
EBI Dbfetch

ID   FP929059; SV 1; linear; genomic DNA; STD; PRO; 2836123 BP.
AC   FP929059;
PR   Project:PRJNA45919;
DT   25-MAR-2010 (Rel. 104, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 2)
DE   Eubacterium siraeum V10Sc8a draft genome.
KW   .
OS   [Eubacterium] siraeum V10Sc8a
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Ruminococcaceae;
OC   Ruminiclostridium.
RN   [1]
RG   metaHIT consortium --
RA   Pajon A., Turner K., Parkhill J., Duncan S., Flint H.;
RT   "The genome sequence of Eubacterium siraeum V10Sc8a";
RL   Unpublished.
RN   [2]
RA   Pajon A.;
RT   ;
RL   Submitted (24-MAR-2010) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
DR   MD5; 2ff32cdc7ff3c8c8433b71cf33ae4bdb.
DR   BioSample; SAMEA3138373.
DR   EnsemblGenomes-Gn; ES1_R_27020.
DR   EnsemblGenomes-Gn; ES1_R_27030.
DR   EnsemblGenomes-Gn; ES1_R_27040.
DR   EnsemblGenomes-Gn; ES1_T_26650.
DR   EnsemblGenomes-Gn; ES1_T_26660.
DR   EnsemblGenomes-Gn; ES1_T_26670.
DR   EnsemblGenomes-Gn; ES1_T_26680.
DR   EnsemblGenomes-Gn; ES1_T_26690.
DR   EnsemblGenomes-Gn; ES1_T_26700.
DR   EnsemblGenomes-Gn; ES1_T_26710.
DR   EnsemblGenomes-Gn; ES1_T_26720.
DR   EnsemblGenomes-Gn; ES1_T_26730.
DR   EnsemblGenomes-Gn; ES1_T_26740.
DR   EnsemblGenomes-Gn; ES1_T_26750.
DR   EnsemblGenomes-Gn; ES1_T_26760.
DR   EnsemblGenomes-Gn; ES1_T_26770.
DR   EnsemblGenomes-Gn; ES1_T_26780.
DR   EnsemblGenomes-Gn; ES1_T_26790.
DR   EnsemblGenomes-Gn; ES1_T_26800.
DR   EnsemblGenomes-Gn; ES1_T_26810.
DR   EnsemblGenomes-Gn; ES1_T_26820.
DR   EnsemblGenomes-Gn; ES1_T_26830.
DR   EnsemblGenomes-Gn; ES1_T_26840.
DR   EnsemblGenomes-Gn; ES1_T_26850.
DR   EnsemblGenomes-Gn; ES1_T_26860.
DR   EnsemblGenomes-Gn; ES1_T_26870.
DR   EnsemblGenomes-Gn; ES1_T_26880.
DR   EnsemblGenomes-Gn; ES1_T_26890.
DR   EnsemblGenomes-Gn; ES1_T_26900.
DR   EnsemblGenomes-Gn; ES1_T_26910.
DR   EnsemblGenomes-Gn; ES1_T_26920.
DR   EnsemblGenomes-Gn; ES1_T_26930.
DR   EnsemblGenomes-Gn; ES1_T_26940.
DR   EnsemblGenomes-Gn; ES1_T_26950.
DR   EnsemblGenomes-Gn; ES1_T_26960.
DR   EnsemblGenomes-Gn; ES1_T_26970.
DR   EnsemblGenomes-Gn; ES1_T_26980.
DR   EnsemblGenomes-Gn; ES1_T_26990.
DR   EnsemblGenomes-Gn; ES1_T_27000.
DR   EnsemblGenomes-Gn; ES1_T_27010.
DR   EnsemblGenomes-Tr; ES1_R_27020.
DR   EnsemblGenomes-Tr; ES1_R_27030.
DR   EnsemblGenomes-Tr; ES1_R_27040.
DR   EnsemblGenomes-Tr; ES1_T_26650.
DR   EnsemblGenomes-Tr; ES1_T_26660.
DR   EnsemblGenomes-Tr; ES1_T_26670.
DR   EnsemblGenomes-Tr; ES1_T_26680.
DR   EnsemblGenomes-Tr; ES1_T_26690.
DR   EnsemblGenomes-Tr; ES1_T_26700.
DR   EnsemblGenomes-Tr; ES1_T_26710.
DR   EnsemblGenomes-Tr; ES1_T_26720.
DR   EnsemblGenomes-Tr; ES1_T_26730.
DR   EnsemblGenomes-Tr; ES1_T_26740.
DR   EnsemblGenomes-Tr; ES1_T_26750.
DR   EnsemblGenomes-Tr; ES1_T_26760.
DR   EnsemblGenomes-Tr; ES1_T_26770.
DR   EnsemblGenomes-Tr; ES1_T_26780.
DR   EnsemblGenomes-Tr; ES1_T_26790.
DR   EnsemblGenomes-Tr; ES1_T_26800.
DR   EnsemblGenomes-Tr; ES1_T_26810.
DR   EnsemblGenomes-Tr; ES1_T_26820.
DR   EnsemblGenomes-Tr; ES1_T_26830.
DR   EnsemblGenomes-Tr; ES1_T_26840.
DR   EnsemblGenomes-Tr; ES1_T_26850.
DR   EnsemblGenomes-Tr; ES1_T_26860.
DR   EnsemblGenomes-Tr; ES1_T_26870.
DR   EnsemblGenomes-Tr; ES1_T_26880.
DR   EnsemblGenomes-Tr; ES1_T_26890.
DR   EnsemblGenomes-Tr; ES1_T_26900.
DR   EnsemblGenomes-Tr; ES1_T_26910.
DR   EnsemblGenomes-Tr; ES1_T_26920.
DR   EnsemblGenomes-Tr; ES1_T_26930.
DR   EnsemblGenomes-Tr; ES1_T_26940.
DR   EnsemblGenomes-Tr; ES1_T_26950.
DR   EnsemblGenomes-Tr; ES1_T_26960.
DR   EnsemblGenomes-Tr; ES1_T_26970.
DR   EnsemblGenomes-Tr; ES1_T_26980.
DR   EnsemblGenomes-Tr; ES1_T_26990.
DR   EnsemblGenomes-Tr; ES1_T_27000.
DR   EnsemblGenomes-Tr; ES1_T_27010.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; FP929059.
DR   SILVA-SSU; FP929059.
CC   This is a reference genome for the metaHIT project
CC   DNA source: Rowett Institute of Nutrition and Health, University of
CC   Aberdeen --
CC   Sequencing technology: 454
CC   Genome coverage: 26x
CC   Annotation was added using ab initio prediction IMG/ER --
CC (Markowitz, Szeto et al. 2007).
FH   Key             Location/Qualifiers
FT   source          1..2836123
FT                   /organism="[Eubacterium] siraeum V10Sc8a"
FT                   /strain="V10Sc8a"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:717961"
FT   CDS             complement(286..858)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33239"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHK6"
FT                   /protein_id="CBL33239.1"
FT   CDS             complement(1536..3251)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00130"
FT                   /product="NhaP-type Na+/H+ and K+/H+ antiporters with a
FT                   unique C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33240"
FT                   /db_xref="GOA:D4MHK7"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHK7"
FT                   /protein_id="CBL33240.1"
FT   CDS             complement(3391..3978)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00140"
FT                   /product="Cytidylate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33241"
FT                   /db_xref="GOA:D4MHK8"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHK8"
FT                   /protein_id="CBL33241.1"
FT   CDS             5569..6219
FT                   /transl_table=11
FT                   /locus_tag="ES1_00160"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33242"
FT                   /db_xref="GOA:D4MHK9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHK9"
FT                   /protein_id="CBL33242.1"
FT   CDS             6231..6518
FT                   /transl_table=11
FT                   /locus_tag="ES1_00170"
FT                   /product="Acylphosphatases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33243"
FT                   /db_xref="GOA:D4MHL0"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHL0"
FT                   /protein_id="CBL33243.1"
FT   CDS             complement(6587..8752)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00180"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33244"
FT                   /db_xref="GOA:D4MHL1"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHL1"
FT                   /protein_id="CBL33244.1"
FT   CDS             complement(9439..9615)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33245"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHL2"
FT                   /protein_id="CBL33245.1"
FT                   ERSYGKNVVLSEG"
FT   CDS             complement(10359..11807)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33246"
FT                   /db_xref="GOA:D4MHL3"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHL3"
FT                   /protein_id="CBL33246.1"
FT   CDS             12019..13131
FT                   /transl_table=11
FT                   /locus_tag="ES1_00210"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33247"
FT                   /db_xref="GOA:D4MHL4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR020853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHL4"
FT                   /protein_id="CBL33247.1"
FT   CDS             13131..14612
FT                   /transl_table=11
FT                   /locus_tag="ES1_00220"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33248"
FT                   /db_xref="GOA:D4MHL5"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHL5"
FT                   /protein_id="CBL33248.1"
FT   CDS             14733..15440
FT                   /transl_table=11
FT                   /locus_tag="ES1_00230"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33249"
FT                   /db_xref="GOA:D4MHL6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHL6"
FT                   /protein_id="CBL33249.1"
FT                   IKTVWGVGYTIEK"
FT   CDS             16698..17417
FT                   /transl_table=11
FT                   /locus_tag="ES1_00250"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33250"
FT                   /db_xref="GOA:D4MHL7"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHL7"
FT                   /protein_id="CBL33250.1"
FT                   EICKRGICLEEYLGETN"
FT   CDS             17514..17822
FT                   /transl_table=11
FT                   /locus_tag="ES1_00260"
FT                   /product="VanW like protein."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33251"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHL8"
FT                   /protein_id="CBL33251.1"
FT   CDS             complement(17894..18178)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00270"
FT                   /product="Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33252"
FT                   /db_xref="GOA:D4MHL9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHL9"
FT                   /protein_id="CBL33252.1"
FT   gap             18193..18766
FT                   /estimated_length=574
FT   CDS             19106..19657
FT                   /transl_table=11
FT                   /locus_tag="ES1_00290"
FT                   /product="Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33253"
FT                   /db_xref="GOA:D4MHM0"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHM0"
FT                   /protein_id="CBL33253.1"
FT   CDS             19762..20055
FT                   /transl_table=11
FT                   /locus_tag="ES1_00300"
FT                   /product="Predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33254"
FT                   /db_xref="GOA:D4MHM1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHM1"
FT                   /protein_id="CBL33254.1"
FT   CDS             20522..21493
FT                   /transl_table=11
FT                   /locus_tag="ES1_00320"
FT                   /product="Predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33255"
FT                   /db_xref="GOA:D4MHM2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHM2"
FT                   /protein_id="CBL33255.1"
FT   CDS             21494..21904
FT                   /transl_table=11
FT                   /locus_tag="ES1_00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33256"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHM3"
FT                   /protein_id="CBL33256.1"
FT   CDS             22011..22631
FT                   /transl_table=11
FT                   /locus_tag="ES1_00340"
FT                   /product="Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33257"
FT                   /db_xref="GOA:D4MHM4"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHM4"
FT                   /protein_id="CBL33257.1"
FT   CDS             complement(22694..23605)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00350"
FT                   /product="rRNA methylases"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33258"
FT                   /db_xref="GOA:D4MHM5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHM5"
FT                   /protein_id="CBL33258.1"
FT   CDS             23655..24023
FT                   /transl_table=11
FT                   /locus_tag="ES1_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33259"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHM6"
FT                   /protein_id="CBL33259.1"
FT                   STEDMLREIQEFDNEYGK"
FT   CDS             24041..24895
FT                   /transl_table=11
FT                   /locus_tag="ES1_00370"
FT                   /product="Predicted esterase of the alpha-beta hydrolase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33260"
FT                   /db_xref="GOA:D4MHM7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHM7"
FT                   /protein_id="CBL33260.1"
FT                   QEI"
FT   CDS             24896..26320
FT                   /transl_table=11
FT                   /locus_tag="ES1_00380"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33261"
FT                   /db_xref="GOA:D4MHM8"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHM8"
FT                   /protein_id="CBL33261.1"
FT                   EKEKAIREAFKYFGMI"
FT   CDS             26375..26593
FT                   /transl_table=11
FT                   /locus_tag="ES1_00390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33262"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHM9"
FT                   /protein_id="CBL33262.1"
FT   CDS             26727..27098
FT                   /transl_table=11
FT                   /locus_tag="ES1_00400"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33263"
FT                   /db_xref="GOA:D4MHN0"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHN0"
FT                   /protein_id="CBL33263.1"
FT   CDS             27095..29098
FT                   /transl_table=11
FT                   /locus_tag="ES1_00410"
FT                   /product="Antirepressor regulating drug resistance,
FT                   predicted signal transduction N-terminal membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33264"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHN1"
FT                   /protein_id="CBL33264.1"
FT   CDS             complement(29193..30368)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33265"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHN2"
FT                   /protein_id="CBL33265.1"
FT   CDS             complement(30433..31377)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00430"
FT                   /product="Protein of unknown function./Domain of unknown
FT                   function (DUF1835)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33266"
FT                   /db_xref="InterPro:IPR014973"
FT                   /db_xref="InterPro:IPR022123"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHN3"
FT                   /protein_id="CBL33266.1"
FT   CDS             complement(31403..32533)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33267"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHN4"
FT                   /protein_id="CBL33267.1"
FT   CDS             32711..33349
FT                   /transl_table=11
FT                   /locus_tag="ES1_00450"
FT                   /product="DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33268"
FT                   /db_xref="GOA:D4MHN5"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHN5"
FT                   /protein_id="CBL33268.1"
FT   CDS             33324..34697
FT                   /transl_table=11
FT                   /locus_tag="ES1_00460"
FT                   /product="phage/plasmid primase, P4 family, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33269"
FT                   /db_xref="InterPro:IPR004968"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHN6"
FT                   /protein_id="CBL33269.1"
FT   CDS             35099..35314
FT                   /transl_table=11
FT                   /locus_tag="ES1_00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33270"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHN7"
FT                   /protein_id="CBL33270.1"
FT   CDS             35650..36939
FT                   /transl_table=11
FT                   /locus_tag="ES1_00480"
FT                   /product="Plasmid recombination enzyme."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33271"
FT                   /db_xref="GOA:D4MHN8"
FT                   /db_xref="InterPro:IPR001668"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHN8"
FT                   /protein_id="CBL33271.1"
FT   CDS             37188..37460
FT                   /transl_table=11
FT                   /locus_tag="ES1_00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33272"
FT                   /db_xref="GOA:D4MHN9"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHN9"
FT                   /protein_id="CBL33272.1"
FT   CDS             37492..39117
FT                   /transl_table=11
FT                   /locus_tag="ES1_00510"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33273"
FT                   /db_xref="GOA:D4MHP0"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHP0"
FT                   /protein_id="CBL33273.1"
FT   CDS             39399..40820
FT                   /transl_table=11
FT                   /locus_tag="ES1_00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33274"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHP1"
FT                   /protein_id="CBL33274.1"
FT                   IRNAINELFHLNFAL"
FT   CDS             complement(41112..41492)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00530"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33275"
FT                   /db_xref="GOA:D4MHP2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHP2"
FT                   /protein_id="CBL33275.1"
FT   CDS             complement(41503..41649)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33276"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHP3"
FT                   /protein_id="CBL33276.1"
FT                   EMD"
FT   CDS             complement(41793..43298)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00550"
FT                   /product="AAA domain (dynein-related subfamily)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33277"
FT                   /db_xref="GOA:D4MHP4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHP4"
FT                   /protein_id="CBL33277.1"
FT   CDS             complement(43310..44737)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00560"
FT                   /product="Predicted metallopeptidase (DUF2201)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33278"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHP5"
FT                   /protein_id="CBL33278.1"
FT                   PVVPPWAIKLVLPSDEI"
FT   CDS             complement(45688..46878)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33279"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHP6"
FT                   /protein_id="CBL33279.1"
FT   CDS             48324..48419
FT                   /transl_table=11
FT                   /locus_tag="ES1_00610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33280"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHP7"
FT                   /protein_id="CBL33280.1"
FT                   /translation="MTNTNLTSEKLCDILVKVCIYIQMRFSLPMT"
FT   CDS             48678..49007
FT                   /transl_table=11
FT                   /locus_tag="ES1_00620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33281"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHP8"
FT                   /protein_id="CBL33281.1"
FT                   VIEES"
FT   CDS             49024..49251
FT                   /transl_table=11
FT                   /locus_tag="ES1_00630"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33282"
FT                   /db_xref="GOA:D4MHP9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHP9"
FT                   /protein_id="CBL33282.1"
FT   CDS             49272..49901
FT                   /transl_table=11
FT                   /locus_tag="ES1_00640"
FT                   /product="Putative inner membrane protein (DUF1819)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33283"
FT                   /db_xref="InterPro:IPR014948"
FT                   /db_xref="InterPro:IPR023137"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHQ0"
FT                   /protein_id="CBL33283.1"
FT   CDS             49958..50473
FT                   /transl_table=11
FT                   /locus_tag="ES1_00650"
FT                   /product="Domain of unknown function (DUF1788)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33284"
FT                   /db_xref="InterPro:IPR014858"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHQ1"
FT                   /protein_id="CBL33284.1"
FT                   YYRAFNVI"
FT   CDS             complement(50501..50659)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33285"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHQ2"
FT                   /protein_id="CBL33285.1"
FT                   TINILLE"
FT   CDS             50729..54040
FT                   /transl_table=11
FT                   /locus_tag="ES1_00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33286"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHQ3"
FT                   /protein_id="CBL33286.1"
FT   CDS             54051..56684
FT                   /transl_table=11
FT                   /locus_tag="ES1_00680"
FT                   /product="Eco57I restriction endonuclease."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33287"
FT                   /db_xref="GOA:D4MHQ4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHQ4"
FT                   /protein_id="CBL33287.1"
FT                   KRSPLI"
FT   CDS             56749..57885
FT                   /transl_table=11
FT                   /locus_tag="ES1_00690"
FT                   /product="HipA-like C-terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33288"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHQ5"
FT                   /protein_id="CBL33288.1"
FT   CDS             57891..58832
FT                   /transl_table=11
FT                   /locus_tag="ES1_00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33289"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHQ6"
FT                   /protein_id="CBL33289.1"
FT   CDS             58854..61451
FT                   /transl_table=11
FT                   /locus_tag="ES1_00710"
FT                   /product="conserved hypothetical protein TIGR02687"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33290"
FT                   /db_xref="GOA:D4MHQ7"
FT                   /db_xref="InterPro:IPR013973"
FT                   /db_xref="InterPro:IPR014060"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHQ7"
FT                   /protein_id="CBL33290.1"
FT   CDS             61475..63595
FT                   /transl_table=11
FT                   /locus_tag="ES1_00720"
FT                   /product="conserved hypothetical protein/conserved
FT                   hypothetical protein TIGR02688"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33291"
FT                   /db_xref="GOA:D4MHQ8"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR013473"
FT                   /db_xref="InterPro:IPR014061"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHQ8"
FT                   /protein_id="CBL33291.1"
FT                   AEDAVFKALGVE"
FT   CDS             63610..63876
FT                   /transl_table=11
FT                   /locus_tag="ES1_00730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33292"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHQ9"
FT                   /protein_id="CBL33292.1"
FT   CDS             63926..65296
FT                   /transl_table=11
FT                   /locus_tag="ES1_00740"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33293"
FT                   /db_xref="GOA:D4MHR0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHR0"
FT                   /protein_id="CBL33293.1"
FT   CDS             65715..66311
FT                   /transl_table=11
FT                   /locus_tag="ES1_00750"
FT                   /product="VanZ like family."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33294"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHR1"
FT                   /protein_id="CBL33294.1"
FT   CDS             66534..67133
FT                   /transl_table=11
FT                   /locus_tag="ES1_00770"
FT                   /product="Calcineurin-like phosphoesterase."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33295"
FT                   /db_xref="GOA:D4MHR2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHR2"
FT                   /protein_id="CBL33295.1"
FT   CDS             67149..67226
FT                   /transl_table=11
FT                   /locus_tag="ES1_00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33296"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHR3"
FT                   /protein_id="CBL33296.1"
FT                   /translation="MVDTENDEYYQVTDSGKQLIEPYEE"
FT   CDS             67274..67477
FT                   /transl_table=11
FT                   /locus_tag="ES1_00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33297"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHR4"
FT                   /protein_id="CBL33297.1"
FT   CDS             complement(67556..69451)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33298"
FT                   /db_xref="InterPro:IPR025584"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHR5"
FT                   /protein_id="CBL33298.1"
FT   CDS             complement(69483..70175)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33299"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHR6"
FT                   /protein_id="CBL33299.1"
FT                   STDGREQL"
FT   CDS             complement(70168..70908)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00820"
FT                   /product="VTC domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33300"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHR7"
FT                   /protein_id="CBL33300.1"
FT   CDS             71201..73669
FT                   /transl_table=11
FT                   /locus_tag="ES1_00830"
FT                   /product="Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33301"
FT                   /db_xref="GOA:D4MHR8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHR8"
FT                   /protein_id="CBL33301.1"
FT                   GLQIKKYLNK"
FT   CDS             73691..74788
FT                   /transl_table=11
FT                   /locus_tag="ES1_00840"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33302"
FT                   /db_xref="InterPro:IPR007163"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHR9"
FT                   /protein_id="CBL33302.1"
FT   CDS             74927..75805
FT                   /transl_table=11
FT                   /locus_tag="ES1_00850"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33303"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHS0"
FT                   /protein_id="CBL33303.1"
FT                   SLKNGRKKLKK"
FT   CDS             complement(75876..76823)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00860"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33304"
FT                   /db_xref="GOA:D4MHS1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHS1"
FT                   /protein_id="CBL33304.1"
FT   CDS             complement(77069..79165)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00870"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33305"
FT                   /db_xref="GOA:D4MHS2"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022147"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHS2"
FT                   /protein_id="CBL33305.1"
FT                   LFNV"
FT   CDS             complement(80344..81669)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00890"
FT                   /product="membrane protein insertase, YidC/Oxa1 family,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33306"
FT                   /db_xref="GOA:D4MHS3"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHS3"
FT                   /protein_id="CBL33306.1"
FT   CDS             complement(81745..81987)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00900"
FT                   /product="conserved hypothetical protein TIGR00278"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33307"
FT                   /db_xref="GOA:D4MHS4"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHS4"
FT                   /protein_id="CBL33307.1"
FT   CDS             complement(81989..82378)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00910"
FT                   /product="ribonuclease P protein component, eubacterial"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33308"
FT                   /db_xref="GOA:D4MHS5"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHS5"
FT                   /protein_id="CBL33308.1"
FT   CDS             complement(82387..82521)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00920"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33309"
FT                   /db_xref="GOA:D4MHS6"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHS6"
FT                   /protein_id="CBL33309.1"
FT   CDS             complement(82701..83777)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00930"
FT                   /product="GDSL-like Lipase/Acylhydrolase."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33310"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHS7"
FT                   /protein_id="CBL33310.1"
FT                   SLVSQKVTAAIKETLGYK"
FT   CDS             complement(83825..84511)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33311"
FT                   /db_xref="InterPro:IPR025377"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHS8"
FT                   /protein_id="CBL33311.1"
FT                   KELSAD"
FT   gap             85244..86263
FT                   /estimated_length=1020
FT   CDS             complement(86308..88293)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00960"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33312"
FT                   /db_xref="GOA:D4MHS9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHS9"
FT                   /protein_id="CBL33312.1"
FT   CDS             88547..89029
FT                   /transl_table=11
FT                   /locus_tag="ES1_00970"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33313"
FT                   /db_xref="GOA:D4MHT0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHT0"
FT                   /protein_id="CBL33313.1"
FT   CDS             89026..90477
FT                   /transl_table=11
FT                   /locus_tag="ES1_00980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33314"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHT1"
FT                   /protein_id="CBL33314.1"
FT   CDS             complement(90529..90699)
FT                   /transl_table=11
FT                   /locus_tag="ES1_00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_00990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33315"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHT2"
FT                   /protein_id="CBL33315.1"
FT                   SNCKKGRKSKK"
FT   CDS             complement(90709..93090)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01000"
FT                   /product="ferrous iron transporter FeoB"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33316"
FT                   /db_xref="GOA:D4MHT3"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011619"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHT3"
FT                   /protein_id="CBL33316.1"
FT   CDS             complement(93663..94460)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01010"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33317"
FT                   /db_xref="GOA:D4MHT4"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHT4"
FT                   /protein_id="CBL33317.1"
FT   CDS             complement(94482..95108)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01020"
FT                   /product="Protein of unknown function (DUF1393)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33318"
FT                   /db_xref="GOA:D4MHT5"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHT5"
FT                   /protein_id="CBL33318.1"
FT   CDS             complement(95350..96321)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01030"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33319"
FT                   /db_xref="GOA:D4MHT6"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHT6"
FT                   /protein_id="CBL33319.1"
FT   CDS             complement(99842..100705)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33320"
FT                   /db_xref="GOA:D4MHT7"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHT7"
