FT                   LEQLLSTVNKVKRQINPKLQIDGILLTMVDSRTNFAKEISALLRETYGSKIKVFGTEIP
FT                   HSVRAKEISAEGKSIFAHDPGGKVAEGYRNLTKEVLKLEKQREKNRAGLGR"
FT   CDS             complement(1249442..1249834)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14120"
FT                   /product="SSU ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36092"
FT                   /db_xref="GOA:D4MQQ6"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQQ6"
FT                   /protein_id="CBL36092.1"
FT                   /translation="MANAKFYGTGRRKKSIARVYIVPGTGKITINKRDIDEYFGLETLK
FT                   VVVRQPLVATETVDKFDVLVNVHGGGFTGQAGAIRHGLSRALLQADAEYRPVLKKAGYL
FT                   TRDPRMKERKKYGLKAARRAPQFSKR"
FT   CDS             complement(1249863..1250297)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14130"
FT                   /product="LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36093"
FT                   /db_xref="GOA:D4MQQ7"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR023564"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQQ7"
FT                   /protein_id="CBL36093.1"
FT                   /translation="MKSFMASPATIERKWYVVDATGYTLGRLSSEVAKILRGKNKPIYT
FT                   PHIDCGDYVIVVNADKIKVTGKKLDQKIYYNHSDYVGGMRETTLKEMMAKKPEKVIELA
FT                   VKGMLPKGPLGRSMIKKLHVYAGPEHEQAAQKPEVLEIKF"
FT   CDS             complement(1250654..1251760)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14140"
FT                   /product="biotin-dependent carboxylase uncharacterized
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36094"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQQ8"
FT                   /protein_id="CBL36094.1"
FT                   /translation="MGIKFANGGFITTIQDMGRTGYQEFGVPAAGVMDTLSFRKANILV
FT                   GNDENEAVLEVTLMGPMFTFTSDNIIAVTGGDLGAKLNGKDIPMYQAVLAKKGDTMSFM
FT                   GIKSGSRAYVAFAGGLDIPVVMGSKSTHLKSSLGGFEGRKLGPGDEIEFTAPKTTLPNM
FT                   SRRVLPADDFSGASCELRVILGPQDDCFTEKGIQTFLSSTYTLTNEADRMGLRFEGETI
FT                   EHKNGGDIITDGISFGAVQVPSHGQPIVMMADHQTTGGYTKIAGVISVDLPKAAQLKPG
FT                   CKVTFRAVTVEEAQDALVKELEELKAMREKLDFVPEKGSAKEREAVAMAVASAAASGNP
FT                   YVAKKKYRVVVDGEEFIVELETEVPGLR"
FT   gap             1251992..1253359
FT                   /estimated_length=1368
FT   CDS             complement(1253776..1255137)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14180"
FT                   /product="Response regulator containing CheY-like receiver,
FT                   AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36095"
FT                   /db_xref="GOA:D4MQQ9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQQ9"
FT                   /protein_id="CBL36095.1"
FT                   /translation="MSRILIVDDEFLIRYTLEEGLRDRGHETWSAETVEEGVEKAKKFH
FT                   PEAVLLDNLLEKSKGIDEIATFKALDPNVQVILMTAYGSVEQAVEAVKRGAYDYILKPF
FT                   DIDDIELAVKRSVEQARSRESLEYLKGETQEFLGISDAVGQIRRHIEILGENSSVNVLI
FT                   RGETGTGKEVAARLIHDMSRRPGLMVRINCGAIPENLLENELFGYERGAFAGAMRTKKG
FT                   LIEMADGGTVFFDEVGEMPLSMQSKLLTFLDDRKIKRVGGLEDIQVDVRIIAATNRNLE
FT                   KAVEQGLFRQDLFYRLNVMQLVIPPLRERREDIPVLCDYYLDYYNKQFARSIDQVEPSF
FT                   MRELLLYDWKGNVRELKNIFERCFLLGPGRVLEKHVELAGRSREETDKEGESFPIKDLE
FT                   KGPVDLEKEVQELERLYMEKALKLCAGNQTKAAALLGITRFSMKRKLERKEELQ"
FT   gap             1256571..1256590
FT                   /estimated_length=20
FT   CDS             complement(1259343..1260143)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14210"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36096"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQR0"
FT                   /protein_id="CBL36096.1"
FT                   /translation="MIRDITLGQYYPVDSCIHRLDPRTKLFGTMVFIISLFLADSVWGY
FT                   VLATLVLAAVIRCSRVPFKFMVKGLKAVVFLLIISVSFNLFLTQGTPIVKVGFLQITRE
FT                   GVRLAVFMGLRLIYLVIGSSVMTLTTTPNQLTDGLEKGLHFLNRFRVPVHEISMMMSIA
FT                   LRFIPILVEETDKIMKAQMARGADFESGNLIQRAKSMIPILVPLFISAFRRATDLAMAM
FT                   EARCYRGGDGRTKMKPLRYESRDRIAYVLFFAYLAVMAALKILL"
FT   gap             1260440..1260576
FT                   /estimated_length=137
FT   CDS             complement(1260711..1261874)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14240"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36097"
FT                   /db_xref="GOA:D4MQR1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQR1"
FT                   /protein_id="CBL36097.1"
FT                   /translation="MNIIKAAGLVFDYIRRDEEDKIEEKKRAIDHLDVEIEKGSFVAVL
FT                   GHNGSGKSTFAKHINGILLPTEGEVWVAGMNTADEDRLWDVRKTAGMVFQNPDNQIIGN
FT                   IVEEDVGFGPENLGVPTEEIWKRVDESLKAVGMTLYRKKSPNRLSGGQKQRVAIAGVMA
FT                   MKPECIVLDEPTAMLDPNGRADVIRTVRELNQKEGITVVLITHYMEEVIHADRVIVMDE
FT                   GRVVMDGTPREVFAQVQQLKEYRLDVPQVTELAWELKNAGINMPEGILDRKEFTEAFLS
FT                   VCPGELLKKPAAEEPRSSETAKEAGGKEGQGETAIKAIDLNFKYSSGTAFEQQALKDVS
FT                   FEVRDGEFIGLIGHTGSGKSTLIQHLNGLIRPTSGDILFHGTSIYSE"
FT   CDS             1261999..1262214
FT                   /transl_table=11
FT                   /locus_tag="CL3_14250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36098"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQR2"
FT                   /protein_id="CBL36098.1"
FT                   /translation="MRRIGSLSLPAVFSGLPDSCLKDGCTKAESEGSADGFFRLHALRL
FT                   LLIILPHPAPAFGIFCVRRPRRPVSL"
FT   CDS             complement(1262227..1263303)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14260"
FT                   /product="Putative cell wall binding repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36099"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQR3"
FT                   /protein_id="CBL36099.1"
FT                   /translation="MAGSRNRRMVLAGAVISLAAGMVFPALADGKIAEVKIGIRNEYEP
FT                   GTVKEPKVQVTGSESSVENVSWDVRVSDWEPGKARTGKIVLRADEGLTFGENGNSPSVQ
FT                   VSGAEYISAEERENGSVLEVTVSYTPVLKLGQTESAGWDSASQGTAVWRPVPYAKAYQL
FT                   RLYRAGTQESGEENAADNQYVNMLTLTGTSADLTAYMQEEGVYFYTVKALASGSGEALS
FT                   AGDAFESERIVTLRRMSEGWEQVSGRYQYTDKNGVRASGGWRYIDGGWYYFDQDAYAVT
FT                   GWQYVGGRWYYLDGQGRMKTGWLNENGTWYYLDPTGAMATGWYELGPGNAYYFDASGKM
FT                   LYDTVVDGRRLDVNGRAE"
FT   CDS             complement(1263359..1263697)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14270"
FT                   /product="Putative cell wall binding repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36100"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQR4"
FT                   /protein_id="CBL36100.1"
FT                   /translation="MLTDWQYKNNNWYYLNPVSDGNRGVMLTGWIQTNSGWYYLNPGPD
FT                   GTVGAMYRNQWLDLNGKRYYLGDSGAMYEGWRQIGNDWYYFYPGSGELAVNTTIDTFYV
FT                   DGSGIWRR"
FT   CDS             complement(1263691..1264626)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36101"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQR5"
FT                   /protein_id="CBL36101.1"
FT                   /translation="MKSRAGYAKALALICMSALLAAGGSLTVFAASKTISKVDIDVKIE
FT                   LEPGDDLPDLSYGSKGEGANVMVSDGAKYEIVEDPEWSSSVGSSGVKIGSTYTFKVILE
FT                   AKDPDEYTFKGTYKSSNVKVSGGEFVSASRSGSDRLKVTIKTDPVEGTFEAPEEAEWSD
FT                   TTLGLAKWDSVDRVDAYDITLYRGGSTVYKVKGYQGNKINFYPYMTSAGTYSFKVRSVA
FT                   KNDSQKDYAKSSDWTDSDEIYIGKESVSDGSGKIDYNNQNSAGNTQPPRWDGSSRATAG
FT                   GTATRTAAIRRMTGFFSTISGSFSTLTDGC"
FT   CDS             complement(1265164..1265715)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14300"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36102"
FT                   /db_xref="GOA:D4MQR6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQR6"
FT                   /protein_id="CBL36102.1"
FT                   /translation="MEDFIMAGYRKLGRTSSHRKALLRNQVTNLLYNGKIVTTEARAKE
FT                   VKKIAEGLIALAVKEKDNYETVKVTAKVAKKDADGKRVKEVVDGKKVTVYEEVEKEIKK
FT                   DKPSRLHARRQMLKVLYGVTEVPTAKAGRKKNTKSVDMAAKLFDEIAPKYANRNGGYTR
FT                   IVKIGLRKGDAAMEVLLELV"
FT   gap             1265835..1266267
FT                   /estimated_length=433
FT   gap             1267318..1268301
FT                   /estimated_length=984
FT   gap             1269130..1269735
FT                   /estimated_length=606
FT   CDS             complement(1269853..1270071)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14340"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36103"
FT                   /db_xref="GOA:D4MQR7"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQR7"
FT                   /protein_id="CBL36103.1"
FT                   /translation="MSKADVIEIEGTVVEKLPNAMFQVELENGHKVLATISGKLRMNYI
FT                   RILPGDRVTLEMSPYDLSKGRIIWRDK"
FT   CDS             complement(1270089..1270364)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36104"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQR8"
FT                   /protein_id="CBL36104.1"
FT                   /translation="MAEYKVGSLVRSLAGHDKDSFFIITEETPEYVYLSDGKLRPVEKP
FT                   KKKKKKHVQPTHFSEAGLTEAILAGRPTVNEEIRLFIRNWKKEREI"
FT   CDS             complement(1270411..1271163)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14360"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36105"
FT                   /db_xref="GOA:D4MQR9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQR9"
FT                   /protein_id="CBL36105.1"
FT                   /translation="MAVTIKSPREIELMREAGRILAITHEELAKALRPGMSTLDIDRLG
FT                   EEIIRSYGCIPSFKNYNGYPASICVSVNDEVVHGIPHKDHIIDEGDIVSLDAGVIYRGY
FT                   HSDAARTHGIGEISPEARKLIEVTRQSFFEGIKFAKPGNHLNDISTAIQAYAESFGYGV
FT                   VRDLVGHGIGSHLHEDPEIPNFRRRRKGILLQPGMTLAIEPMINEGSCEVVWLDDDWTV
FT                   VTDDGSLSAHYENTILITEDEPEILSLR"
FT   CDS             complement(1271294..1271935)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14380"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36106"
FT                   /db_xref="GOA:D4MQS0"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQS0"
FT                   /protein_id="CBL36106.1"
FT                   /translation="MKIIMLGAPGAGKGTQAKRIAEKYGIPHISTGDIFRANIKEGTEL
FT                   GMKAKEFMDQGLLVPDEVTIGMLLDRIKKEDCVNGYVLDGFPRTIPQAESLTKALEEMG
FT                   QKIDYAVDVDVPDENIVSRMSGRRACITCGATYHVQFAPPKAEGICDKCGAELVLRDDD
FT                   KPETVQKRLAVYHEQTQPLIDYYRRAGVLVSVDGTQSMDQVFESIVKIFG"
FT   CDS             complement(1272237..1273553)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14400"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36107"
FT                   /db_xref="GOA:D4MQS1"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQS1"
FT                   /protein_id="CBL36107.1"
FT                   /translation="MLKTLQNAFRVKEVRQKLLFTFAMLVVIRIGSQLPIPGVKTDFFA
FT                   ELFSGQSNDAFGFFNTITGGSFTNLSVFALSITPYITSSIIMQLLTIAIPKLEEMQRDG
FT                   EEGRKKIQEYTRYLTVGLALMQSAAKAIGFGGQGLLLEFTAPSVIVTIAAMTAGSAMLM
FT                   WIGERITEHGVGNGISIVLLFNILSTIPSDMISLYERFAQGRPIGAAVVSVVIIVAIIA
FT                   AIVVFVIILQDAKRIIPVQYSKKMQGRKMVGGQSANIPLKVNTAGVIPVIFASSLMSFP
FT                   VVISEFLKVDPLSVPGHILRALNSSSWFRPEAPIYSVGVLIYIGLVVVFAYFYTSITFN
FT                   PLEIANNMKKAGGFIPGIRPGKPTSDYLSGILTYIIFIGACGLVIVCLIPIIASGVFNI
FT                   NRLSFGGTSLIIIAGVILETIKAIEAQLLVRNYRGFLND"
FT   CDS             complement(1273555..1273995)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14410"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36108"
FT                   /db_xref="GOA:D4MQS2"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQS2"
FT                   /protein_id="CBL36108.1"
FT                   /translation="MELSNLKPAVGSKHSDSFRRGRGHGSGNGKTAGKGHKGQKARSGA
FT                   TRPGFEGGQMPLYRRLPKRGFTNRNGKDIIGINVSALERFENDTVVTVETLIEAGIVKN
FT                   PRDGVKILGNGELTKKLTVKVDAVSEGAKAKIEAVGGTCEVI"
FT   CDS             complement(1274018..1274200)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14420"
FT                   /product="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36109"
FT                   /db_xref="GOA:D4MQS3"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQS3"
FT                   /protein_id="CBL36109.1"
FT                   /translation="MAQTLKITLVKSPIGAVPKQRATVEALGLNKLHKTVEMPDNGAVR
FT                   GMIQSVRHLVKVEEN"
FT   CDS             complement(1274217..1274726)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14430"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36110"
FT                   /db_xref="GOA:D4MQS4"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQS4"
FT                   /protein_id="CBL36110.1"
FT                   /translation="MKRTIIDPTQFELEDKVVAIKRVSKTVKGGRTMRFSALVVVGDKN
FT                   GHVGAGLGKAAEVPEAIRKGKEAAAKNLVAVPFDENNSIPHDFLGKFGSANVLLKKAPE
FT                   GTGIIAGGPARSVLELAGYKNIRTKSLGSNNKTNVVLATLTGLCALKTPEEVAKLRGKS
FT                   VEEILN"
FT   CDS             complement(1274747..1274998)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14440"
FT                   /product="ribosomal protein L18, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36111"
FT                   /db_xref="GOA:D4MQS5"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQS5"
FT                   /protein_id="CBL36111.1"
FT                   /translation="MYAQIIDDTVGNTLVAASTAEKAVKAELAKTNNVEAAAYVGTVIA
FT                   KRALEKGIKTVVFDRGGFIYQGKVQALADAAREAGLEF"
FT   gap             1275074..1275418
FT                   /estimated_length=345
FT   CDS             complement(1275452..1275994)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14450"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36112"
FT                   /db_xref="GOA:D4MQS6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQS6"
FT                   /protein_id="CBL36112.1"
FT                   /translation="MSRIGRMPVAIPAGVTVTIAENNVVTVKGPKGTLERALPVEMSIK
FT                   EEDGQIVVTRPNDLKKMKSLHGLTRTLINNMIHGVTEGYEKVLEINGVGYRAAKQGKKL
FT                   TLSLGYSHPVEMEDPEGIETVLDGQNKIIVKGISKEKVGQYAAEIRDKRRPEPYKGKGI
FT                   KYADEVIRRKVGKTGKK"
FT   CDS             complement(1276280..1276681)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14460"
FT                   /product="Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36113"
FT                   /db_xref="GOA:D4MQS7"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQS7"
FT                   /protein_id="CBL36113.1"
FT                   /translation="MTMSDPIADMLTRIRNANTAKHDTVDVPSSKMKLAIADILVREGY
FT                   IKKYDIVEDNGFNTIRIELKYGKDKNEKIISGIKRISKPGLRVYANTEDMPKVLGGLGI
FT                   AIVSTNQGVITDKEARRLGVGGEVLAFVW"
FT   CDS             complement(1276969..1277139)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14480"
FT                   /product="Ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36114"
FT                   /db_xref="GOA:D4MQS8"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQS8"
FT                   /protein_id="CBL36114.1"
FT                   /translation="MKIKQQRPAKFSTREYNRCRICGRPHAYLRKYGICRICFRELAYK
FT                   GEIPGVKRASW"
FT   CDS             complement(1277169..1277255)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14490"
FT                   /product="Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36115"
FT                   /db_xref="GOA:D4MQS9"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQS9"
FT                   /protein_id="CBL36115.1"
FT                   /translation="MDIIFVTTAKTDEEARELLTLFNMPFAK"
FT   gap             1277377..1277876
FT                   /estimated_length=500
FT   CDS             complement(1278460..1278828)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14520"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36116"
FT                   /db_xref="GOA:D4MQT0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR023571"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQT0"
FT                   /protein_id="CBL36116.1"
FT                   /translation="MIQQETRLKVADNTGAKELLCIRVMGGSTRRYANIGDIIVASVKD
FT                   ATPGGVVKKGDVVKAVVVRSVKGARRSNGSYIKFDENAAVIIKDDKNPRGTRIFGPVAR
FT                   ELREKQFMKIVSLAPEVL"
FT   CDS             complement(1279127..1279195)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36117"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQT1"
FT                   /protein_id="CBL36117.1"
FT                   /translation="MPDEITESSEEEGTDAILCTRK"
FT   gap             1279721..1280496
FT                   /estimated_length=776
FT   CDS             complement(1280875..1281261)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14580"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36118"
FT                   /db_xref="GOA:D4MQT2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQT2"
FT                   /protein_id="CBL36118.1"
FT                   /translation="MAKGHRSQIKRERNANKDTRPSAKLSYARVSVQKACFVLDAIRGK
FT                   DVQTALGIVTYNPRYASTLIKKLLESAIANAENNNQMNVENLYVAECYANKGPTMKRVK
FT                   PRAQGRAYRIEKRMSHITVVLDER"
FT   CDS             complement(1281290..1281568)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14590"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36119"
FT                   /db_xref="GOA:D4MQT3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQT3"
FT                   /protein_id="CBL36119.1"
FT                   /translation="MARSLKKGPFADAHLLKKVDAMNAAGQKQVIKTWSRRSTIFPQMV
FT                   GHTIAVHDGRKHVPVYVTEDMVGHKLGEFVATRTYRGHGKDEKKARR"
FT   CDS             complement(1281591..1282430)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14600"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36120"
FT                   /db_xref="GOA:D4MQT4"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQT4"
FT                   /protein_id="CBL36120.1"
FT                   /translation="MGIKTYSPYTPSRRHMTGSDFSEITKTTPEKSLVVSLKKNAGRNN
FT                   QGKITVRHRGGGSRRKYRIIDFKRNSKDGIPATVIGVEYDPNRTANIALICYADGEKAY
FT                   ILAPQGLTDGMKVMSGPEAEAKVGNCLPLSEIPVGAQIHNIELYPGKGGQLVRSAGNSA
FT                   QLMAKEGKYATLRLPSGEMRMVPIICRATIGVVGNGDHNLVNIGKAGRKRHMGIRPTVR
FT                   GSVMNPNDHPHGGGEGKTGIGRPGPCTPWGKPALGLKTRKKNKQSNKLIVRRRNANK"
FT   CDS             complement(1282551..1282850)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14610"
FT                   /product="Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36121"
FT                   /db_xref="GOA:D4MQT5"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQT5"
FT                   /protein_id="CBL36121.1"
FT                   /translation="MANIQFYDVILKPVVTEKSMNAMSDKKYTFLVHPEANKTMIKEAV
FT                   ERMFPGTKVAAVSTMNLDGKTKRRGLVFGKTAKTKKAIVKLTEDSKEIEIFAGL"
FT   gap             1282986..1283136
FT                   /estimated_length=151
FT   CDS             complement(1283579..1284214)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14640"
FT                   /product="50S ribosomal protein L3, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36122"
FT                   /db_xref="GOA:D4MQT6"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQT6"
FT                   /protein_id="CBL36122.1"
FT                   /translation="MKKAILATKVGMTQIFNEDGVLTPVTVLQAGPCVVTQVKTAENDG
FT                   YEAVQVGFVDKREKLVSKPVKGHFDKAGVSYKRYVREFRFENASEYSVKDEIKADIFAA
FT                   GDKIDATAISKGKGFQGAIKRHGQHRGPMAHGSKFHRHQGSNGSATTPGRVFKGKGMPG
FT                   QMGHVKVTIQNLEIVKVDAENNLLLVKGAVPGPKKSLVTIKETVKVSK"
FT   gap             1284369..1285713
FT                   /estimated_length=1345
FT   gap             1286898..1287560
FT                   /estimated_length=663
FT   gap             1289580..1290514
FT                   /estimated_length=935
FT   CDS             complement(1290823..1291134)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36123"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQT7"
FT                   /protein_id="CBL36123.1"
FT                   /translation="MKWHLAFNTDDRERNGIYEEGEEPCLEQQKQFLVPARTIVVFIGL
FT                   KERAEENRGEKRGKKEKQPADKEKKRAKKDQEKKAKEKDGKKKSEKKASAKGPEQSGE"
FT   gap             1291609..1292499
FT                   /estimated_length=891