FT                   /protein_id="CBL33320.1"
FT                   EDNRGE"
FT   CDS             complement(101711..102169)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33321"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHT8"
FT                   /protein_id="CBL33321.1"
FT   CDS             complement(102193..103062)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01080"
FT                   /product="Predicted P-loop-containing kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33322"
FT                   /db_xref="GOA:D4MHT9"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHT9"
FT                   /protein_id="CBL33322.1"
FT                   RDVNKDKK"
FT   CDS             complement(104179..105132)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01100"
FT                   /product="Transcriptional regulator/sugar kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33323"
FT                   /db_xref="GOA:D4MHU0"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHU0"
FT                   /protein_id="CBL33323.1"
FT   CDS             complement(105191..105934)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01110"
FT                   /product="Histidinol phosphatase and related hydrolases of
FT                   the PHP family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33324"
FT                   /db_xref="GOA:D4MHU1"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHU1"
FT                   /protein_id="CBL33324.1"
FT   CDS             complement(106007..106960)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01120"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.11.-"
FT                   /EC_number="2.7.4.-"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33325"
FT                   /db_xref="GOA:D4MHU2"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHU2"
FT                   /protein_id="CBL33325.1"
FT   CDS             complement(107153..107695)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01130"
FT                   /product="Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33326"
FT                   /db_xref="GOA:D4MHU3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHU3"
FT                   /protein_id="CBL33326.1"
FT                   CRKPQGYFQRKDDSILS"
FT   CDS             107775..107840
FT                   /transl_table=11
FT                   /locus_tag="ES1_01140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33327"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHU4"
FT                   /protein_id="CBL33327.1"
FT                   /translation="MFVNKDGKLCREGISGIVGEV"
FT   CDS             108290..108817
FT                   /transl_table=11
FT                   /locus_tag="ES1_01150"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33328"
FT                   /db_xref="GOA:D4MHU5"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHU5"
FT                   /protein_id="CBL33328.1"
FT                   KILLEHLGVINF"
FT   CDS             complement(108883..109503)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01160"
FT                   /product="Predicted HD-superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33329"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHU6"
FT                   /protein_id="CBL33329.1"
FT   CDS             complement(109572..110495)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01170"
FT                   /product="Integral membrane protein CcmA involved in cell
FT                   shape determination"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33330"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHU7"
FT                   /protein_id="CBL33330.1"
FT   CDS             117463..117684
FT                   /transl_table=11
FT                   /locus_tag="ES1_01210"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33331"
FT                   /db_xref="GOA:D4MHU8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHU8"
FT                   /protein_id="CBL33331.1"
FT   CDS             117753..118670
FT                   /transl_table=11
FT                   /locus_tag="ES1_01220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33332"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHU9"
FT                   /protein_id="CBL33332.1"
FT   CDS             118704..120119
FT                   /transl_table=11
FT                   /locus_tag="ES1_01230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33333"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHV0"
FT                   /protein_id="CBL33333.1"
FT                   LVSRPVPPPIPTI"
FT   CDS             120139..120411
FT                   /transl_table=11
FT                   /locus_tag="ES1_01240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33334"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHV1"
FT                   /protein_id="CBL33334.1"
FT   CDS             complement(120480..120563)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33335"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHV2"
FT                   /protein_id="CBL33335.1"
FT                   /translation="MITEIFTTADKRLYKAKAAGRNKIMID"
FT   gap             121298..121975
FT                   /estimated_length=678
FT   gap             122997..123651
FT                   /estimated_length=655
FT   CDS             complement(124378..124680)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01300"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33336"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHV3"
FT                   /protein_id="CBL33336.1"
FT   gap             124775..125631
FT                   /estimated_length=857
FT   CDS             complement(126677..127717)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01320"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33337"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHV4"
FT                   /protein_id="CBL33337.1"
FT                   NKIMID"
FT   tRNA            129018..129093
FT                   /locus_tag="ES1_T_26650"
FT   CDS             complement(129137..129214)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33338"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHV5"
FT                   /protein_id="CBL33338.1"
FT                   /translation="MNNKKAYCRKKRIRKIMIRIGTQAL"
FT   CDS             complement(129204..130427)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01350"
FT                   /product="stage II sporulation protein P"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33339"
FT                   /db_xref="InterPro:IPR010897"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHV6"
FT                   /protein_id="CBL33339.1"
FT                   NLLKNYEQ"
FT   CDS             complement(130504..131292)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01360"
FT                   /product="Germination protease."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33340"
FT                   /db_xref="GOA:D4MHV7"
FT                   /db_xref="InterPro:IPR005080"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHV7"
FT                   /protein_id="CBL33340.1"
FT   CDS             complement(132690..132935)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01390"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33341"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHV8"
FT                   /protein_id="CBL33341.1"
FT   CDS             133167..135119
FT                   /transl_table=11
FT                   /locus_tag="ES1_01400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33342"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHV9"
FT                   /protein_id="CBL33342.1"
FT                   DDDEMSSDNVGFFDL"
FT   tRNA            135886..135962
FT                   /locus_tag="ES1_T_26660"
FT   tRNA            135970..136044
FT                   /locus_tag="ES1_T_26670"
FT   CDS             complement(136212..136418)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33343"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHW0"
FT                   /protein_id="CBL33343.1"
FT   CDS             complement(136421..136576)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33344"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHW1"
FT                   /protein_id="CBL33344.1"
FT                   LNKKNG"
FT   CDS             136835..137929
FT                   /transl_table=11
FT                   /locus_tag="ES1_01440"
FT                   /product="Glycerol dehydrogenase and related enzymes"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33345"
FT                   /db_xref="GOA:D4MHW2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHW2"
FT                   /protein_id="CBL33345.1"
FT   tRNA            complement(138080..138155)
FT                   /locus_tag="ES1_T_27010"
FT   CDS             complement(138312..139244)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01450"
FT                   /product="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33346"
FT                   /db_xref="GOA:D4MHW3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHW3"
FT                   /protein_id="CBL33346.1"
FT   CDS             complement(139400..141703)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01460"
FT                   /product="Stage II sporulation protein E (SpoIIE)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33347"
FT                   /db_xref="GOA:D4MHW4"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHW4"
FT                   /protein_id="CBL33347.1"
FT                   KSDDISVIAMRLSR"
FT   CDS             141809..141901
FT                   /transl_table=11
FT                   /locus_tag="ES1_01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33348"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHW5"
FT                   /protein_id="CBL33348.1"
FT                   /translation="MRFQAIIFGKIFWKILKEKYGEHFKSDINS"
FT   CDS             142053..142898
FT                   /transl_table=11
FT                   /locus_tag="ES1_01480"
FT                   /product="conserved repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33349"
FT                   /db_xref="GOA:D4MHW6"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHW6"
FT                   /protein_id="CBL33349.1"
FT                   "
FT   CDS             complement(143216..144292)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01490"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33350"
FT                   /db_xref="GOA:D4MHW7"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHW7"
FT                   /protein_id="CBL33350.1"
FT                   QHVVFYDGDIVLGGGVIM"
FT   CDS             complement(144297..145091)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01500"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33351"
FT                   /db_xref="GOA:D4MHW8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHW8"
FT                   /protein_id="CBL33351.1"
FT   gap             149518..150575
FT                   /estimated_length=1058
FT   CDS             150661..150762
FT                   /transl_table=11
FT                   /locus_tag="ES1_01530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33352"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHW9"
FT                   /protein_id="CBL33352.1"
FT   CDS             151559..152581
FT                   /transl_table=11
FT                   /locus_tag="ES1_01550"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33353"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHX0"
FT                   /protein_id="CBL33353.1"
FT                   "
FT   CDS             152593..153393
FT                   /transl_table=11
FT                   /locus_tag="ES1_01560"
FT                   /product="ABC-type polysaccharide/polyol phosphate export
FT                   systems, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33354"
FT                   /db_xref="GOA:D4MHX1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR030194"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHX1"
FT                   /protein_id="CBL33354.1"
FT   CDS             154495..154776
FT                   /transl_table=11
FT                   /locus_tag="ES1_01580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33355"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHX2"
FT                   /protein_id="CBL33355.1"
FT   CDS             155659..156051
FT                   /transl_table=11
FT                   /locus_tag="ES1_01600"
FT                   /product="Glycerol-3-phosphate cytidylyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33356"
FT                   /db_xref="GOA:D4MHX3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006409"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHX3"
FT                   /protein_id="CBL33356.1"
FT   CDS             156097..158523
FT                   /transl_table=11
FT                   /locus_tag="ES1_01610"
FT                   /product="Putative glycosyl/glycerophosphate transferases
FT                   involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33357"
FT                   /db_xref="GOA:D4MHX4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHX4"
FT                   /protein_id="CBL33357.1"
FT   CDS             complement(158585..159208)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01620"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33358"
FT                   /db_xref="GOA:D4MHX5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHX5"
FT                   /protein_id="CBL33358.1"
FT   CDS             159870..161507
FT                   /transl_table=11
FT                   /locus_tag="ES1_01640"
FT                   /product="chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33359"
FT                   /db_xref="GOA:D4MHX6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHX6"
FT                   /protein_id="CBL33359.1"
FT   CDS             complement(161586..162518)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33360"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHX7"
FT                   /protein_id="CBL33360.1"
FT   CDS             complement(162535..164217)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33361"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHX8"
FT                   /protein_id="CBL33361.1"
FT   CDS             164534..166021
FT                   /transl_table=11
FT                   /locus_tag="ES1_01670"
FT                   /product="Beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33362"
FT                   /db_xref="GOA:D4MHX9"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHX9"
FT                   /protein_id="CBL33362.1"
FT   CDS             166038..167339
FT                   /transl_table=11
FT                   /locus_tag="ES1_01680"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33363"
FT                   /db_xref="GOA:D4MHY0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHY0"
FT                   /protein_id="CBL33363.1"
FT   CDS             167341..167751
FT                   /transl_table=11
FT                   /locus_tag="ES1_01690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33364"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHY1"
FT                   /protein_id="CBL33364.1"
FT   CDS             167771..167914
FT                   /transl_table=11
FT                   /locus_tag="ES1_01700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33365"
FT                   /db_xref="GOA:D4MHY2"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHY2"
FT                   /protein_id="CBL33365.1"
FT                   TL"
FT   CDS             168106..169776
FT                   /transl_table=11
FT                   /locus_tag="ES1_01710"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33366"
FT                   /db_xref="GOA:D4MHY3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHY3"
FT                   /protein_id="CBL33366.1"
FT   CDS             169888..169989
FT                   /transl_table=11
FT                   /locus_tag="ES1_01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33367"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHY4"
FT                   /protein_id="CBL33367.1"
FT   CDS             complement(170047..170904)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01730"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33368"
FT                   /db_xref="GOA:D4MHY5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHY5"
FT                   /protein_id="CBL33368.1"
FT                   FTIL"
FT   CDS             complement(170908..171762)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01740"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33369"
FT                   /db_xref="GOA:D4MHY6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHY6"
FT                   /protein_id="CBL33369.1"
FT                   RSF"
FT   CDS             172290..174791
FT                   /transl_table=11
FT                   /locus_tag="ES1_01750"
FT                   /product="cellobiose phosphorylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33370"
FT                   /db_xref="GOA:D4MHY7"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR010403"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHY7"
FT                   /protein_id="CBL33370.1"
FT   CDS             complement(174922..175275)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33371"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHY8"
FT                   /protein_id="CBL33371.1"
FT                   KGYTNEYRRIGRK"
FT   CDS             complement(175415..176482)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33372"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHY9"
FT                   /protein_id="CBL33372.1"
FT                   DEVIKYYNNLKLYLD"
FT   CDS             176800..177126
FT                   /transl_table=11
FT                   /locus_tag="ES1_01790"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33373"
FT                   /db_xref="GOA:D4MHZ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHZ0"
FT                   /protein_id="CBL33373.1"
FT                   IENN"
FT   CDS             177995..180163
FT                   /transl_table=11
FT                   /locus_tag="ES1_01820"
FT                   /product="YhgE/Pip N-terminal domain/YhgE/Pip C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33374"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHZ1"
FT                   /protein_id="CBL33374.1"
FT   CDS             complement(180244..181164)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01830"
FT                   /product="dihydroorotate oxidase B, catalytic subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33375"
FT                   /db_xref="GOA:D4MHZ2"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHZ2"
FT                   /protein_id="CBL33375.1"
FT   CDS             complement(181161..181934)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01840"
FT                   /product="2-polyprenylphenol hydroxylase and related
FT                   flavodoxin oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33376"
FT                   /db_xref="GOA:D4MHZ3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR023455"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHZ3"
FT                   /protein_id="CBL33376.1"
FT   CDS             complement(182650..185856)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01860"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33377"
FT                   /db_xref="GOA:D4MHZ4"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHZ4"
FT                   /protein_id="CBL33377.1"
FT   CDS             complement(185847..186965)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01870"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33378"
FT                   /db_xref="GOA:D4MHZ5"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHZ5"
FT                   /protein_id="CBL33378.1"
FT   CDS             complement(187009..187953)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01880"
FT                   /product="orotidine 5'-phosphate decarboxylase, subfamily
FT                   2"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33379"
FT                   /db_xref="GOA:D4MHZ6"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHZ6"
FT                   /protein_id="CBL33379.1"
FT   gap             190092..190381
FT                   /estimated_length=290
FT   CDS             complement(190524..191153)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01910"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33380"
FT                   /db_xref="GOA:D4MHZ7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHZ7"
FT                   /protein_id="CBL33380.1"
FT   CDS             complement(191146..191385)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33381"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHZ8"
FT                   /protein_id="CBL33381.1"
FT   CDS             complement(191361..191900)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01930"
FT                   /product="Fructose-2,6-bisphosphatase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33382"
FT                   /db_xref="GOA:D4MHZ9"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4MHZ9"
FT                   /protein_id="CBL33382.1"
FT                   EFWNAGLDQCKMMRLL"
FT   CDS             complement(191937..192863)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33383"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI00"
FT                   /protein_id="CBL33383.1"
FT   CDS             complement(193207..194142)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01950"
FT                   /product="Transketolase, C-terminal subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33384"
FT                   /db_xref="GOA:D4MI01"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI01"
FT                   /protein_id="CBL33384.1"
FT   CDS             complement(194164..195006)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01960"
FT                   /product="Transketolase, N-terminal subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33385"
FT                   /db_xref="GOA:D4MI02"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI02"
FT                   /protein_id="CBL33385.1"
FT   CDS             complement(195232..196470)
FT                   /transl_table=11
FT                   /locus_tag="ES1_01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33386"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI03"
FT                   /protein_id="CBL33386.1"
FT                   CKDLTAYIFFPCY"
FT   CDS             196774..197499
FT                   /transl_table=11
FT                   /locus_tag="ES1_01980"
FT                   /product="Uncharacterized membrane protein, possible Na+
FT                   channel or pump"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33387"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI04"
FT                   /protein_id="CBL33387.1"
FT   CDS             197512..197553
FT                   /transl_table=11
FT                   /locus_tag="ES1_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_01990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33388"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI05"
FT                   /protein_id="CBL33388.1"
FT                   /translation="MKNRDLTVGNITG"
FT   CDS             198568..198840
FT                   /transl_table=11
FT                   /locus_tag="ES1_02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33389"
FT                   /db_xref="InterPro:IPR025306"
FT                   /db_xref="InterPro:IPR026363"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI06"
FT                   /protein_id="CBL33389.1"
FT   CDS             198925..199041
FT                   /transl_table=11
FT                   /locus_tag="ES1_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33390"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI07"
FT                   /protein_id="CBL33390.1"
FT   CDS             complement(201619..207384)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02060"
FT                   /product="Protein of unknown function (DUF3320)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33391"
FT                   /db_xref="InterPro:IPR021754"
FT                   /db_xref="InterPro:IPR025103"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI08"
FT                   /protein_id="CBL33391.1"
FT   CDS             complement(207906..208091)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33392"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI09"
FT                   /protein_id="CBL33392.1"
FT                   VNMKEKKNQRDQGNNF"
FT   CDS             complement(208131..214829)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02080"
FT                   /product="Listeria-Bacteroides repeat domain
FT                   (List_Bact_rpt)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33393"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI10"
FT                   /protein_id="CBL33393.1"
FT                   FSGK"
FT   CDS             215140..217899
FT                   /transl_table=11
FT                   /locus_tag="ES1_02090"
FT                   /product="FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33394"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI11"
FT                   /protein_id="CBL33394.1"
FT   gap             218130..218426
FT                   /estimated_length=297
FT   CDS             218787..219236
FT                   /transl_table=11
FT                   /locus_tag="ES1_02100"
FT                   /product="Molecular chaperone (small heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33395"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI12"
FT                   /protein_id="CBL33395.1"
FT   CDS             219316..219762
FT                   /transl_table=11
FT                   /locus_tag="ES1_02110"
FT                   /product="Molecular chaperone (small heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33396"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI13"
FT                   /protein_id="CBL33396.1"
FT   CDS             219986..221182
FT                   /transl_table=11
FT                   /locus_tag="ES1_02120"
FT                   /product="cysteine desulfurase NifS"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33397"
FT                   /db_xref="GOA:D4MI14"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI14"
FT                   /protein_id="CBL33397.1"
FT   CDS             221214..221648
FT                   /transl_table=11
FT                   /locus_tag="ES1_02130"
FT                   /product="FeS cluster assembly scaffold protein NifU,
FT                   Clostridium type"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33398"
FT                   /db_xref="GOA:D4MI15"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR017787"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI15"
FT                   /protein_id="CBL33398.1"
FT   CDS             complement(222264..222782)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02140"
FT                   /product="Sortase and related acyltransferases"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33399"
FT                   /db_xref="GOA:D4MI16"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI16"
FT                   /protein_id="CBL33399.1"
FT                   MVWMEKIIG"
FT   CDS             complement(222867..223307)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33400"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI17"
FT                   /protein_id="CBL33400.1"
FT   CDS             complement(223381..224058)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02160"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33401"
FT                   /db_xref="GOA:D4MI18"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI18"
FT                   /protein_id="CBL33401.1"
FT                   PTK"
FT   CDS             complement(224073..226046)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33402"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI19"
FT                   /protein_id="CBL33402.1"
FT   CDS             complement(226128..226919)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02180"
FT                   /product="Metal-dependent hydrolases of the beta-lactamase
FT                   superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33403"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI20"
FT                   /protein_id="CBL33403.1"
FT   CDS             complement(228466..229431)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33404"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI21"
FT                   /protein_id="CBL33404.1"
FT   CDS             229567..230310
FT                   /transl_table=11
FT                   /locus_tag="ES1_02210"
FT                   /product="ABC-type transport system involved in Fe-S
FT                   cluster assembly, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33405"
FT                   /db_xref="GOA:D4MI22"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI22"
FT                   /protein_id="CBL33405.1"
FT   CDS             230319..231254
FT                   /transl_table=11
FT                   /locus_tag="ES1_02220"
FT                   /product="ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33406"
FT                   /db_xref="GOA:D4MI23"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI23"
FT                   /protein_id="CBL33406.1"
FT   gap             231383..232456
FT                   /estimated_length=1074
FT   CDS             complement(232898..233479)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02240"
FT                   /product="probable proton-coupled thiamine transporter
FT                   YuaJ"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33407"
FT                   /db_xref="GOA:D4MI24"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI24"
FT                   /protein_id="CBL33407.1"
FT   CDS             complement(233697..234248)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02250"
FT                   /product="RNA:NAD 2'-phosphotransferase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33408"
FT                   /db_xref="GOA:D4MI25"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI25"
FT                   /protein_id="CBL33408.1"
FT   CDS             complement(235120..237435)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02270"
FT                   /product="Alpha-glucosidases, family 31 of glycosyl
FT                   hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33409"
FT                   /db_xref="GOA:D4MI26"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI26"
FT                   /protein_id="CBL33409.1"
FT                   DKHFTVESAEGLNVVISK"
FT   CDS             238336..240111
FT                   /transl_table=11
FT                   /locus_tag="ES1_02280"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33410"
FT                   /db_xref="GOA:D4MI27"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI27"
FT                   /protein_id="CBL33410.1"
FT                   IEYWLRRYDVRIDRQ"
FT   CDS             complement(240776..241918)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02300"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33411"
FT                   /db_xref="GOA:D4MI28"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI28"
FT                   /protein_id="CBL33411.1"
FT   gap             242600..242954
FT                   /estimated_length=355
FT   CDS             complement(243295..244680)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02320"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33412"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI29"
FT                   /protein_id="CBL33412.1"
FT                   LDS"
FT   CDS             complement(244719..245411)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02330"
FT                   /product="NfeD-like."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33413"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI30"
FT                   /protein_id="CBL33413.1"
FT                   VVAVEKDK"
FT   CDS             complement(245487..246020)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33414"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI31"
FT                   /protein_id="CBL33414.1"
FT                   KNFLILLTLGYYNK"
FT   CDS             246435..246953
FT                   /transl_table=11
FT                   /locus_tag="ES1_02350"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33415"
FT                   /db_xref="GOA:D4MI32"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI32"
FT                   /protein_id="CBL33415.1"
FT                   KLSEIAGGK"
FT   CDS             246955..247233
FT                   /transl_table=11
FT                   /locus_tag="ES1_02360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33416"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI33"
FT                   /protein_id="CBL33416.1"
FT   tRNA            247301..247389
FT                   /locus_tag="ES1_T_26680"
FT   CDS             complement(249025..250818)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02390"
FT                   /product="Myosin-crossreactive antigen"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33417"
FT                   /db_xref="GOA:D4MI34"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI34"
FT                   /protein_id="CBL33417.1"
FT   CDS             complement(250970..251524)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02400"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33418"
FT                   /db_xref="GOA:D4MI35"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI35"
FT                   /protein_id="CBL33418.1"
FT   CDS             complement(251770..252078)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33419"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI36"
FT                   /protein_id="CBL33419.1"
FT   CDS             complement(252200..253228)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33420"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="InterPro:IPR025386"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI37"
FT                   /protein_id="CBL33420.1"
FT                   NR"
FT   CDS             complement(253228..253830)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02430"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33421"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI38"
FT                   /protein_id="CBL33421.1"
FT   CDS             complement(253847..254158)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02440"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33422"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI39"
FT                   /protein_id="CBL33422.1"
FT   CDS             complement(254527..255690)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02450"
FT                   /product="Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33423"
FT                   /db_xref="GOA:D4MI40"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI40"
FT                   /protein_id="CBL33423.1"
FT   CDS             complement(255723..256802)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02460"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33424"
FT                   /db_xref="GOA:D4MI41"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI41"
FT                   /protein_id="CBL33424.1"
FT   gap             257071..257566
FT                   /estimated_length=496
FT   CDS             complement(259322..260227)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02480"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33425"
FT                   /db_xref="GOA:D4MI42"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI42"
FT                   /protein_id="CBL33425.1"
FT   CDS             complement(260224..260268)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33426"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI43"
FT                   /protein_id="CBL33426.1"
FT                   /translation="MTTDRKAVGKDMYI"
FT   CDS             complement(260453..261568)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33427"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI44"
FT                   /protein_id="CBL33427.1"
FT   CDS             261919..262755
FT                   /transl_table=11
FT                   /locus_tag="ES1_02530"
FT                   /product="sulfide dehydrogenase (flavoprotein) subunit
FT                   SudB"
FT                   /EC_number=""
FT                   /EC_number="1.97.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33428"
FT                   /db_xref="GOA:D4MI45"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI45"
FT                   /protein_id="CBL33428.1"
FT   CDS             262804..264162
FT                   /transl_table=11
FT                   /locus_tag="ES1_02540"
FT                   /product="sulfide dehydrogenase (flavoprotein) subunit
FT                   SudA"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /EC_number="1.97.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33429"
FT                   /db_xref="GOA:D4MI46"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI46"
FT                   /protein_id="CBL33429.1"
FT   gap             264308..264632
FT                   /estimated_length=325
FT   CDS             complement(264843..265328)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02550"
FT                   /product="HD domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33430"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI47"
FT                   /protein_id="CBL33430.1"
FT   CDS             complement(265341..268067)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02560"
FT                   /product="Beta propeller domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33431"
FT                   /db_xref="InterPro:IPR019198"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI48"
FT                   /protein_id="CBL33431.1"
FT   CDS             complement(268084..268578)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02570"
FT                   /product="Sigma-70, region 4./ECF sigma factor."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33432"
FT                   /db_xref="GOA:D4MI49"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI49"
FT                   /protein_id="CBL33432.1"
FT                   I"
FT   CDS             268742..271045
FT                   /transl_table=11
FT                   /locus_tag="ES1_02580"
FT                   /product="Superfamily I DNA and RNA helicases"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33433"
FT                   /db_xref="GOA:D4MI50"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI50"
FT                   /protein_id="CBL33433.1"
FT                   MLKACLDKGIIGLS"
FT   CDS             271093..271236
FT                   /transl_table=11
FT                   /locus_tag="ES1_02590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33434"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI51"
FT                   /protein_id="CBL33434.1"
FT                   IT"
FT   CDS             271416..272951
FT                   /transl_table=11
FT                   /locus_tag="ES1_02600"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33435"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI52"
FT                   /protein_id="CBL33435.1"
FT   CDS             complement(273023..273724)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02610"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33436"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI53"
FT                   /protein_id="CBL33436.1"
FT                   MEEKEEEKDAV"
FT   gap             274138..274668
FT                   /estimated_length=531
FT   CDS             275672..277495
FT                   /transl_table=11
FT                   /locus_tag="ES1_02640"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33437"
FT                   /db_xref="GOA:D4MI54"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI54"
FT                   /protein_id="CBL33437.1"
FT   CDS             277517..278605
FT                   /transl_table=11
FT                   /locus_tag="ES1_02650"
FT                   /product="methyltransferase, FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33438"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI55"
FT                   /protein_id="CBL33438.1"
FT   CDS             278628..279344
FT                   /transl_table=11
FT                   /locus_tag="ES1_02660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33439"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI56"
FT                   /protein_id="CBL33439.1"
FT                   ITFTNNNGVVTAAFAG"
FT   CDS             279518..280831
FT                   /transl_table=11
FT                   /locus_tag="ES1_02670"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33440"
FT                   /db_xref="GOA:D4MI57"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024551"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI57"
FT                   /protein_id="CBL33440.1"
FT   tRNA            280910..280986
FT                   /locus_tag="ES1_T_26690"
FT   CDS             281854..282192
FT                   /transl_table=11
FT                   /locus_tag="ES1_02700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33441"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI58"
FT                   /protein_id="CBL33441.1"
FT                   VMSQGNDD"
FT   CDS             complement(282256..283959)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02710"
FT                   /product="Sulfate permease and related transporters (MFS
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33442"
FT                   /db_xref="GOA:D4MI59"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR030402"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI59"
FT                   /protein_id="CBL33442.1"
FT   CDS             complement(284080..284184)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33443"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI60"
FT                   /protein_id="CBL33443.1"
FT   CDS             284833..285207
FT                   /transl_table=11
FT                   /locus_tag="ES1_02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33444"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI61"
FT                   /protein_id="CBL33444.1"
FT   CDS             complement(285373..286017)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02750"
FT                   /product="Phosphatidylglycerophosphate synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33445"
FT                   /db_xref="GOA:D4MI62"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI62"
FT                   /protein_id="CBL33445.1"
FT   CDS             complement(286221..286544)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33446"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI63"
FT                   /protein_id="CBL33446.1"
FT                   SGQ"
FT   CDS             complement(286568..287017)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02770"
FT                   /product="RNase HI"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33447"
FT                   /db_xref="GOA:D4MI64"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI64"
FT                   /protein_id="CBL33447.1"
FT   CDS             complement(287010..289493)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02780"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33448"
FT                   /db_xref="GOA:D4MI65"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI65"
FT                   /protein_id="CBL33448.1"
FT                   KMSAKRKAGKENKNA"
FT   CDS             complement(289527..290900)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02790"
FT                   /product="Maltose-binding periplasmic proteins/domains"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33449"
FT                   /db_xref="GOA:D4MI66"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI66"
FT                   /protein_id="CBL33449.1"
FT   CDS             complement(292822..293397)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33450"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI67"
FT                   /protein_id="CBL33450.1"
FT   CDS             complement(293414..294172)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02820"
FT                   /product="ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33451"
FT                   /db_xref="GOA:D4MI68"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI68"
FT                   /protein_id="CBL33451.1"
FT   CDS             complement(295665..296495)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02840"
FT                   /product="Glycosyltransferases, probably involved in cell
FT                   wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33452"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI69"
FT                   /protein_id="CBL33452.1"
FT   CDS             complement(297780..298958)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02860"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33453"
FT                   /db_xref="GOA:D4MI70"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI70"
FT                   /protein_id="CBL33453.1"
FT   CDS             complement(299190..299903)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02870"
FT                   /product="Pyruvate-formate lyase-activating enzyme"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33454"
FT                   /db_xref="GOA:D4MI71"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI71"
FT                   /protein_id="CBL33454.1"
FT                   DVIEKLKPGLDKFVF"
FT   CDS             complement(299905..302163)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02880"
FT                   /product="formate acetyltransferase 1"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33455"
FT                   /db_xref="GOA:D4MI72"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI72"
FT                   /protein_id="CBL33455.1"
FT   CDS             complement(302523..302951)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02890"
FT                   /product="ACT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33456"
FT                   /db_xref="GOA:D4MI73"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI73"
FT                   /protein_id="CBL33456.1"
FT   CDS             complement(302969..304291)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02900"
FT                   /product="phenylacetate-CoA ligase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33457"
FT                   /db_xref="GOA:D4MI74"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI74"
FT                   /protein_id="CBL33457.1"
FT   CDS             complement(306226..307056)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33458"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI75"
FT                   /protein_id="CBL33458.1"
FT   CDS             complement(307053..307661)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33459"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI76"
FT                   /protein_id="CBL33459.1"
FT   CDS             complement(309110..309835)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02960"
FT                   /product="Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33460"
FT                   /db_xref="GOA:D4MI77"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI77"
FT                   /protein_id="CBL33460.1"
FT   CDS             complement(310102..312846)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02980"
FT                   /product="Predicted permease."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33461"
FT                   /db_xref="GOA:D4MI78"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI78"
FT                   /protein_id="CBL33461.1"
FT   CDS             complement(312916..313896)
FT                   /transl_table=11
FT                   /locus_tag="ES1_02990"
FT                   /product="Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_02990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33462"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI79"
FT                   /protein_id="CBL33462.1"
FT   CDS             314251..315864
FT                   /transl_table=11
FT                   /locus_tag="ES1_03000"
FT                   /product="CTP synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33463"
FT                   /db_xref="GOA:D4MI80"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI80"
FT                   /protein_id="CBL33463.1"
FT   CDS             315976..318105
FT                   /transl_table=11
FT                   /locus_tag="ES1_03010"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33464"
FT                   /db_xref="GOA:D4MI81"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI81"
FT                   /protein_id="CBL33464.1"
FT                   RKSLFARIRARLQSK"
FT   CDS             complement(318170..320422)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03020"
FT                   /product="BNR/Asp-box repeat."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33465"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI82"
FT                   /protein_id="CBL33465.1"
FT   CDS             320707..322515
FT                   /transl_table=11
FT                   /locus_tag="ES1_03030"
FT                   /product="Beta-mannanase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33466"
FT                   /db_xref="GOA:D4MI83"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI83"
FT                   /protein_id="CBL33466.1"
FT   CDS             complement(322600..324492)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03040"
FT                   /product="Molecular chaperone, HSP90 family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33467"
FT                   /db_xref="GOA:D4MI84"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI84"
FT                   /protein_id="CBL33467.1"
FT   CDS             324767..325204
FT                   /transl_table=11
FT                   /locus_tag="ES1_03050"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33468"
FT                   /db_xref="GOA:D4MI85"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI85"
FT                   /protein_id="CBL33468.1"
FT   CDS             325204..325980
FT                   /transl_table=11
FT                   /locus_tag="ES1_03060"
FT                   /product="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33469"
FT                   /db_xref="GOA:D4MI86"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI86"
FT                   /protein_id="CBL33469.1"
FT   CDS             complement(326036..326548)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33470"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI87"
FT                   /protein_id="CBL33470.1"
FT                   MPEVEVQ"
FT   CDS             complement(326749..329967)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33471"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI88"
FT                   /protein_id="CBL33471.1"
FT   CDS             complement(330000..333434)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03090"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33472"
FT                   /db_xref="GOA:D4MI89"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI89"
FT                   /protein_id="CBL33472.1"
FT   CDS             complement(333454..334155)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03100"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33473"
FT                   /db_xref="GOA:D4MI90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI90"
FT                   /protein_id="CBL33473.1"
FT                   EHPTPVEEIEW"
FT   CDS             334641..335822
FT                   /transl_table=11
FT                   /locus_tag="ES1_03110"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33474"
FT                   /db_xref="GOA:D4MI91"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI91"
FT                   /protein_id="CBL33474.1"
FT   CDS             335893..336342
FT                   /transl_table=11
FT                   /locus_tag="ES1_03120"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33475"
FT                   /db_xref="GOA:D4MI92"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI92"
FT                   /protein_id="CBL33475.1"
FT   CDS             complement(336477..337517)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03130"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33476"
FT                   /db_xref="GOA:D4MI93"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI93"
FT                   /protein_id="CBL33476.1"
FT                   NFTVFA"
FT   CDS             complement(337529..338041)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03140"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33477"
FT                   /db_xref="GOA:D4MI94"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI94"
FT                   /protein_id="CBL33477.1"
FT                   DGLFDEE"
FT   CDS             complement(338060..338710)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03150"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED/haloacid
FT                   dehalogenase superfamily, subfamily IA, variant 1 with
FT                   third motif having Dx(3-4)D or Dx(3-4)E"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33478"
FT                   /db_xref="GOA:D4MI95"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI95"
FT                   /protein_id="CBL33478.1"
FT   CDS             340381..340626
FT                   /transl_table=11
FT                   /locus_tag="ES1_03170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33479"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI96"
FT                   /protein_id="CBL33479.1"
FT   CDS             340645..341094
FT                   /transl_table=11
FT                   /locus_tag="ES1_03180"
FT                   /product="Bacterial membrane flanked domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33480"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI97"
FT                   /protein_id="CBL33480.1"
FT   gap             341771..342246
FT                   /estimated_length=476
FT   CDS             complement(344673..344957)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33481"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI98"
FT                   /protein_id="CBL33481.1"
FT   CDS             complement(345031..346002)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03220"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33482"
FT                   /db_xref="GOA:D4MI99"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MI99"
FT                   /protein_id="CBL33482.1"
FT   CDS             complement(346170..347954)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03230"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33483"
FT                   /db_xref="GOA:D4MIA0"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIA0"
FT                   /protein_id="CBL33483.1"
FT                   VIKVRTGEEAYEALQDND"
FT   CDS             348598..348828
FT                   /transl_table=11
FT                   /locus_tag="ES1_03240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33484"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIA1"
FT                   /protein_id="CBL33484.1"
FT   CDS             complement(349170..349775)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33485"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIA2"
FT                   /protein_id="CBL33485.1"
FT   CDS             complement(349788..351194)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33486"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIA3"
FT                   /protein_id="CBL33486.1"
FT                   TVVMYLAGRK"
FT   CDS             complement(351315..352733)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03270"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33487"
FT                   /db_xref="GOA:D4MIA4"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIA4"
FT                   /protein_id="CBL33487.1"
FT                   TVEETRQGTVIKKK"
FT   CDS             complement(352750..353412)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03280"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33488"
FT                   /db_xref="GOA:D4MIA5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIA5"
FT                   /protein_id="CBL33488.1"
FT   CDS             complement(353767..355512)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03290"
FT                   /product="PAS domain S-box"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33489"
FT                   /db_xref="GOA:D4MIA6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIA6"
FT                   /protein_id="CBL33489.1"
FT                   KNISE"
FT   CDS             complement(356245..356901)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03310"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33490"
FT                   /db_xref="GOA:D4MIA7"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIA7"
FT                   /protein_id="CBL33490.1"
FT   CDS             complement(356947..357726)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03320"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33491"
FT                   /db_xref="GOA:D4MIA8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIA8"
FT                   /protein_id="CBL33491.1"
FT   CDS             complement(357754..358650)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03330"
FT                   /product="phosphate ABC transporter membrane protein 2,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33492"
FT                   /db_xref="GOA:D4MIA9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIA9"
FT                   /protein_id="CBL33492.1"
FT                   NICAKLVAYRIRKKRSV"
FT   CDS             complement(358657..359661)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03340"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33493"
FT                   /db_xref="GOA:D4MIB0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIB0"
FT                   /protein_id="CBL33493.1"
FT   CDS             complement(359753..360610)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03350"
FT                   /product="phosphate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33494"
FT                   /db_xref="GOA:D4MIB1"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIB1"
FT                   /protein_id="CBL33494.1"
FT                   VPVK"
FT   CDS             360967..362055
FT                   /transl_table=11
FT                   /locus_tag="ES1_03360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33495"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIB2"
FT                   /protein_id="CBL33495.1"
FT   CDS             362074..362562
FT                   /transl_table=11
FT                   /locus_tag="ES1_03370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33496"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIB3"
FT                   /protein_id="CBL33496.1"
FT   CDS             complement(362643..363650)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03380"
FT                   /product="Predicted glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33497"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIB4"
FT                   /protein_id="CBL33497.1"
FT   CDS             364180..364392
FT                   /transl_table=11
FT                   /locus_tag="ES1_03390"
FT                   /product="FeoA domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33498"
FT                   /db_xref="GOA:D4MIB5"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIB5"
FT                   /protein_id="CBL33498.1"
FT   CDS             364418..364639
FT                   /transl_table=11
FT                   /locus_tag="ES1_03400"
FT                   /product="Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33499"
FT                   /db_xref="GOA:D4MIB6"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIB6"
FT                   /protein_id="CBL33499.1"
FT   CDS             364734..367256
FT                   /transl_table=11
FT                   /locus_tag="ES1_03410"
FT                   /product="ferrous iron transporter FeoB"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33500"
FT                   /db_xref="GOA:D4MIB7"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011619"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIB7"
FT                   /protein_id="CBL33500.1"
FT   CDS             367289..367483
FT                   /transl_table=11
FT                   /locus_tag="ES1_03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33501"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIB8"
FT                   /protein_id="CBL33501.1"
FT   CDS             complement(367600..369150)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03430"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33502"
FT                   /db_xref="GOA:D4MIB9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIB9"
FT                   /protein_id="CBL33502.1"
FT   CDS             complement(369607..370422)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33503"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIC0"
FT                   /protein_id="CBL33503.1"
FT   CDS             complement(370438..371703)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03460"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33504"
FT                   /db_xref="GOA:D4MIC1"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIC1"
FT                   /protein_id="CBL33504.1"
FT   CDS             complement(371693..372478)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03470"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33505"
FT                   /db_xref="GOA:D4MIC2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIC2"
FT                   /protein_id="CBL33505.1"
FT   CDS             complement(372496..373581)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03480"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33506"
FT                   /db_xref="GOA:D4MIC3"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIC3"
FT                   /protein_id="CBL33506.1"
FT   CDS             375812..376156
FT                   /transl_table=11
FT                   /locus_tag="ES1_03500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33507"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIC4"
FT                   /protein_id="CBL33507.1"
FT                   LTSLLSDKTD"
FT   CDS             complement(376272..376634)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33508"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIC5"
FT                   /protein_id="CBL33508.1"
FT                   RANRKYYWKLEKQSVL"
FT   CDS             complement(376643..377539)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03520"
FT                   /product="conserved protein of unknown function