FT   CDS             complement(1294050..1294805)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14740"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36124"
FT                   /db_xref="GOA:D4MQT8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQT8"
FT                   /protein_id="CBL36124.1"
FT                   /translation="MKKMISWNVNGLRACVGKGFLDVFRKLDADIFCIQESKLQAGQID
FT                   LDIPGYYQYWSYADKKGYSGTALFSKEEPISVVYGLGIDAHDHEGRVITAEYEDYYVLT
FT                   CYTPNSQNELARLPYRMEWEDAFLAYLKKLEEKKPVIFCGDLNVAHREIDLKNPRTNRK
FT                   NAGFTDEERGKFSALLDAGFIDTYRHFYPDTEGVYSWWSYRFKAREKNAGWRIDYFCVS
FT                   ESLEDRLVSASIHTEIMGSDHCPVELVIK"
FT   CDS             complement(1295103..1296992)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14750"
FT                   /product="Listeria-Bacteroides repeat domain
FT                   (List_Bact_rpt)./Putative cell wall binding repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36125"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQT9"
FT                   /protein_id="CBL36125.1"
FT                   /translation="MEAVENAELVAPDSHAGQTPVWMTEKGNFDSKINLDDGEDYEFSA
FT                   GKLEADFYAGWFFPVGGNSTQISGVNAVTPDGVELTVTDLEELKTVGELSEALPEGMDI
FT                   SDISDTIQLDISLAEGSVKSGQSVGINIVLPDDFAERVTEGRDIAVIHFTKDGKAKLEK
FT                   STYDRDNRTVEFSMTSFSPVILAAVSETAHVTVENVPGAVTEIYSISENEDGTTTQTYV
FT                   PIGEEVNIPAGTELQLRGFSINARLEGFEIDNEGTVESCDSYEKYTVKEGTTVITPVVK
FT                   DRQSSAQEEEEWTYLEADPYQVATENPEKGAGDADLFTITADGKLTSKEALPAGWYYIE
FT                   LCTEYQGEEKWESVQVNIGSSVTFYMYTGHGAGVRKTFYTDYLDEVFVYTGTPFGEAEE
FT                   MLMTKPAMFGGYEFAGWFEENQTASAIDEGRPLDEENLIAYARFQKDGNLYDPEIKPYD
FT                   GTQDPGDNTDDPSQPSSSGRRGSGGSATGSSYSGGTIYGDWQQDAAGWRFRQTDGTYAA
FT                   NKWGRIDGTWYYFGADTYMVTGWFYDGFNWYYLNPISDGTRGAMKTGWVYDASYGKWFY
FT                   LSASGEMLTGWQVIDGKYYYLNPVSDGTKGAMAAEQWVDDYYVNADGARIMAR"
FT   CDS             complement(1296962..1297381)
FT                   /transl_table=11
FT                   /locus_tag="CL3_14760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36126"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQU0"
FT                   /protein_id="CBL36126.1"
FT                   /translation="MYVKELKRAAALTLSAVLALGNIPVGGIMEAFAESKPGPVYGEKG
FT                   EDFIKVRLHGTGGTFLNALKLEKKDRNPSTPSDATPNDATPSDSTPSDAVGDEDYKWEL
FT                   KSIGEEKIRILLLTFSGALSCPTRSLWRQWRMPSW"
FT   CDS             1297760..1298524
FT                   /transl_table=11
FT                   /locus_tag="CL3_14780"
FT                   /product="Response regulator containing CheY-like receiver
FT                   domain and AraC-type DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36127"
FT                   /db_xref="GOA:D4MQU1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQU1"
FT                   /protein_id="CBL36127.1"
FT                   /translation="MLKVIIADDERLICRLVQALGDWEALDMEVAGLAENGLEALELIE
FT                   RERPDILITDIRMPGCDGLELIRRAKELRPELEIVIISGYAHFEYAQTAIRYGVGNYLL
FT                   KPIKKDELMETLRKMKERCEERTAGREVGEARYKKSQNDLKRLRNSLIDDLMSAQPPVL
FT                   TNQILKETYYFDFSEGQAFLVKLDCRAGAFGNSAEVVREKVQEILNAGLKGLCSDVIFC
FT                   FRRLIRGYGPFKLRLRQKRTGEKGIPLLPGTA"
FT   gap             1298531..1300110
FT                   /estimated_length=1580
FT   CDS             1300119..1300481
FT                   /transl_table=11
FT                   /locus_tag="CL3_14790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36128"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQU2"
FT                   /protein_id="CBL36128.1"
FT                   /translation="MELADRLGREVFDIPVDELTEGQKYDLIYTRILLQNPDVVFCVQP
FT                   FKGAGVSQRIHIYRLLEELLEKGIAVVILAVNLADSMALADRLLRVRKGKEVRQYDREE
FT                   FGRLPVNTPWLYLYQK"
FT   CDS             1300571..1301044
FT                   /transl_table=11
FT                   /locus_tag="CL3_14800"
FT                   /product="ybaK/ebsC protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36129"
FT                   /db_xref="GOA:D4MQU3"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQU3"
FT                   /protein_id="CBL36129.1"
FT                   /translation="MTRTNVMRLLDAAGIEYEAGEYEVDENDLSGSHAADMMGVDHDSM
FT                   FKTLVLRGEKTGYLVCCIPVDEELDLKKVAKAAGDKKVEMIHMKELLPLTGYIRGGCSP
FT                   IGMKKKFPTYIEETAVLFDKIAVSAGMRGVQILIDPEQLAAYTEAAFAPLVRE"
FT   CDS             1301445..1302149
FT                   /transl_table=11
FT                   /locus_tag="CL3_14810"
FT                   /product="Cell Wall Hydrolase."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36130"
FT                   /db_xref="GOA:D4MQU4"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQU4"
FT                   /protein_id="CBL36130.1"
FT                   /translation="MPDIYSFLQTVYQFVKSLAVNMTKKMYRTAAVFTTGVAVVTVVMF
FT                   NSGDFSGAGKSAAVSLYGDSEEAYEMTDELPSEEDGNGTGTRMEFQLAASNEQGQHLLG
FT                   SLLERNIQDEIAQSALEVEVIEKEVLMQAQQAQKEAEEKEKQRKRENAVISYTDADYEV
FT                   LLRIVQAEAGICDDKGKILVANVIINRVKSSKFPDNITDVVYQRSQFSPVSNGTINTCR
FT                   VTEQTRDSLPRL"
FT   CDS             1302158..1302394
FT                   /transl_table=11
FT                   /locus_tag="CL3_14820"
FT                   /product="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36131"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQU5"
FT                   /protein_id="CBL36131.1"
FT                   /translation="MYADIFGTIPVAEALLSKGAQLGTVLSFMMAVTTLSLPSLIMLRK
FT                   AVKPKLLSLFIGICAVGIILVGYLFNAFQIILI"
FT   CDS             1302411..1302752
FT                   /transl_table=11
FT                   /locus_tag="CL3_14830"
FT                   /product="small redox-active disulfide protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36132"
FT                   /db_xref="GOA:D4MQU6"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQU6"
FT                   /protein_id="CBL36132.1"
FT                   /translation="MGLFNKKKAEKNCCCGSSCTPEKMEQAETVKTAAGVKVLGSGCAK
FT                   CHALEDAAKAALEELNMDTTIDHVTDFAQIAAYGVMTTPALVVDGKVVSYGKVLKKDEA
FT                   KALIQKVRG"
FT   CDS             1302756..1303166
FT                   /transl_table=11
FT                   /locus_tag="CL3_14840"
FT                   /product="Protein-tyrosine-phosphatase"
FT                   /EC_number="1.20.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36133"
FT                   /db_xref="GOA:D4MQU7"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQU7"
FT                   /protein_id="CBL36133.1"
FT                   /translation="MKEKPKVAFICVHNSCRSQIAEALGKYLAADIFESYSAGTETVPQ
FT                   INQEAVRLMKQLYNIDMEKTQYSKLLSALPPVDIVVTMGCNVNCPYLPCKYREDWGLED
FT                   PTGKDEGEYRETISAIEQKIAALKKFIQTNFK"
FT   CDS             1303315..1303473
FT                   /transl_table=11
FT                   /locus_tag="CL3_14850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36134"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQU8"
FT                   /protein_id="CBL36134.1"
FT                   /translation="MTDFEAYQEYIQRRHNAFCKAVIRYAARDKILQLRRKWERQISLD
FT                   YISDKIG"
FT   CDS             1303477..1303707
FT                   /transl_table=11
FT                   /locus_tag="CL3_14860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36135"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQU9"
FT                   /protein_id="CBL36135.1"
FT                   /translation="MKVDYKVGNTIQYKGYVGSVEFSEEDRIFYGKVMGVRSLISYEGE
FT                   NEKELLNDFHAAVDDYLKTRVEEVKRSCIIK"
FT   CDS             1303704..1303892
FT                   /transl_table=11
FT                   /locus_tag="CL3_14870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36136"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQV0"
FT                   /protein_id="CBL36136.1"
FT                   /translation="MTLRGYSRQKVVDEYMQDYNPYEKHEPLQFDLRRYAQYVKERNLK
FT                   PEDITLEILAFFSKQKE"
FT   CDS             1303903..1304037
FT                   /transl_table=11
FT                   /locus_tag="CL3_14880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36137"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQV1"
FT                   /protein_id="CBL36137.1"
FT                   /translation="MRNRLIMDKIQKRIVGAVAAEEELKDAIILTKAFGHKTLGGTVS"
FT   gap             1304092..1304483
FT                   /estimated_length=392
FT   CDS             1305009..1305617
FT                   /transl_table=11
FT                   /locus_tag="CL3_14900"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36138"
FT                   /db_xref="GOA:D4MQV2"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQV2"
FT                   /protein_id="CBL36138.1"
FT                   /translation="MGNTYGYIRVSSRDQNEDRQIDAMDQLKIVPKNIYIDKQSGKDFE
FT                   RPEYKKLFKRLKRDDVLYIKSIDRLGRNYEEIQNQWRILTKEKGVDIVVMDMPLLDTRR
FT                   GKDLMGTFLSDIVLQVLSFVAENERVNIRQRQAEGIAAAKARGIHLGRPPEPLPENFHQ
FT                   VYQKWKSGRITGAEAAKECGMPPTTFRYKAKIYEKATLL"
FT   gap             1307309..1307806
FT                   /estimated_length=498
FT   CDS             1308013..1309473
FT                   /transl_table=11
FT                   /locus_tag="CL3_14940"
FT                   /product="DNA or RNA helicases of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36139"
FT                   /db_xref="GOA:D4MQV3"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQV3"
FT                   /protein_id="CBL36139.1"
FT                   /translation="MAAIKVKTAKRVIPMIYAYTTPEIKRHDGWTKIGYTEQDVDKRLN
FT                   QQTHTADVEYKEEWRGTAIFDDGSGEVFRDTDFHAYLRKNKVEVQEEKDNEWFHITGPE
FT                   SRIKFYEFKENRGILKSLDVISPYKLRKEQQEAVDQTVAYRNSHEQGEFLWNAKPRFGK
FT                   TLSVYDFCKRVQAVNVLIVTNRPAIANSWYSDYEKFLGTESGYLFVSNTDALKGKPLVL
FT                   TREAYLKYIRTKETEDVKCIEFVSLQDLKGSIEFGGEHKKLEEVAHIDWDVLVIDEAHE
FT                   GVDTYKTDVAFDHIKRKFTLHLSGTPFKALANDKFPEAAIYNWTYADEQRAKHGWDEAS
FT                   GQENPYENLPQLNMFTYQMSDIVRDELKQGIEINGETEEYAFDLNLFFETKNGKFTHES
FT                   SVDKFLDALTTQEKFPFSTEELRRELKHTLWFLNRVDSAKALALIYRADYNCLWEEVPI
FT                   MCEHCRNIQIWRKFDAPKDYLACIAYIQ"
FT   CDS             1309685..1309918
FT                   /transl_table=11
FT                   /locus_tag="CL3_14960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36140"
FT                   /db_xref="InterPro:IPR029087"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQV4"
FT                   /protein_id="CBL36140.1"
FT                   /translation="MNSEQITAFLQEHWYLASVIIGVVILIGAIRNWNWLCDPTGKPDS
FT                   HRYGRGSRRVLFFLLGVLLIVVSIWGFVLKLQ"
FT   gap             1310070..1310317
FT                   /estimated_length=248
FT   CDS             1310645..1311787
FT                   /transl_table=11
FT                   /locus_tag="CL3_14990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_14990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36141"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQV5"
FT                   /protein_id="CBL36141.1"
FT                   /translation="MMTLEQLPPKGVKREQAILELGKDEANGEMLFQLVNTEKGKCKTA
FT                   AQKALAQLEYAPAAPLWAKLVRGKWMGSNIMSDACSDCVSEQIAPVILKTLSQPLDEGD
FT                   TKPLDIEQLNFCFHLMLGKASPKMLEVYRFLAENTQRIAQLKRTPVYSDDDCTSWWITD
FT                   GLRIWDATPKEKEKIPAVVLTASLIRNPDERLQALADELNERYGGSWLMPVFMKAIITQ
FT                   PKEQVYETYSPLLDTPQKAYLFNALGMLHYPCYPEDWTYERLGPDGMIALIFWGDYSYG
FT                   TYDTRLMIERYVDLDERWLFDLAKDPEGRKPTVTWQTYNRGGVLYGSYDEMFISLLPLK
FT                   VENPELKRILWDYFRIRSQKKKVAKSITVYKDAAERFGDE"
FT   CDS             1311814..1312893
FT                   /transl_table=11
FT                   /locus_tag="CL3_15000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36142"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQV6"
FT                   /protein_id="CBL36142.1"
FT                   /translation="MYQIAYIGRWEALPETAAAICDHDTPKLEALLQGGLDLDVPIQLS
FT                   EYIKLMPLEIAVFRNDVPMIHFLLEHGADPGLAEEQPLLLTAARCCGPEVVALFAGQAA
FT                   KLSSKQKERAFQEVRWGKRPENIQVLEQAGITVDKFGGEAFRAAVSDGQAELAKLLLEK
FT                   GADINYHKPDMVFPYASTPVTEAARSNNFLMVRWLVEQGADITLVDKYGDRPYTVAVQN
FT                   KNQELADYLKALEPEKWHNEQEKVRQLMPYKLPAKLVEYLKTGPLRLEFPDQEWVKWAE
FT                   LYSFMDVQEMTWKRKKLLSLMVQMDNYSDYLLLWSPRDKKLWYLDIEHEEFHPLTKWDD
FT                   FIADPGRYLNGMIEGEFEE"
FT   CDS             1312898..1313518
FT                   /transl_table=11
FT                   /locus_tag="CL3_15010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36143"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQV7"
FT                   /protein_id="CBL36143.1"
FT                   /translation="MTSIDFLNKVHKNLDSQEYSLSYSPAKSKNYMLYCNGNFIGGLFD
FT                   EELCFVYADSVSELLGQPEPVYRGYSSTAQHRMLVIPEEHWAKALKLLYAEKFDWNRLV
FT                   YDITYTSIGAAVVEDFYDENVVFLRFCYEKELLKKNPLDRHDRILRMVYLNQDLTTAGK
FT                   YLFPRLLDKFLAFFDRKGKTSLETMLKRWYTALEKEYLSQTAG"
FT   CDS             1313532..1314122
FT                   /transl_table=11
FT                   /locus_tag="CL3_15020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36144"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQV8"
FT                   /protein_id="CBL36144.1"
FT                   /translation="MTEKNRTYITHLKVADVPWHRLTTAYGRGTDFPAHLTVLEQMRDL
FT                   ASVKESLYELTTNMEHQSTLWHATPFGMVFLSRILEKALADSGQNPVAHFLAGELLDFF
FT                   TCILQCFRDGDEMVHAEALPLFSDLLKEEYLWSEEYDEEEDEMRYEEDEVFPNDLFYSF
FT                   YYYSWQAVKAYQDVLVQVPAEFAKPAAEVLELL"
FT   CDS             1314137..1314913
FT                   /transl_table=11
FT                   /locus_tag="CL3_15030"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36145"
FT                   /db_xref="InterPro:IPR019260"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQV9"
FT                   /protein_id="CBL36145.1"
FT                   /translation="MFEEFYEMYEPEEQEVVALINRCIGGGYNWKGKFWEMTVVTLGMV
FT                   FCDTGKVSTKEEHLEWPVTEEERNSDKGWGRFGKEQICRLKIRRMKEERAKDLVVRPWS
FT                   ISEIVNAHEDCPELQAVLEEYHKPVVIQDQVLGELTLDKDYDTFEGEIQWCGKDVSLSL
FT                   EVNAESKPSWTRARSAAKKLLANNWLSQDEENPRDPETDPITEEELARRISLTSLSVTS
FT                   GGSFTAWFDCDEMFTDHAVTVYGSLKKGLKTANIEG"
FT   gap             1315180..1316030
FT                   /estimated_length=851
FT   CDS             1316038..1316331
FT                   /transl_table=11
FT                   /locus_tag="CL3_15050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36146"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQW0"
FT                   /protein_id="CBL36146.1"
FT                   /translation="MKSTFCVWTEDGTTWHCNPMDGEDASKDLLSTIDGNPLSYVEYGK
FT                   WFYPADLPLEAVRQLADGVPVTKELVTALNPKRSEWEEIKAGLDKIGYPNKL"
FT   CDS             1316358..1316912
FT                   /transl_table=11
FT                   /locus_tag="CL3_15060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36147"
FT                   /db_xref="InterPro:IPR025850"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQW1"
FT                   /protein_id="CBL36147.1"
FT                   /translation="MIKERIPISGDLKSKVKQLMEYAGWQEGRKVDISIAEKYYADHGV
FT                   LMMKTTQRFYRKYFGLCCEWYLEQKKQNWAADFQFALFPYLVNGIKNHLEEAYFRDMSG
FT                   CELAEIEQAVGEKCQPIGHIGYYYPAEVWISEYGKLYAKYEYQDEIECFPDVFALIERD
FT                   LRQCKFDSAAMKTVEALDGKL"
FT   gap             1317363..1319226
FT                   /estimated_length=1864
FT   CDS             1319420..1319746
FT                   /transl_table=11
FT                   /locus_tag="CL3_15090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36148"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQW2"
FT                   /protein_id="CBL36148.1"
FT                   /translation="MKAFDPNYKLLDEMYQDDYYPTFLVDKVKDELQKVIDLLESGETD
FT                   TEVIQETLDEAVCGINDLQEEFDENDSEIETVARDCIGVTVAYILEWFGIPIDIEEAIR
FT                   ERDW"
FT   gap             1320133..1321118
FT                   /estimated_length=986
FT   CDS             1321775..1322020
FT                   /transl_table=11
FT                   /locus_tag="CL3_15130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36149"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQW3"
FT                   /protein_id="CBL36149.1"
FT                   /translation="MDQTVIYNGQIFTLTRFWATGEPCLWITDPEQIGMPKMEFVGGHP
FT                   DEYCIFLKNLTEAELAQITSLDGAPLDMKEERNDIE"
FT   CDS             1322781..1323029
FT                   /transl_table=11
FT                   /locus_tag="CL3_15150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36150"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQW4"
FT                   /protein_id="CBL36150.1"
FT                   /translation="MALQDKKIMPPPWLAHREIERYSIGWRMGYGEDYIDRFGDWLDTL
FT                   SPEERTEYRTLFPEPVTWKGWWDDEDSSEVLEHGDFW"
FT   gap             1323049..1324420
FT                   /estimated_length=1372
FT   CDS             1324994..1325263
FT                   /transl_table=11
FT                   /locus_tag="CL3_15170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36151"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQW5"
FT                   /protein_id="CBL36151.1"
FT                   /translation="MNKPIKAKNLPLFPIIDLDQLRRENRLEGTEVTDFFTARDGKVYL
FT                   LMEQPSETQGKDWLSTPSTYTAVEIQLDWAEQRVLETTLFLLAS"
FT   gap             1326154..1327527
FT                   /estimated_length=1374
FT   CDS             1327553..1327798
FT                   /transl_table=11
FT                   /locus_tag="CL3_15200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36152"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQW6"
FT                   /protein_id="CBL36152.1"
FT                   /translation="MEEPNFFGVSIAYDPYMREVVKAEQFTTCGGDGGRSICGGLGIFL
FT                   GFLPCSPHCKPEVQEDKELNGDYDFYRPIIRVDTDC"
FT   CDS             1327878..1328726
FT                   /transl_table=11
FT                   /locus_tag="CL3_15210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36153"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQW7"
FT                   /protein_id="CBL36153.1"
FT                   /translation="MDVVKLPKKVRMVCYEIMDGKEGALDTLESFADKYPHQVAAVKAE
FT                   VAYFNLDYEKALALDLTILPWLEEWYYSNVSDEHMIAMTVAAIRLHREQELIEALTKEQ
FT                   TRIRAENGLPQRDRFCDILMDYLKRGLMPFADNDKNYPYHEPEEPQTKEQLWAKLVEQN
FT                   KKLSPDDPDARRKLYNHCCMFGTARDAVDLFEEIQGVPMADSSYRDAIARYLYLGEREK
FT                   ALQTAERLAASRLWAVAGPTQVRPMSFFEDPNLREFLLEPESLRRIREAAFIDDGNLIR
FT                   K"
FT   CDS             1328752..1329102
FT                   /transl_table=11
FT                   /locus_tag="CL3_15220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36154"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQW8"
FT                   /protein_id="CBL36154.1"
FT                   /translation="MSKELVLYKAFIDGLVERKDSMTALCVKGGGFPKTEDNKAKNDLL
FT                   ATLTPEQKDVLAEMLQDEHIAGIHTTLAYINKMMDLDGLELHQDGESYPNDYFESLHYD
FT                   FISRCDGDEWPE"
FT   gap             1329575..1330359
FT                   /estimated_length=785
FT   gap             1331918..1333379
FT                   /estimated_length=1462
FT   CDS             1334039..1334317
FT                   /transl_table=11
FT                   /locus_tag="CL3_15270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36155"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQW9"
FT                   /protein_id="CBL36155.1"
FT                   /translation="MQTKTLTIQLNDEQLPILPVEPEAHLSFTTYADGNELELTGNRAG
FT                   LLLLAKAALGMAETVREDGFHIHLDDLYDINSEGKSILIRKEERPKP"
FT   gap             1335198..1336139
FT                   /estimated_length=942
FT   CDS             1336290..1337039
FT                   /transl_table=11
FT                   /locus_tag="CL3_15290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36156"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQX0"
FT                   /protein_id="CBL36156.1"
FT                   /translation="MNKESLTEKLLNLVEGRETPESWRSWWDEHETELEALLNRGEFLK