FT                   cotranscribed with Bmr (bmrU)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33509"
FT                   /db_xref="GOA:D4MIC6"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIC6"
FT                   /protein_id="CBL33509.1"
FT                   IEVLHESVNIILPKKRG"
FT   CDS             complement(377659..378738)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03530"
FT                   /product="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33510"
FT                   /db_xref="GOA:D4MIC7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIC7"
FT                   /protein_id="CBL33510.1"
FT   CDS             complement(378795..379502)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33511"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIC8"
FT                   /protein_id="CBL33511.1"
FT                   HGVADEEKFTLIP"
FT   CDS             complement(379622..380806)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03550"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33512"
FT                   /db_xref="GOA:D4MIC9"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIC9"
FT                   /protein_id="CBL33512.1"
FT   CDS             complement(380908..382755)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03560"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33513"
FT                   /db_xref="GOA:D4MID0"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D4MID0"
FT                   /protein_id="CBL33513.1"
FT   CDS             complement(383386..384435)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03580"
FT                   /product="heat shock gene repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33514"
FT                   /db_xref="GOA:D4MID1"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D4MID1"
FT                   /protein_id="CBL33514.1"
FT                   NEEKEADSV"
FT   CDS             384768..385067
FT                   /transl_table=11
FT                   /locus_tag="ES1_03590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MID2"
FT                   /protein_id="CBL33515.1"
FT   gap             385234..385518
FT                   /estimated_length=285
FT   CDS             complement(385699..386355)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03600"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33516"
FT                   /db_xref="GOA:D4MID3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4MID3"
FT                   /protein_id="CBL33516.1"
FT   CDS             complement(386595..388973)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03610"
FT                   /product="Superfamily I DNA and RNA helicases"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33517"
FT                   /db_xref="GOA:D4MID4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MID4"
FT                   /protein_id="CBL33517.1"
FT   CDS             complement(389086..390015)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03620"
FT                   /product="Membrane protease subunits, stomatin/prohibitin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33518"
FT                   /db_xref="GOA:D4MID5"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="UniProtKB/TrEMBL:D4MID5"
FT                   /protein_id="CBL33518.1"
FT   CDS             complement(390083..394378)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03630"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33519"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:D4MID6"
FT                   /protein_id="CBL33519.1"
FT   CDS             394730..395935
FT                   /transl_table=11
FT                   /locus_tag="ES1_03640"
FT                   /product="LL-diaminopimelate aminotransferase apoenzyme"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33520"
FT                   /db_xref="GOA:D4MID7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/TrEMBL:D4MID7"
FT                   /protein_id="CBL33520.1"
FT                   SK"
FT   CDS             395944..396732
FT                   /transl_table=11
FT                   /locus_tag="ES1_03650"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33521"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4MID8"
FT                   /protein_id="CBL33521.1"
FT   CDS             396786..397172
FT                   /transl_table=11
FT                   /locus_tag="ES1_03660"
FT                   /product="Response regulator containing CheY-like receiver,
FT                   AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33522"
FT                   /db_xref="GOA:D4MID9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4MID9"
FT                   /protein_id="CBL33522.1"
FT   CDS             397176..398054
FT                   /transl_table=11
FT                   /locus_tag="ES1_03670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33523"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIE0"
FT                   /protein_id="CBL33523.1"
FT                   FGTVVFTLAVI"
FT   CDS             398277..400055
FT                   /transl_table=11
FT                   /locus_tag="ES1_03680"
FT                   /product="Na/Pi-cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33524"
FT                   /db_xref="GOA:D4MIE1"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIE1"
FT                   /protein_id="CBL33524.1"
FT                   TVFSEKYMLPDAKKTD"
FT   CDS             400184..400675
FT                   /transl_table=11
FT                   /locus_tag="ES1_03690"
FT                   /product="Deoxycytidylate deaminase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33525"
FT                   /db_xref="GOA:D4MIE2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIE2"
FT                   /protein_id="CBL33525.1"
FT                   "
FT   gap             401572..402546
FT                   /estimated_length=975
FT   CDS             complement(402595..403599)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03710"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33526"
FT                   /db_xref="GOA:D4MIE3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIE3"
FT                   /protein_id="CBL33526.1"
FT   CDS             complement(403683..404444)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03720"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family (TC 3.A.1.3.-)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33527"
FT                   /db_xref="GOA:D4MIE4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIE4"
FT                   /protein_id="CBL33527.1"
FT   CDS             complement(404457..405200)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03730"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family (TC 3.A.1.3.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33528"
FT                   /db_xref="GOA:D4MIE5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIE5"
FT                   /protein_id="CBL33528.1"
FT   CDS             405541..409128
FT                   /transl_table=11
FT                   /locus_tag="ES1_03740"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33529"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIE6"
FT                   /protein_id="CBL33529.1"
FT   CDS             complement(409180..410151)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03750"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33530"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIE7"
FT                   /protein_id="CBL33530.1"
FT   CDS             complement(410195..411031)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33531"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIE8"
FT                   /protein_id="CBL33531.1"
FT   CDS             complement(411050..412123)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33532"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIE9"
FT                   /protein_id="CBL33532.1"
FT                   SGNIVICEEEEYYREGL"
FT   CDS             complement(412654..413238)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33533"
FT                   /db_xref="GOA:D4MIF0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIF0"
FT                   /protein_id="CBL33533.1"
FT   CDS             413465..413983
FT                   /transl_table=11
FT                   /locus_tag="ES1_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33534"
FT                   /db_xref="InterPro:IPR025328"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIF1"
FT                   /protein_id="CBL33534.1"
FT                   LAEDYNIRG"
FT   CDS             complement(414057..415016)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33535"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIF2"
FT                   /protein_id="CBL33535.1"
FT   CDS             complement(415050..415142)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33536"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIF3"
FT                   /protein_id="CBL33536.1"
FT                   /translation="MKFLVINQNAENTANRSDFANDIAIRIDLC"
FT   CDS             415223..415411
FT                   /transl_table=11
FT                   /locus_tag="ES1_03830"
FT                   /product="Small, acid-soluble spore proteins, alpha/beta
FT                   type."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33537"
FT                   /db_xref="GOA:D4MIF4"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIF4"
FT                   /protein_id="CBL33537.1"
FT                   GQMVKKMIESYEMSNKQ"
FT   CDS             415683..416798
FT                   /transl_table=11
FT                   /locus_tag="ES1_03840"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33538"
FT                   /db_xref="GOA:D4MIF5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIF5"
FT                   /protein_id="CBL33538.1"
FT   CDS             417126..418502
FT                   /transl_table=11
FT                   /locus_tag="ES1_03850"
FT                   /product="glycyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33539"
FT                   /db_xref="GOA:D4MIF6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIF6"
FT                   /protein_id="CBL33539.1"
FT                   "
FT   CDS             complement(418727..418888)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33540"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIF7"
FT                   /protein_id="CBL33540.1"
FT                   MPKNTGVF"
FT   CDS             419225..423583
FT                   /transl_table=11
FT                   /locus_tag="ES1_03880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33541"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIF8"
FT                   /protein_id="CBL33541.1"
FT   CDS             423679..424533
FT                   /transl_table=11
FT                   /locus_tag="ES1_03890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33542"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIF9"
FT                   /protein_id="CBL33542.1"
FT                   YDL"
FT   CDS             424549..425421
FT                   /transl_table=11
FT                   /locus_tag="ES1_03900"
FT                   /product="Cobalt transport protein."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33543"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIG0"
FT                   /protein_id="CBL33543.1"
FT                   KRRERNGTL"
FT   CDS             425408..427936
FT                   /transl_table=11
FT                   /locus_tag="ES1_03910"
FT                   /product="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33544"
FT                   /db_xref="GOA:D4MIG1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIG1"
FT                   /protein_id="CBL33544.1"
FT   CDS             428067..428342
FT                   /transl_table=11
FT                   /locus_tag="ES1_03920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33545"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIG2"
FT                   /protein_id="CBL33545.1"
FT   CDS             complement(428498..429406)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03930"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33546"
FT                   /db_xref="GOA:D4MIG3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIG3"
FT                   /protein_id="CBL33546.1"
FT   CDS             complement(429415..430335)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03940"
FT                   /product="ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33547"
FT                   /db_xref="GOA:D4MIG4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIG4"
FT                   /protein_id="CBL33547.1"
FT   CDS             complement(430476..431909)
FT                   /transl_table=11
FT                   /locus_tag="ES1_03950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33548"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIG5"
FT                   /protein_id="CBL33548.1"
FT   CDS             433096..433914
FT                   /transl_table=11
FT                   /locus_tag="ES1_03960"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33549"
FT                   /db_xref="GOA:D4MIG6"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIG6"
FT                   /protein_id="CBL33549.1"
FT   CDS             433936..435333
FT                   /transl_table=11
FT                   /locus_tag="ES1_03970"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33550"
FT                   /db_xref="GOA:D4MIG7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIG7"
FT                   /protein_id="CBL33550.1"
FT                   ESEGNKE"
FT   CDS             435330..436193
FT                   /transl_table=11
FT                   /locus_tag="ES1_03980"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33551"
FT                   /db_xref="GOA:D4MIG8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIG8"
FT                   /protein_id="CBL33551.1"
FT                   DELKKE"
FT   CDS             436312..437487
FT                   /transl_table=11
FT                   /locus_tag="ES1_03990"
FT                   /product="Transglutaminase-like enzymes, putative cysteine
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_03990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33552"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIG9"
FT                   /protein_id="CBL33552.1"
FT   CDS             437516..438553
FT                   /transl_table=11
FT                   /locus_tag="ES1_04000"
FT                   /product="Type II secretory pathway, component PulF"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33553"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIH0"
FT                   /protein_id="CBL33553.1"
FT                   MTVIG"
FT   CDS             438567..438890
FT                   /transl_table=11
FT                   /locus_tag="ES1_04010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33554"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIH1"
FT                   /protein_id="CBL33554.1"
FT                   IAK"
FT   CDS             438919..439422
FT                   /transl_table=11
FT                   /locus_tag="ES1_04020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33555"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIH2"
FT                   /protein_id="CBL33555.1"
FT                   EGAG"
FT   CDS             439419..439769
FT                   /transl_table=11
FT                   /locus_tag="ES1_04030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33556"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIH3"
FT                   /protein_id="CBL33556.1"
FT                   YITITSARRVAS"
FT   CDS             440277..441344
FT                   /transl_table=11
FT                   /locus_tag="ES1_04050"
FT                   /product="pilus retraction protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33557"
FT                   /db_xref="GOA:D4MIH4"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIH4"
FT                   /protein_id="CBL33557.1"
FT                   ASHPDIMLRKIGEDK"
FT   CDS             441867..443051
FT                   /transl_table=11
FT                   /locus_tag="ES1_04060"
FT                   /product="Transcriptional regulatory protein, C
FT                   terminal./Bacterial transcriptional activator domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33558"
FT                   /db_xref="GOA:D4MIH5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIH5"
FT                   /protein_id="CBL33558.1"
FT   CDS             443387..443767
FT                   /transl_table=11
FT                   /locus_tag="ES1_04070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33559"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIH6"
FT                   /protein_id="CBL33559.1"
FT   CDS             complement(444268..445881)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04090"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33560"
FT                   /db_xref="GOA:D4MIH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIH7"
FT                   /protein_id="CBL33560.1"
FT   gap             448634..449518
FT                   /estimated_length=885
FT   gap             452088..452972
FT                   /estimated_length=885
FT   CDS             453477..453608
FT                   /transl_table=11
FT                   /locus_tag="ES1_04120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33561"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIH8"
FT                   /protein_id="CBL33561.1"
FT   CDS             453861..457010
FT                   /transl_table=11
FT                   /locus_tag="ES1_04130"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33562"
FT                   /db_xref="GOA:D4MIH9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIH9"
FT                   /protein_id="CBL33562.1"
FT                   V"
FT   CDS             457007..457630
FT                   /transl_table=11
FT                   /locus_tag="ES1_04140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33563"
FT                   /db_xref="UniProtKB/TrEMBL:D4MII0"
FT                   /protein_id="CBL33563.1"
FT   CDS             457633..458523
FT                   /transl_table=11
FT                   /locus_tag="ES1_04150"
FT                   /product="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33564"
FT                   /db_xref="GOA:D4MII1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4MII1"
FT                   /protein_id="CBL33564.1"
FT                   GVAMFIYNNRRDKNP"
FT   CDS             458642..459079
FT                   /transl_table=11
FT                   /locus_tag="ES1_04160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33565"
FT                   /db_xref="UniProtKB/TrEMBL:D4MII2"
FT                   /protein_id="CBL33565.1"
FT   CDS             complement(459184..460266)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04170"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33566"
FT                   /db_xref="GOA:D4MII3"
FT                   /db_xref="InterPro:IPR001804"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D4MII3"
FT                   /protein_id="CBL33566.1"
FT   CDS             complement(460289..460654)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04180"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33567"
FT                   /db_xref="GOA:D4MII4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MII4"
FT                   /protein_id="CBL33567.1"
FT                   FGFEKAEGKSALYKIEL"
FT   CDS             complement(461175..461477)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04200"
FT                   /product="Stress responsive A/B Barrel Domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33568"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:D4MII5"
FT                   /protein_id="CBL33568.1"
FT   CDS             complement(461487..462743)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04210"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33569"
FT                   /db_xref="GOA:D4MII6"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniProtKB/TrEMBL:D4MII6"
FT                   /protein_id="CBL33569.1"
FT   CDS             complement(462804..463277)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04220"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33570"
FT                   /db_xref="GOA:D4MII7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="UniProtKB/TrEMBL:D4MII7"
FT                   /protein_id="CBL33570.1"
FT   CDS             complement(463292..464995)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04230"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33571"
FT                   /db_xref="GOA:D4MII8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4MII8"
FT                   /protein_id="CBL33571.1"
FT   CDS             complement(465140..465562)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33572"
FT                   /db_xref="UniProtKB/TrEMBL:D4MII9"
FT                   /protein_id="CBL33572.1"
FT   CDS             complement(465760..466986)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04250"
FT                   /product="SpoIID/LytB domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33573"
FT                   /db_xref="GOA:D4MIJ0"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIJ0"
FT                   /protein_id="CBL33573.1"
FT                   HYFTGVEIH"
FT   CDS             complement(467026..468129)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04260"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33574"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIJ1"
FT                   /protein_id="CBL33574.1"
FT   CDS             complement(469240..470385)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04280"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33575"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIJ2"
FT                   /protein_id="CBL33575.1"
FT   CDS             complement(471845..472363)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04300"
FT                   /product="competence/damage-inducible protein CinA
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33576"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIJ3"
FT                   /protein_id="CBL33576.1"
FT                   ALQWVAENI"
FT   CDS             complement(472392..473582)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04310"
FT                   /product="thiazole biosynthesis/tRNA modification protein
FT                   ThiI"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33577"
FT                   /db_xref="GOA:D4MIJ4"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIJ4"
FT                   /protein_id="CBL33577.1"
FT   CDS             474869..476212
FT                   /transl_table=11
FT                   /locus_tag="ES1_04330"
FT                   /product="germination protein YpeB"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33578"
FT                   /db_xref="GOA:D4MIJ5"
FT                   /db_xref="InterPro:IPR014239"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIJ5"
FT                   /protein_id="CBL33578.1"
FT   CDS             complement(476282..477424)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04340"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33579"
FT                   /db_xref="GOA:D4MIJ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIJ6"
FT                   /protein_id="CBL33579.1"
FT   CDS             477831..478274
FT                   /transl_table=11
FT                   /locus_tag="ES1_04350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33580"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIJ7"
FT                   /protein_id="CBL33580.1"
FT   CDS             complement(478333..478977)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04360"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33581"
FT                   /db_xref="GOA:D4MIJ8"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIJ8"
FT                   /protein_id="CBL33581.1"
FT   CDS             complement(479251..479685)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04370"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33582"
FT                   /db_xref="GOA:D4MIJ9"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIJ9"
FT                   /protein_id="CBL33582.1"
FT   CDS             complement(479688..480407)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04380"
FT                   /product="Inactive homolog of metal-dependent proteases,
FT                   putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33583"
FT                   /db_xref="GOA:D4MIK0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIK0"
FT                   /protein_id="CBL33583.1"
FT                   QRELMAKNAEAYKERKE"
FT   CDS             complement(480401..480835)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04390"
FT                   /product="conserved hypothetical nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33584"
FT                   /db_xref="GOA:D4MIK1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIK1"
FT                   /protein_id="CBL33584.1"
FT   CDS             complement(480835..482511)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04400"
FT                   /product="Formate-tetrahydrofolate ligase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33585"
FT                   /db_xref="GOA:D4MIK2"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIK2"
FT                   /protein_id="CBL33585.1"
FT   CDS             complement(485567..487570)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04430"
FT                   /product="Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33586"
FT                   /db_xref="GOA:D4MIK3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIK3"
FT                   /protein_id="CBL33586.1"
FT   CDS             complement(488172..489659)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04440"
FT                   /product="L-fucose isomerase and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33587"
FT                   /db_xref="GOA:D4MIK4"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIK4"
FT                   /protein_id="CBL33587.1"
FT   CDS             491104..492399
FT                   /transl_table=11
FT                   /locus_tag="ES1_04460"
FT                   /product="Acyl-CoA reductase (LuxC)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33588"
FT                   /db_xref="GOA:D4MIK5"
FT                   /db_xref="InterPro:IPR008670"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIK5"
FT                   /protein_id="CBL33588.1"
FT   CDS             492412..493104
FT                   /transl_table=11
FT                   /locus_tag="ES1_04470"
FT                   /product="YhhN-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33589"
FT                   /db_xref="GOA:D4MIK6"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIK6"
FT                   /protein_id="CBL33589.1"
FT                   TTEKIRVA"
FT   CDS             complement(493220..494977)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04480"
FT                   /product="Endoglucanase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33590"
FT                   /db_xref="GOA:D4MIK7"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIK7"
FT                   /protein_id="CBL33590.1"
FT                   WMRNWFRKH"
FT   CDS             complement(494999..495796)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33591"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIK8"
FT                   /protein_id="CBL33591.1"
FT   CDS             496082..496645
FT                   /transl_table=11
FT                   /locus_tag="ES1_04500"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33592"
FT                   /db_xref="GOA:D4MIK9"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIK9"
FT                   /protein_id="CBL33592.1"
FT   gap             496683..497590
FT                   /estimated_length=908
FT   CDS             498086..499444
FT                   /transl_table=11
FT                   /locus_tag="ES1_04510"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33593"
FT                   /db_xref="GOA:D4MIL0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIL0"
FT                   /protein_id="CBL33593.1"
FT   CDS             complement(499553..499921)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04520"
FT                   /product="Predicted transcription factor, homolog of
FT                   eukaryotic MBF1"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33594"
FT                   /db_xref="GOA:D4MIL1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIL1"
FT                   /protein_id="CBL33594.1"
FT                   LTDKQSCLLGQILAEFLK"
FT   CDS             500758..500994
FT                   /transl_table=11
FT                   /locus_tag="ES1_04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33595"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIL2"
FT                   /protein_id="CBL33595.1"
FT   CDS             501323..501997
FT                   /transl_table=11
FT                   /locus_tag="ES1_04550"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33596"
FT                   /db_xref="GOA:D4MIL3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIL3"
FT                   /protein_id="CBL33596.1"
FT                   ED"
FT   CDS             502003..502320
FT                   /transl_table=11
FT                   /locus_tag="ES1_04560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33597"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIL4"
FT                   /protein_id="CBL33597.1"
FT                   R"
FT   CDS             complement(502380..503951)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04570"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33598"
FT                   /db_xref="GOA:D4MIL5"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIL5"
FT                   /protein_id="CBL33598.1"
FT                   GMEIKV"
FT   CDS             complement(505761..505931)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33599"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIL6"
FT                   /protein_id="CBL33599.1"
FT                   PYLGTLLSENA"
FT   CDS             complement(505931..506464)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33600"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIL7"
FT                   /protein_id="CBL33600.1"
FT                   HSCYIAARFKGGDV"
FT   CDS             complement(507999..510461)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04630"
FT                   /product="Predicted glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33601"
FT                   /db_xref="GOA:D4MIL8"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIL8"
FT                   /protein_id="CBL33601.1"
FT                   WEYLPKQI"
FT   CDS             complement(510461..511045)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33602"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIL9"
FT                   /protein_id="CBL33602.1"
FT   CDS             complement(511063..511251)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33603"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIM0"
FT                   /protein_id="CBL33603.1"
FT                   HPPAGRGGGHGMGRPSL"
FT   CDS             complement(511251..513776)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04660"
FT                   /product="phage minor structural protein, N-terminal
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33604"