FT                   LKPCRHGFQWVPVFGSQKGAIAILEKSGTAFEASNLYQERYLAELDAFCKEQERVQREK
FT                   QAKFKADNPEMFRRYPKFSKALAKVLDTSDEIKPAATEEQIGNQESVLDFTLPSQVREF
FT                   FLLTAGINVSTGVILTLSGMFDLTIHGERYCVLGEFWKEADGDQLLLRPGEDTIWYYAH
FT                   EQDKVKRLCNDMTELLEKKLARYLNEQ"
FT   CDS             1337094..1337633
FT                   /transl_table=11
FT                   /locus_tag="CL3_15300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36157"
FT                   /db_xref="InterPro:IPR025412"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQX1"
FT                   /protein_id="CBL36157.1"
FT                   /translation="MEKKDFPKGTKPREIFVYTCERIAEPLIPLGYKYRKSKNDIYKKD
FT                   GIFVFSFYFSPSIRFGSTTFTAFFYVSSPVIAQWRSEQEGTEDTYDGIVGTSIARLTRR
FT                   YDDFPRYEVSTLLEGNAPSRRFPGRSRTMHYRSLPGFPTCRSCWTMWNGRGSFPIGRGS
FT                   MSLSGIGSSSNASGSI"
FT   CDS             1337682..1338191
FT                   /transl_table=11
FT                   /locus_tag="CL3_15310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36158"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQX2"
FT                   /protein_id="CBL36158.1"
FT                   /translation="MEEIRKFLSEPEEHQDEFWESDALIWVDWRDFDESIINYFNEKLP
FT                   DADKIQFECAETEKERGVDIFMKKNGVSAPIPYADDCTDRDTTLRSIQEYLSPQYQLRW
FT                   YMGSLGSDTLAFCIYPTSEWEQMEQEFGAEKVAFYFAPVQADSVMFEMDMNEVFALLEQ
FT                   RGEAQT"
FT   CDS             1338210..1338569
FT                   /transl_table=11
FT                   /locus_tag="CL3_15320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36159"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQX3"
FT                   /protein_id="CBL36159.1"
FT                   /translation="MSQIASFYLLKDGQRQELSNGDCSGAVYMAIWDWCESELDLDVRF
FT                   PAPQAEDTLDCALLKGELASNGLAALREEDLPELAAEIAPDWDLPTEAVQSGLETLRSH
FT                   LELVRGDIALLYEMT"
FT   CDS             1338621..1338917
FT                   /transl_table=11
FT                   /locus_tag="CL3_15330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36160"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQX4"
FT                   /protein_id="CBL36160.1"
FT                   /translation="MVRDGLVFKDEDGQVIFNQYSFCELVKRLLVELVGISYEEASQIV
FT                   ERSPLAEPVTDALGVAIFSHDLPYYWAMFFLLWERLLVGGQGYSSAARGYGCL"
FT   CDS             1338904..1338978
FT                   /transl_table=11
FT                   /locus_tag="CL3_15340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36161"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQX5"
FT                   /protein_id="CBL36161.1"
FT                   /translation="MDAYETLENKIMEKYHLKEPFIWT"
FT   CDS             1338969..1339274
FT                   /transl_table=11
FT                   /locus_tag="CL3_15350"
FT                   /product="Barstar (barnase inhibitor)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36162"
FT                   /db_xref="InterPro:IPR000468"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQX6"
FT                   /protein_id="CBL36162.1"
FT                   /translation="MDIREVFTIDGRRFSNMAGFYDEVERVFTFGLDWKIGRNLNAFND
FT                   ILRGGFGRHEYGQPIHIQWLAYEKSVRNLGKETMDTIVEIILDTDHSGHDCTLERL"
FT   CDS             1339299..1340078
FT                   /transl_table=11
FT                   /locus_tag="CL3_15360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36163"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQX7"
FT                   /protein_id="CBL36163.1"
FT                   /translation="MGLDIYAGTLTRYYSHNWKTVVQQWAEENGWGFQKITPDGEAADN
FT                   EEEMSPAEVQAVVENWRDQILSAISQPGQLPYAPWPEDNEKPYYTDKPDWDAFGAMLLV
FT                   AACHTYNEPVPSTVEKDWNFGEHPLVVRLASDEERVWSLFRGVTWWLPLADAFFFQAPL
FT                   PTDNQAMIATLGGLRKELEKLNQLAWQADEDAILDWADTEGYPIDGTIGPDGQYSKADI
FT                   PEHTQYDTQSLAKFAFSMFWRAMRFAEEQQVPILLDY"
FT   CDS             1340107..1340829
FT                   /transl_table=11
FT                   /locus_tag="CL3_15370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36164"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQX8"
FT                   /protein_id="CBL36164.1"
FT                   /translation="MSNKVFQQNLDDKKGPQPGGPYLIQMLFKEPVPMPDKEKMTAVMG
FT                   KHIGATECFCYDKKMAGFAALDHIAEFQDGKCPVQLMVMKCDKFKGKGFDAFLLSQMWD
FT                   CQKDRERIFRECRYQVVATDMLAAALPALERANLDADFLEALAELYPSCEAFYFQNCGK
FT                   LFLAEDVRSHQIEGPDRFIRFGVNVRFFNIEGTEDMLIDTVGMSTLFLPDLQYHFHDMD
FT                   PKLGGKPCLQCGVLHSGT"
FT   CDS             complement(1341072..1341164)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36165"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQX9"
FT                   /protein_id="CBL36165.1"
FT                   /translation="MCGSFSVKFEDTFLLIFLGKNWYFFLKKNN"
FT   gap             1341666..1343235
FT                   /estimated_length=1570
FT   gap             1343870..1344805
FT                   /estimated_length=936
FT   gap             1345300..1346093
FT                   /estimated_length=794
FT   gap             1347951..1349338
FT                   /estimated_length=1388
FT   gap             1350846..1351149
FT                   /estimated_length=304
FT   CDS             complement(1351274..1352512)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15470"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36166"
FT                   /db_xref="GOA:D4MQY0"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQY0"
FT                   /protein_id="CBL36166.1"
FT                   /translation="MAGSIFGTILTMTTWGESHGPAVGVTVDGCPAGIALCEEDIQAYL
FT                   DRRKPGQSRYSTKRNESDRVEILSGIFEGRTTGTPISMMVRNQDQRSRDYGEIASCYRP
FT                   GHADYTFDAKYGFRDYRGGGRSSGRETIGRTAAGAVAAKILGELGISVKAYTRQIGPVS
FT                   ISPERFCLEDREKNRLYMPDQEAAREAEQFLEEKMAQKNSAGGIVECVISGVPAGVGEP
FT                   VFEKLSANLAKAVCSIGAVKGFEIGDGFAAAASTGAENNDAFRVLREKEIWAEEIREEG
FT                   PQEEEILDREILREESQKAAERRKACPEEMRGGKRIVKATNHAGGILGGISDGSDIVFR
FT                   AAFKPTPSIASPQQTVNRDGEEIEISIKGRHDPIIVPRAVVVVEAMAAFTVADMMLCGM
FT                   GARMDRVKEFYAR"
FT   CDS             complement(1352676..1353737)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15480"
FT                   /product="3-carboxymuconate cyclase"
FT                   /EC_number="3.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36167"
FT                   /db_xref="GOA:D4MQY1"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQY1"
FT                   /protein_id="CBL36167.1"
FT                   /translation="MTGKYMAYVGSYSYNGQAKGITVYDVDVENGYFKYRCEMEVDNAS
FT                   YLTVSHDGRTLYSIADEGVVSFRILPNGGLARLNRASIKGMRGCHLATDEEDKFIFVSG
FT                   YHDGKETTLRLNPDGSVGEIADKVFHKGLGSVAERNFRPHISCTRRTPDGKFLMVADLG
FT                   IDQVKIYRFDGDKGTMTLVDALRCELESAPRQFIFSQDGKYFYLMYQLKNTIDVFSYET
FT                   GERVPVIERVQTVSSTGDAPAGQLTAACAIRMSPDDRYLYCSNAGDNSVSIYRRDLETG
FT                   LLTLICCLPISGDYPKDIAVFPDQKHLASINHASGTISFFSVDYENGLLMMNHRSIEVN
FT                   EPNCCVITKISKE"
FT   gap             1355192..1356507
FT                   /estimated_length=1316
FT   CDS             1356524..1358155
FT                   /transl_table=11
FT                   /locus_tag="CL3_15510"
FT                   /product="Spermidine/putrescine-binding periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36168"
FT                   /db_xref="GOA:D4MQY2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQY2"
FT                   /protein_id="CBL36168.1"
FT                   /translation="MGINNIPILNSEIVTGISLMLTFIAFGISLGFKTILIAHITFNLP
FT                   FVILSVLPKLRQTSRYTYEAALDLGANPLQAFFKVVFPDIMPGVLSGFLMGFTLSLDDF
FT                   IITHFTRGAGINTLSTLIYSEVRRGIKPSMYALSTIIFVTVLALLLITNFAPKESGAKP
FT                   QKNMQQSADKGRKISGPHLKKGLLAAASFAIVAVVCFTTYIRYTSKPANELYVYNWGEY
FT                   IDPSVIEEFEAETGIRVTYDLFETNEEMYPVVEAGGVSYDVVCPSDYMIQKMAENGLLA
FT                   ELNYDNIPNIKNIDSQYLEKSESFDPGNRYAVPYTWGTVGILYNTKRIEELGVQPPSRW
FT                   ADLWDPAYKGEILMQDSVRDAFMVALKSLGYSMNSTDEGELAQARDLLIAQKPLVQAYV
FT                   IDQVRDKMIGGEAAVGVIYSGEMLFIQEEVARQNLDYSLEYVIPEEGTNIWIDAWVIPK
FT                   NAKNKENAEKWINFLCRPDIAKKNFEYITYATPNKAAKELLEPEIQNNKALFPDTDKLE
FT                   NSEVFQYLGDAVDMIYNNLWKEVKSQ"
FT   CDS             1358200..1358589
FT                   /transl_table=11
FT                   /locus_tag="CL3_15520"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36169"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQY3"
FT                   /protein_id="CBL36169.1"
FT                   /translation="MKIAIPYADGLVFQHFNEASLFKIYTVDDFDILSSGLVTISQGTP
FT                   AQTAESLREQGVNVVICGNIGVASLLNLQDAKIQVMGGAYGEVDAQVESFLNGQLHFET
FT                   KESRREQKDGESNGNVSACGSTQCF"
FT   CDS             complement(1358721..1360244)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15530"
FT                   /product="Iron only hydrogenase large subunit, C-terminal
FT                   domain"
FT                   /EC_number="1.12.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36170"
FT                   /db_xref="GOA:D4MQY4"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027631"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQY4"
FT                   /protein_id="CBL36170.1"
FT                   /translation="MRGVETRIQEIRHRIFREVARMAYHTEWPVDKRIEELPYKIIPGE
FT                   VGNFRNDVFLERAIVGERLRLAMGLPCRGAGEHAPLSDNIEAADRAETYYTPPLINVIK
FT                   FACNACHEKRVYVTDGCQGCLAHPCVEVCPKGAVTLDRTNGRSYIDQDKCIKCGKCKEV
FT                   CGYNAIIVQERPCAAACGMDAIHSDVNGKADIDYDKCVSCGQCLVNCPFGAIADKSQIF
FT                   QVIRAIQSGERVYAAVAPAFVGQFGPKVTPGKLRAAMKALGFADVFEVAIGADLCATQE
FT                   AIDFVKEVPEKLPFMATSCCPAWSMMAKKLFPDYANCISMALTPMTLTARLIKSKHENA
FT                   RVVFIGPCAAKKLEAMRKSVRSEVDFVLTFEEMAGIFDAKHVDIENIEEDPDGVNDAST
FT                   DGRNFAVAGGVAKSVVDVIKNRFPDREIKVANAEGLKDCRKLLTLAKAGKYNGYLLEGM
FT                   ACPGGCVAGAGTMQPIKKSQAAVNQYAAKAKHKTSNETEHVKELDKLVD"
FT   CDS             complement(1360409..1361323)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15540"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36171"
FT                   /db_xref="GOA:D4MQY5"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQY5"
FT                   /protein_id="CBL36171.1"
FT                   /translation="MIMGKKTVVPFIESSYHTFTPMEKVIGDFFIHNTERENLAAKAVA
FT                   ERLFVSEASLSRFAKKCGYKGYREFLFYYLDSFEEQRTEEKANDTTKHVLETYQELLSR
FT                   TYAVVDESQVGRFLDLLLAKKRIYIYGKGSSGLAGEEMQFRFMRIGVNVQAITDSHLMK
FT                   MHSVLVSDECLVIGISVSGQTEEVIHSLKAAKAQGARVVLMTSRRDRSFDAFCDEVLLF
FT                   AVKEHMENGRAISPQFPILILVDILYSHYMKSDRFRKEALHELTMDALQNTGKGKKDRE
FT                   ILEAGADKKERKRGGEEAETWER"
FT   gap             1362849..1363617
FT                   /estimated_length=769
FT   CDS             complement(1364616..1365311)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15590"
FT                   /product="Putative N-acetylmannosamine-6-phosphate
FT                   epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36172"
FT                   /db_xref="GOA:D4MQY6"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQY6"
FT                   /protein_id="CBL36172.1"
FT                   /translation="MMDKCLERLRGHLIVSCQALPEEPLHSSFIMGRMALAAMQGGASG
FT                   IRANTKEDIAEIRRNVDLPIIGIVKRDYEDSQVYITPTMKEIDELMEVKPEIIAVQAGI
FT                   ELRPEGKTLDEFYREIREKYPNQPLMADCSTIEEALHADELGFDFIGTTMVGYTEQSRG
FT                   DRIEANDFEIIRTILEKVTHPVIAEGNINTPEKAKRVIELGCFSVVVGSIITRPQVITK
FT                   TFTDALAGK"
FT   CDS             complement(1365442..1365537)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36173"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQY7"
FT                   /protein_id="CBL36173.1"
FT                   /translation="MFFQWELKIERTFKNYAFSTKRGGVFQEKER"
FT   CDS             1365600..1366343
FT                   /transl_table=11
FT                   /locus_tag="CL3_15610"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /EC_number="3.5.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36174"
FT                   /db_xref="GOA:D4MQY8"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQY8"
FT                   /protein_id="CBL36174.1"
FT                   /translation="MRIIRTENYEELSRRAADLIAAQILVKPDCVLGLATGSTPEGTYK
FT                   ELVDRYEKGILDFSQVSSVNLDEYKGLSGDNDQSYRYFMNHHLFDHVNIDKTRTHVPNG
FT                   LEPDSDKACADYNAQIQAMGGVDLQLLGIGGNGHIGFNEPCEEFIVETHCVDLTQSTIE
FT                   ANARFFASIDEVPKKAYTMGIGNIMAAKKILLLASGKGKAQAIYDTCFGPVTPHVPASV
FT                   LQLHPDVVIIADEDALSLTKEKGAI"
FT   gap             1366746..1367441
FT                   /estimated_length=696
FT   CDS             complement(1368411..1368893)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15640"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36175"
FT                   /db_xref="GOA:D4MQY9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQY9"
FT                   /protein_id="CBL36175.1"
FT                   /translation="MREKILAVIEKNSRISTAELAEILGESEAAVAAEIAKMEEEHVIC
FT                   GYHTLINWDNTEEEKVIALIEVKVTPQRQMGFDKIAERLSQYSEVKSVYLMSGAYDFTV
FT                   ILEEKTMRGVAQFVSEKLATIDSVISTATHFVLKKYKDHGTVLSDGPQDERMLINP"
FT   CDS             complement(1368890..1369501)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15650"
FT                   /product="Hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36176"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQZ0"
FT                   /protein_id="CBL36176.1"
FT                   /translation="MNRHHSREEKKRPGFLKPGQDLIVAGSIGLTGAAAAARAGEKALR
FT                   ERFSASYAERLLSLDKDAENFAQNRLGEAFFREAGVTEAEPAEDGGIMNSLWNLLEAYG
FT                   LGCTIELRAIPILQETVEVCEVFDINPYRLSSGGCLLMAADNGFSALNALRKRGVEGAV
FT                   IGKVEKGIARRILNGETETFLDRPKPDEIEKILNQREVKV"
FT   gap             1370291..1370366
FT                   /estimated_length=76
FT   CDS             complement(1371166..1371279)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36177"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQZ1"
FT                   /protein_id="CBL36177.1"
FT                   /translation="MFMGNNKSKKIFTTVMVVIILVTMVGGTVIAGLSSLF"
FT   CDS             complement(1371285..1372040)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15690"
FT                   /product="exonuclease, DNA polymerase III, epsilon subunit
FT                   family"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36178"
FT                   /db_xref="GOA:D4MQZ2"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQZ2"
FT                   /protein_id="CBL36178.1"
FT                   /translation="MEEKNQKTADPVSFGDSYAAIDLETTGLDPKRDKIIEVGACLVEQ
FT                   GKVKRELSFLINPHREISERVELLTGITGRMVEHAPGIEEVIGEIAAFVGELPLLGHHV
FT                   IFDYSFLKHAAVNAGLPFEKNGIDTLSLCRRFMPPEEKKNLSAACGWFQIPRETAHRAL
FT                   SDAKAAHLLYQSLRDCHFQENEEAFAAKPLIYKVKREQPASKRQKEGLRELAKYHRINL
FT                   SVDIEYLTRSEASRLTDKIILNYGRMKKR"
FT   gap             1374084..1374320
FT                   /estimated_length=237
FT   CDS             complement(1374541..1375071)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15730"
FT                   /product="Deoxycytidylate deaminase"
FT                   /EC_number="3.5.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36179"
FT                   /db_xref="GOA:D4MQZ3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQZ3"
FT                   /protein_id="CBL36179.1"
FT                   /translation="MEQTAKIRGDFHKSEKRQDYITWDEYFMGVAKLAAMRSKDPSTQV
FT                   GACIVSSDNKILSMGYNGFPIGCSDDEFPWGKEHETDDPYNAKYLYTTHSELNAILNYR
FT                   GGSLEGSKLYVTLFPCNECAKAIIQAGIRTLVYDSDKYQDTPSVRASKRMLDAAGVRYY
FT                   KYSHTGRKIEVCL"
FT   gap             1375682..1376964
FT                   /estimated_length=1283
FT   CDS             complement(1379428..1380165)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36180"
FT                   /db_xref="InterPro:IPR025449"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQZ4"
FT                   /protein_id="CBL36180.1"
FT                   /translation="MIPYFNELLQEEREELTQAIRLLERQTYVLERKYDRKTGRYQYSG
FT                   VYRTLERHMEFLREYLEISGISIYEDIQLGVIYIKGEAVLAEKLPKLATLYLLILKVIY
FT                   DEQMTEASNSLAVHTTLGELSERLGVFGLTGRTAPTEIRRALSLLKKYQIIEPLDLMDD
FT                   LDGNMRLILYPTINLILTGNDVRELLSELGEGEGQDRQLTRDTEEAADEEENETDGEEN
FT                   EADREENETDGEENETDGEEDSR"
FT   CDS             complement(1380149..1380427)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQZ5"
FT                   /protein_id="CBL36181.1"
FT                   /translation="MEDKAAAITGDSVRSEEDFEKLILAYDYSLKKESPFRTEGEPESI
FT                   DNGAYVFPALVFREKTKAGEPERRAGEEAKGSYHTGKGQIREDDTIF"
FT   CDS             complement(1380369..1381595)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36182"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQZ6"
FT                   /protein_id="CBL36182.1"
FT                   /translation="MKLLNEISSSFWGLFRSPNREIYIEALLKINEEYQYSNYFLSREM
FT                   CIQVLGDYFSRRQVEIEREQEEAEADTLEPPATRILNWLIRTRWLRRQEDFVNLSVNIV
FT                   IPDYAAVFIGAFERLIGEEGDEADIYIQNIYANLFSYRNDPRASIALLNTALVNTRRLN
FT                   KTLQDMLHNMDKFFTILLDLKFYGELLRERLDGYVEEIVKKKYHILKTSDNFYLYKADI
FT                   KQWLKLLREEPEYLELTIRRGGKKLELSEAVRLLDDIERGFDDIERRIANMDREHTRYV
FT                   RVTVSRLYYLLNKEEDTKGLILQLLNRMSREEDPEPLIRKTAARMNLSRRELLSDKSLY
FT                   RKRKPREAFREKLQPEEAPKELSREELLSLNRVSAKIHQRRDYRLHQRADGGQGCGDHR
FT                   RQRPKRRRF"
FT   CDS             complement(1381822..1381887)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36183"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQZ7"
FT                   /protein_id="CBL36183.1"
FT                   /translation="MFALAMSSAARERETGALMLA"
FT   gap             1383930..1385197
FT                   /estimated_length=1268
FT   CDS             1385308..1385592
FT                   /transl_table=11
FT                   /locus_tag="CL3_15830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36184"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQZ8"
FT                   /protein_id="CBL36184.1"
FT                   /translation="MSRKHTLAIGCLLLAALAAAYAFVSGFSAREDRKREQAEAAGVIP
FT                   FTDCAELAALSYTSAGTSISFEKDKRWNMEVYGGRRFSRSSGLCPDPCQ"
FT   CDS             complement(1388475..1388714)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36185"
FT                   /db_xref="UniProtKB/TrEMBL:D4MQZ9"
FT                   /protein_id="CBL36185.1"
FT                   /translation="MEEKKRETKKGKPDGISGRSVRRKSLDRYSRAEFLRRLIEAGILK
FT                   RDTGEGEKKSLQEGQAVCKRKQREGQKTGREASL"
FT   CDS             complement(1388804..1389319)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15880"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36186"
FT                   /db_xref="GOA:D4MR00"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR00"
FT                   /protein_id="CBL36186.1"
FT                   /translation="MKENRKDRELRLREYRREDLEEMERLFFETVHTVNADDYTEEQLW
FT                   AWADKEVDHRAWHESFCRHRTVIAELGGRIAGFGDMAPDGYLDRLYVHREEQGQGIGTA
FT                   ICDYLEGEQAEAGSRTEGKEKRFVTHASVTARPFFEKRGYRVVKEQQVERKGVMLTNYM
FT                   MEKRTGGN"
FT   CDS             complement(1389588..1389662)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36187"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR01"
FT                   /protein_id="CBL36187.1"
FT                   /translation="MALALVEWDEENREYTGHKETISR"
FT   gap             1390825..1391323
FT                   /estimated_length=499
FT   CDS             complement(1391379..1391633)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36188"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR02"
FT                   /protein_id="CBL36188.1"
FT                   /translation="MRDKSLRTVQKKKREQEEKRRYLDGIRRYQSVGVTVLVDGKEPGP
FT                   GELEQIVEVREDGAFYMGDYITDETGKLVEIHFDKVYHR"
FT   CDS             complement(1391708..1392337)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36189"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR03"