FT                   /db_xref="InterPro:IPR007119"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIM1"
FT                   /protein_id="CBL33604.1"
FT   CDS             complement(513783..514523)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04670"
FT                   /product="phage putative tail component, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33605"
FT                   /db_xref="InterPro:IPR006520"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIM2"
FT                   /protein_id="CBL33605.1"
FT   CDS             complement(517363..517512)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33606"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIM3"
FT                   /protein_id="CBL33606.1"
FT                   PYGI"
FT   CDS             complement(517551..517931)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33607"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIM4"
FT                   /protein_id="CBL33607.1"
FT   CDS             complement(517946..518560)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04710"
FT                   /product="phage major tail protein, phi13 family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33608"
FT                   /db_xref="InterPro:IPR006490"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIM5"
FT                   /protein_id="CBL33608.1"
FT   CDS             complement(518564..518905)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33609"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIM6"
FT                   /protein_id="CBL33609.1"
FT                   VAKTYETEE"
FT   CDS             complement(518902..519312)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04730"
FT                   /product="phage protein, HK97 gp10 family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33610"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIM7"
FT                   /protein_id="CBL33610.1"
FT   CDS             complement(519326..519658)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04740"
FT                   /product="phage head-tail adaptor, putative, SPP1 family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33611"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIM8"
FT                   /protein_id="CBL33611.1"
FT                   EVKAGG"
FT   CDS             complement(519661..519972)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04750"
FT                   /product="uncharacterized phage protein (possible DNA
FT                   packaging)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33612"
FT                   /db_xref="InterPro:IPR006450"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIM9"
FT                   /protein_id="CBL33612.1"
FT   CDS             complement(520100..521302)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04760"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33613"
FT                   /db_xref="InterPro:IPR006444"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIN0"
FT                   /protein_id="CBL33613.1"
FT                   A"
FT   CDS             complement(521942..523321)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04780"
FT                   /product="phage portal protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33614"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIN1"
FT                   /protein_id="CBL33614.1"
FT                   V"
FT   CDS             complement(523341..524906)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04790"
FT                   /product="Phage terminase-like protein, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33615"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIN2"
FT                   /protein_id="CBL33615.1"
FT                   LLFI"
FT   CDS             complement(525264..525593)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04800"
FT                   /product="Zeta toxin."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33616"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIN3"
FT                   /protein_id="CBL33616.1"
FT                   EVHYI"
FT   CDS             complement(525666..525875)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33617"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIN4"
FT                   /protein_id="CBL33617.1"
FT   CDS             complement(525865..526341)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04820"
FT                   /product="AIG2-like family."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33618"
FT                   /db_xref="GOA:D4MIN5"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIN5"
FT                   /protein_id="CBL33618.1"
FT   CDS             complement(526439..527443)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04830"
FT                   /product="Putative amidoligase enzyme."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33619"
FT                   /db_xref="InterPro:IPR022025"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIN6"
FT                   /protein_id="CBL33619.1"
FT   CDS             complement(527523..527771)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33620"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIN7"
FT                   /protein_id="CBL33620.1"
FT   CDS             complement(527755..528465)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33621"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIN8"
FT                   /protein_id="CBL33621.1"
FT                   SAFKNGGADHAVSE"
FT   CDS             complement(528614..529852)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04860"
FT                   /product="DNA modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33622"
FT                   /db_xref="GOA:D4MIN9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR015840"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIN9"
FT                   /protein_id="CBL33622.1"
FT                   RTYSYEEVTDGTE"
FT   CDS             complement(529849..530634)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04870"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33623"
FT                   /db_xref="GOA:D4MIP0"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIP0"
FT                   /protein_id="CBL33623.1"
FT   CDS             complement(530639..531187)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04880"
FT                   /product="Phage terminase, small subunit."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33624"
FT                   /db_xref="InterPro:IPR006448"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIP1"
FT                   /protein_id="CBL33624.1"
FT   CDS             complement(531778..532203)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33625"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIP2"
FT                   /protein_id="CBL33625.1"
FT   CDS             complement(532442..533806)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04920"
FT                   /product="Superfamily II DNA/RNA helicases, SNF2 family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33626"
FT                   /db_xref="GOA:D4MIP3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIP3"
FT                   /protein_id="CBL33626.1"
FT   CDS             complement(533787..534068)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04930"
FT                   /product="VRR-NUC domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33627"
FT                   /db_xref="GOA:D4MIP4"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIP4"
FT                   /protein_id="CBL33627.1"
FT   CDS             complement(534204..536462)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04940"
FT                   /product="phage/plasmid primase, P4 family, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33628"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIP5"
FT                   /protein_id="CBL33628.1"
FT   CDS             complement(536459..536881)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33629"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIP6"
FT                   /protein_id="CBL33629.1"
FT   CDS             complement(536951..538933)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04960"
FT                   /product="DNA polymerase I-3'-5' exonuclease and polymerase
FT                   domains"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33630"
FT                   /db_xref="GOA:D4MIP7"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIP7"
FT                   /protein_id="CBL33630.1"
FT   CDS             complement(539000..539188)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33631"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIP8"
FT                   /protein_id="CBL33631.1"
FT                   ERDKEYHDKRMEDLLSK"
FT   CDS             complement(539208..539780)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04980"
FT                   /product="Protein of unknown function (DUF2815)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33632"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022595"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIP9"
FT                   /protein_id="CBL33632.1"
FT   CDS             complement(539782..540906)
FT                   /transl_table=11
FT                   /locus_tag="ES1_04990"
FT                   /product="Protein of unknown function (DUF2800)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_04990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33633"
FT                   /db_xref="InterPro:IPR021229"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIQ0"
FT                   /protein_id="CBL33633.1"
FT   CDS             complement(540899..541210)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33634"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIQ1"
FT                   /protein_id="CBL33634.1"
FT   CDS             complement(542041..542316)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33635"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIQ2"
FT                   /protein_id="CBL33635.1"
FT   CDS             complement(544332..545453)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05040"
FT                   /product="Restriction endonuclease S subunits"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33636"
FT                   /db_xref="GOA:D4MIQ3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIQ3"
FT                   /protein_id="CBL33636.1"
FT   CDS             complement(545503..546081)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05050"
FT                   /product="Restriction endonuclease S subunits"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33637"
FT                   /db_xref="GOA:D4MIQ4"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIQ4"
FT                   /protein_id="CBL33637.1"
FT   CDS             complement(546123..546737)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33638"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIQ5"
FT                   /protein_id="CBL33638.1"
FT   CDS             complement(547805..548947)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05080"
FT                   /product="Restriction endonuclease S subunits"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33639"
FT                   /db_xref="GOA:D4MIQ6"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIQ6"
FT                   /protein_id="CBL33639.1"
FT   CDS             complement(550432..552849)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05100"
FT                   /product="Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33640"
FT                   /db_xref="GOA:D4MIQ7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIQ7"
FT                   /protein_id="CBL33640.1"
FT   CDS             complement(552874..555798)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05110"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33641"
FT                   /db_xref="GOA:D4MIQ8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIQ8"
FT                   /protein_id="CBL33641.1"
FT   CDS             complement(555860..557467)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05120"
FT                   /product="Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33642"
FT                   /db_xref="GOA:D4MIQ9"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIQ9"
FT                   /protein_id="CBL33642.1"
FT                   AAEEGWRGVQQGIQSKLY"
FT   CDS             559161..562043
FT                   /transl_table=11
FT                   /locus_tag="ES1_05140"
FT                   /product="T5orf172 domain."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33643"
FT                   /db_xref="GOA:D4MIR0"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIR0"
FT                   /protein_id="CBL33643.1"
FT   CDS             complement(562513..564732)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05160"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33644"
FT                   /db_xref="GOA:D4MIR1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIR1"
FT                   /protein_id="CBL33644.1"
FT   CDS             complement(564734..565372)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33645"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIR2"
FT                   /protein_id="CBL33645.1"
FT   CDS             complement(565618..565704)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33646"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIR3"
FT                   /protein_id="CBL33646.1"
FT                   /translation="MVLQRNREITITRLTANKPGADIAEKII"
FT   CDS             566148..566663
FT                   /transl_table=11
FT                   /locus_tag="ES1_05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33647"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIR4"
FT                   /protein_id="CBL33647.1"
FT                   IRSFGFLR"
FT   CDS             566864..567859
FT                   /transl_table=11
FT                   /locus_tag="ES1_05200"
FT                   /product="Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33648"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIR5"
FT                   /protein_id="CBL33648.1"
FT   CDS             567871..568935
FT                   /transl_table=11
FT                   /locus_tag="ES1_05210"
FT                   /product="Predicted phosphatase homologous to the
FT                   C-terminal domain of histone macroH2A1"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33649"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIR6"
FT                   /protein_id="CBL33649.1"
FT                   NETLFSYDQMLLGA"
FT   CDS             569077..569757
FT                   /transl_table=11
FT                   /locus_tag="ES1_05220"
FT                   /product="von Willebrand factor type A domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33650"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIR7"
FT                   /protein_id="CBL33650.1"
FT                   NNRK"
FT   CDS             complement(569805..571013)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05230"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33651"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIR8"
FT                   /protein_id="CBL33651.1"
FT                   FSK"
FT   CDS             571493..572218
FT                   /transl_table=11
FT                   /locus_tag="ES1_05240"
FT                   /product="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33652"
FT                   /db_xref="GOA:D4MIR9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIR9"
FT                   /protein_id="CBL33652.1"
FT   CDS             572215..573117
FT                   /transl_table=11
FT                   /locus_tag="ES1_05250"
FT                   /product="fructose-1-phosphate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33653"
FT                   /db_xref="GOA:D4MIS0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIS0"
FT                   /protein_id="CBL33653.1"
FT   CDS             573140..575086
FT                   /transl_table=11
FT                   /locus_tag="ES1_05260"
FT                   /product="PTS system D-fructose-specific IIA component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)/PTS system
FT                   D-fructose-specific IIB component (F1P-forming), Frc family
FT                   (TC 4.A.2.1.4)/PTS system D-fructose-specific IIC component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33654"
FT                   /db_xref="GOA:D4MIS1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIS1"
FT                   /protein_id="CBL33654.1"
FT                   KKTVKEPETKNVK"
FT   CDS             575107..575373
FT                   /transl_table=11
FT                   /locus_tag="ES1_05270"
FT                   /product="Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33655"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIS2"
FT                   /protein_id="CBL33655.1"
FT   CDS             575457..577091
FT                   /transl_table=11
FT                   /locus_tag="ES1_05280"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33656"
FT                   /db_xref="GOA:D4MIS3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIS3"
FT                   /protein_id="CBL33656.1"
FT   CDS             complement(577504..577911)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33657"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIS4"
FT                   /protein_id="CBL33657.1"
FT   CDS             complement(577933..578127)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33658"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIS5"
FT                   /protein_id="CBL33658.1"
FT   CDS             579389..579676
FT                   /transl_table=11
FT                   /locus_tag="ES1_05330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33659"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIS6"
FT                   /protein_id="CBL33659.1"
FT   CDS             579742..581826
FT                   /transl_table=11
FT                   /locus_tag="ES1_05340"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC/heavy metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33660"
FT                   /db_xref="GOA:D4MIS7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIS7"
FT                   /protein_id="CBL33660.1"
FT                   "
FT   CDS             complement(582721..583743)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05350"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33661"
FT                   /db_xref="GOA:D4MIS8"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIS8"
FT                   /protein_id="CBL33661.1"
FT                   "
FT   CDS             584273..584953
FT                   /transl_table=11
FT                   /locus_tag="ES1_05360"
FT                   /product="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33662"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIS9"
FT                   /protein_id="CBL33662.1"
FT                   YING"
FT   CDS             complement(585325..585732)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05370"
FT                   /product="ATP synthase, F1 epsilon subunit (delta in
FT                   mitochondria)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33663"
FT                   /db_xref="GOA:D4MIT0"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIT0"
FT                   /protein_id="CBL33663.1"
FT   CDS             complement(585757..586332)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33664"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIT1"
FT                   /protein_id="CBL33664.1"
FT   CDS             complement(586319..587716)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05390"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33665"
FT                   /db_xref="GOA:D4MIT2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIT2"
FT                   /protein_id="CBL33665.1"
FT                   KAKNEKA"
FT   CDS             complement(587739..588599)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05400"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33666"
FT                   /db_xref="GOA:D4MIT3"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR023633"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIT3"
FT                   /protein_id="CBL33666.1"
FT                   ANALN"
FT   CDS             complement(588612..588737)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33667"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIT4"
FT                   /protein_id="CBL33667.1"
FT   CDS             complement(588776..590281)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05420"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33668"
FT                   /db_xref="GOA:D4MIT5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIT5"
FT                   /protein_id="CBL33668.1"
FT   CDS             complement(590329..590874)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05430"
FT                   /product="ATP synthase, F1 delta subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33669"
FT                   /db_xref="GOA:D4MIT6"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIT6"
FT                   /protein_id="CBL33669.1"
FT                   SVKARLEQLKADIAGTID"
FT   CDS             complement(590876..591418)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05440"
FT                   /product="ATP synthase, F0 subunit b"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33670"
FT                   /db_xref="GOA:D4MIT7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIT7"
FT                   /protein_id="CBL33670.1"
FT                   DNEKIIDSVLSQIGKEN"
FT   CDS             complement(591456..591737)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05450"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33671"
FT                   /db_xref="GOA:D4MIT8"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIT8"
FT                   /protein_id="CBL33671.1"
FT   CDS             complement(591805..592533)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05460"
FT                   /product="F0F1-type ATP synthase, subunit a"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33672"
FT                   /db_xref="GOA:D4MIT9"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIT9"
FT                   /protein_id="CBL33672.1"
FT   CDS             complement(592634..593035)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05470"
FT                   /product="ATP synthase I chain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33673"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIU0"
FT                   /protein_id="CBL33673.1"
FT   CDS             complement(593038..593346)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33674"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIU1"
FT                   /protein_id="CBL33674.1"
FT   CDS             complement(593350..594036)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33675"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIU2"
FT                   /protein_id="CBL33675.1"
FT                   LQKLVY"
FT   CDS             595087..595881
FT                   /transl_table=11
FT                   /locus_tag="ES1_05510"
FT                   /product="3-methyladenine DNA glycosylase/8-oxoguanine DNA
FT                   glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33676"
FT                   /db_xref="GOA:D4MIU3"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIU3"
FT                   /protein_id="CBL33676.1"
FT   CDS             595895..596566
FT                   /transl_table=11
FT                   /locus_tag="ES1_05520"
FT                   /product="Uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33677"
FT                   /db_xref="GOA:D4MIU4"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIU4"
FT                   /protein_id="CBL33677.1"
FT                   H"
FT   CDS             596616..597389
FT                   /transl_table=11
FT                   /locus_tag="ES1_05530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33678"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIU5"
FT                   /protein_id="CBL33678.1"
FT   CDS             597441..597674
FT                   /transl_table=11
FT                   /locus_tag="ES1_05540"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33679"
FT                   /db_xref="GOA:D4MIU6"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIU6"
FT                   /protein_id="CBL33679.1"
FT   CDS             597695..598885
FT                   /transl_table=11
FT                   /locus_tag="ES1_05550"
FT                   /product="Alpha-galactosidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33680"
FT                   /db_xref="GOA:D4MIU7"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002241"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIU7"
FT                   /protein_id="CBL33680.1"
FT   CDS             598885..599088
FT                   /transl_table=11
FT                   /locus_tag="ES1_05560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33681"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIU8"
FT                   /protein_id="CBL33681.1"
FT   gap             599692..600611
FT                   /estimated_length=920
FT   CDS             complement(600659..604180)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05570"
FT                   /product="Endo-beta-mannanase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33682"
FT                   /db_xref="GOA:D4MIU9"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR005087"
FT                   /db_xref="InterPro:IPR005102"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIU9"
FT                   /protein_id="CBL33682.1"
FT                   AAVTNAN"
FT   gap             604588..604966
FT                   /estimated_length=379
FT   CDS             complement(605206..608775)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05580"
FT                   /product="Fibronectin type III domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33683"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIV0"
FT                   /protein_id="CBL33683.1"
FT   CDS             611863..614193
FT                   /transl_table=11
FT                   /locus_tag="ES1_05610"
FT                   /product="Preprotein translocase subunit SecA (ATPase, RNA
FT                   helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33684"
FT                   /db_xref="GOA:D4MIV1"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIV1"
FT                   /protein_id="CBL33684.1"
FT   CDS             614200..615573
FT                   /transl_table=11
FT                   /locus_tag="ES1_05620"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33685"
FT                   /db_xref="GOA:D4MIV2"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIV2"
FT                   /protein_id="CBL33685.1"
FT   CDS             complement(615826..617199)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05630"
FT                   /product="Na+-dependent transporters of the SNF family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33686"
FT                   /db_xref="GOA:D4MIV3"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIV3"
FT                   /protein_id="CBL33686.1"
FT   CDS             complement(617414..617992)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05640"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33687"
FT                   /db_xref="GOA:D4MIV4"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIV4"
FT                   /protein_id="CBL33687.1"
FT   CDS             complement(618011..619351)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05650"
FT                   /product="SSU ribosomal protein S12P methylthiotransferase"
FT                   /EC_number=""
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33688"
FT                   /db_xref="GOA:D4MIV5"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023970"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIV5"
FT                   /protein_id="CBL33688.1"
FT   CDS             complement(619399..619887)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05660"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33689"
FT                   /db_xref="GOA:D4MIV6"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIV6"
FT                   /protein_id="CBL33689.1"
FT   CDS             complement(619887..621146)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05670"
FT                   /product="protein RecA"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33690"
FT                   /db_xref="GOA:D4MIV7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIV7"
FT                   /protein_id="CBL33690.1"
FT   CDS             complement(622332..623387)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05690"
FT                   /product="Predicted metal-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33691"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIV8"
FT                   /protein_id="CBL33691.1"
FT                   VLPENAEDAKW"
FT   CDS             complement(625025..625759)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05710"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33692"
FT                   /db_xref="GOA:D4MIV9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIV9"
FT                   /protein_id="CBL33692.1"
FT   CDS             complement(625816..627291)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33693"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIW0"
FT                   /protein_id="CBL33693.1"
FT   CDS             complement(627317..628279)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33694"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIW1"
FT                   /protein_id="CBL33694.1"
FT   CDS             complement(628312..629652)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05740"
FT                   /product="Citrate synthase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33695"
FT                   /db_xref="GOA:D4MIW2"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016141"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIW2"
FT                   /protein_id="CBL33695.1"
FT   CDS             629816..630712
FT                   /transl_table=11
FT                   /locus_tag="ES1_05750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33696"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIW3"
FT                   /protein_id="CBL33696.1"
FT                   SKRGYSCREILNEFYAL"
FT   gap             630949..631840
FT                   /estimated_length=892
FT   CDS             complement(632128..632832)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33697"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIW4"
FT                   /protein_id="CBL33697.1"
FT                   LEAIPINESELP"
FT   CDS             complement(632837..633337)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05770"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33698"
FT                   /db_xref="GOA:D4MIW5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIW5"
FT                   /protein_id="CBL33698.1"
FT                   RMD"
FT   CDS             633592..633813
FT                   /transl_table=11
FT                   /locus_tag="ES1_05780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33699"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIW6"
FT                   /protein_id="CBL33699.1"
FT   CDS             complement(633860..635248)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05790"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33700"
FT                   /db_xref="GOA:D4MIW7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIW7"
FT                   /protein_id="CBL33700.1"
FT                   SDDQ"
FT   CDS             complement(635267..636349)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05800"
FT                   /product="ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33701"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIW8"
FT                   /protein_id="CBL33701.1"
FT   CDS             636405..636800
FT                   /transl_table=11
FT                   /locus_tag="ES1_05810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33702"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIW9"
FT                   /protein_id="CBL33702.1"
FT   CDS             complement(638043..639017)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33703"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIX0"
FT                   /protein_id="CBL33703.1"
FT   CDS             complement(639032..639436)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33704"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIX1"
FT                   /protein_id="CBL33704.1"
FT   CDS             complement(640546..642738)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05860"
FT                   /product="Alpha-galactosidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33705"
FT                   /db_xref="GOA:D4MIX2"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIX2"
FT                   /protein_id="CBL33705.1"
FT   gap             642948..643264
FT                   /estimated_length=317
FT   CDS             643890..644789
FT                   /transl_table=11
FT                   /locus_tag="ES1_05870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33706"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIX3"
FT                   /protein_id="CBL33706.1"
FT                   AGIAVLATGAVIVAKKRK"
FT   CDS             complement(644818..645105)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33707"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIX4"
FT                   /protein_id="CBL33707.1"
FT   CDS             complement(645137..645343)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33708"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIX5"
FT                   /protein_id="CBL33708.1"
FT   CDS             complement(645495..645701)
FT                   /transl_table=11
FT                   /locus_tag="ES1_05900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33709"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIX6"
FT                   /protein_id="CBL33709.1"
FT   CDS             645724..647130
FT                   /transl_table=11
FT                   /locus_tag="ES1_05910"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33710"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIX7"
FT                   /protein_id="CBL33710.1"
FT                   SKNTDDKKQK"
FT   CDS             647306..647533
FT                   /transl_table=11
FT                   /locus_tag="ES1_05920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33711"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIX8"
FT                   /protein_id="CBL33711.1"
FT   CDS             647783..649309
FT                   /transl_table=11
FT                   /locus_tag="ES1_05930"
FT                   /product="yjeF C-terminal region, hydroxyethylthiazole
FT                   kinase-related/yjeF N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33712"
FT                   /db_xref="GOA:D4MIX9"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIX9"
FT                   /protein_id="CBL33712.1"
FT   CDS             649365..649898
FT                   /transl_table=11
FT                   /locus_tag="ES1_05940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33713"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIY0"
FT                   /protein_id="CBL33713.1"
FT                   ETSAPAVDVGKYLK"
FT   CDS             649998..650264
FT                   /transl_table=11
FT                   /locus_tag="ES1_05950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33714"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIY1"
FT                   /protein_id="CBL33714.1"
FT   CDS             650363..653335
FT                   /transl_table=11
FT                   /locus_tag="ES1_05960"
FT                   /product="CHAP domain./Bacterial SH3 domain./Fibronectin
FT                   type III domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33715"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIY2"
FT                   /protein_id="CBL33715.1"
FT                   K"
FT   CDS             653675..654697
FT                   /transl_table=11
FT                   /locus_tag="ES1_05980"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33716"
FT                   /db_xref="GOA:D4MIY3"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIY3"
FT                   /protein_id="CBL33716.1"
FT                   "
FT   CDS             654755..657130
FT                   /transl_table=11
FT                   /locus_tag="ES1_05990"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33717"
FT                   /db_xref="GOA:D4MIY4"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIY4"
FT                   /protein_id="CBL33717.1"
FT   CDS             657191..658423
FT                   /transl_table=11
FT                   /locus_tag="ES1_06000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33718"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIY5"
FT                   /protein_id="CBL33718.1"
FT                   LNKYKPENLKK"
FT   CDS             658507..660420
FT                   /transl_table=11
FT                   /locus_tag="ES1_06010"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33719"
FT                   /db_xref="GOA:D4MIY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIY6"
FT                   /protein_id="CBL33719.1"
FT                   FT"
FT   CDS             660735..660845
FT                   /transl_table=11
FT                   /locus_tag="ES1_06020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33720"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIY7"
FT                   /protein_id="CBL33720.1"
FT   CDS             660934..661629
FT                   /transl_table=11
FT                   /locus_tag="ES1_06030"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33721"
FT                   /db_xref="GOA:D4MIY8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIY8"
FT                   /protein_id="CBL33721.1"
FT                   ITDVRKQVE"
FT   CDS             661629..662594
FT                   /transl_table=11
FT                   /locus_tag="ES1_06040"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33722"
FT                   /db_xref="GOA:D4MIY9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIY9"
FT                   /protein_id="CBL33722.1"
FT   CDS             666876..667739
FT                   /transl_table=11
FT                   /locus_tag="ES1_06070"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33723"
FT                   /db_xref="GOA:D4MIZ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIZ0"
FT                   /protein_id="CBL33723.1"
FT                   TSGLKD"
FT   CDS             667783..669366
FT                   /transl_table=11
FT                   /locus_tag="ES1_06080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33724"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIZ1"
FT                   /protein_id="CBL33724.1"
FT                   HIKAKKAGGK"
FT   CDS             669369..670007
FT                   /transl_table=11
FT                   /locus_tag="ES1_06090"
FT                   /product="Yip1 domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33725"
FT                   /db_xref="GOA:D4MIZ2"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIZ2"
FT                   /protein_id="CBL33725.1"
FT   CDS             670026..672383
FT                   /transl_table=11
FT                   /locus_tag="ES1_06100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33726"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIZ3"
FT                   /protein_id="CBL33726.1"
FT   CDS             672376..673641
FT                   /transl_table=11
FT                   /locus_tag="ES1_06110"
FT                   /product="ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33727"
FT                   /db_xref="GOA:D4MIZ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIZ4"
FT                   /protein_id="CBL33727.1"
FT   CDS             675466..675987
FT                   /transl_table=11
FT                   /locus_tag="ES1_06130"
FT                   /product="Isopentenyldiphosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33728"
FT                   /db_xref="GOA:D4MIZ5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIZ5"
FT                   /protein_id="CBL33728.1"
FT                   RTKRGNFSKE"
FT   CDS             675991..676485
FT                   /transl_table=11
FT                   /locus_tag="ES1_06140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33729"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIZ6"
FT                   /protein_id="CBL33729.1"
FT                   E"
FT   CDS             676503..677300
FT                   /transl_table=11
FT                   /locus_tag="ES1_06150"
FT                   /product="Predicted metal-dependent hydrolase of the
FT                   TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33730"
FT                   /db_xref="GOA:D4MIZ7"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIZ7"
FT                   /protein_id="CBL33730.1"
FT   CDS             complement(677347..678720)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06160"
FT                   /product="Arylsulfatase regulator (Fe-S oxidoreductase)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33731"
FT                   /db_xref="GOA:D4MIZ8"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR024025"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIZ8"
FT                   /protein_id="CBL33731.1"
FT   CDS             complement(679023..679169)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33732"
FT                   /db_xref="InterPro:IPR023975"
FT                   /db_xref="UniProtKB/TrEMBL:D4MIZ9"
FT                   /protein_id="CBL33732.1"
FT                   LNK"
FT   CDS             complement(679245..679400)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33733"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ00"
FT                   /protein_id="CBL33733.1"
FT                   DDCGWM"
FT   CDS             complement(679442..680272)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06200"
FT                   /product="conserved hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33734"
FT                   /db_xref="GOA:D4MJ01"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ01"
FT                   /protein_id="CBL33734.1"
FT   CDS             complement(680282..681019)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06210"
FT                   /product="Predicted O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33735"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ02"
FT                   /protein_id="CBL33735.1"
FT   CDS             complement(681021..682340)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06220"
FT                   /product="Trk-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33736"
FT                   /db_xref="GOA:D4MJ03"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ03"
FT                   /protein_id="CBL33736.1"
FT   CDS             complement(684283..685179)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06240"
FT                   /product="Protein of unknown function (DUF2628)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33737"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ04"
FT                   /protein_id="CBL33737.1"
FT                   INNTLGISISVLKELVN"
FT   CDS             685422..686360
FT                   /transl_table=11
FT                   /locus_tag="ES1_06250"
FT                   /product="L-asparaginase/archaeal Glu-tRNAGln
FT                   amidotransferase subunit D"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33738"
FT                   /db_xref="GOA:D4MJ05"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ05"
FT                   /protein_id="CBL33738.1"
FT   CDS             686485..686730
FT                   /transl_table=11
FT                   /locus_tag="ES1_06260"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33739"
FT                   /db_xref="GOA:D4MJ06"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ06"
FT                   /protein_id="CBL33739.1"
FT   CDS             686727..687140
FT                   /transl_table=11
FT                   /locus_tag="ES1_06270"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33740"
FT                   /db_xref="GOA:D4MJ07"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ07"
FT                   /protein_id="CBL33740.1"
FT   CDS             687490..688350
FT                   /transl_table=11
FT                   /locus_tag="ES1_06280"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33741"
FT                   /db_xref="GOA:D4MJ08"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ08"
FT                   /protein_id="CBL33741.1"
FT                   YKKDV"
FT   CDS             688350..689582
FT                   /transl_table=11
FT                   /locus_tag="ES1_06290"
FT                   /product="conserved hypothetical protein TIGR00275"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33742"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ09"
FT                   /protein_id="CBL33742.1"
FT                   SAAAAVAAGRR"
FT   CDS             complement(692032..692685)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06310"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33743"
FT                   /db_xref="GOA:D4MJ10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ10"
FT                   /protein_id="CBL33743.1"
FT   CDS             complement(692682..695435)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06320"
FT                   /product="Predicted permease."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33744"
FT                   /db_xref="GOA:D4MJ11"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ11"
FT                   /protein_id="CBL33744.1"
FT   CDS             complement(695682..695999)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33745"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ12"
FT                   /protein_id="CBL33745.1"
FT                   F"
FT   CDS             696279..698021
FT                   /transl_table=11
FT                   /locus_tag="ES1_06340"
FT                   /product="Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33746"
FT                   /db_xref="GOA:D4MJ13"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ13"
FT                   /protein_id="CBL33746.1"
FT                   SKTN"
FT   CDS             698116..699240
FT                   /transl_table=11
FT                   /locus_tag="ES1_06350"
FT                   /product="monofunctional chorismate mutase, gram
FT                   positive-type, clade 2"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33747"
FT                   /db_xref="GOA:D4MJ14"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR020822"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ14"
FT                   /protein_id="CBL33747.1"
FT   CDS             699256..700416
FT                   /transl_table=11
FT                   /locus_tag="ES1_06360"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase/2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33748"
FT                   /db_xref="GOA:D4MJ15"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR026596"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ15"
FT                   /protein_id="CBL33748.1"
FT   CDS             700580..700720
FT                   /transl_table=11
FT                   /locus_tag="ES1_06370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33749"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ16"
FT                   /protein_id="CBL33749.1"
FT                   K"
FT   CDS             700828..702099
FT                   /transl_table=11
FT                   /locus_tag="ES1_06380"
FT                   /product="sodium/proton-potassium antiporter GerN, CPA2
FT                   family (TC 2.A.37.2.2)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33750"
FT                   /db_xref="GOA:D4MJ17"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ17"
FT                   /protein_id="CBL33750.1"
FT   CDS             703240..704685
FT                   /transl_table=11
FT                   /locus_tag="ES1_06400"
FT                   /product="arginine decarboxylase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33751"
FT                   /db_xref="GOA:D4MJ18"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ18"
FT                   /protein_id="CBL33751.1"
FT   CDS             704745..705614
FT                   /transl_table=11
FT                   /locus_tag="ES1_06410"
FT                   /product="spermidine synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33752"
FT                   /db_xref="GOA:D4MJ19"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ19"
FT                   /protein_id="CBL33752.1"
FT                   GEVLDVRR"
FT   CDS             705601..706596
FT                   /transl_table=11
FT                   /locus_tag="ES1_06420"
FT                   /product="Predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33753"
FT                   /db_xref="GOA:D4MJ20"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ20"
FT                   /protein_id="CBL33753.1"
FT   CDS             706615..707640
FT                   /transl_table=11
FT                   /locus_tag="ES1_06430"
FT                   /product="CAAX amino terminal protease family."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33754"
FT                   /db_xref="GOA:D4MJ21"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ21"
FT                   /protein_id="CBL33754.1"
FT                   N"
FT   CDS             707695..707883
FT                   /transl_table=11
FT                   /locus_tag="ES1_06440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33755"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ22"
FT                   /protein_id="CBL33755.1"
FT                   KVKADKKERGQAVTWLL"
FT   CDS             707967..709202
FT                   /transl_table=11
FT                   /locus_tag="ES1_06450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33756"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ23"
FT                   /protein_id="CBL33756.1"
FT                   AMRRIKVLKQVR"
FT   CDS             709220..710542
FT                   /transl_table=11
FT                   /locus_tag="ES1_06460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33757"
FT                   /db_xref="GOA:D4MJ24"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ24"
FT                   /protein_id="CBL33757.1"
FT   gap             710914..711654
FT                   /estimated_length=741
FT   CDS             712226..714883
FT                   /transl_table=11
FT                   /locus_tag="ES1_06490"
FT                   /product="acetaldehyde dehydrogenase /alcohol dehydrogenase
FT                   AdhE"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33758"
FT                   /db_xref="GOA:D4MJ25"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ25"
FT                   /protein_id="CBL33758.1"
FT                   QMYLNAYYGVDETV"
FT   CDS             715121..715798
FT                   /transl_table=11
FT                   /locus_tag="ES1_06500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33759"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ26"
FT                   /protein_id="CBL33759.1"
FT                   KRM"
FT   CDS             716230..716880
FT                   /transl_table=11
FT                   /locus_tag="ES1_06510"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33760"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ27"
FT                   /protein_id="CBL33760.1"
FT   CDS             717039..717731
FT                   /transl_table=11
FT                   /locus_tag="ES1_06520"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33761"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ28"
FT                   /protein_id="CBL33761.1"
FT                   APALDIGA"
FT   CDS             717782..719062
FT                   /transl_table=11
FT                   /locus_tag="ES1_06530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33762"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ29"
FT                   /protein_id="CBL33762.1"
FT   CDS             719049..719957
FT                   /transl_table=11
FT                   /locus_tag="ES1_06540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33763"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ30"
FT                   /protein_id="CBL33763.1"
FT   gap             723756..724192
FT                   /estimated_length=437
FT   CDS             complement(724481..724915)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33764"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ31"
FT                   /protein_id="CBL33764.1"
FT   CDS             complement(725055..725831)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33765"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ32"
FT                   /protein_id="CBL33765.1"
FT   CDS             726038..726787
FT                   /transl_table=11
FT                   /locus_tag="ES1_06600"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33766"
FT                   /db_xref="GOA:D4MJ33"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ33"
FT                   /protein_id="CBL33766.1"
FT   CDS             726932..728119
FT                   /transl_table=11
FT                   /locus_tag="ES1_06610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33767"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ34"
FT                   /protein_id="CBL33767.1"
FT   gap             728189..728531
FT                   /estimated_length=343
FT   CDS             731566..732498
FT                   /transl_table=11
FT                   /locus_tag="ES1_06630"
FT                   /product="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33768"
FT                   /db_xref="GOA:D4MJ35"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ35"
FT                   /protein_id="CBL33768.1"
FT   CDS             732527..733360
FT                   /transl_table=11
FT                   /locus_tag="ES1_06640"
FT                   /product="Hydroxyethylthiazole kinase, sugar kinase family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33769"
FT                   /db_xref="GOA:D4MJ36"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ36"
FT                   /protein_id="CBL33769.1"
FT   CDS             733365..733757
FT                   /transl_table=11
FT                   /locus_tag="ES1_06650"
FT                   /product="uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33770"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ37"
FT                   /protein_id="CBL33770.1"
FT   CDS             734004..734204
FT                   /transl_table=11
FT                   /locus_tag="ES1_06660"
FT                   /product="TM2 domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33771"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ38"
FT                   /protein_id="CBL33771.1"
FT   CDS             complement(734257..734679)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33772"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ39"
FT                   /protein_id="CBL33772.1"
FT   CDS             complement(734692..735078)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33773"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ40"
FT                   /protein_id="CBL33773.1"
FT   CDS             complement(735094..735705)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06690"
FT                   /product="Biopolymer transport protein ExbD/TolR."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33774"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ41"
FT                   /protein_id="CBL33774.1"
FT   CDS             complement(735702..736166)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06700"
FT                   /product="MotA/TolQ/ExbB proton channel family."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33775"
FT                   /db_xref="GOA:D4MJ42"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ42"
FT                   /protein_id="CBL33775.1"
FT   CDS             complement(736278..736481)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06710"
FT                   /product="Mn-containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33776"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ43"
FT                   /protein_id="CBL33776.1"
FT   CDS             complement(736491..736745)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33777"
FT                   /db_xref="InterPro:IPR024207"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ44"
FT                   /protein_id="CBL33777.1"
FT   CDS             complement(736735..736935)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33778"
FT                   /db_xref="InterPro:IPR020256"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ45"
FT                   /protein_id="CBL33778.1"
FT   CDS             737488..738030
FT                   /transl_table=11
FT                   /locus_tag="ES1_06740"
FT                   /product="thiW protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33779"
FT                   /db_xref="InterPro:IPR012652"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ46"
FT                   /protein_id="CBL33779.1"
FT                   KTGVINMMFRQTSEKKA"
FT   CDS             complement(738263..739759)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06750"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33780"
FT                   /db_xref="GOA:D4MJ47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ47"
FT                   /protein_id="CBL33780.1"
FT   CDS             740242..740688
FT                   /transl_table=11
FT                   /locus_tag="ES1_06760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33781"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ48"
FT                   /protein_id="CBL33781.1"
FT   CDS             740747..741436
FT                   /transl_table=11
FT                   /locus_tag="ES1_06770"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33782"
FT                   /db_xref="GOA:D4MJ49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ49"
FT                   /protein_id="CBL33782.1"
FT                   VSDEIIR"
FT   CDS             741420..742601
FT                   /transl_table=11
FT                   /locus_tag="ES1_06780"
FT                   /product="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33783"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ50"
FT                   /protein_id="CBL33783.1"
FT   CDS             742616..743962
FT                   /transl_table=11
FT                   /locus_tag="ES1_06790"
FT                   /product="Predicted permease."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33784"
FT                   /db_xref="GOA:D4MJ51"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ51"
FT                   /protein_id="CBL33784.1"
FT   CDS             complement(743968..744657)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33785"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ52"
FT                   /protein_id="CBL33785.1"
FT                   LKGTMQA"
FT   CDS             complement(744674..745381)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33786"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ53"
FT                   /protein_id="CBL33786.1"
FT                   VSACRYIKENWQF"
FT   CDS             complement(745384..746310)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06820"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33787"
FT                   /db_xref="GOA:D4MJ54"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ54"
FT                   /protein_id="CBL33787.1"
FT   CDS             complement(746307..746675)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06830"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33788"
FT                   /db_xref="GOA:D4MJ55"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ55"
FT                   /protein_id="CBL33788.1"
FT                   GLSVDEVCEVLKTLGSIE"
FT   CDS             747595..747873
FT                   /transl_table=11
FT                   /locus_tag="ES1_06840"
FT                   /product="Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
FT                   subunit"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33789"
FT                   /db_xref="GOA:D4MJ56"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ56"
FT                   /protein_id="CBL33789.1"
FT   CDS             747901..749349
FT                   /transl_table=11
FT                   /locus_tag="ES1_06850"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33790"
FT                   /db_xref="GOA:D4MJ57"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ57"
FT                   /protein_id="CBL33790.1"
FT   CDS             749367..750797
FT                   /transl_table=11
FT                   /locus_tag="ES1_06860"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33791"
FT                   /db_xref="GOA:D4MJ58"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ58"
FT                   /protein_id="CBL33791.1"
FT                   GAASPASIKAMLEEKLKG"
FT   CDS             750825..752594
FT                   /transl_table=11
FT                   /locus_tag="ES1_06870"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33792"
FT                   /db_xref="GOA:D4MJ59"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ59"
FT                   /protein_id="CBL33792.1"
FT                   REVHIKVRQKPTV"
FT   CDS             complement(752886..753032)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33793"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ60"
FT                   /protein_id="CBL33793.1"
FT                   IAI"
FT   CDS             753392..753592
FT                   /transl_table=11
FT                   /locus_tag="ES1_06890"
FT                   /product="Domain of unknown function (DUF1858)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33794"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR023883"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ61"
FT                   /protein_id="CBL33794.1"
FT   CDS             753592..754251
FT                   /transl_table=11
FT                   /locus_tag="ES1_06900"
FT                   /product="Predicted SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33795"
FT                   /db_xref="GOA:D4MJ62"
FT                   /db_xref="InterPro:IPR006901"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ62"
FT                   /protein_id="CBL33795.1"
FT   CDS             754271..755044
FT                   /transl_table=11
FT                   /locus_tag="ES1_06910"
FT                   /product="conserved hypothetical protein TIGR00486"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33796"