FT                   /protein_id="CBL36189.1"
FT                   /translation="MGRRDKAPKKAEPGESYGAPLMVGVAGSSRGVGTTHFSIMTAAYL
FT                   SGVLGKKTALLERNDSGDFARIEEVFETHPVLKKNGCSFNILEISFIKGAGSHAFSDLA
FT                   NSDFDTVVVDFGNNFDAARPEFLLCRKKFLVGSLAEWKLAAFLELIEGKKHSEGLWEYF
FT                   ACSGSRELETELKRYPGIVIRRIPRTEDALSVTGEAMDFFGEFLEY"
FT   gap             1394452..1394582
FT                   /estimated_length=131
FT   CDS             complement(1395261..1395359)
FT                   /transl_table=11
FT                   /locus_tag="CL3_15970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36190"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR04"
FT                   /protein_id="CBL36190.1"
FT                   /translation="MQINKEMLIGDLVRLDDGIAPILMGAGMHCLG"
FT   CDS             1395630..1395800
FT                   /transl_table=11
FT                   /locus_tag="CL3_15980"
FT                   /product="Indolepyruvate ferredoxin oxidoreductase, alpha
FT                   and beta subunits"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_15980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36191"
FT                   /db_xref="GOA:D4MR05"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR05"
FT                   /protein_id="CBL36191.1"
FT                   /translation="MAYVITDTCVSCGACAGGCPVGAISEGDGKYEIDAAACIDCGACA
FT                   GTCPTGAIEEA"
FT   gap             1396874..1397639
FT                   /estimated_length=766
FT   gap             1399775..1399945
FT                   /estimated_length=171
FT   CDS             complement(1400793..1402547)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36192"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="InterPro:IPR024008"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR06"
FT                   /protein_id="CBL36192.1"
FT                   /translation="MRKGKHAVLGLAALASVAAIGATWASWTQELKAGNEFMTGDYHTS
FT                   LDETFESPDNWQPGTTTQKAVWVANDGTVDAMAKVVISQSWVRTEDVMATVLASDGNAT
FT                   EEVPVKPLAGESFPLTFDTGNGREYAAVPEFSRENVVLLASADADGEPGNRWGLEEAET
FT                   LGQAEGKWLLMNEEPQGEEGTFTLYYMGTIEAGAKSPQFLDSVTMNPDIPRSVTGKDTV
FT                   YTRDEKGNVKQITIDTVGEVPGYENARYTMTINATTVQATQAAVEEIFGSGNAEEDPGT
FT                   DADSQTLDYLVKLADEAVFDHSAEVKTLKFDETNGTMTYVPYRDGNGNVEEGNWFMSFT
FT                   DMVPGGVYKDLLNIENASNKEWNLYMRALPREQEAIKDELLEKISMTVWYKTPDMENET
FT                   KLYEGTAMGSTFLTDEGNADGADGMRAVYIGNYDAGETGYIRVELTLDPNLVLEEDPSL
FT                   TPGEGESSLVNHYAGVLSKIDWQFMVTEVKTEGGNGDNGGGGGSHGGGSSGGGGGRRID
FT                   IADNETPLSPPLTDETILDEPVPLAVLPKTGDETPIIPAVVTLLGSGIILLWLGSSLRK
FT                   KKETESPS"
FT   CDS             complement(1402673..1403521)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16050"
FT                   /product="Camelysin metallo-endopeptidase."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36193"
FT                   /db_xref="InterPro:IPR022121"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="InterPro:IPR024008"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR07"
FT                   /protein_id="CBL36193.1"
FT                   /translation="MKKKAALGLAGIAAVAVIGGTWAYWSQDLTATNEFETGKFDSDIV
FT                   EQFTPPAVGEWLPGVTTEKNVKVTNSGDVDMALVAEITQEWNREGESLPIRFAAPDPSP
FT                   ITRGYENAAVINWGENTAMHDITAIDSVAEEAREMGITASVSSLGDSEAKDKWVLVDVS
FT                   DDYSKLIFVYNGIVPAGEETPELLNSVTLNSKIESWVSEKNYFYDENGEQQVEEKGWME
FT                   VNYEDAQYTMDIHVNTVQATGDAIREIFSQYEGVDVDGFLSANADDIADAYLEATSSNA
FT                   N"
FT   CDS             complement(1403564..1404082)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16060"
FT                   /product="Signal peptidase I . Serine peptidase. MEROPS
FT                   family S26B"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36194"
FT                   /db_xref="GOA:D4MR08"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR08"
FT                   /protein_id="CBL36194.1"
FT                   /translation="MKLIKGLVNILSWAVYACIACYLLIAAPMLAGYHPVVVLSGSMEP
FT                   TYHVGSVIYYKQASFADINVGDAITFRAGEDGMVTHRVTQKSELSQNFTTKGDANLSED
FT                   PNPVDYSDVMGKVWKVSIPYAGYFVNYGKNVTVIAVMAAVIIINIVLDMIFPDKEKKKK
FT                   SEQTDAKAD"
FT   CDS             complement(1404754..1404942)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36195"
FT                   /db_xref="InterPro:IPR023833"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR09"
FT                   /protein_id="CBL36195.1"
FT                   /translation="MKRKIAALGGLAALAAVGGTWAYFNQTAAITNPFHTEGGYETSVI
FT                   EHFKPGRRPGVEARRNS"
FT   gap             1405891..1406163
FT                   /estimated_length=273
FT   gap             1407976..1408158
FT                   /estimated_length=183
FT   CDS             complement(1410522..1411238)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36196"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR10"
FT                   /protein_id="CBL36196.1"
FT                   /translation="MYEKAVSWLGDYLKVQKDYPGMYRLYRQAAQVYPFDGWQTGQIES
FT                   MIFMGNYKEAFRLYDQTARRYSEEMGLPPSDKMLECYRKMSQQFVSCPDGLDNIRAELC
FT                   ERNGTDGENAYYCSYPSFIDIYRLMARRSERSGQPMCLMLCTLVDYEGKIIQNQEKQKA
FT                   RSELLKKAIGHVLRRGDVYARYSAYQYLILLTGVSVESSHSIGNRISRYFKTLCGKRAE
FT                   VNFSVSAYQTGQEIRF"
FT   gap             1411766..1412463
FT                   /estimated_length=698
FT   CDS             1412540..1413151
FT                   /transl_table=11
FT                   /locus_tag="CL3_16140"
FT                   /product="phosphoserine phosphatase/homoserine
FT                   phosphotransferase bifunctional protein"
FT                   /EC_number="2.7.1.39"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36197"
FT                   /db_xref="GOA:D4MR11"
FT                   /db_xref="InterPro:IPR011863"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR11"
FT                   /protein_id="CBL36197.1"
FT                   /translation="MYIVCLDMEGVLVPEIWIEFAKASNIPELTRTTRDEPDYNRLMRW
FT                   RLDILKQHGLGLGQIQETISTIDPLPGAKEFLDELRSFTQVVVLSDTFEEFAMPLMKKL
FT                   GYPTLLCNSLEVAPDGTITDFKMRVEHSKLTTVRALQSIGYKTIASGDSYNDLDMIRAS
FT                   HAGFLFRSPESIRSSVPEIPAYETFDELLSAVREAVKQKD"
FT   CDS             complement(1413563..1414435)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16150"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36198"
FT                   /db_xref="GOA:D4MR12"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR12"
FT                   /protein_id="CBL36198.1"
FT                   /translation="MKKLGRNDACWCGSGKKYKHCHVAFDEKLEAAAREGHFIPSHDMI
FT                   KTPEQIEKIRESCKINIAVLDYVAEHIRAGVTTAEIDQWVYDETTRMGGIPAPLGYEGF
FT                   PKSVCTSIDDQVCHGIPSEEVVLKDGDIINVDVSTIYNGYYSDSSRMFCIGEVSPEKKR
FT                   LVEVVKECVELGLKEVKPWGFLGDMAHAVNEHAVKNGYSVVREIGGHGVGLEFHEEPWV
FT                   GYIGDRGTGMMMAPGMVFTIEPMVNMGGSEVYVDDNDGWGVYTEDGKPSAQWEIMVLVT
FT                   ENGHEVLCW"
FT   gap             1415574..1416291
FT                   /estimated_length=718
FT   CDS             complement(1416845..1417825)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16180"
FT                   /product="Cysteine-rich secretory protein family./Putative
FT                   cell wall binding repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36199"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR13"
FT                   /protein_id="CBL36199.1"
FT                   /translation="MKHKAAVILLTAVFSAGTIFPAMAGSWQKNEAGWWYRNDDGSWPA
FT                   GIWQWVDGNSDGAAECYYFDSNGYMLESTVTPDGYMVNENGAWTVDGTVQTKQVQSGKT
FT                   SGSDGWHYENGGWKYYENGSFLRNAWKYTRGNWYYFSGNGNMATGLIYVSGDRYYLNSD
FT                   GSLRMDSFEENGIYYQTDSNGKIVSETDRRKEAQLSGRFDEESGQEVLKLTNKARTEAG
FT                   VGTLEWDQSLAGCARTRAVEIGKNFAHSRPDGKSWKTVIDEAGIVTMAWGENIAQGQFT
FT                   SEEAMEDWLNSEGHRANLLKERYTKTGAACYVENGVHYWVQLFIQ"
FT   CDS             1418286..1419131
FT                   /transl_table=11
FT                   /locus_tag="CL3_16200"
FT                   /product="Pyridoxal/pyridoxine/pyridoxamine kinase"
FT                   /EC_number="2.7.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36200"
FT                   /db_xref="GOA:D4MR14"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR14"
FT                   /protein_id="CBL36200.1"
FT                   /translation="MKRIITLQDISCVGRCSITVALPILSAMGVECGILPTAVLSTHTM
FT                   FKTFTCKDLSDQIEPISEAWEREQITFDSIYTGYLASGEQCHQICQFFDRFGTKDNLIL
FT                   VDPAMADNGKLYAAFDASFPAEMAKVCAKADIILPNITEACLLTGTPYRTEYGPDYIRS
FT                   LMEKLLELGCKTAVLTGVSYQPDQLGVAYLDRSGKEFSYFTRRCPQSFHGTGDLYSSTV
FT                   LGGLMRGLDLGDALALAADFVVICIEATAASESARWYGVEFESQIPKLCQMLEERLDKA
FT                   "
FT   gap             1419307..1419435
FT                   /estimated_length=129
FT   gap             1420769..1421316
FT                   /estimated_length=548
FT   gap             1422399..1423383
FT                   /estimated_length=985
FT   gap             1425352..1425623
FT                   /estimated_length=272
FT   CDS             complement(1426566..1426910)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36201"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR15"
FT                   /protein_id="CBL36201.1"
FT                   /translation="MKERIRAVFTGVKDDGLAERQTGKANSKMGNALEALEMFQIILEF
FT                   ARKRLPTGTFFTARILETGDEDMVKVPEHTEIELNLYAEYRDKLEAMEKLLEDGARGAA
FT                   LMAGCRAEFT"
FT   gap             1427516..1428854
FT                   /estimated_length=1339
FT   CDS             complement(1429607..1430860)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16320"
FT                   /product="Bacterial extracellular solute-binding proteins,
FT                   family 5 Middle."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36202"
FT                   /db_xref="GOA:D4MR16"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR16"
FT                   /protein_id="CBL36202.1"
FT                   /translation="MVFAAQVGSAEASTVTRRSYFSSLEGTDENGVCTDLSALGVVAAD
FT                   DHTVEYHFKNPVAVSTFLSIDAQRYYPMPYHLLKDVPMEEMEKNEYWQHPIGTGPFIFD
FT                   SMVSGESITVLANKDYFLGAPNVDRIVFKVMAPANFSAALMSGELDCVIDDVPLQDLAL
FT                   LQSKEGLVAESRPSMKYTYMSVNCEKEYFQDYRVRLAFSKAIDRNAIIEQGLYGNGVIA
FT                   VSPLNPDNQYFNDAIAGDPYDPEGARELLEEAGWDFDRELTFVSYNTSAPREAATLIIQ
FT                   QNLADIGVKVNVQMVDWATLIVMAREGECDLSILGGAGSLDPDDSRVLMQPDGAQNFCN
FT                   FTDPRYYELAQKGHDAMTVEEKKRIYDEYQQLLHDEPTYIWLYHDNASPVYKDSIKNIP
FT                   ADDFIHLNFNAYAWTFEQ"
FT   gap             1431017..1431361
FT                   /estimated_length=345
FT   CDS             complement(1431631..1432494)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16350"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36203"
FT                   /db_xref="GOA:D4MR17"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR17"
FT                   /protein_id="CBL36203.1"
FT                   /translation="MGNLKKQSYFNDVLKRFVNHRLAITGTVVLFLLIVTVMVLPMIIA
FT                   LDPYTIGRGLPYGTPEKGLPLGLDSTGRDNFARLVYGGRVSLLVGLLSTAISIGIGVPL
FT                   GLIAAYYGKIVDAVIMRIADIFISFPSIILILVLVSIIGPSMWSVIVIIGIMGWPEFAR
FT                   LIRGNVLAIRQKEYVESARAVGAKDGRIITRYLLPNAVAPIIVAATFRVAGAILQESSL
FT                   SFLGMGVQPPQASWGNMLNGAQSLTVLTSRPWVWIPPGLLLVITICCVNFIGDGLRDAL
FT                   DPRMKV"
FT   CDS             complement(1432508..1433461)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16360"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36204"
FT                   /db_xref="GOA:D4MR18"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR18"
FT                   /protein_id="CBL36204.1"
FT                   /translation="MTNYIIRRTALAVITFFGITILVYFMSTLAPGSPLDALLADPGMT
FT                   KEEIARRSAELGLDQPVYIQYLSWLKEFLHGNMGFSYTSYRPVSDMITERIGATLSLTV
FT                   TAILLSYLVGIPLGLISALKPYSLRDYSVSTAAFVMTGVPGFFLGMILIYIFAVKLKLL
FT                   PFGGMYDSSGSHSIGVVIRHLILPAAAIAIPEIGKVMRHVRSNMLEVMNEDYVRTARAK
FT                   GVRESAVVIVHAFRNTLIPIVTVLSGSIPFMIGGSVVVEKVFGWPGLGTLMINSITSRD
FT                   YPVIMGISVVIAIVVLVTNLLVDILYAYLDPRITYN"
FT   CDS             1433692..1434582
FT                   /transl_table=11
FT                   /locus_tag="CL3_16370"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36205"
FT                   /db_xref="GOA:D4MR19"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR19"
FT                   /protein_id="CBL36205.1"
FT                   /translation="MELRVLNYFLTIAREENFTRAARQLHVTQPTLSRQIADLEQELGV
FT                   KLFVRSNHNIILTEDGMILKRRAQEILSLADKTKRDFLQKDEALSGTISIGSGEFRSTE
FT                   YLAKIIAGFRRKYPNVTYEIYSGNANNIRDYIERGHLDIGLMSEPIDMRKYNFVNMPIK
FT                   EQWGLFAPVDSPLSEKESISPEDLKGMSIVTATGDFNQSRIGKWLGDCREQVEIAATAN
FT                   LPYNEAVLVKENIGVMLSINLNCTYENLRFIPLRPALEVSTALAWKKEQIFSATTSAFI
FT                   DFASQYLKGISCDEI"
FT   CDS             1434721..1435074
FT                   /transl_table=11
FT                   /locus_tag="CL3_16380"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36206"
FT                   /db_xref="GOA:D4MR20"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR20"
FT                   /protein_id="CBL36206.1"
FT                   /translation="MTINEASERYKIPIKILQEYESWGLCGEVKKVMGSWHYDESDMER
FT                   LSTIMTLHDIGFSNDEVKKYMQLLLKGKSTEKERLKMLSEKRNGTLDEIHFKERQLDRL
FT                   DYLRFEIQKAMKA"
FT   CDS             complement(1435946..1436395)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16400"
FT                   /product="Type IV leader peptidase family."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36207"
FT                   /db_xref="GOA:D4MR21"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR21"
FT                   /protein_id="CBL36207.1"
FT                   /translation="MKAVFAVFLCACAWKDLKEKEIPLIFFVVAAAAGVIWAAGDLGTG
FT                   GWKEGEQVFRKLFGQAASLLPGTGLLIISYCTKGAIGKGDGLFFLVSGLYLGFWKCLAL
FT                   LFCGLLFCSAWFSLRQLLSGLKNFPLWFKMDIKMDIVQPLSFSEC"
FT   CDS             complement(1436392..1437240)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36208"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR22"
FT                   /protein_id="CBL36208.1"
FT                   /translation="MTFKMGKRRKTVSGSLTVEAALGLTLFVLFSVCMMMPMEMLRTRQ
FT                   KVQTVLEVTAREMSQYAYILYRLDQGDDTVLEESENWEKELSGLLAGMAVRAYLREKIE
FT                   GIAGKGRIENLRITEASLMEDGENIILAAEYDLKIPFSVFHISRIQASSRTARRAWIGS
FT                   EGDRNRGKETEKAEEVMVYIGSSMGRYHLSRKCHYLTNEFRAVSYESIENLRNQSGGKY
FT                   YSCSVCGKACGAGDTVYIMPNGSHYHSRTDCPSVVSYVREVPLSQAEHLGACSYCGGNK
FT                   T"
FT   CDS             complement(1437811..1438518)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36209"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR23"
FT                   /protein_id="CBL36209.1"
FT                   /translation="MDSYRSYTDAEGERRLEVERIAEETQKNREIVEESIERAVEVKEY
FT                   IDSWEGDDEDDELDEEKLWKNVRSSLNRCRIPTPGYQAGIEDRQRLGILQKINNMAKMD
FT                   LLDFVLPKGAEISEREMKMGELPSGGKDGYKMGLDSVSAKGLIDRALINKYVEVHFPRY
FT                   ENEQQEGEQKRQLFYEQEYIINGKRKDRENLSQTVKKLLAVREGMNLIHILGDSEKREE
FT                   ARLLALALTGLPV"
FT   CDS             complement(1439383..1439619)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36210"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR24"
FT                   /protein_id="CBL36210.1"
FT                   /translation="MKDTGVQRERKLKSDGLPQVVKREAAAFWEDESGVGVIEIVLILV
FT                   VLIGLVIIFKEQINKLLETIFKEINSQSKEVYK"
FT   gap             1439988..1440265
FT                   /estimated_length=278
FT   gap             1442849..1443390
FT                   /estimated_length=542
FT   CDS             complement(1443961..1444617)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16510"
FT                   /product="transaldolase, putative, TalC family"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36211"
FT                   /db_xref="GOA:D4MR25"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR25"
FT                   /protein_id="CBL36211.1"
FT                   /translation="MKFFIDTANVDEIRKANDMGIICGVTTNPSLIAKEGRDFKQVIEE
FT                   IASIVDGPISGEVNAFTTDAEGMIREGREIAAIHPNMVVKIPMTAEGLKATKVLSSEGI
FT                   KVNVTLIFSANQALLAARAGAAYVSPFVGRLDDISEPGVELIETIMDIFETHGIETEVI
FT                   AASIRTTMHVTQCAQAGADIATVPYKVLEQMLHHPLTDQGIVKFQADYRAAFGEK"
FT   gap             1444760..1445008
FT                   /estimated_length=249
FT   CDS             1445561..1445785
FT                   /transl_table=11
FT                   /locus_tag="CL3_16530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36212"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR26"
FT                   /protein_id="CBL36212.1"
FT                   /translation="MIKTKTKQEAKAGGKPTAMTVKDELRRIMAEMDCARNHFDQAVDP
FT                   VLIDCYIYEINAAQLRYQFLLRRIKSQEL"
FT   CDS             1445926..1447899
FT                   /transl_table=11
FT                   /locus_tag="CL3_16540"
FT                   /product="alpha-1,4-glucan:alpha-1,4-glucan
FT                   6-glycosyltransferase"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36213"
FT                   /db_xref="GOA:D4MR27"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR27"
FT                   /protein_id="CBL36213.1"
FT                   /translation="MNTTTDTKSFGKDQYMKKTAGQKTKTPKAGMGFFGELDLYLFGEG
FT                   RHYRLYEKMGAHPYTYRKKAGMHFAVWAPHAQSVSVVGDFNGWNPEKNPMKNINGQGIY
FT                   EAFVPDLKEGELYKYAVTTQTGSLLLKSDPFAFSAEYRPGTASVTSDITGFSWSDSAWM
FT                   EKRKQTDPVKAPLAIYEVHLGSWRKTIRPERDNCYTYREAAKALADYVKHMGYTHVELM
FT                   GIAEHPFDGSWGYQVTGYYAPTSRYGAPKDFMYLVNYLHKKGIGVILDWVPAHFPRDAH
FT                   GLADFDGEPLYEYADPRKGEHPDWGTKVFDYGKNEVKNFLIANALYWIEQYHIDGLRVD
FT                   AVASMLYLDYGRKDGEWVANQYGGNQNLEAIEFFKHLNSVLTGRKDGCMIIAEESTAWP
FT                   KVTHRPEDDGLGFTFKWNMGWMHDFLEYMKLDPIYRKFNHNHMTFGLTYSTSENFILVL
FT                   SHDEVVHLKCSMINKMPGIYEDKFANLKAGYTFMLGHPGKKLLFMGQDFGQFHEWDEKV
FT                   SLDWYLADEPLHADLQSYVRGLLTLYRKYPCLSRLDNDYAGFQWINANDADRSIFSFVR
FT                   RDETKKKNLLFIINFTPVERADYRVGVPKRGNFTLVLDSHHGYYEKNDDVHVYRSKKGE
FT                   CDGQPYSFSYPLPPYGTAVFRF"
FT   CDS             1448121..1448501
FT                   /transl_table=11
FT                   /locus_tag="CL3_16560"
FT                   /product="Copper chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36214"
FT                   /db_xref="GOA:D4MR28"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR28"
FT                   /protein_id="CBL36214.1"
FT                   /translation="MSGGTISTAVICVILAVICIFSVKKYRKKLTSGCCGAGGEGTVKK
FT                   RRVSDRNKAHYPYTKILKIDGMSCGNCANRVENALNALDGVWASVDLGSQEALVRMKQP
FT                   TDPELLKNAVRKQGYTVIRITD"
FT   CDS             complement(1448674..1449552)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16580"
FT                   /product="conserved hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36215"
FT                   /db_xref="GOA:D4MR29"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR29"
FT                   /protein_id="CBL36215.1"
FT                   /translation="MDDKALLSEKTQKAGTGKLYLCATPIGNLDDITLRVLDTLKNVDL
FT                   IAAEDTRHSIKLLNHFQIKTPMTSYHEYNKVEKARYLVDQMKKGVTVALVTDAGTPGIS
FT                   DPGEELVRQCHEAGIPLTSLPGPAACITALTISGLPTRRFCFEAFLPADKKERQWILEE
FT                   LKKETRTIIVYEAPHHLVRTLSELAAALGERNITVCRELTKRYEEAFRTTFSGALEFYK
FT                   ENEPKGECVVVIEGKSFDQVNREKQQEFEEMTVEEHMELYLSQGMDKKEAMKRVAKDRG
FT                   ISKREVYQALL"
FT   CDS             complement(1450403..1451275)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16600"
FT                   /product="Uncharacterized homolog of PSP1"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36216"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR30"
FT                   /protein_id="CBL36216.1"
FT                   /translation="MIKVIGVRFRTAGKVYFFDPAGLEINTGDHVIVETARGIEFGHVV
FT                   LGSREVDESKVVQPLKSVIRMATAADEETERRNKEKEKEAFGICLEKIKKHNLQMKLID
FT                   AEYTFDNNKVLFYFTADGRIDFRELVKDLAAVFKTRIELRQIGVRDETKIMGGIGICGR
FT                   PLCCHTYLSEFIPVSIKMAKEQNLSLNPTKISGVCGRLMCCLKNEEETYEELNSKLPGI
FT                   GDYVTTDDGLKGEVHSVSVLRQLVKVVVTVGKDEKEIREYPVKTPEIQTEAQKRKGKCG
FT                   CGVKAAGGP"
FT   CDS             complement(1451280..1452269)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16610"
FT                   /product="DNA polymerase III, delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36217"
FT                   /db_xref="GOA:D4MR31"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR31"
FT                   /protein_id="CBL36217.1"
FT                   /translation="MAGFKDIIGHEMIKDHFQKAIEYHKVSHAYILSGEQGMGRKTLAK
FT                   AFAMTLLCEKSDKEPCMECHSCKQILSGNHPDVIWVTHEKPNSIGVDDIREQLNDTIQI
FT                   KPYSSAYKIYLVDEAEKMTVQAQNALLKTIEEPPSYAVIILMTTNEEAFLPTILSRCIK
FT                   LKLRPLKDQTVSSYLMESMGIGESQADIYAAFARGNLGKAIHLASSEEFKLLYREILNL
FT                   LKHVKEMDLVMLLDYIKKMQEENLDLDECLDFMQLWYRDILMYKVTKDMNCLIFKEEYT
FT                   TVSKLCQNSSYEGLETILNAIDKAKARLAANVNTELALELMLLTMKEN"
FT   CDS             complement(1452290..1452352)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36218"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR32"
FT                   /protein_id="CBL36218.1"
FT                   /translation="MTAAQAVREETAALMRSFYA"
FT   gap             1452425..1453524
FT                   /estimated_length=1100
FT   CDS             complement(1454197..1455909)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36219"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR33"
FT                   /protein_id="CBL36219.1"
FT                   /translation="MWAHFHHAGMAPESESEPGSDPEKISENMAAELWMTVEEKAGISK
FT                   DEAVEEKEESSPGEYVKSFVRVTLMFVVLGIAAFILYRGVIQFIDEHNRVQDTVSEGTE
FT                   SEGIYKAGENGTSDGKAPDSENKTENMDGKEDQAVSFRLEGDRLLVDSEEGGMETGELF
FT                   LGRQRLIFEDGELTGIERNRQTEASQNIFYDGETKYTVRDGDIYRKIPGQKEECVIRNG
FT                   HVEWADFRFQSLYYVCSYQIPNSEQIKRTAYMADRDGENQSELFTDSAVLDNDGLQFTE
FT                   DWVYYRKGNSVFRTGMREARKERMVETQGEYFAFGDTLFYMDENGLNCVSEGETDYAEG
FT                   EILLPALEDGQIVFVYEDGEPAQPDENGELHIGDMVYTMDGNAVTAVRPAQQIYGDELY
FT                   YLYGSGMDRKIYKKAIDSDSTALVAQNGIYTDSFCIIGSWLYYSACMENIDGVQYSQTY
FT                   RANLDTMAQEKVGRLFQGVITAMYPDREENRIFGEYISETVDGKIHGNICAIMEDGQMG
FT                   IIEDSIPRNSGNDRLSFVAAQGDDIYCFYHECTYDSTSGVIRDISTEASLVKW"
FT   CDS             complement(1456452..1457312)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36220"
FT                   /db_xref="GOA:D4MR34"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR34"
FT                   /protein_id="CBL36220.1"
FT                   /translation="MKKVFAEVYRIFKKAPLHISVILLMDIAGAIIWVANPYIIGACID
FT                   DLLGRKYCWLCIFIALQLLLIALRTADKILDTRIYSRIIEEESTTYYEKIIRTDADDSK
FT                   ISSLLDRVDDIPNFLEINLFNFLSMAGGIIFSLIFIFSISGLFVLLLAVSVSIVVPFAT
FT                   YRFQKDIALNNENRKNIDEARVNIIASRKIERYKEHIRKALSLDIINSDLDAKTYLLTD
FT                   LLQTVLLVIAIISTIHAGSYTSGQLFSTITYVMMLNDYVGEINESIIVVKDLQDTVSRL
FT                   ERSAK"
FT   CDS             complement(1457542..1457874)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36221"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR35"
FT                   /protein_id="CBL36221.1"
FT                   /translation="MTRSEAVKAFFLKSVLPVAATMLLYCIFKSACMKDGELDYVWLWI
FT                   LCGLPFGLHRMYLWIVPGGGSFGGGIALFALNFIIGGVIGGFILVWRLVVAVLYVPLTM
FT                   YRLIAG"
FT   CDS             complement(1457974..1458306)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36222"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR36"
FT                   /protein_id="CBL36222.1"
FT                   /translation="MKNGKEKTTITVSTRPGLDSRGWFEEKSNRILEELSFLADIVHRP
FT                   GDAPSEGWPSKREEIDFHFTQAVRNALKIASLSGETERPFTAEDIDRIIDGGHKGYLEY
FT                   REGRQS"
FT   CDS             complement(1458359..1459702)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16680"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36223"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR37"
FT                   /protein_id="CBL36223.1"
FT                   /translation="MAVTKTHPIKSTLKAAIDYICNPEKTDGKLLVSSYGCAAETADIE
FT                   FSWTRRHAIDKGTHLGRHLIQAFEPGEVTPEEAHEIGMQLAKEILGGKYEFVLTTHIDK
FT                   NHIHNHLIFNAVSFTDYKHYHSNKRSYHYIRRTSDRICREHGLSVIIPGKDKGKSYIEH
FT                   QAAQAGTSYKAALKKAIDRLIPGSADFEDLLLHLQREGYEIKRGKYVSCRAPGQERFTR
FT                   MKTLGVDYTEETIASRIAGGSRPSRRPKRRDGRISLLIDIQNNLKAQQSAGFAHWAKLN
FT                   NLKQAARTMNFLAEHGITSYAELESRLAAVTERRDTAHASLKETEARIAELSLVMKHAG
FT                   TYRRLKPLYDRYRHSRDKEKFLRGHESGIIIFEAAARELKKLGAVPLPSTESMEKELSE
FT                   LTTKKDMLLAGYRAARSEAQEYETIRQNVDALLSAPEEQEQQRRHELE"
FT   gap             1459886..1460143
FT                   /estimated_length=258
FT   CDS             1460694..1461119
FT                   /transl_table=11
FT                   /locus_tag="CL3_16710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36224"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR38"
FT                   /protein_id="CBL36224.1"
FT                   /translation="MEEKDNAVEQLKVLISAYCFNKNTLSLYLGLSLDQVECLAEGNVD
FT                   FLPDEPLYRYQLFNKIAFLYLCATDDKDLKLSSFLEVLISYHGLSKSTLAKMAGVEIMD
FT                   IERILINSSYEVAEDVKYRVAVTSMALRFFLKDCEPK"
FT   CDS             1461155..1461817
FT                   /transl_table=11
FT                   /locus_tag="CL3_16720"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36225"
FT                   /db_xref="GOA:D4MR39"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR39"
FT                   /protein_id="CBL36225.1"
FT                   /translation="MNDTIMVIDDEQMILDMLRDQFETEQYRVITAKSSGEALRKLIEQ
FT                   PDIILLDINMPGMDGLELCRLIRDHVTCPILFLTARIEEADRVAGLRVGGDDYIMKPFS
FT                   LAELTARVEAHLRRENRIQQKISVRGFGDIVVDYTARTVSRNGQVIELSKVEFDIVELL
FT                   SLHPGQVFSREAIYEKVRGYDGTADNAVVKEHIRRIRNKLGAQNIETVWGCGYRWTK"
FT   gap             1462437..1463055
FT                   /estimated_length=619
FT   CDS             1463087..1463914
FT                   /transl_table=11
FT                   /locus_tag="CL3_16740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36226"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR40"
FT                   /protein_id="CBL36226.1"
FT                   /translation="MLSSQTAADVQDTGGVTVISGDSSAETLYYWLFDQHLNLVNEYEL
FT                   TNETLVNGLWGSVFAAAPDGKSLVYAEGPSLYQYTFDTQELAEITPAMSETVYFEAVGY
FT                   SDSGNYLAFFGSLDGQENTTAYGSIDLSSSTAAVFTAKGFSGSMLSVNGEYAAISDTIL
FT                   PASMGGAKQTGSVLFLDLAQQQGKAISVESGDESGIATVAADGQYIVTCAGGDSPSGTL
FT                   RAYQVSDGTKVADETYTMDTNCKPYEIWVIGHSAYAALGTDDGYTLSQAVDLP"
FT   CDS             1463925..1464797
FT                   /transl_table=11
FT                   /locus_tag="CL3_16750"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36227"
FT                   /db_xref="GOA:D4MR41"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR41"
FT                   /protein_id="CBL36227.1"
FT                   /translation="MKLKLESITKFYGKYPALQNVSATLTEGVYGLLGPNGAGKTTLIN
FT                   ILIGILPASGGVIYLDGENTVQMGGRYFDQIGYMPQYPQFYANFTVQEFLDYMCQVKGV
FT                   ANAKESIDAALVFVNLEEHRSKRIGALSGGMRQRLGIAQAILNDPKLLVLDEPTAGLDP
FT                   GERIRFRNLISRLANGRIILLATHIVSDVEYIAKEILLLRRGTLVMQGTPKELEQSIQG
FT                   KVWEVSVNEADMALMVDTYCVSNIKQQDGSYLLRVVDDGKPLRGAKPVSPNLDDLFLHT
FT                   FFQPSEGQT"
FT   gap             1465133..1466650
FT                   /estimated_length=1518
FT   gap             1468401..1469408
FT                   /estimated_length=1008
FT   CDS             1469820..1469957
FT                   /transl_table=11
FT                   /locus_tag="CL3_16790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36228"
FT                   /db_xref="InterPro:IPR026990"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR42"
FT                   /protein_id="CBL36228.1"
FT                   /translation="MVREYKIGNTTYVVKSHSRPDATEDAVSKVRRLIRNDLRKKPVNS
FT                   "
FT   gap             1470990..1472696
FT                   /estimated_length=1707
FT   CDS             1474236..1474697
FT                   /transl_table=11
FT                   /locus_tag="CL3_16820"
FT                   /product="Protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36229"
FT                   /db_xref="GOA:D4MR43"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR43"
FT                   /protein_id="CBL36229.1"
FT                   /translation="MIKVLFICHGNICRSPMAEFVLKDMVKKLHREQEFFIASAATSTE
FT                   EIGNPVHPGTREKLRRYGISTAGKYAVQMTRKDYAAYDYLLGMDSRNISNMRRIAGGDP
FT                   DGKIFRLLDFSASPRDIADPWYTGNFDVTYDDIAEGCQAFLQYLSEKKL"
FT   gap             1474829..1475384
FT                   /estimated_length=556
FT   gap             1476718..1476806
FT                   /estimated_length=89
FT   CDS             1478987..1479166
FT                   /transl_table=11
FT                   /locus_tag="CL3_16880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36230"
FT                   /db_xref="InterPro:IPR025346"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR44"
FT                   /protein_id="CBL36230.1"
FT                   /translation="MRIIPKDPIMCLSFVNTKLRDSYSSLDDFCEDFEADREELVSKLA
FT                   RAGYTYDREKNQFR"
FT   gap             1479639..1479938
FT                   /estimated_length=300
FT   CDS             1481328..1482098
FT                   /transl_table=11
FT                   /locus_tag="CL3_16910"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferases"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36231"
FT                   /db_xref="GOA:D4MR45"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR45"
FT                   /protein_id="CBL36231.1"
FT                   /translation="MIRFILVAGFLICFLLFSSGVLYRLKKLGEKDWETAEWKSLNIVK
FT                   RAFSVILKVSGVKVTVKGAENIPADRPVLYVGNHRSYFDILVGYTTVPGLLGFVAKKEM
FT                   IKWPFLSQWMVQVNCLFMDRENVKEGLKTILQGIEKIKRGVSIWIFPEGTRNRNALETE
FT                   LLPFKEGSLKIAEKSGCPVIPVAITGTADIFEKHIPIIRPAHVTIEFGEPFIVKELSPE
FT                   QRKFPGAYTRERILEMLEREQHGLTGNKEEAGQN"
FT   CDS             1482058..1483185
FT                   /transl_table=11
FT                   /locus_tag="CL3_16920"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36232"
FT                   /db_xref="GOA:D4MR46"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR020822"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR46"
FT                   /protein_id="CBL36232.1"
FT                   /translation="MDLQEIRKKLDKIDGEIVRLFEERMKLCADVAQFKIQTGKAVYDP
FT                   QREKEKIETVTAMADGEFMKQAVGELFLQMMTLSRRYQYRLMQNGQTALDFRFQKVKDI
FT                   EKKGVRVVYQGLEGAYSHAAVLRYFGEGADMFHVRRFEDAAKAVYEGDADYAVLPIENS
FT                   SAGAVTDNYDLLLKYENYIVAEVFVPVCHCLLGTGDAELSDIRTVSAHPQALMQSAEYL
FT                   NARRDWKQVSVENNAVAAKRVKDENDRTQAAVASAEAAKIYGLKILAEGINSSQNNTTR
FT                   FLILSRKPVYREAANRVSICFELPHESGTLYNMLNHFAFSHLNMQMIESRPIPGRNWEY
FT                   RFFVDIEGNLDDPDMINALRSVAGEANHMRILGNY"
FT   CDS             1483368..1484777
FT                   /transl_table=11
FT                   /locus_tag="CL3_16940"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36233"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR47"
FT                   /protein_id="CBL36233.1"
FT                   /translation="MMQAEGGSSFCKIPVNGRKKSGKGPGRERKSRMRNSLILYRNLKY
FT                   GELFQRMGSLLEEERGEGFTEESAWCAGSLIELADAYGFEGNLWHCFLALCLAIDENAY
FT                   SVACEIRGEAKGSLSELALYDFAVFRRLFSYDLRLLDQRSEEGEDFGLWAVIGSYRGRS
FT                   QKGRCFNSRIRSRIVELSKALGKAGSDEEFRSRTAEFYREFGVGKFGLNKAFRVTGEEG
FT                   DVTIEPITSVEHVYLRDLVGYERQKKKLVENTEAFIEGREANNVLLFGDSGTGKSSSIK
FT                   AILNEYYDRGLRMIEVYKHQFQCLSDILEQIKDRNYKFIVYMDDLSFEEYEIEYKYLKA
FT                   MIEGGLGRKPDNVLIYATSNRRHLIREKFSDKRELDDDLHKNDTVQEKLSLVARFGVTI
FT                   YYGAPDKKEFQNIVSVLAEKYHVEIPREELLLLANQWELSHGGLSGRTAAQFITHLLGT
FT                   GMSNKEGSYGN"
FT   CDS             1484767..1484976
FT                   /transl_table=11
FT                   /locus_tag="CL3_16950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36234"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR48"
FT                   /protein_id="CBL36234.1"
FT                   /translation="MAIKMFAAIDVGSFELEMGIYEISQSFGIREVDHLRHVLALGKDT
FT                   YNDGKIGYGLVKEMCQVLKILQRS"
FT   CDS             1484973..1486331
FT                   /transl_table=11
FT                   /locus_tag="CL3_16960"
FT                   /product="Exopolyphosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36235"
FT                   /db_xref="GOA:D4MR49"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR49"
FT                   /protein_id="CBL36235.1"
FT                   /translation="MKSYRITEYRAYATSAMREAKNSQIVLDQIQVRTGLIVKSINNSE
FT                   LRLMSYKAVASKDAAFQKTVQKGTAIIDVGFGSTQISLFDKDMLVSTQNIFLGGLRMRE
FT                   MISRWNLSAGEVVPVMEELVDNELYPFKRIYLKEREIKCLIATGESILFMAKSGIRHME
FT                   SDRVSAEQFRSFYNRLLSMRPEEIEDYYGVDREYASILVPSAIIYGRVLEMTGAETVWI
FT                   PGVSLCDGIAAEYAQEKKLVKLRHDFNGDILSAARNMAKRYKCHGAHIQEVDRMASELF
FT                   DVTKKYHGLGERERLLLRIAAILHDCGKFISSSRETQSSYQIIMATEIIGISHLEREIV
FT                   ANVVRYCNQEFAYNGVNLESDLSQYEGRGLTKRAVTILIAKLTAILRLANALDKSQRQK
FT                   LAGASLAVKDGKLLITATCQETIILERASFDNTAEFFEEIFGIQPVLKHKRRV"
FT   gap             1486490..1486707
FT                   /estimated_length=218
FT   CDS             complement(1486726..1486848)
FT                   /transl_table=11
FT                   /locus_tag="CL3_16980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_16980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36236"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR50"
FT                   /protein_id="CBL36236.1"
FT                   /translation="MGSDHLQAVLAQRREEGAVINPVLLLHQLMSFDSDGRKLL"
FT   CDS             complement(1488698..1488883)
FT                   /transl_table=11
FT                   /locus_tag="CL3_17010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36237"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR51"
FT                   /protein_id="CBL36237.1"
FT                   /translation="MADPHQLPSITSEKLACFSRLARLGGRHFQREIRPYLFFQMEKEG
FT                   KEGKPAVRQALTLGCV"
FT   CDS             1489023..1489727
FT                   /transl_table=11
FT                   /locus_tag="CL3_17020"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36238"
FT                   /db_xref="GOA:D4MR52"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR52"
FT                   /protein_id="CBL36238.1"
FT                   /translation="MAEINILVVDDEKEIADLVEICLVSDGYRVFKAENAKEGLDILDR
FT                   ENIHLVLLDIMMPGMDGLEMCRKIRETNNIPIIMLSARSTDLDKILGLGTGADDYVVKP
FT                   FNPLELTARVKSQLRRYTQLNPQSSALQSAKNEISIRGLVINKDNHKVTVYDEEIKLTP
FT                   IEFDILYLLASNPGRVFSTDEIFEKVWNEKVYEANNTVMVHIRRLRGKMKEDTRQNKII
FT                   TTVWGVGYKIEK"
FT   gap             1490803..1491083
FT                   /estimated_length=281
FT   gap             1492333..1492854
FT                   /estimated_length=522
FT   CDS             1493452..1494285
FT                   /transl_table=11
FT                   /locus_tag="CL3_17070"
FT                   /product="Endonuclease IV"
FT                   /EC_number="3.1.21.2"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36239"
FT                   /db_xref="GOA:D4MR53"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR53"
FT                   /protein_id="CBL36239.1"
FT                   /translation="MLRIGCHLSSAKGYLAMGMEAKKIDAGTFQFFTRNPRGGNAKEID
FT                   PEDVRAFLEFSRQEDIVPLLAHAPYTLNGCSADENIRVFARNTMEDDLRRMEFTPGNLY
FT                   NFHPGSHVKQGVETGIEYIAGMLNAILKPEQTTTVLLETMAGKGSEVGRSFEELREILD
FT                   RVALSEKMGVCLDTCHVWDGGYDIVNHLDEVLTEFDRVIGLSRLKAIHLNDSQNPLGAH
FT                   KDRHARIGEGQIGLEALVRVINHPALRRLPFYLETPNDLDGYAREIALLKSRYQD"
FT   CDS             1494362..1494877
FT                   /transl_table=11
FT                   /locus_tag="CL3_17080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36240"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR54"
FT                   /protein_id="CBL36240.1"
FT                   /translation="MVITAFCRGKTMRFLFFRDSERKSRRSSRKKDAGRAGRLMPLSGE
FT                   TGKPLRQKTAGDSEQKGRQRNRRLSLPCLPENALFWVFLVLLSIGCITRLYEKAALSPA
FT                   SSGQIFSAGGQGRDYQVKDRKLPIYCVETEKPQVALSFDAAWGGARMRLCRAIYKQFIE
FT                   NPIIKINE"
FT   gap             1495441..1496504
FT                   /estimated_length=1064
FT   CDS             1496618..1497319
FT                   /transl_table=11
FT                   /locus_tag="CL3_17100"
FT                   /product="Glycogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36241"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR55"
FT                   /protein_id="CBL36241.1"
FT                   /translation="MKKILFIASEAVPFIKTGGLADVVGSLPKCFDKQYFDVRVMIPKY
FT                   LCIKESFRNDMKYLNHFYMDYLGQSRYVGILEYVYEGITFYFIDNESYFCGSRPYGDWY
FT                   CDLEKFAFFSRAALSSLPVIGFQPDVVHCHDWQTGLIPVFLKDKFHEGEFFRNMKSVMT
FT                   IHNLKFQGVWDVKTIQRLSGLPDYYFTPDKLEAYKDGNMLKGGLVYADAITTVSNTYAE
FT                   EIKTPVLRRRA"
FT   CDS             1498284..1498802
FT                   /transl_table=11
FT                   /locus_tag="CL3_17120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36242"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR56"
FT                   /protein_id="CBL36242.1"
FT                   /translation="MRRTGRFAGEQLREWYRDQGYLECVRDILEHPAFQSMDQYIQHGG
FT                   TTCLEHCLRVSYMSYLICRRKGLHFCEAARGGLLHDLFLYDWHVHGRETGEHFHGFTHP
FT                   RTALENAEKYFSLTERERNLILRHMWPLTPLPPKYREGYVVIYADKLCSLEEIWLSVRK
FT                   KLGAALKAA"
FT   CDS             1498845..1499183
FT                   /transl_table=11
FT                   /locus_tag="CL3_17130"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36243"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR57"
FT                   /protein_id="CBL36243.1"
FT                   /translation="MTIYQEITGNQVLMSGVIGWIVAQVLKTIIDIALNRSFNPERLTG
FT                   SGGMPSSHSSTVCALTTASAYCYGFGSFEFAISFLFAMVVMYDAIGVRQETGKQAKVLN
FT                   SLRVLKIF"
FT   gap             1500085..1501044
FT                   /estimated_length=960
FT   CDS             1501597..1501689
FT                   /transl_table=11
FT                   /locus_tag="CL3_17170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36244"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR58"
FT                   /protein_id="CBL36244.1"
FT                   /translation="MQYTDSEWGIQEEKREAYVPEKIRAHRRRT"
FT   gap             1503265..1504480
FT                   /estimated_length=1216
FT   CDS             complement(1505119..1506147)
FT                   /transl_table=11
FT                   /locus_tag="CL3_17200"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36245"
FT                   /db_xref="GOA:D4MR59"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR59"
FT                   /protein_id="CBL36245.1"
FT                   /translation="MNSAENKNTQSISSPCGSSFLSSAKRAGACRRAPLPGGCSLLADE
FT                   PLEKLCQAADEIRSHFCGNDFDLCSIVNGKCGRCSEDCRYCAQSVHYHTSCREEYPLLS
FT                   SEELVKQARFNAARGVLRYSIVTSGKRLSDAEIDKVCGSIRQIRRQTNIRVCVSFGLLD
FT                   EAQFTKLRLAGVSRVHCNLESSERFFPSVCTTHTWQEKIETLKAARRAGLEICSGGIMG
FT                   LGETMEDRIDMVLSVRSLGVKSVPVNLLNPIPGTPFARNPVLTNDELRRTVAVFRFLIP
FT                   DGSIRLAGGRGLLADKGEACFQSGANAAISGDMLTTSGYSFETDRELIRRLGYEVRDER
FT                   QI"
FT   CDS             complement(1506158..1506745)
FT                   /transl_table=11
FT                   /locus_tag="CL3_17210"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36246"
FT                   /db_xref="GOA:D4MR60"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR60"