FT                   /db_xref="GOA:D4MJ63"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ63"
FT                   /protein_id="CBL33796.1"
FT   CDS             755067..756830
FT                   /transl_table=11
FT                   /locus_tag="ES1_06920"
FT                   /product="Predicted RNA-binding protein homologous to
FT                   eukaryotic snRNP"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33797"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ64"
FT                   /protein_id="CBL33797.1"
FT                   PDEQLFTRVEA"
FT   CDS             756867..759515
FT                   /transl_table=11
FT                   /locus_tag="ES1_06930"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33798"
FT                   /db_xref="GOA:D4MJ65"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ65"
FT                   /protein_id="CBL33798.1"
FT                   EKIMLSIEKMK"
FT   gap             759589..760373
FT                   /estimated_length=785
FT   CDS             760852..761973
FT                   /transl_table=11
FT                   /locus_tag="ES1_06940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33799"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ66"
FT                   /protein_id="CBL33799.1"
FT   CDS             761986..762483
FT                   /transl_table=11
FT                   /locus_tag="ES1_06950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33800"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ67"
FT                   /protein_id="CBL33800.1"
FT                   DR"
FT   CDS             762848..764356
FT                   /transl_table=11
FT                   /locus_tag="ES1_06960"
FT                   /product="IMP dehydrogenase/GMP reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33801"
FT                   /db_xref="GOA:D4MJ68"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ68"
FT                   /protein_id="CBL33801.1"
FT   gap             764850..765247
FT                   /estimated_length=398
FT   CDS             complement(765356..767002)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06970"
FT                   /product="FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33802"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ69"
FT                   /protein_id="CBL33802.1"
FT   CDS             767415..767852
FT                   /transl_table=11
FT                   /locus_tag="ES1_06980"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33803"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ70"
FT                   /protein_id="CBL33803.1"
FT   CDS             complement(768753..769109)
FT                   /transl_table=11
FT                   /locus_tag="ES1_06990"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_06990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33804"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ71"
FT                   /protein_id="CBL33804.1"
FT                   NVCEYIDMLVKGEL"
FT   CDS             complement(769220..770821)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07000"
FT                   /product="Flagellin and related hook-associated proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33805"
FT                   /db_xref="GOA:D4MJ72"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ72"
FT                   /protein_id="CBL33805.1"
FT                   LAQANQQPQAILQLLQ"
FT   CDS             complement(771166..772368)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07010"
FT                   /product="Uncharacterised protein family (UPF0153)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33806"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ73"
FT                   /protein_id="CBL33806.1"
FT                   K"
FT   CDS             complement(772510..772677)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33807"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ74"
FT                   /protein_id="CBL33807.1"
FT                   VDKMISDILD"
FT   CDS             772978..773079
FT                   /transl_table=11
FT                   /locus_tag="ES1_07030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33808"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ75"
FT                   /protein_id="CBL33808.1"
FT   CDS             complement(773445..774659)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07040"
FT                   /product="Alcohol dehydrogenase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33809"
FT                   /db_xref="GOA:D4MJ76"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ76"
FT                   /protein_id="CBL33809.1"
FT                   TEVDF"
FT   CDS             complement(775100..775678)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07050"
FT                   /product="Response regulator with putative antiterminator
FT                   output domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33810"
FT                   /db_xref="GOA:D4MJ77"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ77"
FT                   /protein_id="CBL33810.1"
FT   CDS             complement(775770..776495)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07060"
FT                   /product="glutamate synthase (NADPH) GltB3 subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33811"
FT                   /db_xref="GOA:D4MJ78"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR012061"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ78"
FT                   /protein_id="CBL33811.1"
FT   CDS             complement(776533..777768)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07070"
FT                   /product="NAD(P)H-nitrite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33812"
FT                   /db_xref="GOA:D4MJ79"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ79"
FT                   /protein_id="CBL33812.1"
FT                   ARREEKLAGKKH"
FT   CDS             complement(777780..778214)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07080"
FT                   /product="Fe-S-cluster-containing hydrogenase components 2"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33813"
FT                   /db_xref="GOA:D4MJ80"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ80"
FT                   /protein_id="CBL33813.1"
FT   CDS             complement(779753..780850)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07100"
FT                   /product="glutamate synthase (NADPH) GltB1 subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33814"
FT                   /db_xref="GOA:D4MJ81"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR012375"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ81"
FT                   /protein_id="CBL33814.1"
FT   CDS             complement(781701..781919)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33815"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ82"
FT                   /protein_id="CBL33815.1"
FT   CDS             782004..782399
FT                   /transl_table=11
FT                   /locus_tag="ES1_07120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33816"
FT                   /db_xref="InterPro:IPR023804"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ83"
FT                   /protein_id="CBL33816.1"
FT   tRNA            783918..783994
FT                   /locus_tag="ES1_T_26700"
FT   CDS             complement(784098..784658)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07140"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33817"
FT                   /db_xref="GOA:D4MJ84"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ84"
FT                   /protein_id="CBL33817.1"
FT   CDS             complement(784680..785162)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07150"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33818"
FT                   /db_xref="GOA:D4MJ85"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ85"
FT                   /protein_id="CBL33818.1"
FT   CDS             complement(785162..786562)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07160"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33819"
FT                   /db_xref="GOA:D4MJ86"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ86"
FT                   /protein_id="CBL33819.1"
FT                   FESYAKRR"
FT   CDS             786789..788729
FT                   /transl_table=11
FT                   /locus_tag="ES1_07170"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33820"
FT                   /db_xref="GOA:D4MJ87"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ87"
FT                   /protein_id="CBL33820.1"
FT                   FTVPCGKEDAK"
FT   CDS             complement(789460..790185)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33821"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ88"
FT                   /protein_id="CBL33821.1"
FT   CDS             complement(790206..790832)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33822"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ89"
FT                   /protein_id="CBL33822.1"
FT   CDS             complement(791268..793673)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07210"
FT                   /product="leucyl-tRNA synthetase, eubacterial and
FT                   mitochondrial family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33823"
FT                   /db_xref="GOA:D4MJ90"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ90"
FT                   /protein_id="CBL33823.1"
FT   gap             794784..795630
FT                   /estimated_length=847
FT   CDS             795677..795850
FT                   /transl_table=11
FT                   /locus_tag="ES1_07230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33824"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ91"
FT                   /protein_id="CBL33824.1"
FT                   DKGGKDIMLFEG"
FT   CDS             796019..796375
FT                   /transl_table=11
FT                   /locus_tag="ES1_07240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33825"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ92"
FT                   /protein_id="CBL33825.1"
FT                   EKLKEALHKCRCMA"
FT   CDS             796404..810425
FT                   /transl_table=11
FT                   /locus_tag="ES1_07250"
FT                   /product="Fibronectin type III domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33826"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ93"
FT                   /protein_id="CBL33826.1"
FT   CDS             complement(810633..811184)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07260"
FT                   /product="Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33827"
FT                   /db_xref="GOA:D4MJ94"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ94"
FT                   /protein_id="CBL33827.1"
FT   CDS             811459..813714
FT                   /transl_table=11
FT                   /locus_tag="ES1_07270"
FT                   /product="Clostripain family."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33828"
FT                   /db_xref="InterPro:IPR005077"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ95"
FT                   /protein_id="CBL33828.1"
FT   CDS             813779..814384
FT                   /transl_table=11
FT                   /locus_tag="ES1_07280"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33829"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ96"
FT                   /protein_id="CBL33829.1"
FT   CDS             814453..814503
FT                   /transl_table=11
FT                   /locus_tag="ES1_07290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33830"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ97"
FT                   /protein_id="CBL33830.1"
FT                   /translation="MNTVEKTEEGCKGENR"
FT   CDS             814500..815483
FT                   /transl_table=11
FT                   /locus_tag="ES1_07300"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33831"
FT                   /db_xref="GOA:D4MJ98"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ98"
FT                   /protein_id="CBL33831.1"
FT   CDS             complement(815966..816166)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33832"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJ99"
FT                   /protein_id="CBL33832.1"
FT   gap             816293..817077
FT                   /estimated_length=785
FT   CDS             817373..818584
FT                   /transl_table=11
FT                   /locus_tag="ES1_07320"
FT                   /product="acetate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33833"
FT                   /db_xref="GOA:D4MJA0"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJA0"
FT                   /protein_id="CBL33833.1"
FT                   DKNA"
FT   CDS             818807..820156
FT                   /transl_table=11
FT                   /locus_tag="ES1_07330"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33834"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJA1"
FT                   /protein_id="CBL33834.1"
FT   CDS             820163..820630
FT                   /transl_table=11
FT                   /locus_tag="ES1_07340"
FT                   /product="Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33835"
FT                   /db_xref="GOA:D4MJA2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJA2"
FT                   /protein_id="CBL33835.1"
FT   CDS             820787..821371
FT                   /transl_table=11
FT                   /locus_tag="ES1_07350"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33836"
FT                   /db_xref="GOA:D4MJA3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJA3"
FT                   /protein_id="CBL33836.1"
FT   CDS             821697..822713
FT                   /transl_table=11
FT                   /locus_tag="ES1_07370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33837"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJA4"
FT                   /protein_id="CBL33837.1"
FT   CDS             822819..823553
FT                   /transl_table=11
FT                   /locus_tag="ES1_07380"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33838"
FT                   /db_xref="GOA:D4MJA5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJA5"
FT                   /protein_id="CBL33838.1"
FT   CDS             823747..825387
FT                   /transl_table=11
FT                   /locus_tag="ES1_07390"
FT                   /product="transporter, NhaC family (TC 2.A.35)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33839"
FT                   /db_xref="GOA:D4MJA6"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJA6"
FT                   /protein_id="CBL33839.1"
FT   CDS             825641..825886
FT                   /transl_table=11
FT                   /locus_tag="ES1_07400"
FT                   /product="TfoX N-terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33840"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJA7"
FT                   /protein_id="CBL33840.1"
FT   CDS             826223..826729
FT                   /transl_table=11
FT                   /locus_tag="ES1_07410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33841"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJA8"
FT                   /protein_id="CBL33841.1"
FT                   IGLAL"
FT   CDS             complement(827139..827879)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07430"
FT                   /product="nicotinamide mononucleotide transporter PnuC"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33842"
FT                   /db_xref="GOA:D4MJA9"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJA9"
FT                   /protein_id="CBL33842.1"
FT   CDS             complement(828920..829861)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07450"
FT                   /product="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33843"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJB0"
FT                   /protein_id="CBL33843.1"
FT   CDS             complement(830026..830907)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07460"
FT                   /product="N-carbamoylputrescine amidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33844"
FT                   /db_xref="GOA:D4MJB1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJB1"
FT                   /protein_id="CBL33844.1"
FT                   RRPELYGKIMEH"
FT   CDS             complement(832052..832627)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07480"
FT                   /product="Pyruvate:ferredoxin oxidoreductase and related
FT                   2-oxoacid:ferredoxin oxidoreductases, gamma subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33845"
FT                   /db_xref="GOA:D4MJB2"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJB2"
FT                   /protein_id="CBL33845.1"
FT   CDS             complement(832648..834369)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07490"
FT                   /product="indolepyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33846"
FT                   /db_xref="GOA:D4MJB3"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJB3"
FT                   /protein_id="CBL33846.1"
FT   CDS             834536..838063
FT                   /transl_table=11
FT                   /locus_tag="ES1_07500"
FT                   /product="ATP-dependent nuclease, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33847"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJB4"
FT                   /protein_id="CBL33847.1"
FT                   KAKKGKGDK"
FT   CDS             838063..841770
FT                   /transl_table=11
FT                   /locus_tag="ES1_07510"
FT                   /product="ATP-dependent exoDNAse (exonuclease V) beta
FT                   subunit (contains helicase and exonuclease domains)"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33848"
FT                   /db_xref="GOA:D4MJB5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJB5"
FT                   /protein_id="CBL33848.1"
FT                   IDLEKPEENK"
FT   CDS             841770..842408
FT                   /transl_table=11
FT                   /locus_tag="ES1_07520"
FT                   /product="Abi-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33849"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJB6"
FT                   /protein_id="CBL33849.1"
FT   CDS             842482..842619
FT                   /transl_table=11
FT                   /locus_tag="ES1_07530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33850"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJB7"
FT                   /protein_id="CBL33850.1"
FT                   "
FT   gap             842746..843760
FT                   /estimated_length=1015
FT   CDS             complement(843768..844637)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07540"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33851"
FT                   /db_xref="GOA:D4MJB8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJB8"
FT                   /protein_id="CBL33851.1"
FT                   AYLKTLDI"
FT   CDS             845688..846563
FT                   /transl_table=11
FT                   /locus_tag="ES1_07570"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33852"
FT                   /db_xref="GOA:D4MJB9"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJB9"
FT                   /protein_id="CBL33852.1"
FT                   DKERGGNREP"
FT   CDS             847209..847670
FT                   /transl_table=11
FT                   /locus_tag="ES1_07590"
FT                   /product="Predicted flavin-nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33853"
FT                   /db_xref="GOA:D4MJC0"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJC0"
FT                   /protein_id="CBL33853.1"
FT   CDS             847667..848128
FT                   /transl_table=11
FT                   /locus_tag="ES1_07600"
FT                   /product="O-6-methylguanine DNA methyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33854"
FT                   /db_xref="GOA:D4MJC1"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJC1"
FT                   /protein_id="CBL33854.1"
FT   CDS             848125..848817
FT                   /transl_table=11
FT                   /locus_tag="ES1_07610"
FT                   /product="DNA alkylation repair enzyme."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33855"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJC2"
FT                   /protein_id="CBL33855.1"
FT                   TDTVNLQR"
FT   CDS             848969..849697
FT                   /transl_table=11
FT                   /locus_tag="ES1_07620"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33856"
FT                   /db_xref="GOA:D4MJC3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJC3"
FT                   /protein_id="CBL33856.1"
FT   CDS             849694..851025
FT                   /transl_table=11
FT                   /locus_tag="ES1_07630"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33857"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJC4"
FT                   /protein_id="CBL33857.1"
FT   CDS             complement(851083..852579)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07640"
FT                   /product="Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33858"
FT                   /db_xref="GOA:D4MJC5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJC5"
FT                   /protein_id="CBL33858.1"
FT   CDS             852810..853166
FT                   /transl_table=11
FT                   /locus_tag="ES1_07650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33859"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJC6"
FT                   /protein_id="CBL33859.1"
FT                   ELYSRILLKFGQRV"
FT   gap             853266..853643
FT                   /estimated_length=378
FT   CDS             complement(853889..854995)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07660"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33860"
FT                   /db_xref="GOA:D4MJC7"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJC7"
FT                   /protein_id="CBL33860.1"
FT   CDS             complement(857016..857687)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07680"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33861"
FT                   /db_xref="GOA:D4MJC8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJC8"
FT                   /protein_id="CBL33861.1"
FT                   K"
FT   CDS             complement(857687..858361)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07690"
FT                   /product="cytidylate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33862"
FT                   /db_xref="GOA:D4MJC9"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJC9"
FT                   /protein_id="CBL33862.1"
FT                   IR"
FT   CDS             complement(858519..859496)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07700"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33863"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJD0"
FT                   /protein_id="CBL33863.1"
FT   CDS             861344..862051
FT                   /transl_table=11
FT                   /locus_tag="ES1_07720"
FT                   /product="purine-nucleoside phosphorylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33864"
FT                   /db_xref="GOA:D4MJD1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJD1"
FT                   /protein_id="CBL33864.1"
FT                   KTLTDMITIALDA"
FT   CDS             863591..865243
FT                   /transl_table=11
FT                   /locus_tag="ES1_07740"
FT                   /product="Competence protein A."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33865"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJD2"
FT                   /protein_id="CBL33865.1"
FT   CDS             865265..866071
FT                   /transl_table=11
FT                   /locus_tag="ES1_07750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33866"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJD3"
FT                   /protein_id="CBL33866.1"
FT   CDS             866111..868513
FT                   /transl_table=11
FT                   /locus_tag="ES1_07760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33867"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJD4"
FT                   /protein_id="CBL33867.1"
FT   CDS             868513..869409
FT                   /transl_table=11
FT                   /locus_tag="ES1_07770"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33868"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJD5"
FT                   /protein_id="CBL33868.1"
FT                   GIYNHIYGTPVKEDDAG"
FT   CDS             869406..870113
FT                   /transl_table=11
FT                   /locus_tag="ES1_07780"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33869"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJD6"
FT                   /protein_id="CBL33869.1"
FT                   MNIVILYRIKIFG"
FT   CDS             complement(870164..871222)
FT                   /transl_table=11
FT                   /locus_tag="ES1_07790"
FT                   /product="Type II secretory pathway, prepilin signal
FT                   peptidase PulO and related peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33870"
FT                   /db_xref="GOA:D4MJD7"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJD7"
FT                   /protein_id="CBL33870.1"
FT                   GETIIKAYLSML"
FT   CDS             871334..873025
FT                   /transl_table=11
FT                   /locus_tag="ES1_07800"
FT                   /product="Type II secretory pathway, ATPase PulE/Tfp pilus
FT                   assembly pathway, ATPase PilB"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33871"
FT                   /db_xref="GOA:D4MJD8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJD8"
FT                   /protein_id="CBL33871.1"
FT   CDS             874218..874673
FT                   /transl_table=11
FT                   /locus_tag="ES1_07820"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33872"
FT                   /db_xref="GOA:D4MJD9"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJD9"
FT                   /protein_id="CBL33872.1"
FT   CDS             874898..875662
FT                   /transl_table=11
FT                   /locus_tag="ES1_07830"
FT                   /product="Phosphotransferase enzyme family."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33873"
FT                   /db_xref="GOA:D4MJE0"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJE0"
FT                   /protein_id="CBL33873.1"
FT   CDS             875935..878313
FT                   /transl_table=11
FT                   /locus_tag="ES1_07850"
FT                   /product="Membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /EC_number="2.4.1.-"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33874"
FT                   /db_xref="GOA:D4MJE1"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJE1"
FT                   /protein_id="CBL33874.1"
FT   CDS             878376..879506
FT                   /transl_table=11
FT                   /locus_tag="ES1_07860"
FT                   /product="Predicted N6-adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33875"
FT                   /db_xref="GOA:D4MJE2"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJE2"
FT                   /protein_id="CBL33875.1"
FT   CDS             879888..880286
FT                   /transl_table=11
FT                   /locus_tag="ES1_07870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33876"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJE3"
FT                   /protein_id="CBL33876.1"
FT   CDS             881790..883148
FT                   /transl_table=11
FT                   /locus_tag="ES1_07890"
FT                   /product="PAS domain S-box/diguanylate cyclase (GGDEF)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33877"
FT                   /db_xref="GOA:D4MJE4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJE4"
FT                   /protein_id="CBL33877.1"
FT   CDS             883854..884966
FT                   /transl_table=11
FT                   /locus_tag="ES1_07910"
FT                   /product="transcription termination factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33878"
FT                   /db_xref="GOA:D4MJE5"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJE5"
FT                   /protein_id="CBL33878.1"
FT   CDS             885015..885269
FT                   /transl_table=11
FT                   /locus_tag="ES1_07920"
FT                   /product="Predicted nucleic-acid-binding protein implicated
FT                   in transcription termination"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33879"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJE6"
FT                   /protein_id="CBL33879.1"
FT   CDS             885275..885580
FT                   /transl_table=11
FT                   /locus_tag="ES1_07930"
FT                   /product="Ribosomal protein L7Ae/L30e/S12e/Gadd45 family."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33880"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJE7"
FT                   /protein_id="CBL33880.1"
FT   gap             886153..886490
FT                   /estimated_length=338
FT   CDS             888665..889045
FT                   /transl_table=11
FT                   /locus_tag="ES1_07960"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33881"
FT                   /db_xref="GOA:D4MJE8"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJE8"
FT                   /protein_id="CBL33881.1"
FT   CDS             889052..890014
FT                   /transl_table=11
FT                   /locus_tag="ES1_07970"
FT                   /product="Exopolyphosphatase-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33882"
FT                   /db_xref="GOA:D4MJE9"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJE9"
FT                   /protein_id="CBL33882.1"
FT   CDS             890007..890906
FT                   /transl_table=11
FT                   /locus_tag="ES1_07980"
FT                   /product="tRNA pseudouridine 55 synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_07980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33883"
FT                   /db_xref="GOA:D4MJF0"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJF0"
FT                   /protein_id="CBL33883.1"
FT                   ARVNEENGLKSVYLNILS"
FT   CDS             891951..892934
FT                   /transl_table=11
FT                   /locus_tag="ES1_08000"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33884"
FT                   /db_xref="GOA:D4MJF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJF1"
FT                   /protein_id="CBL33884.1"
FT   CDS             892954..893658
FT                   /transl_table=11
FT                   /locus_tag="ES1_08010"
FT                   /product="ABC-2 type transporter."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33885"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJF2"
FT                   /protein_id="CBL33885.1"
FT                   LTVRVLEKRRWA"
FT   CDS             893695..895302
FT                   /transl_table=11
FT                   /locus_tag="ES1_08020"
FT                   /product="ABC-type uncharacterized transport system."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33886"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJF3"
FT                   /protein_id="CBL33886.1"