FT                   /protein_id="CBL36246.1"
FT                   /translation="MFQNDIQMSRRQGSRALSLTLCALFTALISAGAFIRIPVPVVPFT
FT                   LQLLFTMLAGLLLGGRDGAFCVGTYILLGLMGLPIFAEGGGIWYLGKPSFGYLIGFFLA
FT                   SYVTGKLAWSRKSPSLRFILLCNLAGLFIVYGIGMLYYYLISNYVIQTPIGLWPLFLYC
FT                   FILAVPGDICLCILAAVLYFRLRPLILSTFRM"
FT   gap             1506949..1507447
FT                   /estimated_length=499
FT   CDS             1507525..1508118
FT                   /transl_table=11
FT                   /locus_tag="CL3_17220"
FT                   /product="Bifunctional PLP-dependent enzyme with
FT                   beta-cystathionase and maltose regulon repressor
FT                   activities"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36247"
FT                   /db_xref="GOA:D4MR61"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR61"
FT                   /protein_id="CBL36247.1"
FT                   /translation="MEICRAYKVAVISDEIHGDLVRSGKKHLPLTSLFPSEKRVIVCTS
FT                   PSKTFNLAGNHLANIIISDSELRKEWEQRYHYMPNPISVEATISAYTRAGQWEESLDRY
FT                   IDGTFEMMENYFQLHMPRIHFSAPEATYLAWIDMREYGLSQEEIVDRFLKNGLIIEGGD
FT                   QFVADGEGFVRMNVAAPRQVIRETLERMKTAFPE"
FT   CDS             1508216..1509118
FT                   /transl_table=11
FT                   /locus_tag="CL3_17230"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36248"
FT                   /db_xref="GOA:D4MR62"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR62"
FT                   /protein_id="CBL36248.1"
FT                   /translation="MKKRTLALAAAFALAAVATGCSGQEKEAETQAAASSQAGAGAEGE
FT                   TAGSADAKSDLEATRYENILSSGVLKIGTEGTYKPFTYHDENNELCGYDVEVGKMIGDK
FT                   LGVKTEFSEITWEGLLTSLDTGTVDLVLNQVGVTPEREEKYDFSDPYLYSYIALITLDD
FT                   NEEITDWESAEGKKTSLNVSSNYAGIAEQYGMDITASDTFSKDIELLLAGRTDCVINNT
FT                   IAFNDFLTQKPDTPIKIVAVQETPDTVAIPIPKGNEDLLEAVNQAIAELREDGTLTELS
FT                   EKYLGKDFSREMTLEELTQ"
FT   CDS             1509140..1509844
FT                   /transl_table=11
FT                   /locus_tag="CL3_17240"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family (TC 3.A.1.3.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36249"
FT                   /db_xref="GOA:D4MR63"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR63"
FT                   /protein_id="CBL36249.1"
FT                   /translation="MDARTIEILTESFWPILKAGITYTIPLTLIAFALGTLLAVLVAII
FT                   RISRVPILDRICELYVWIIRGTPLLVQLFLVFFGLPKVGIVIDPMPSGILVFTLSIGAY
FT                   SSEIFRAAILSIPKGQWEAAMSLGMSYPQQLIRVILPQAVKISVPPLFNSFIALVKDTS
FT                   LAANITIPEMFLTTQRITARNYEPLLMYIEVGFIYLIFCTVLNYLQKKVEDRLMLTPHE
FT                   KKKIKEITDSQG"
FT   CDS             1509855..1510586
FT                   /transl_table=11
FT                   /locus_tag="CL3_17250"
FT                   /product="ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36250"
FT                   /db_xref="GOA:D4MR64"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR64"
FT                   /protein_id="CBL36250.1"
FT                   /translation="MLEIRHLHKYFGSNHVLKDINLKIESNRTTAIIGSSGSGKSTLLR
FT                   CINLLETPDEGEISLDGNTLRFPGRLAHSTKSAFTKRTGMVFQSFNLFPHMNAIENIME
FT                   GPVTVLKKNKKEARLEAMELLKKVGLEDKWDSLPNQLSGGQQQRIAIARALAMKPEILL
FT                   FDEPTSALDPELGAGILNLIKDLSKENYTILVVTHNMSFAREVSDEVVFVEKGTILAKG
FT                   SYDELVNMKNDRITQFLSYLD"
FT   CDS             1511687..1512196
FT                   /transl_table=11
FT                   /locus_tag="CL3_17270"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36251"
FT                   /db_xref="GOA:D4MR65"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR65"
FT                   /protein_id="CBL36251.1"
FT                   /translation="MDRNRYSIYCEMMKELKETNELMNEYDSLPHDYGNVVLYQSEAHL
FT                   IQCIGQNEGITVTEASKLLKKTKSACSQMVKKLVGKNWVRQERNKENNREYKLHLTEEG
FT                   MVIYDHHENFDRLSYEHNSQELFDFTDEELRLYIRIQQKMNELIGLDVERSYNYFTTTP
FT                   QELMEK"
FT   gap             1512348..1512534
FT                   /estimated_length=187
FT   CDS             1512566..1513210
FT                   /transl_table=11
FT                   /locus_tag="CL3_17290"
FT                   /product="Predicted TIM-barrel enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36252"
FT                   /db_xref="GOA:D4MR66"
FT                   /db_xref="InterPro:IPR005137"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR66"
FT                   /protein_id="CBL36252.1"
FT                   /translation="MRDIPYMRPDEIGYETAAALAVGIHAVREKVSIPVGAECHMNGAD
FT                   CAMACAVAAGAEWIRVFEWCNSFISQSGFINAMGGRVARMRKNLGAEHILALCDVNVKH
FT                   GSHFIIHDRSVEEQAMDVEAQDGDAVIVTGFDTGTPPTVENLERCKRAVKLPILIGSGL
FT                   SSQNVCELLSAADGAIIGSWFKEDNNWKNPVSYERTKEFMDRVKQLRDQIR"
FT   CDS             1513475..1514866
FT                   /transl_table=11
FT                   /locus_tag="CL3_17300"
FT                   /product="Na+/glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36253"
FT                   /db_xref="GOA:D4MR67"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR67"
FT                   /protein_id="CBL36253.1"
FT                   /translation="MTSAMLTDLLQSLGLLGAFLLIGVFLRAKLKIFQKTFIPASVIGG
FT                   FLLLILGPQCANVLPVPASWFDTYSLLPGILIVPVVAAVPLGLTIGGGKKDGVEPDVLK
FT                   NVFPLIGIGLAASMFQFAVGYGTHVLFSGEDLYDVFGIELAIGFVGGHGTAGTLGNMLS
FT                   ALNLPYWETSQGVATTTATFGIVGGILIGIMMINWAARHGQTAMLKKPADIPEPLRIGF
FT                   EKDIKKQNSVGRETTMSSSIDTLAFHAALIFVACGLAYLLLMAAESLQIPVLKSISVWA
FT                   YGMIVMFVIWGIMNKLKLDYLVDEKVKSKISSSVTEFAVIAAIASLPIKAVAAYIVPIL
FT                   VMVALGYVVTTGVLFILSKRLLKGFWFEQMIGTYGMSTGVFLTGVLLLRICDPDLESPA
FT                   LANYSLSYTITSIIYFAMLNFFIILPMSSGAGVTALVAVGLGLLATLFAVVSSRISFGS
FT                   EFKGN"
FT   CDS             1514943..1516436
FT                   /transl_table=11
FT                   /locus_tag="CL3_17310"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36254"
FT                   /db_xref="GOA:D4MR68"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017145"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR68"
FT                   /protein_id="CBL36254.1"
FT                   /translation="MKISGRAVIEVRKMQNYEELLEKLNARIWDYAELKFEEHQSAEAL
FT                   KHVMEEHGFSVESGLAGMETAFRATAGKGRPVIGLLAEYDALSGLSQKAGQTKPVPREE
FT                   TENGHGCGHCLLGTAAAGAALMARDYLLETGREGTIVLIGCPAEEGGSGKAYLARAGVF
FT                   DGLDAALTWHPAGGNAVLTGSLQANCQAYFRFHGVSAHAAGAPHLGRSALDAVELMDVG
FT                   VNYMREHMEPCDRIHYAITDTGGSSPNVVQNHAEVLYLIRSTDTEKVKKLYERVKNIAR
FT                   GAALMTETKVEVVFDKACSNILSNSVLEQLLYDCMKTVPLPSYTEKELEYAEKIKETIT
FT                   DADIDSDMSLMMAQGAEKRKLASRYRELPMADFVVEHRHQELFLPGSSDVGDCSHAAPT
FT                   AQFVGACFVPGTPAHSWQMTAQGKEKTAVKGMLYAAKVLCEACRRLFEEPELVKQARKE
FT                   FEETTEGKPYECPIPAEIFPNANGKRENAGLTADRKDRK"
FT   CDS             1516460..1517659
FT                   /transl_table=11
FT                   /locus_tag="CL3_17320"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /EC_number="3.5.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36255"
FT                   /db_xref="GOA:D4MR69"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR69"
FT                   /protein_id="CBL36255.1"
FT                   /translation="MTVAESAKAIEEHLRQLRREFHRHPETSGNEKETAARVVRELLDI
FT                   GGFEIREGVGGNGVIAELSGALPGPTTALRADMDALQIEEETGLPFCSENRGVMHACGH
FT                   DNHITMALGAARLLAQRKDELRGRVRMIFQPSEELSPQGGSRKMIEEGALDGVDAVFGM
FT                   HVWPDLPLGKVGVKAGPLMAASDHFTVTIKGKPSHAARPNEGIDALVAGAQFVTAAQTI
FT                   VSRNADPMKSIVITIGKLNAGTRYNIIAGECVLEGTCRTFDPSVRDLAERRLSEVLSGV
FT                   CTASGCTGELHYERGYMAVVNDEKMADYVRESADRILGNGTAVSVEPAMTAEDFSFYLD
FT                   KKPGAFAWIGTTPPGETVWPLHSSHYSPDEGVLWRGAALLAGLALGLRERQEVLLSEKG
FT                   "
FT   CDS             complement(1517645..1518949)
FT                   /transl_table=11
FT                   /locus_tag="CL3_17330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36256"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR70"
FT                   /protein_id="CBL36256.1"
FT                   /translation="MITVSIISPKVSLQAINRVIEQNDFGCIFHKYVYHTLEEIQDIYY
FT                   KCKDHCDIIFCSGEFGYYQLMNIPNIEKPCAFVSYETKHFLAIALDFVQTHPDIPLNRI
FT                   YCDFLIPSNNYLDLHRYLRPELMPHCCTDPVLRYETLFRTAKELWDEGKIDIAFVRSTN
FT                   SLKRYEDAHIPYLYIFPDDNTIADSIRSAVSTAKLRLNSVVQKASILIRLVYPDNLAGT
FT                   ELEYQRVTLLKALLDFRKEQGASFSVQTFVTYFQITWELEDGGQLSSLLRSLILYLNAR
FT                   GEISFRLGAGLSASLSNSLEQAEQALNESVHYGKNDGFLINEQLRLIGPLSVQDPLHIS
FT                   YDNEKILKFSKANGINEGNLQKIIGLFLKNPRQFLNSSLLSEWLNITPRSCNRIIQKLC
FT                   LAGLLTQMHTEGPMEKGRPVKTYCFNEKACLSTFF"
FT   gap             1519946..1520291
FT                   /estimated_length=346
FT   CDS             1520496..1521281
FT                   /transl_table=11
FT                   /locus_tag="CL3_17350"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36257"
FT                   /db_xref="GOA:D4MR71"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR71"
FT                   /protein_id="CBL36257.1"
FT                   /translation="MISKLEVTGLSYSYHSMDGETQALSDISFQVEEGEFIAVVGPSGC
FT                   GKSTLLSIICGLIKPDQGAVRIDGEPVEGTSPKLGYMLQRDHLFEWRSIFSNASLGLEI
FT                   QKNLDEEHRALVLKLLGDYGLLQFKDARPSELSGGMRQRAALIRTLALEPEILLLDEPF
FT                   SALDYQTRLAVCDDISSIIRGTKKTAVLITHDLSEAVSVADRIIILSKRPGRIKAILPV
FT                   KFSKPRLGPLSRRNAPEFSGYFKQVWNILENREESHEQV"
FT   CDS             1521268..1522068
FT                   /transl_table=11
FT                   /locus_tag="CL3_17360"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36258"
FT                   /db_xref="GOA:D4MR72"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR72"
FT                   /protein_id="CBL36258.1"
FT                   /translation="MSRYEKYETLAQQVFVAEQKRYRRRIAAGRFLLLFLLLALWEISA
FT                   DTGLLNDFIFSSPSRMLSCFVSMTADGSIFVHMGVTLFETLVSFVLVVLLGLSGAMLLW
FT                   ASRTVSDLLEPYLVMLNSLPKSALAPILIVWLGNNMNTIIVAAVSVAVFGSILTLHNGF
FT                   STMDPEQIKLIYSLGGTKKDVLRKVLLPGSLPLIISNMKVNVGLCLVGVIIGEFLAADR
FT                   GLGYLIIYGSQVFKMDMVVMSIVILCFMSALLYQAIAVLEKKIN"
FT   gap             1522824..1523726
FT                   /estimated_length=903
FT   CDS             1524331..1525191
FT                   /transl_table=11
FT                   /locus_tag="CL3_17400"
FT                   /product="Predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36259"
FT                   /db_xref="GOA:D4MR73"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR73"
FT                   /protein_id="CBL36259.1"
FT                   /translation="MKQIRKYEAALIQMDTQNDKGENLKKARRFIEEAAAHGAKLICFP
FT                   EVMNLIGKNTGEGGGREEVPGYTSEILCEEAKKHGVYIHAGSITEQVPGQKRSRNLSFL
FT                   INPEGEIIAGYRKLHMFDITLSDGTAFRESDRVQGGEEIVTAETELGVFGMSVCYDVRF
FT                   PELYRLMALSGAQVIFVPSSFTMPTGKDHWEPLLRARAIENGCYIIAAGQTGTKPAYTA
FT                   YGNSLVADPWGTVIARARDEECITYAQIDLDYLDKIREQLPSLENRRTDVYEVIYKKDS
FT                   AAKDR"
FT   CDS             1525237..1525422
FT                   /transl_table=11
FT                   /locus_tag="CL3_17410"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36260"
FT                   /db_xref="GOA:D4MR74"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR74"
FT                   /protein_id="CBL36260.1"
FT                   /translation="MNVLEAIKKRKSYRDVFKKEPVPREDLREILEAGTAAPSGCNLQT
FT                   TQFIAVDEPELVKKIG"
FT   gap             1525559..1526823
FT                   /estimated_length=1265
FT   CDS             1527419..1527688
FT                   /transl_table=11
FT                   /locus_tag="CL3_17440"
FT                   /product="Predicted nucleic-acid-binding protein implicated
FT                   in transcription termination"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36261"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR75"
FT                   /protein_id="CBL36261.1"
FT                   /translation="MKKIPLRQCIGCGEMKSKKEMIRVLKTTEDEIVIDATGRRNGRGA
FT                   YICPSMECFKKAVKSRGLERSLKMAIPKEVYEALEKEMEQIGQQ"
FT   gap             1528804..1529264
FT                   /estimated_length=461
FT   CDS             1531395..1531826
FT                   /transl_table=11
FT                   /locus_tag="CL3_17480"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36262"
FT                   /db_xref="GOA:D4MR76"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR76"
FT                   /protein_id="CBL36262.1"
FT                   /translation="MPPDVQQTGKRGNMRKNSIKNTRINSEVQRELSEIISREIKDPRI
FT                   HPMTTVVAVEVTPDLKYCKAYISVLGSEEAGKETIKGLKSAEGFVRRQLASRINLRNTP
FT                   EITFVLDQSIEYGVNMTHLINEVTKDLDTDEPEADEDEL"
FT   gap             1532559..1532664
FT                   /estimated_length=106
FT   CDS             1533263..1534204
FT                   /transl_table=11
FT                   /locus_tag="CL3_17510"
FT                   /product="riboflavin kinase/FMN adenylyltransferase"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36263"
FT                   /db_xref="GOA:D4MR77"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR77"
FT                   /protein_id="CBL36263.1"
FT                   /translation="MEYIRGTREFQIGEPTAVTLGKFDGLHRGHKKLLEELFRFRGKGY
FT                   RTAVFTFETAPGTLIRRKLQTMITTNEERCENLRAAGVDYLVEYPFNDQVASMTPEDFV
FT                   RKVLVEQMNAKAIVAGTDFHFGCRRSGDVEFLRAHARELGYELVVVEKAMDGSREISST
FT                   YIREELAAGQIEKANELLGYTYSVQGRVVHGKHLGTGMGFPTVNLLPPSQKHLPAFGVY
FT                   YSEVVIDGKVYPGITNIGRKPTIKGEHPAGVETYIYDWKKDIYGKNIEVKLLSFLRPER
FT                   KFESVEELKRQVLSDKEEGRRWHEEREGRERV"
FT   CDS             complement(1534271..1534798)
FT                   /transl_table=11
FT                   /locus_tag="CL3_17520"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36264"
FT                   /db_xref="GOA:D4MR78"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR78"
FT                   /protein_id="CBL36264.1"
FT                   /translation="MDIQKPAENSRKIRKISDCPELIHEAAGWFHSKWGVPAEEYIKSM
FT                   EESLDLSFPIPQWYVITEEDSIIAGAGIIENDFHSRKDLSPNLCALYVEEPFRCQGIAG
FT                   LLLSFICHDMLQKGIDTLYLVTDHTSFYERYGWQFLCTVQTEEPDAFPVPIRMYTRKTS
FT                   LQRPLLSQETRV"
FT   gap             1535077..1535269
FT                   /estimated_length=193
FT   gap             1537641..1538979
FT                   /estimated_length=1339
FT   gap             1540091..1540991
FT                   /estimated_length=901
FT   CDS             1542842..1543231
FT                   /transl_table=11
FT                   /locus_tag="CL3_17580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36265"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR79"
FT                   /protein_id="CBL36265.1"
FT                   /translation="MEMYLLVTNNRLCFEKYRDRVRVDYLEDGSYLDVLVRARDYVQKG
FT                   SRIETHPMAGSIKPNQTPFRSVLLSDRKMDGDEVIENELMIEDAVLMTKKFLSDRPVRK
FT                   WDESIVNDFRQVDLELISGAIDRVV"
FT   CDS             1543645..1544925
FT                   /transl_table=11
FT                   /locus_tag="CL3_17600"
FT                   /product="Glycine/sarcosine/betaine reductase component B
FT                   subunits."
FT                   /EC_number="1.21.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36266"
FT                   /db_xref="GOA:D4MR80"
FT                   /db_xref="InterPro:IPR015417"
FT                   /db_xref="InterPro:IPR016585"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR80"
FT                   /protein_id="CBL36266.1"
FT                   /translation="MKLELGIIPVKDIQFGPESKVENGVIYVNADELKALLLEDENLKS
FT                   VELDIARPGESVRIMPVKDVIEPRVKVSGEGAMFPGMISKVATVGSGRTNVLRGSAVVT
FT                   TGKIVGFQEGIIDMCGTGAEYTPFSKLNNLVVICEPADGIEKHAHEKAVRMAGLKAADY
FT                   VGKLAKDIEAEEIETYETEDVKEGIEKYPNLPRVAYVLMLQSQGLMHDTYVYGVDMKQS
FT                   LPTIINPTETMDGAILSGNCVSACDKNTSYHHLNNPVIKSLFEQHGKTLNFVGVIITNE
FT                   NVYLADKMRSSDWTSKLCKWLGVDGAIVSQEGFGNPDTDLIMNCKKIEAQGVKTVIITD
FT                   EYAGRDGASQSLADADAAADAVVTGGNANMVITLEPKDRVIGYPEVADIIAGGFDGSLQ
FT                   ADGSIVAELQVITGATNEMGFNKLSAR"
FT   CDS             1544935..1545984
FT                   /transl_table=11
FT                   /locus_tag="CL3_17610"
FT                   /product="selenoprotein B,
FT                   glycine/betaine/sarcosine/D-proline reductase family"
FT                   /EC_number="1.21.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36267"
FT                   /db_xref="GOA:D4MR81"
FT                   /db_xref="InterPro:IPR010187"
FT                   /db_xref="InterPro:IPR022787"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR81"
FT                   /protein_id="CBL36267.1"
FT                   /translation="MGKLKFVHYINQFFANIGGEEKADYQPEVRDGAVGPGLAFNQAFG
FT                   EEAEVIATVICGDSYFNENVDAATETVLNMIKEKAPDGVICGPAFNAGRYGVACGTVAA
FT                   AVKEKLGLPVVTGMYKENPGADMYKTKVYICPTKNSAAGMRDAVKKMAPLALKLVKGEK
FT                   IGSSKEDGYMPNGIRVNFFEDKPGAQRAVEMLVKKLNGKEYETEYPMPSFDRVAPGEAV
FT                   KDLAHAKIALVTSGGIVPKGNPDHIESSSASKYGQYDIEGVMDLTEETYETAHGGYDPV
FT                   YANQDADRVLPVDIVEEFIKEGKIGSLHKYFYTTVGNGTAVANASKFAKEIGQKLVDDH
FT                   VDAVILTST"
FT   CDS             1546012..1546248
FT                   /transl_table=11
FT                   /locus_tag="CL3_17620"
FT                   /product="selenoprotein B,
FT                   glycine/betaine/sarcosine/D-proline reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36268"
FT                   /db_xref="GOA:D4MR82"
FT                   /db_xref="InterPro:IPR010187"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR82"
FT                   /protein_id="CBL36268.1"
FT                   /translation="MVKGIESYGIPVVHIATVVPISLTVGANRIVPAIAIPHPLGNPAL
FT                   SHEEEKEIRRKIVGKALEALQTPVDGQTVFEWK"
FT   CDS             1546436..1547377
FT                   /transl_table=11
FT                   /locus_tag="CL3_17630"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36269"
FT                   /db_xref="GOA:D4MR83"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR83"
FT                   /protein_id="CBL36269.1"
FT                   /translation="MGKIYDVIILGAGPGGLAAGLYSGRYRLDTLVIEKAKDGGQIAIT
FT                   DEIENYPGQMVDGESGPSLIERMTKQVEKFGAERVTDTINKVELEGPIKKLYGTNGEYE
FT                   CKCLIIATGAYPRPIGCKREGEFVGKGVSFCATCDANFFEDFEVFVVGGGDSAVEEAMY
FT                   LTKFARKVTIIHRRDELRAAKSIQEKAFKNPKLHFMWDTVVDGLEGDGLLSAMTVKNVK
FT                   TGEITRIEADPDDGMFGVFGFIGYIPRTDLFEGMLDMENGYIKTDDNMHTNIPGVFAAG
FT                   DVRVKSLRQVVTAAADGAIAAQQAEKYISEME"
FT   CDS             1547410..1547727
FT                   /transl_table=11
FT                   /locus_tag="CL3_17640"
FT                   /product="Thioredoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36270"
FT                   /db_xref="GOA:D4MR84"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR84"
FT                   /protein_id="CBL36270.1"
FT                   /translation="MVDLTKENFEEEVLKAEGTVLVDFYGDGCVPCQALMPHIHAMEDV
FT                   YGKDIKFTSLNTTKARRLAIGQKVLGLPVIAIYKGGEKVAECVKDDATPENVEAMIKAN
FT                   L"
FT   CDS             1547878..1548009
FT                   /transl_table=11
FT                   /locus_tag="CL3_17650"
FT                   /product="Glycine reductase complex selenoprotein A."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36271"
FT                   /db_xref="GOA:D4MR85"
FT                   /db_xref="InterPro:IPR006812"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR85"
FT                   /protein_id="CBL36271.1"
FT                   /translation="MAILNGKKAIIIGDRDGIPGPAIEECVKTAGAEVIYSSTECFV"
FT   CDS             1548025..1548351
FT                   /transl_table=11
FT                   /locus_tag="CL3_17660"
FT                   /product="Glycine reductase complex selenoprotein A."
FT                   /EC_number="1.21.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36272"
FT                   /db_xref="GOA:D4MR86"
FT                   /db_xref="InterPro:IPR006812"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR86"
FT                   /protein_id="CBL36272.1"
FT                   /translation="MDLENQKRVKDFAEQYGPENVVVILGAAEGEAAGLAAETVTAGDP
FT                   TFAGPLAGVQLGLTVYHICEDEIKAEVDPGVYDDQISMMEMVMDVDDIHNEMSSIRDQY
FT                   CKYL"
FT   gap             1548409..1548919
FT                   /estimated_length=511
FT   CDS             1549002..1549562
FT                   /transl_table=11
FT                   /locus_tag="CL3_17670"
FT                   /product="Fatty acid synthesis protein."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36273"
FT                   /db_xref="GOA:D4MR87"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR87"
FT                   /protein_id="CBL36273.1"
FT                   /translation="MRGNDLLSASADVMVMDSLTGNLMTKIFSAYTTGGSYESLGFGYG
FT                   PGIGPDFDKLIMIVSRASGAPVIAGAMEFATNLINHDWKKIVKEEWKKAEKAGLRAILD
FT                   EIKKANTKKADADEEVAMPPKEICTEQIPGIEVMDLEDAVKVLWKDGIYAESGMGCTGP
FT                   IVRMAADKKEKAVELLTAAGYIG"
FT   CDS             complement(1549652..1549789)
FT                   /transl_table=11
FT                   /locus_tag="CL3_17680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36274"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR88"
FT                   /protein_id="CBL36274.1"
FT                   /translation="MQFFCSRKVTKKLHPFPTFIHFTLFPGERGEAAHHALLPSVFSPP
FT                   "
FT   tRNA            1549883..1549975
FT                   /locus_tag="CL3_T_35370"
FT   gap             1550029..1550977
FT                   /estimated_length=949
FT   CDS             1551390..1552733
FT                   /transl_table=11
FT                   /locus_tag="CL3_17700"
FT                   /product="Selenocysteine-specific translation elongation
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36275"
FT                   /db_xref="GOA:D4MR89"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR89"
FT                   /protein_id="CBL36275.1"
FT                   /translation="MEGFGTVVTGTLIEGMCETGQEVMVYPQERLLKIRGVQSHGQKEE
FT                   KAFAGQRTAINLAGIKKEELSRGEVLAYPGSLVNSTMVDATLRLFASTQRKLKNGDRVH
FT                   LSYGSAQVIGKVILLDADVIEAGQEAFVQLRFDEPICVKRNDKFIVRFYSPVETFGGGT
FT                   VLNPAADKHKRGQEAVIESLRLKKTGTDIEVLEQMVDEESRRFPEPKELAAWMDLTVSE
FT                   AEKLLDTLRNKKKILHLNDGSFVGKAYWERVAETAKEILAQFHRENPIVGGMDREELKS
FT                   RLAERLHLQSMKKAETLMAELEKRKVISIQGSIVSVAGFTVSYSDEASRLVTDLENIYK
FT                   KAGFEVPSTEELVSAYKDKKQAKQVLAELTKQGVLVKAGTGVLMHKEHWDRALSVLRDY
FT                   LSSHPEITLGEFRDLLGTSRKYAVMLLETYDQMKITKKMGDARIPGGK"
FT   gap             1553796..1554171
FT                   /estimated_length=376
FT   CDS             1554260..1554340
FT                   /transl_table=11
FT                   /locus_tag="CL3_17730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36276"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR90"
FT                   /protein_id="CBL36276.1"
FT                   /translation="MAGKVALVIAIVVLFMIGFLPSKGKK"
FT   CDS             1554387..1554593
FT                   /transl_table=11
FT                   /locus_tag="CL3_17740"
FT                   /product="Predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36277"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR91"
FT                   /protein_id="CBL36277.1"
FT                   /translation="MYEVDARGLSCPEPVMMTADAIKKHGSETIRVLVSEVHTRQNVEK
FT                   YAKSQGKNVSVRENGEDFELIIE"
FT   CDS             1555112..1555711
FT                   /transl_table=11
FT                   /locus_tag="CL3_17760"
FT                   /product="Selenocysteine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36278"
FT                   /db_xref="GOA:D4MR92"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR92"
FT                   /protein_id="CBL36278.1"
FT                   /translation="MIYFDNAATTMKKPAQVADAVSRALMNFGNSGRGASEASMDASRI
FT                   IFSTREKIARLFHAGEPRQTAFTCNATESLNTAICGLIGPQDHVITTVLEHNSVLRPLF
FT                   HLAEQGTDVSFVTCDSLGRLKYEEFEANLKKNTKAVICTHASNVTGNVVDLKRVGEFCK
FT                   KHGLLLSPTFPRQQEPIRWIWRYFRRMSCALPGIRV"
FT   CDS             1555660..1556259
FT                   /transl_table=11
FT                   /locus_tag="CL3_17770"
FT                   /product="Selenocysteine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36279"
FT                   /db_xref="GOA:D4MR93"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR93"
FT                   /protein_id="CBL36279.1"
FT                   /translation="MEVFQADVLCFTGHKGLMGPQGTGGLCVREGVDIAPLKRGGSGVH
FT                   SFLKEHPSEMPVRLEAGTLNGHGIAGLNAALDFIDKTGVENIHSRENALLMQFYEGVRG
FT                   IPGVKVYGDFEDSLSRFRRTAVAAINIGDYDSSRVSDELETVYGIATRPGAHCAPLMHQ
FT                   SLGTVEQGIVRFSFSWFNTEEEIEAGIRAVREMAKE"
FT   CDS             complement(1556516..1556917)
FT                   /transl_table=11
FT                   /locus_tag="CL3_17780"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36280"
FT                   /db_xref="GOA:D4MR94"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR94"
FT                   /protein_id="CBL36280.1"
FT                   /translation="MAIMTPLAIQLGYMITNDVHFSVGMCGAVLSGAIFGDHCSPVSDT
FT                   TVMASLFSGADHIDHIGTQIPYTCTVGAVIAVLYVLYGFFRISPVIMIPLGLVALYFLQ
FT                   IILHNIFMKKYGIDPNYSKTMTEDHVVAK"
FT   gap             1558047..1558332
FT                   /estimated_length=286
FT   gap             1560172..1560238
FT                   /estimated_length=67
FT   CDS             1562326..1562442
FT                   /transl_table=11
FT                   /locus_tag="CL3_17840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36281"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR95"
FT                   /protein_id="CBL36281.1"
FT                   /translation="MAKSLCGQAAQKKIKKQKAAFYSGKRPFLLNKEGIKYR"
FT   gap             1563174..1564134
FT                   /estimated_length=961
FT   CDS             1564348..1564416
FT                   /transl_table=11
FT                   /locus_tag="CL3_17870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36282"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR96"
FT                   /protein_id="CBL36282.1"
FT                   /translation="MKEEMKGNGAERLISPEYKTRN"
FT   CDS             1564433..1565824
FT                   /transl_table=11
FT                   /locus_tag="CL3_17880"
FT                   /product="glycine dehydrogenase (decarboxylating) alpha
FT                   subunit"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36283"
FT                   /db_xref="GOA:D4MR97"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020580"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR97"
FT                   /protein_id="CBL36283.1"
FT                   /translation="MKGYASHPYIPNSVPEIQEEMLHEIGMNSLEELHKNVPEILKLKE
FT                   NMNLPKAFGSEYELRRHVEKVLSKDTDCHKNLNFLGAGCWQHYVPAICDEINGKGEFLT
FT                   AYGGEPYNDEGRFQSLFEYASMVAELVDMDVVNVPTMDWAQAAATTVRMAQRITNRSVV
FT                   LVPEIIDPQKLAVMKNYAESVIKFEKVKATAQGTIDLDDLKAKLNDDVIGMYFENPNYL
FT                   GVIEPNGQAISDAVHAAGGLSLVGIDPISLGVLATPPTYGADIVCGDLQPLGIHMFYGG
FT                   GQSGFMATTDDEKFVMEFPSRLFGIAPTSEPGEYGFGDVAYDRTSFGHHREHGKEYVGT
FT                   QSALWGITAGVYLATMGPQGMAEVDELIMANAQYAAKKLSEIPGIKVNPFGSVFFKEFV
FT                   IDFTETGKTVEEINKALLAKGIFGGKDLSKEFPNLGQSALYCVTEVHMKEDLDTLAAAI
FT                   AEVIK"
FT   gap             1567179..1568067
FT                   /estimated_length=889
FT   CDS             complement(1568286..1569086)
FT                   /transl_table=11
FT                   /locus_tag="CL3_17900"
FT                   /product="Integral membrane protein (intg_mem_TP0381)."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36284"
FT                   /db_xref="InterPro:IPR011737"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR98"
FT                   /protein_id="CBL36284.1"
FT                   /translation="MKYLLLNYILEPTAWPMEPPAPGSVFHLALSFILISLALLLAWKL
FT                   RHLGEPQAIRLLTGLGILLFCCELYKQLFIYYIENNGHYNWWYFPFQLCSLPMYLCLLL
FT                   PFLTARKRALLFTFMYQYNLLGALLVFAEPSGLMHPYWTLTLHGFFWHGILVFIGFFIL
FT                   FSGRTSSGNDVFLKTTALFLSCCAIAAGINVLSRQVALPPWQDADMFYISPFYPNTQIV
FT                   FHQIAERFGISTGNIAYLAAIIAGAFLMKEISDAVSKHCKKASK"
FT   CDS             1569450..1570352
FT                   /transl_table=11
FT                   /locus_tag="CL3_17910"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family (TC 3.A.1.3.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36285"
FT                   /db_xref="GOA:D4MR99"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D4MR99"
FT                   /protein_id="CBL36285.1"
FT                   /translation="METVNENEKKKKVNGGVYYEKKFLALSMAAVMAAALAGCSSGGST
FT                   ADTTAAAAEETTAAGSEAAAEGSEAAEDAEAAEETAGGTLIMGTNATFPPYEYYDGDAI
FT                   VGIDVEIAEAIGEKLGMDVQVEDMEFDALIPALVSDKVDFVAAGMTVTPDREASVNFTD
FT                   TYATAAQVIIVKEGSDIASVDDLAGKVVGVQLGTTGDLLVSEIEGTTVERYNKGFEAVQ
FT                   SVTQGKIDAVVIDNAPAKNFVAQGEGLVILEEALSSEDYAMAVNKDNTELLEQINGAIA
FT                   ELKEEGTLDAIVDKYIPAE"
FT   CDS             1570463..1571155
FT                   /transl_table=11
FT                   /locus_tag="CL3_17920"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family (TC 3.A.1.3.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36286"
FT                   /db_xref="GOA:D4MRA0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRA0"
FT                   /protein_id="CBL36286.1"
FT                   /translation="MWNQFVDTFTRNFINGDNWHYIADGLVTTIQITFFAVLVGIVIGF
FT                   IVGIIRSTYDKTHRLKILNFICNVYLTVIRGTPVLVQLLIIYYVIFASVRIDKVLVAVL
FT                   AFGINSGAYVAEIFRSGIMSIDNGQFEAGRSLGFNYPQTMWYIIMPQAFKNVLPALCNE
FT                   FIALLKETSIAGYIGLQDLTKGGDIIRSRTYSAFMPLIAVALIYLAIVLIFTQLIKILE
FT                   RRLRQSEH"
FT   gap             1571941..1572504
FT                   /estimated_length=564
FT   CDS             1574284..1575099
FT                   /transl_table=11
FT                   /locus_tag="CL3_17950"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36287"
FT                   /db_xref="GOA:D4MRA1"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRA1"
FT                   /protein_id="CBL36287.1"
FT                   /translation="MKQKGYQTNAEYIESMMKQFKLVDMREQYRDLILEAESSDMDYES
FT                   FLVRLLSAEEEGKRGRRTEKLRREACFEAEKRLEDIDYGFNQSLDRDKITELGRLDFID
FT                   AGENVIIIGPPGVGKSMIATGIGMNAIRAGYRVLFANAKDLVDRLYEKMREGVLRETLE
FT                   ELNRIPLLIIDELSYLKMDRERESLFFQVIRHRHEKNSLIITTNLPMGRWDELFTGKLA
FT                   ATAILDRLVHHCHILSKKTIPAIRWSFGTKAERPFFPASSWSGICPNCL"
FT   CDS             1576275..1577366
FT                   /transl_table=11
FT                   /locus_tag="CL3_17970"
FT                   /product="Ankyrin repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_17970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36288"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRA2"
FT                   /protein_id="CBL36288.1"
FT                   /translation="MSEVSYSNVPPMMAAIKSGDIEAIRSLLHAGHSPNEPQCYQVMIG
FT                   DWPRDDEASPLELAVLENRMDMVQLLIECGADLTHNPEELLCGSLRSQDLTLFSFLVDV
FT                   GVRIPATQRDICRLFLHLVDRDEPNVLPILKRMGMDLKQYGGEALRSMASHGNQLLVEY
FT                   PIQNGADINYHKPDMVFPYASTPVTEAARHNDFSMVRWLVEQGADITIPDKYGDRPYTV
FT                   AVQNKNQEMAAYLKALEPEEWHNEQEKARQLMPYKLPAKLVEYLKTGPLRLEFPERELV
FT                   KWAELYPYMDLQEMTWKRKKLLSLMAKMDNYSDYLLLWSPRDKKLWYLDIEHKEFHPLA
FT                   KWEEFIADPGKYLNGMIEGEFEE"
FT   gap             1577661..1578214
FT                   /estimated_length=554
FT   CDS             1578491..1579246
FT                   /transl_table=11
FT                   /locus_tag="CL3_18000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36289"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRA3"
FT                   /protein_id="CBL36289.1"
FT                   /translation="MEQAYCTAVFWRGGEKIDLNGLKPDAVRCLSVTGERKVNLSFLRD
FT                   YPNLEELTLMEKCEGVEVLSELKQLHTLSLWLSAPVSWDNVSLPGLRVLHLRGEKNGDI
FT                   TPLLSSITNLHLEEMRKTEDLTPFLTPATRLQKLYLQSLPAVQKLPALDGLPSLYALKL
FT                   YELHKLSDLSALSHSHLRYFAASLIGDKLSAQALADAVLAIPGLEAAALQLVDRSGRRY
FT                   GSIQKAFAAAGKSGLLREEISALTTWLSL"
FT   CDS             1579271..1579396
FT                   /transl_table=11
FT                   /locus_tag="CL3_18010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36290"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRA4"
FT                   /protein_id="CBL36290.1"
FT                   /translation="MEQFFEHSDLGLGALTFQKGPGTIHCWTGRIADTEILFPLF"
FT   CDS             1582190..1583215
FT                   /transl_table=11
FT                   /locus_tag="CL3_18040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36291"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRA5"
FT                   /protein_id="CBL36291.1"
FT                   /translation="MKAKLKVIKNWEFEEFELTGTSFKYSPTGCKGMVARSEDEIVFWT
FT                   YHLVQKCSGVLWVKGEVSRWIPSPDPKEQQDVWEIPVLLSCDRGILLVCPASKSLWWMP
FT                   QMDGEWIPIPMDNWCAQGIPKPVAVTGSQGVFPIVCRVDNSADATNSFTSLTVDFETMT
FT                   AHWAESGSCVYSKAGTRQTHLAAVERAGGNFAQADFHYNYPMIGSILEQNGQFYAFLES
FT                   STINPAGLSLMGYYWYLELEENGLFKKKLWGKDNLSRLPGKHGMRGKFSGDRTCLILSP
FT                   IFKNDDWKGKQKVLRLSDLVLIDLAMPHGYASFHVLDVWGNRAFLSDEKDKLVLCEMTL
FT                   E"
FT   gap             1583341..1584071
FT                   /estimated_length=731
FT   CDS             1584452..1585117
FT                   /transl_table=11
FT                   /locus_tag="CL3_18060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36292"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRA6"
FT                   /protein_id="CBL36292.1"
FT                   /translation="MSEQYKSQIRRRWELPADYWMLLERCCGLRTVWSNDTYEALELWG
FT                   LDTLVKSQEGYAYNPVEQKVIKDWDEHLVVIASDAGDPYCLDLRRNDTAVFWAEHGAGT
FT                   WDFQPAFDCLEDFLESVLNVPKTQKYETAYSYHYTRLIVTGISDTKKALVFLKQHFGDS
FT                   SFQQTKDRLKELPLLIYSGLDTETAPLENSLDRWGLMYEKQQISLEKFLEDQAYIRNL"
FT   CDS             1585235..1585468
FT                   /transl_table=11
FT                   /locus_tag="CL3_18070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36293"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRA7"
FT                   /protein_id="CBL36293.1"
FT                   /translation="MKIHTTSSSVTFVCGDVAIIGNGEFRASSGKVDGFILYADTLQYE
FT                   NGAKLSRDEQENLKCLYQHFVLNREDFIDWDI"
FT   gap             1585567..1586088
FT                   /estimated_length=522
FT   gap             1588579..1589217
FT                   /estimated_length=639
FT   CDS             1589886..1590749
FT                   /transl_table=11
FT                   /locus_tag="CL3_18110"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36294"
FT                   /db_xref="InterPro:IPR005363"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRA8"
FT                   /protein_id="CBL36294.1"
FT                   /translation="MNEYLKQYIELQKQFRETKGKADSVRALYAFKEELEQSEDTQAKE
FT                   VLVYVYDLLDFKKSAYELLSKIGDRSNPKIFRRLAIMKEYADDWGDSFALRKPKTKAEK
FT                   QKDKEKRDKLGLPSFRYHPDPLDTGAFEQSEESVVCDCCGKNIHIYYTDPFYTVEDIEY
FT                   LCPECIASGEAARKYNGSFQDVCSLEDGVDDPEKLDELLHRTPGYSGWQQEYWRVHCGD
FT                   YCAYLGNVGASELRALDVLEEVLDDPMWDDEQKEMIQESVNGGHLQCYLFQCLHCGKHL
FT                   VWMDFD"
FT   gap             1590876..1591896
FT                   /estimated_length=1021
FT   CDS             complement(1592135..1593763)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18130"
FT                   /product="transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36295"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRA9"
FT                   /protein_id="CBL36295.1"
FT                   /translation="MRINKILQKDYTLSSLYYQIKLPLDVEILIPADDPVRLLSAFVEG
FT                   MELSDLYQTYGKIKKNQATPRQLFKIMVYASMNRIYSSRDIETACRRDINFMYLLEGKP
FT                   APDHATFARFISLHFAQCSKKTLAEVSKLLYSLGEISGKSIFIDGTKIESVANKYTFVW
FT                   KKAITKNQAKLFDKILVFVEECENLYGFRIAYNGKVSLHTLKRLRKKLCRIRQEEGIVF
FT                   VHGTGRRKTHLQKSLETLETYIAKLKEYNKKLYVCGDRNSYSKTDPDATFMRMKEDAML
FT                   NGQLKPAYNLQHGVDSEYITWLDISPRPTDTRTLIPFLKDMELYLPFKYQEIVADAGYE
FT                   SEENYLFLEENGQLAYIKPQNYEISKTRKYRQDIGRMENMKYDEKADCYYCKNGQVLTM
FT                   QYEKREKTARGYRRTVTVYRSNGCSGCPFKTDCIKGNNCKTPMEDRQKVLYVSKKMKEK
FT                   RQETLERITSDYGTQLRMNRSIQAEGSFANIKEDMEFRRYLYRGNANVTAQSILLAIGY
FT                   NINKLHHKIQAGRTGRHLFPLKQTA"
FT   CDS             complement(1593879..1594421)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18140"
FT                   /product="Bacterial regulatory proteins, tetR family."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36296"
FT                   /db_xref="GOA:D4MRB0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRB0"
FT                   /protein_id="CBL36296.1"
FT                   /translation="MREDMKAVIADTFSQMLDKEDIDKITVTKLIAECHISRQTFYYHF
FT                   KDIMDVLEWTFRRATQELVQKSLNEEDRLGALTTYVAFVRQNRKKFERLLYSRRWVQIE
FT                   GMLVEAVTVYLAQIARSKVPELDLSVDDLEVMLRFYACGMVGVLLQYMEKPNLNEEKLV
FT                   IQMEKIITGKMFPGKHD"
FT   gap             1594515..1595524
FT                   /estimated_length=1010
FT   CDS             complement(1595627..1596433)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18160"
FT                   /product="ABC-type spermidine/putrescine transport system,
FT                   permease component II"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36297"
FT                   /db_xref="GOA:D4MRB1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRB1"
FT                   /protein_id="CBL36297.1"
FT                   /translation="MNTEKKKRNAGSKIAIIVIIVYLLLPLVMTLIYSLFQEWIDVMPT
FT                   GFTLGAYTELFTDPLFWKAVGRTVIISIVPIVLCTVFVLLAMYVVVVYHPEWDKMIQIL
FT                   CTIPYAIQGVILPICVLSLYSSAPEPFGDRMFMLVATYMVVILPYVYQGIRNNLNGVGA
FT                   PRLIEAAQMLGASKFYAFFRVVIPNIMSGVTISVMLAMAIVFGDFVIINTLAGGQFMTA
FT                   QMYLYDVMKKSGQRTCAVIVILFLVTLIISACAFFLQSKGKDRKDR"
FT   CDS             complement(1596464..1597279)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18170"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36298"
FT                   /db_xref="GOA:D4MRB2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRB2"
FT                   /protein_id="CBL36298.1"
FT                   /translation="MKTQKKTYIFALVPFLLLCLLFEIIPVIFTVIRSFFPEGGDMGFT
FT                   LDNYINIFTGKLYQQAIVNSLLISILSSVIGLLVAFIGAKAVHEEKGKLKQVFMSILNM
FT                   VSNFSGVPLAFAYIIMFGNIGVMTMIGANYGIEFLAEFPLYSVWGLLLIYVYFQIPLST
FT                   LLLIPAFDSIRKEWKEAVALLGGSRMTFWRKVGIPVLMPSILGTIFCIVCQRTGSLCVC
FT                   LCTADEQCITASDPSVGTVRRRYHTETGVRKCDCSHHDGLHGDRHWRTE"
FT   CDS             complement(1597351..1598451)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18180"
FT                   /product="ABC-type Fe3+ transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36299"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRB3"
FT                   /protein_id="CBL36299.1"
FT                   /translation="MKRRIISALLLVCITAAIASGCGSDEPVETVDLNSMTLEEIEAQA
FT                   KEEGELASAAMPDTWANWGETWQEYTDTYGIEHVDTDMSSAEEISLFETEGTDATKDIG
FT                   DVGQAFGPVAEEQGVTLPYKTSYWDSIPDWAKDDDGDWIIGYYGTMSVIVNNKIVKDTP
FT                   TSFEDILNGDYIVAVGDVQAATQAQYAVLAAAIAYGGDESNIQPGLDYFRQIAEQGRLD
FT                   LGEFTQARIEKGEVGVAFLWDFNALGYREQFVENNPDADFTVFIPSEASIQTGYATIIN
FT                   KYSKHPCAAALAREYILSDEGQINLAKGYATPIREDVELPDDVASKLLDDSQYANARMV
FT                   EDQDAWDETAQTIGTLWQEEVVAYAQ"
FT   gap             1598590..1598962
FT                   /estimated_length=373
FT   CDS             complement(1599508..1599804)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18200"
FT                   /product="Ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36300"
FT                   /db_xref="GOA:D4MRB4"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRB4"
FT                   /protein_id="CBL36300.1"
FT                   /translation="MGEPDEVWEKRIKELSPYKVTKEVMANAKDSAIFLHCLPAFHDLK
FT                   TKIGKEMGERFNIEDMEVTDEVFESEQSKVFDEAENRMHTIKAVMMATLGIEE"
FT   CDS             1600131..1600745
FT                   /transl_table=11
FT                   /locus_tag="CL3_18210"
FT                   /product="SOS regulatory protein LexA"
FT                   /EC_number="3.4.21.88"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36301"
FT                   /db_xref="GOA:D4MRB5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRB5"
FT                   /protein_id="CBL36301.1"
FT                   /translation="MRSKNPEVMNAICTFVDQYYREHHASPSVNEIAQGVGVSKATSYR
FT                   YLVAMNERGMLSYDCKTIVTKQVGKCTSGYFSAPVVGSIRCGDPEREEESVEEYVSLPK
FT                   SIFGEGKFYILRAKGDSMVDAGIEDEDLIVIRIQDTAAVGDIVVALDEDNENTLKTFGG
FT                   IDEENGDVILRYANQTKYPDKEIRVKQLIVQGVAKHVIKAL"
FT   CDS             1600788..1600982
FT                   /transl_table=11
FT                   /locus_tag="CL3_18220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36302"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRB6"
FT                   /protein_id="CBL36302.1"
FT                   /translation="METYDVRCPICGKLNHNLYLEETDGWMECEHCHQAVQILAYAKTK
FT                   PIPVYTGRELAEKFLISTK"
FT   CDS             1601009..1601227
FT                   /transl_table=11
FT                   /locus_tag="CL3_18230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36303"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRB7"
FT                   /protein_id="CBL36303.1"
FT                   /translation="MQEKEIWRPFSWHCPNCGGISVGYKNSSGTIKVECSKCHAVMVRK
FT                   VMGRRHDRIDIYAPKGEVNETGRLASL"
FT   CDS             1601340..1601459
FT                   /transl_table=11
FT                   /locus_tag="CL3_18240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36304"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRB8"
FT                   /protein_id="CBL36304.1"
FT                   /translation="MRGRWQNWIPILESGSVGGLLLLSGRAFKNIESLICIKG"
FT   gap             1601644..1601859
FT                   /estimated_length=216
FT   CDS             1602320..1602403
FT                   /transl_table=11
FT                   /locus_tag="CL3_18260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36305"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRB9"
FT                   /protein_id="CBL36305.1"
FT                   /translation="MEQPSKLPPDDFPLLRGVEDKCEKITA"
FT   CDS             1602486..1602863
FT                   /transl_table=11
FT                   /locus_tag="CL3_18270"
FT                   /product="Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36306"
FT                   /db_xref="GOA:D4MRC0"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRC0"
FT                   /protein_id="CBL36306.1"
FT                   /translation="MDRDFKQYHRGEIYFANLNPAYGCEHGGIRPVLILQNDVGNFYSP
FT                   TLIVTPATKQADKKPYLPTHVVLSKIPGMKYDGDSLFMLEQLRVIDKHRIRSYAGRLTK
FT                   AQMEVIDKAVCASLGLSQDSV"
FT   CDS             1602860..1603060
FT                   /transl_table=11
FT                   /locus_tag="CL3_18280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36307"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRC1"
FT                   /protein_id="CBL36307.1"
FT                   /translation="MTRLTRQGNDRNSLICLCPTCRENFEITGSYRIRRANYRQTVKEI
FT                   CTYCQIRMGYDYYVTPVSERG"
FT   CDS             1603065..1604075
FT                   /transl_table=11
FT                   /locus_tag="CL3_18290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36308"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRC2"
FT                   /protein_id="CBL36308.1"
FT                   /translation="MDELLRIDPEFESKIPPLTEEEYQLLEENILQDGVVLNPLIVWNG
FT                   CIVDGHNRFRIIQAHPEIKYTVFEKEFPDRYAAIAWICCNQLGRRNLTPQRKKYLIGQR
FT                   YEAEKLANCFRGNQYALADKSASGQNDPKQKSERTSECIAREINTSESYVRRAERYAKG
FT                   VDAAEEIEPGIKQELLSGSIRPTDTAVAAIAKANLDDRPALVEQLRQSKQLPDKAPSPV
FT                   QKQIPTEIEPSSITDDEAQPESEPKESELPTRPMTEIQKILAISSGMETAEELADESTM
FT                   FYELEDAISTMIRRCLRCFESYPGLLSKKSYRRKVLKIFKKAIQFIHKIEQEEPT"
FT   gap             1604435..1605250
FT                   /estimated_length=816
FT   CDS             1605489..1605743
FT                   /transl_table=11
FT                   /locus_tag="CL3_18310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36309"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRC3"
FT                   /protein_id="CBL36309.1"
FT                   /translation="MLGQIENTITEPIGKRTYSVAEVQAILGISRRKAYELCNSGKFKI
FT                   IRIGRALRVSKYSFDYWLDHFEDNGDNGGIENGINRQKR"
FT   gap             1606715..1608351
FT                   /estimated_length=1637
FT   CDS             complement(1608380..1608880)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36310"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRC4"
FT                   /protein_id="CBL36310.1"
FT                   /translation="MENSLLNNLAFDPAFLIIGLAVLTLVCMIITLVCSTQYRKLYRRY
FT                   DIFMRGKDAETLEDTILDLLDETAVLQTSDRESRDQLKSLTRQVRASYQKIGIVKYNAF
FT                   KGMGGNLSFVIALLDDNNSGFILNSVHSREGCYLYMKDVEKGSTDVLLGAEEKEALEMA
FT                   LGY"
FT   gap             1609554..1610276
FT                   /estimated_length=723
FT   CDS             complement(1610281..1611048)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18350"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36311"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRC5"
FT                   /protein_id="CBL36311.1"
FT                   /translation="MGRVIAIANQKGGVGKTTTAINLSACLAEAGQKVLAIDFDPQGNA
FT                   TTGLGLEKEYMEETVYEMMLGECSLDDCLHEQVQENLDVLPSDSNLAGAEIELLDMEQK
FT                   EFILRDHLEEVRDNYDFIIIDCPPSLSLLTINALTAADTVLVPIQCEYYALEGLSQVLR
FT                   TIGLVKKTMNPGLELEGVVFTMYDARTNLSLEVVENVKSNLNETIYKTIIPRNVRLAEA
FT                   PSHGMPINLYDSKSTGAESYRLLAAEVISRGEE"
FT   gap             1611850..1612084
FT                   /estimated_length=235
FT   CDS             complement(1612658..1614583)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18380"
FT                   /product="glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36312"
FT                   /db_xref="GOA:D4MRC6"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRC6"
FT                   /protein_id="CBL36312.1"
FT                   /translation="MPYLEETYDIAVVGAGHAGCEAALAAARLGMETVVFTVSVDSIAL
FT                   MPCNPNIGGSSKGHLVRELDALGGEMGKNIDKTFIQSKMLNQSKGPAVHSLRAQADKEM
FT                   YTREMRRVLENTEHLTIKQAEVTEILAEEGRVTGIRTLSGAVYHCRAVVLATGTYLRAR
FT                   CIYGDVSNPTGPNGLQAANHLTDSLKALGIEMYRFKTGTPARVDRRSIDFSKMEEQFGD
FT                   DRVVPFSFTTDPESVQKEQVSCWLTYTNERTHEIIRENLDRSPLFSGAIEGTGPRYCPS
FT                   IEDKVVKFPDKERHQVFVEPEGLYTNEMYLGGMSSSLPEDVQTAMYRTVPGLEHVKIVR
FT                   NAYAIEYDCINSRQLRATLEFKAIEGLFSGGQFNGSSGYEEAAVQGFMAGVNAARKLQG
FT                   KEGIVLDRSQAYIGVLIDDLVTKESHEPYRMMTSRAEYRLLLRQDNADLRLSGIGHEIG
FT                   LIDDERYERVLRKEQQIREEVERLNRTPVGATHEVQECLKSYGSTELKTGSTLAELVRR
FT                   PELSYEAVKEIDPKRPVLDWDVAEQVNINIKYEGYIKRQLQQVAQFKKMESRKLDESFD
FT                   YSTVKSLRKEAVQKLNLYKPRNIGQASRISGVSPADISVLLVHLEQLKYQRERNEGQRQ
FT                   NTQEES"
FT   CDS             complement(1614571..1614705)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36313"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRC7"
FT                   /protein_id="CBL36313.1"
FT                   /translation="MTITGCARDIMERAQKSSRKAAKDRKNKRFNCARLEERKLKCHI"
FT   gap             1615045..1615470
FT                   /estimated_length=426
FT   CDS             1616086..1616238
FT                   /transl_table=11
FT                   /locus_tag="CL3_18420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36314"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRC8"
FT                   /protein_id="CBL36314.1"
FT                   /translation="MLSLLFYHFICIWQPSSELTARLSAVNAETDKADFNFMASFSFYF
FT                   ILISV"
FT   CDS             complement(1616412..1616489)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36315"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRC9"
FT                   /protein_id="CBL36315.1"
FT                   /translation="MSSQPQQSEKLIKNERRNNRIKTYN"
FT   CDS             complement(1616756..1618132)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18440"
FT                   /product="tRNA modification GTPase trmE"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36316"
FT                   /db_xref="GOA:D4MRD0"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRD0"
FT                   /protein_id="CBL36316.1"
FT                   /translation="MFRNDTIAAISTGMTNSGIGVVRISGEDAVKVADRIFRKPNGRKL
FT                   SEEKTFTIHYGHIYDENELIDEVLVMLMRGPRSYTAEDTVEIDCHGGVLVMRKILETVV
FT                   KNGARLAEPGEFTKRAFLNGRIDLSQAEAVIDVINAKNDYALKSSVNQLNGAMSRKVKE
FT                   LREKLIYEIAFIESALDDPEHISLEGYPEILHERLIPIKQEIEKLLATADNGRVVREGV
FT                   KTVILGKPNAGKSSLMNVLVGEERAIVTDVAGTTRDTLEENIRLHGISLNIIDTAGIRD
FT                   TDDIVEKIGVDKARQIADDADLIIYVVDGSRPLDENDREIMELIRGRKAIVLLNKTDLE
FT                   MLVTEKELEERTGQTVIPVSAKEQKGIDVLEERIRELFFSGKIDFNDEVMITNVRHKTA
FT                   LREAYDSLLLVEKSIEDQMPEDFFSIDLMNAYEELGTIVGEALEDDLVNEIFSKFCMGK
FT                   "
FT   gap             1618259..1619978
FT                   /estimated_length=1720
FT   CDS             complement(1620437..1620796)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18460"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36317"
FT                   /db_xref="GOA:D4MRD1"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRD1"
FT                   /protein_id="CBL36317.1"
FT                   /translation="MKHFNSIKKYADFQKVYRTGKSYANRLLIMYVMKTEEGADTRIGI
FT                   SVSKKVGNSVVRHHITRLLRESYRLNKPMVKAGLDIVVVARAAAKESNFRQIESAYLHL
FT                   SGLHNILENRSENIG"
FT   CDS             complement(1620871..1621005)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18470"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36318"
FT                   /db_xref="GOA:D4MRD2"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRD2"
FT                   /protein_id="CBL36318.1"
FT                   /translation="MKMTFQPKKRQRAKVHGFRARMSSAGGRKVLAARRAKGRAKLTA"
FT   CDS             complement(1621111..1621716)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36319"
FT                   /db_xref="InterPro:IPR024211"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRD3"
FT                   /protein_id="CBL36319.1"
FT                   /translation="MGDRSNGIRLYISQAEAVMREIDSRGTCFSRREYVALKYGESREI
FT                   FLTAYDWFVKELQKRVKRPAGAQYPYWGYREEYGIDWSGENVGFQAEVPADQLVLFDAD
FT                   DWRKILCMQYIGEDEGEERAFRDELSQMGIREEQAVLTGFYPDIKRRIMESWDRLFVND
FT                   QRFKNGEESSRGGIQAGMWEIKREWIVKIGEKKEKMLD"
FT   CDS             complement(1621692..1622243)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36320"
FT                   /db_xref="InterPro:IPR024211"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRD4"
FT                   /protein_id="CBL36320.1"
FT                   /translation="MVRVWTRQKKSVLEELRKTGRYTAKRKYIEMDLTEHAALVLEAYD
FT                   WLVANGPDAAGRPKDVEYPVWVVFSRGTAMIPGEGEVVLELSLEPEQITHINIEKWGTI
FT                   LNYSYIPENEQDARRHQEILDNLGVGDAQAYMSRFYPELKREIRESWKRLFDPSIILGN
FT                   DMEYGTIWEIRREWVTGVTE"
FT   gap             1622339..1622377
FT                   /estimated_length=39
FT   CDS             1623186..1624556
FT                   /transl_table=11
FT                   /locus_tag="CL3_18520"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36321"
FT                   /db_xref="GOA:D4MRD5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRD5"
FT                   /protein_id="CBL36321.1"
FT                   /translation="MLEKIKEKWEDILLHIKEEHELTDVSFKTWLLPTEAYSMKGNTLQ
FT                   ILVPDIHFLGYMQKKYGFLLTVAIAEITGIECQVDFITREQIKEEPEEVSENQLLSHST
FT                   DVDQQVIQNANLNPRYTFDTFVVGANNNLAHAASLAVAESPGEIYNPLFIYGGVGLGKT
FT                   HLMHSIGHFILQNNPKAKILYVTSEKFTNELIDAIRNKNNISTTEFREKYRNNDVLLID
FT                   DIQFIIGKESTQEEFFHTFNALYEAKKQIIISSDKPPKEIETLEERLRSRFEWGLTVDI
FT                   QSPDYETRMAILRKKEELEGYNIDNEVIKYIATHVKSNIRELEGALTKIVALSKLNKRE
FT                   ITTELAEEALKDLISPGGAREITPELIIQVVSDHFGITPADISSKKRNKEIVYPRQIAM
FT                   YLCRTMTGTPLQGIGKYLGDRDHTTIIHGAEKITADMEKNESLRNTIEVLKKKLSPQ"
FT   gap             1625428..1625590
FT                   /estimated_length=163
FT   CDS             1626174..1626479
FT                   /transl_table=11
FT                   /locus_tag="CL3_18550"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36322"
FT                   /db_xref="GOA:D4MRD6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRD6"
FT                   /protein_id="CBL36322.1"
FT                   /translation="MQSAADAHREKAKRINIHLYIKLENYEKEQQSMEVIKLREEYIKL
FT                   GQALKAAGLAESGVDAKFAIQDGLVKVNGAVELQRGKKLYDGDLVEFQGNTIKIEK"
FT   CDS             1626521..1627627
FT                   /transl_table=11
FT                   /locus_tag="CL3_18560"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36323"
FT                   /db_xref="GOA:D4MRD7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRD7"
FT                   /protein_id="CBL36323.1"
FT                   /translation="MDFQGNNMFVESIELKNYRNYGSLSMVFDPGTNVLYGDNAQGKTN
FT                   VLEAVYVCATTKSHRGSKDKEIIRFAEDESHIKMNIRKDNVPYRIDMHLKKNKTKGIAI
FT                   NGVPIRRASELFGIVNVVFFSPEDLNIIKNGPAERRRFVDLELCQLNRLYVHALVQYNR
FT                   TLTQRNKLLKELPFKPELLETLDIWDMQLVSFGRELIRYRREFAGELNEMIRDIHRQLS
FT                   GGREELVICYEPNTEEEAFETALKRGREADIRQKTTLSGPHRDDLSFSVNGVDIRRFGS
FT                   QGQQRTAALSLKLAEIELVKKIVKDYPVLLLDDVLSELDSGRQQHLLSGIRHIQTIITC
FT                   TGLDDFVAHAFHIDRVFRIVNGTVKEEE"
FT   CDS             1627641..1629551
FT                   /transl_table=11
FT                   /locus_tag="CL3_18570"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36324"
FT                   /db_xref="GOA:D4MRD8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRD8"
FT                   /protein_id="CBL36324.1"
FT                   /translation="MGSEYSADQIQILEGLEAVRKRPGMYIGSTSIRGLHHLVYEIVDN
FT                   SVDEALAGFCSEIDVQINADNSITVTDNGRGIPVDIQKKAGIPAVEVVFTVLHAGGKFG
FT                   GGGYKVSGGLHGVGASVVNALSEWLEVDIYKDGHIYNQRYERGKVMYPLTIKGDCPADK
FT                   HGTRVTFLPDKEIFEETVYDYDTLKVRLRETAFLTKNLKIILRDDREEKQEKTFHYEGG
FT                   IKEFVTYLNRGGESLYAPVIYCEGVRDNVYVEVAMQHNDSYTENIYTFVNNINTPEGGT
FT                   HLSGFKTALTNTFNDYARKNKLLKENEPSLSGEDIREGLTAIISVKLEEPQFEGQTKQK
FT                   LGNTEARAAVAGIVSEQLTYFLEQNPGVAKIISEKSILAQRARAAARRAREMTRRKSAL
FT                   DGLALPGKLADCSDKNPENCEIYLVEGDSAGGSAKEARSKANQAILPLRGKILNVEKAR
FT                   LDKIYANAEIRSMITAFGTGIHEDFDISKLRYHKIIIMTDADVDGAHISTLLLTFIYRF
FT                   MPELIKQGYVYLAQPPLYKIEKNKRIWYAYSDAELNSILSEIGRDQNNKIQRYKGLGEM
FT                   DAEQLWETTMDPERRILLRVTMDEETTSEVDLTFTTLMGDQVEPRREFIEANAKYGTLD
FT                   I"
FT   gap             1630973..1632068
FT                   /estimated_length=1096
FT   CDS             1632719..1633015
FT                   /transl_table=11
FT                   /locus_tag="CL3_18600"
FT                   /product="Tartrate dehydratase beta subunit/Fumarate
FT                   hydratase class I, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36325"
FT                   /db_xref="GOA:D4MRD9"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRD9"
FT                   /protein_id="CBL36325.1"
FT                   /translation="MERYISAPISREDARSLKAGDYVYITGTIYTARDAAHKRMQEALE
FT                   QGKELPIELDRTSSTIWDLRRRGREDPSAQQALPQPAGWTGTRPSFWIWDWER"
FT   CDS             1633012..1633284
FT                   /transl_table=11
FT                   /locus_tag="CL3_18610"
FT                   /product="Tartrate dehydratase beta subunit/Fumarate
FT                   hydratase class I, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36326"
FT                   /db_xref="GOA:D4MRE0"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRE0"
FT                   /protein_id="CBL36326.1"
FT                   /translation="MIGKGKRSREVIEAIVKNGSVYFAAVGGAGALLSKCITSSEVVAY
FT                   GDLGTEAIRKLTVERFPVIVVIDSEGNNLYETAVKEFGESSRQEK"
FT   tRNA            1633563..1633650
FT                   /locus_tag="CL3_T_35380"
FT   CDS             complement(1633653..1634360)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18620"
FT                   /product="Glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36327"
FT                   /db_xref="GOA:D4MRE1"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRE1"
FT                   /protein_id="CBL36327.1"
FT                   /translation="MTEEKVRLESPQKEGGGRNGGVSDGEMPRILNEALLAGMREVPKG
FT                   ETASYIPELSRADKTDLGICIYTRDGKVYEAGDAEKRFSIQSISKVISLCVALQHCGFE
FT                   KVFEKIRMEPSGDAFNSLLKLDMTSNYPYNPMINSGAIAVASYLMPVFSFKELLDYAGK
FT                   LCLDPKIRLDERVYSSEMGHSARNRAIAYLLQSKGIIECDVERSLELYIKMCSLGVTAK
FT                   SLAGRFVFHPFSG"
FT   CDS             complement(1634357..1634398)
FT                   /transl_table=11
FT                   /locus_tag="CL3_18630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36328"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRE2"
FT                   /protein_id="CBL36328.1"
FT                   /translation="MGEDIQAGRGNEK"
FT   CDS             1634634..1635614
FT                   /transl_table=11
FT                   /locus_tag="CL3_18640"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36329"
FT                   /db_xref="GOA:D4MRE3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRE3"
FT                   /protein_id="CBL36329.1"
FT                   /translation="MNFDLNLKHLSYFIAVARLGSINKAAQTLYISQPYLGKIIKELEN
FT                   TAGTVLFERTRSGVILTPDGRDFLEHADTILREAKKLQRFSGSSDAPSHFLSVSMTRFS
FT                   HIMESFIEIVLRHKDEPSFLHRLREGTAQEVVEDVYSGQFSVGVIHLDPKNRGQVSSHI
FT                   SSLGLSYSFLAHVRPHIILSANHPLIREGRPVTLRNLAPYGFARYQDAAEDYAYRIFSQ
FT                   NAQYNLNSGPKIVYLDGRASLMHLLSNSDFYSIGIHDFSAQSSTYQVISIPIEECTDCL
FT                   EFGCILPRGGAVSGIAAEFLEELKSRLSEGITALWQTEGRAEHNR"
FT   CDS             1636017..1636766
FT                   /transl_table=11
FT                   /locus_tag="CL3_18660"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36330"
FT                   /db_xref="GOA:D4MRE4"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRE4"
FT                   /protein_id="CBL36330.1"
FT                   /translation="MTKTRKTQILLAALPAAALGVSFPASAMHIMEGALPAGFCVAWGL
FT                   ICLPFLLAGFFSIQKTIRENRRAITLLAMSGAFIFVISSLKIPSVSGSCSHMTGTGLGA
FT                   VLFGPSAMSVLGILVLIFQAILLAHGGLTTLGANTFSMAIAGPFVSWLLYRILSGFRIN
FT                   RKVSLFAAAFLGDLFTYCVTAFQLALAHNSATSFSIAFRENLVIFAGTQIPLAVVEGLL
FT                   TVAIVIGLESYAQPELAAVGFLKEGTE"
FT   gap             1638632..1639293
FT                   /estimated_length=662
FT   CDS             1639617..1640366
FT                   /transl_table=11
FT                   /locus_tag="CL3_18690"
FT                   /product="Zn-dependent carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36331"
FT                   /db_xref="GOA:D4MRE5"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRE5"
FT                   /protein_id="CBL36331.1"
FT                   /translation="MNEPINKSMSQSFAKLEEQLEKAMAVQTAMILFEWDNETLAPREA
FT                   AERTARVIGSLSGQYLDIITGETVKKLLKQCRKEEELLTQTQRAVVREVEEELEKLQGI
FT                   PADEYRKFAELTARATGIWADARKKKRFDLFAPVLKEIVDYQKRFASYRAKKGQKLYDV
FT                   MLNNYEKDFGMKELDEFFAVVKAGVVPLLKESAKRSETIDDSFLTGPYTEEQQERAARF
FT                   LAEYVGFDFGRGVMAVSAHPFTTSPQS"
FT   gap             1641262..1641844
FT                   /estimated_length=583
FT   gap             1643444..1643856
FT                   /estimated_length=413
FT   gap             1645254..1645969
FT                   /estimated_length=716
FT   CDS             1646208..1646720
FT                   /transl_table=11
FT                   /locus_tag="CL3_18750"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36332"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRE6"
FT                   /protein_id="CBL36332.1"
FT                   /translation="MKKEEKMDYILVSACLLGENCKYSGGSNRNETILKWRERLLREER
FT                   AVFVPVCPEVMGGLPTPRTPAEICGSQVLTKDGRDVTEEYVRGAGEALRLFEKYGCCLA
FT                   IFKERSPSCGSGEIYDGSFSGSVTAADGIAAGLLKKRGARVYGESQAEEILELLFGKTE
FT                   EGRKSRV"
FT   CDS             1647201..1647296
FT                   /transl_table=11
FT                   /locus_tag="CL3_18770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36333"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRE7"
FT                   /protein_id="CBL36333.1"
FT                   /translation="MILFAAVKKKNSGYSWKMTNFRKNKYKKFIK"
FT   CDS             1647470..1647709
FT                   /transl_table=11
FT                   /locus_tag="CL3_18780"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36334"
FT                   /db_xref="GOA:D4MRE8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRE8"
FT                   /protein_id="CBL36334.1"
FT                   /translation="MQICEATVKRIEELRKRDRLTLYALAYKTGMPPSTLKCIINGRSK
FT                   NPGIVNIKKIAEGFNMTIREFYDSDLFDDLEQED"
FT   CDS             1649349..1651268
FT                   /transl_table=11
FT                   /locus_tag="CL3_18800"
FT                   /product="small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36335"
FT                   /db_xref="GOA:D4MRE9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MRE9"
FT                   /protein_id="CBL36335.1"
FT                   /translation="MKIINIGILAHVDAGKTTLTESLLYASGAISEPGSVEKGTTRTDT
FT                   MFLERQRGITIQAAVTSFQWHRCKVNIVDTPGHMDFLAEVYRSLAVLDGAILVISAKDG
FT                   VQAQTRILFHALRKMNIPTVIFINKIDQAGVDLQSVVQSVRDKLSADIIIKQTVSLSPE
FT                   IVLEENTDIEAWDAVIENNDELLEKYIAGEPISREKLAREEQQRVQDASLFPVYHGSAK
FT                   NGLGIQPLMDAVTGLFQPIGEQGSAALCGSVFKVEYTDCGQRRVYLRLYSGTLRLRDTV
FT                   ALAGREKLKITEMRIPSKGEIVRTDTAYPGEIVILPSDSVRLNDVLGDPTRLPRKRWRE
FT                   DPLPMLRTSIAPKTAAQRERLLDALTQLADTDPLLRCEVDSITHEIILSFLGRVQLEVV
FT                   SALLSEKYKLETVVKEPTVIYMERPLKAASHTIHIEVPPNPFWASIGLSVTPLPLGSGV
FT                   QYESRVSLGYLNQSFQNAVRDGIRYGLEQGLFGWNVTDCKICFEYGLYYSPVSTPADFR
FT                   SLAPIVLEQALKESGTQLLEPYLSFILYAPQEYLSRAYHDAPKYCATIETAQVKKDEVV
FT                   FTGEIPARCIQAYRTDLAFYTNGRSVCLTELKGYQAAVGQPVIQPRRPNSRLDKVRHMF
FT                   QEVM"
FT   CDS             1651319..1652086
FT                   /transl_table=11
FT                   /locus_tag="CL3_18810"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CL3_18810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL36336"
FT                   /db_xref="GOA:D4MRF0