FT                   PLLLIISGIVIWVKRLHK"
FT   CDS             895317..896795
FT                   /transl_table=11
FT                   /locus_tag="ES1_08030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33887"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJF4"
FT                   /protein_id="CBL33887.1"
FT   CDS             896904..897182
FT                   /transl_table=11
FT                   /locus_tag="ES1_08040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33888"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJF5"
FT                   /protein_id="CBL33888.1"
FT   CDS             complement(897314..897829)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08050"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33889"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJF6"
FT                   /protein_id="CBL33889.1"
FT                   IGKITLLK"
FT   CDS             898127..899311
FT                   /transl_table=11
FT                   /locus_tag="ES1_08060"
FT                   /product="Transcriptional regulators containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33890"
FT                   /db_xref="GOA:D4MJF7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJF7"
FT                   /protein_id="CBL33890.1"
FT   CDS             899628..901895
FT                   /transl_table=11
FT                   /locus_tag="ES1_08070"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33891"
FT                   /db_xref="GOA:D4MJF8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJF8"
FT                   /protein_id="CBL33891.1"
FT                   LD"
FT   CDS             901895..902446
FT                   /transl_table=11
FT                   /locus_tag="ES1_08080"
FT                   /product="Domain of unknown function (DUF1854)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33892"
FT                   /db_xref="InterPro:IPR015005"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJF9"
FT                   /protein_id="CBL33892.1"
FT   CDS             902486..904678
FT                   /transl_table=11
FT                   /locus_tag="ES1_08090"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33893"
FT                   /db_xref="GOA:D4MJG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJG0"
FT                   /protein_id="CBL33893.1"
FT   gap             904917..905281
FT                   /estimated_length=365
FT   CDS             905556..906875
FT                   /transl_table=11
FT                   /locus_tag="ES1_08100"
FT                   /product="aspartate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33894"
FT                   /db_xref="GOA:D4MJG1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJG1"
FT                   /protein_id="CBL33894.1"
FT   CDS             907130..908344
FT                   /transl_table=11
FT                   /locus_tag="ES1_08110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33895"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJG2"
FT                   /protein_id="CBL33895.1"
FT                   LLSKI"
FT   CDS             908403..909230
FT                   /transl_table=11
FT                   /locus_tag="ES1_08120"
FT                   /product="thymidylate synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33896"
FT                   /db_xref="GOA:D4MJG3"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJG3"
FT                   /protein_id="CBL33896.1"
FT   CDS             910300..911826
FT                   /transl_table=11
FT                   /locus_tag="ES1_08140"
FT                   /product="Domain of unknown function (DUF303)."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33897"
FT                   /db_xref="GOA:D4MJG4"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJG4"
FT                   /protein_id="CBL33897.1"
FT   CDS             911851..913359
FT                   /transl_table=11
FT                   /locus_tag="ES1_08150"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33898"
FT                   /db_xref="GOA:D4MJG5"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJG5"
FT                   /protein_id="CBL33898.1"
FT   CDS             913362..913991
FT                   /transl_table=11
FT                   /locus_tag="ES1_08160"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33899"
FT                   /db_xref="GOA:D4MJG6"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJG6"
FT                   /protein_id="CBL33899.1"
FT   CDS             914006..917533
FT                   /transl_table=11
FT                   /locus_tag="ES1_08170"
FT                   /product="transcription-repair coupling factor"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33900"
FT                   /db_xref="GOA:D4MJG7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJG7"
FT                   /protein_id="CBL33900.1"
FT                   VTEEGENNG"
FT   CDS             917526..918020
FT                   /transl_table=11
FT                   /locus_tag="ES1_08180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33901"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJG8"
FT                   /protein_id="CBL33901.1"
FT                   G"
FT   CDS             918050..918544
FT                   /transl_table=11
FT                   /locus_tag="ES1_08190"
FT                   /product="shikimate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33902"
FT                   /db_xref="GOA:D4MJG9"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJG9"
FT                   /protein_id="CBL33902.1"
FT                   K"
FT   CDS             918576..919682
FT                   /transl_table=11
FT                   /locus_tag="ES1_08200"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33903"
FT                   /db_xref="GOA:D4MJH0"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJH0"
FT                   /protein_id="CBL33903.1"
FT   CDS             complement(919832..922462)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08210"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33904"
FT                   /db_xref="GOA:D4MJH1"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJH1"
FT                   /protein_id="CBL33904.1"
FT                   IADKK"
FT   CDS             complement(922484..922552)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33905"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJH2"
FT                   /protein_id="CBL33905.1"
FT                   /translation="MAEKSVILQVSAEKENSDKRPE"
FT   gap             922830..923104
FT                   /estimated_length=275
FT   CDS             complement(923210..926146)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33906"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJH3"
FT                   /protein_id="CBL33906.1"
FT   CDS             complement(926188..926952)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08250"
FT                   /product="rRNA methylase, putative, group 3"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33907"
FT                   /db_xref="GOA:D4MJH4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJH4"
FT                   /protein_id="CBL33907.1"
FT   CDS             927156..927344
FT                   /transl_table=11
FT                   /locus_tag="ES1_08260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33908"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJH5"
FT                   /protein_id="CBL33908.1"
FT                   GVCDNIYEKPVQDADDL"
FT   CDS             927376..928365
FT                   /transl_table=11
FT                   /locus_tag="ES1_08270"
FT                   /product="Uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33909"
FT                   /db_xref="GOA:D4MJH6"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJH6"
FT                   /protein_id="CBL33909.1"
FT   CDS             928520..929440
FT                   /transl_table=11
FT                   /locus_tag="ES1_08280"
FT                   /product="Chemotaxis signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33910"
FT                   /db_xref="GOA:D4MJH7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJH7"
FT                   /protein_id="CBL33910.1"
FT   CDS             930508..931128
FT                   /transl_table=11
FT                   /locus_tag="ES1_08300"
FT                   /product="K+ transport systems, NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33911"
FT                   /db_xref="GOA:D4MJH8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJH8"
FT                   /protein_id="CBL33911.1"
FT   CDS             931155..931820
FT                   /transl_table=11
FT                   /locus_tag="ES1_08310"
FT                   /product="K+ transport systems, NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33912"
FT                   /db_xref="GOA:D4MJH9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJH9"
FT                   /protein_id="CBL33912.1"
FT   CDS             932031..934430
FT                   /transl_table=11
FT                   /locus_tag="ES1_08320"
FT                   /product="glycogen/starch/alpha-glucan phosphorylases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33913"
FT                   /db_xref="GOA:D4MJI0"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJI0"
FT                   /protein_id="CBL33913.1"
FT   CDS             934544..936424
FT                   /transl_table=11
FT                   /locus_tag="ES1_08330"
FT                   /product="Glycosidases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33914"
FT                   /db_xref="GOA:D4MJI1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJI1"
FT                   /protein_id="CBL33914.1"
FT   CDS             complement(937770..939008)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08350"
FT                   /product="Nucleotidyltransferase/DNA polymerase involved in
FT                   DNA repair"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33915"
FT                   /db_xref="GOA:D4MJI2"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJI2"
FT                   /protein_id="CBL33915.1"
FT                   KAVVSLPGNMLNK"
FT   CDS             939140..939529
FT                   /transl_table=11
FT                   /locus_tag="ES1_08360"
FT                   /product="Putative translation initiation inhibitor, yjgF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33916"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJI3"
FT                   /protein_id="CBL33916.1"
FT   CDS             939541..939936
FT                   /transl_table=11
FT                   /locus_tag="ES1_08370"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33917"
FT                   /db_xref="GOA:D4MJI4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJI4"
FT                   /protein_id="CBL33917.1"
FT   CDS             939946..940467
FT                   /transl_table=11
FT                   /locus_tag="ES1_08380"
FT                   /product="Predicted Zn peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33918"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJI5"
FT                   /protein_id="CBL33918.1"
FT                   LHNNKFLAGD"
FT   CDS             942326..943834
FT                   /transl_table=11
FT                   /locus_tag="ES1_08400"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33919"
FT                   /db_xref="InterPro:IPR019219"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJI6"
FT                   /protein_id="CBL33919.1"
FT   CDS             943993..946482
FT                   /transl_table=11
FT                   /locus_tag="ES1_08410"
FT                   /product="DNA polymerase I"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33920"
FT                   /db_xref="GOA:D4MJI7"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJI7"
FT                   /protein_id="CBL33920.1"
FT                   VPMTVDVNIGKTWYDTH"
FT   CDS             946469..946957
FT                   /transl_table=11
FT                   /locus_tag="ES1_08420"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33921"
FT                   /db_xref="GOA:D4MJI8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJI8"
FT                   /protein_id="CBL33921.1"
FT   CDS             complement(948448..950049)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08430"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33922"
FT                   /db_xref="GOA:D4MJI9"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJI9"
FT                   /protein_id="CBL33922.1"
FT                   KMLGLTAPDCWQESMI"
FT   CDS             complement(950087..950860)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08440"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33923"
FT                   /db_xref="GOA:D4MJJ0"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJJ0"
FT                   /protein_id="CBL33923.1"
FT   CDS             complement(951125..952345)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08450"
FT                   /product="3-phosphoglycerate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33924"
FT                   /db_xref="GOA:D4MJJ1"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJJ1"
FT                   /protein_id="CBL33924.1"
FT                   IACIQDK"
FT   CDS             952344..952544
FT                   /transl_table=11
FT                   /locus_tag="ES1_08460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33925"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJJ2"
FT                   /protein_id="CBL33925.1"
FT   CDS             complement(952524..953147)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08470"
FT                   /product="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33926"
FT                   /db_xref="GOA:D4MJJ3"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJJ3"
FT                   /protein_id="CBL33926.1"
FT   gap             953550..953913
FT                   /estimated_length=364
FT   CDS             complement(953962..954288)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33927"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJJ4"
FT                   /protein_id="CBL33927.1"
FT                   HAEQ"
FT   CDS             complement(954777..955229)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33928"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJJ5"
FT                   /protein_id="CBL33928.1"
FT   CDS             complement(955282..955542)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33929"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJJ6"
FT                   /protein_id="CBL33929.1"
FT   gap             955592..956062
FT                   /estimated_length=471
FT   CDS             complement(956111..957496)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08520"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33930"
FT                   /db_xref="GOA:D4MJJ7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJJ7"
FT                   /protein_id="CBL33930.1"
FT                   AEQ"
FT   CDS             complement(959196..959342)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33931"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJJ8"
FT                   /protein_id="CBL33931.1"
FT                   NAD"
FT   CDS             complement(959353..960591)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08550"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33932"
FT                   /db_xref="GOA:D4MJJ9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJJ9"
FT                   /protein_id="CBL33932.1"
FT                   GFKHPYTAPYFRC"
FT   CDS             complement(961202..961405)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33933"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJK0"
FT                   /protein_id="CBL33933.1"
FT   gap             961465..961744
FT                   /estimated_length=280
FT   CDS             complement(961890..962252)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33934"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJK1"
FT                   /protein_id="CBL33934.1"
FT                   QFASRINGYYGLFTRV"
FT   CDS             963994..964569
FT                   /transl_table=11
FT                   /locus_tag="ES1_08600"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33935"
FT                   /db_xref="GOA:D4MJK2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJK2"
FT                   /protein_id="CBL33935.1"
FT   CDS             964642..965808
FT                   /transl_table=11
FT                   /locus_tag="ES1_08610"
FT                   /product="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33936"
FT                   /db_xref="GOA:D4MJK3"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJK3"
FT                   /protein_id="CBL33936.1"
FT   CDS             965944..967476
FT                   /transl_table=11
FT                   /locus_tag="ES1_08620"
FT                   /product="nucleoside ABC transporter ATP-binding protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33937"
FT                   /db_xref="GOA:D4MJK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJK4"
FT                   /protein_id="CBL33937.1"
FT   CDS             967473..968540
FT                   /transl_table=11
FT                   /locus_tag="ES1_08630"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33938"
FT                   /db_xref="GOA:D4MJK5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJK5"
FT                   /protein_id="CBL33938.1"
FT                   YKISLRKHTAVKEAE"
FT   CDS             968540..969484
FT                   /transl_table=11
FT                   /locus_tag="ES1_08640"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33939"
FT                   /db_xref="GOA:D4MJK6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJK6"
FT                   /protein_id="CBL33939.1"
FT   CDS             969617..970105
FT                   /transl_table=11
FT                   /locus_tag="ES1_08650"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33940"
FT                   /db_xref="GOA:D4MJK7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJK7"
FT                   /protein_id="CBL33940.1"
FT   CDS             970107..972578
FT                   /transl_table=11
FT                   /locus_tag="ES1_08660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33941"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJK8"
FT                   /protein_id="CBL33941.1"
FT                   YIGTCKYGLIK"
FT   CDS             973005..973514
FT                   /transl_table=11
FT                   /locus_tag="ES1_08670"
FT                   /product="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33942"
FT                   /db_xref="GOA:D4MJK9"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJK9"
FT                   /protein_id="CBL33942.1"
FT                   QSESAE"
FT   CDS             973593..973967
FT                   /transl_table=11
FT                   /locus_tag="ES1_08680"
FT                   /product="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33943"
FT                   /db_xref="GOA:D4MJL0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJL0"
FT                   /protein_id="CBL33943.1"
FT   gap             974305..974665
FT                   /estimated_length=361
FT   CDS             complement(974848..975624)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08690"
FT                   /product="Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33944"
FT                   /db_xref="GOA:D4MJL1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJL1"
FT                   /protein_id="CBL33944.1"
FT   CDS             complement(975642..975812)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33945"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJL2"
FT                   /protein_id="CBL33945.1"
FT                   NDDEYELARKQ"
FT   CDS             complement(975809..976654)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08710"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   [carboxylating]"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33946"
FT                   /db_xref="GOA:D4MJL3"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJL3"
FT                   /protein_id="CBL33946.1"
FT                   "
FT   CDS             complement(976654..978135)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08720"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33947"
FT                   /db_xref="GOA:D4MJL4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJL4"
FT                   /protein_id="CBL33947.1"
FT   CDS             978212..979471
FT                   /transl_table=11
FT                   /locus_tag="ES1_08730"
FT                   /product="GTP-binding protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33948"
FT                   /db_xref="GOA:D4MJL5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJL5"
FT                   /protein_id="CBL33948.1"
FT   CDS             complement(979520..980770)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08740"
FT                   /product="Galactokinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33949"
FT                   /db_xref="GOA:D4MJL6"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJL6"
FT                   /protein_id="CBL33949.1"
FT                   SCHVLSIRPVGGTEVQL"
FT   CDS             complement(980825..981979)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08750"
FT                   /product="Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33950"
FT                   /db_xref="GOA:D4MJL7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJL7"
FT                   /protein_id="CBL33950.1"
FT   CDS             982004..982174
FT                   /transl_table=11
FT                   /locus_tag="ES1_08760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33951"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJL8"
FT                   /protein_id="CBL33951.1"
FT                   NYQQFFDFFNK"
FT   CDS             complement(986144..986407)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08790"
FT                   /product="Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33952"
FT                   /db_xref="GOA:D4MJL9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJL9"
FT                   /protein_id="CBL33952.1"
FT   CDS             complement(986767..987945)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08800"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33953"
FT                   /db_xref="GOA:D4MJM0"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJM0"
FT                   /protein_id="CBL33953.1"
FT   CDS             complement(988045..989007)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08810"
FT                   /product="radical SAM protein, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33954"
FT                   /db_xref="GOA:D4MJM1"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJM1"
FT                   /protein_id="CBL33954.1"
FT   CDS             989089..989199
FT                   /transl_table=11
FT                   /locus_tag="ES1_08820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33955"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJM2"
FT                   /protein_id="CBL33955.1"
FT   CDS             989221..989850
FT                   /transl_table=11
FT                   /locus_tag="ES1_08830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33956"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJM3"
FT                   /protein_id="CBL33956.1"
FT   CDS             complement(989987..991360)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08840"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33957"
FT                   /db_xref="GOA:D4MJM4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJM4"
FT                   /protein_id="CBL33957.1"
FT   CDS             complement(991580..993109)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08850"
FT                   /product="Mg chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33958"
FT                   /db_xref="GOA:D4MJM5"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJM5"
FT                   /protein_id="CBL33958.1"
FT   CDS             993365..995083
FT                   /transl_table=11
FT                   /locus_tag="ES1_08860"
FT                   /product="Phosphomannomutase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33959"
FT                   /db_xref="GOA:D4MJM6"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJM6"
FT                   /protein_id="CBL33959.1"
FT   CDS             995243..995446
FT                   /transl_table=11
FT                   /locus_tag="ES1_08870"
FT                   /product="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33960"
FT                   /db_xref="GOA:D4MJM7"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJM7"
FT                   /protein_id="CBL33960.1"
FT   CDS             complement(995618..995812)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33961"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJM8"
FT                   /protein_id="CBL33961.1"
FT   CDS             complement(996033..998432)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08890"
FT                   /product="CotH protein."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33962"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="InterPro:IPR026876"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJM9"
FT                   /protein_id="CBL33962.1"
FT   CDS             998644..999567
FT                   /transl_table=11
FT                   /locus_tag="ES1_08900"
FT                   /product="Ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33963"
FT                   /db_xref="GOA:D4MJN0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJN0"
FT                   /protein_id="CBL33963.1"
FT   CDS             complement(1000992..1001123)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33964"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJN1"
FT                   /protein_id="CBL33964.1"
FT   CDS             complement(1001220..1002086)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08930"
FT                   /product="Uncharacterized homolog of PSP1"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33965"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJN2"
FT                   /protein_id="CBL33965.1"
FT                   ALKGLED"
FT   CDS             complement(1002108..1003064)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08940"
FT                   /product="hypothetical protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33966"
FT                   /db_xref="GOA:D4MJN3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJN3"
FT                   /protein_id="CBL33966.1"
FT   CDS             complement(1003064..1003387)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08950"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33967"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJN4"
FT                   /protein_id="CBL33967.1"
FT                   EKV"
FT   CDS             complement(1003490..1003594)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33968"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJN5"
FT                   /protein_id="CBL33968.1"
FT   CDS             complement(1003694..1005034)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08970"
FT                   /product="Arginine/lysine/ornithine decarboxylases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33969"
FT                   /db_xref="GOA:D4MJN6"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJN6"
FT                   /protein_id="CBL33969.1"
FT   CDS             complement(1005034..1005474)
FT                   /transl_table=11
FT                   /locus_tag="ES1_08980"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33970"
FT                   /db_xref="GOA:D4MJN7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJN7"
FT                   /protein_id="CBL33970.1"
FT   CDS             1005749..1007935
FT                   /transl_table=11
FT                   /locus_tag="ES1_08990"
FT                   /product="Actin-like ATPase involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_08990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33971"
FT                   /db_xref="GOA:D4MJN8"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJN8"
FT                   /protein_id="CBL33971.1"
FT   CDS             1007979..1009556
FT                   /transl_table=11
FT                   /locus_tag="ES1_09000"
FT                   /product="Beta-mannanase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33972"
FT                   /db_xref="GOA:D4MJN9"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJN9"
FT                   /protein_id="CBL33972.1"
FT                   DEIGKQKE"
FT   CDS             complement(1011004..1011888)
FT                   /transl_table=11
FT                   /locus_tag="ES1_09020"
FT                   /product="Uncharacterized Fe-S protein PflX, homolog of
FT                   pyruvate formate lyase activating proteins"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33973"
FT                   /db_xref="GOA:D4MJP0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJP0"
FT                   /protein_id="CBL33973.1"
FT                   TFEYTPEWDFEGI"
FT   gap             1011997..1012326
FT                   /estimated_length=330
FT   CDS             complement(1012611..1014029)
FT                   /transl_table=11
FT                   /locus_tag="ES1_09030"
FT                   /product="PPIC-type PPIASE domain."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33974"
FT                   /db_xref="GOA:D4MJP1"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJP1"
FT                   /protein_id="CBL33974.1"
FT                   ETSSAASSGTTTSE"
FT   CDS             1014171..1015439
FT                   /transl_table=11
FT                   /locus_tag="ES1_09040"
FT                   /product="Uncharacterized ABC-type transport system,
FT                   periplasmic component/surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33975"
FT                   /db_xref="GOA:D4MJP2"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJP2"
FT                   /protein_id="CBL33975.1"
FT   CDS             complement(1016027..1016395)
FT                   /transl_table=11
FT                   /locus_tag="ES1_09060"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33976"
FT                   /db_xref="GOA:D4MJP3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJP3"
FT                   /protein_id="CBL33976.1"
FT                   LAMLQLELRRSKEKDGKK"
FT   CDS             1016876..1017400
FT                   /transl_table=11
FT                   /locus_tag="ES1_09070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33977"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJP4"
FT                   /protein_id="CBL33977.1"
FT                   PEARTENEGEF"
FT   CDS             1017996..1019459
FT                   /transl_table=11
FT                   /locus_tag="ES1_09080"
FT                   /product="Terminase-like family."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33978"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJP5"
FT                   /protein_id="CBL33978.1"
FT   CDS             1019476..1021080
FT                   /transl_table=11
FT                   /locus_tag="ES1_09090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33979"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJP6"
FT                   /protein_id="CBL33979.1"
FT                   EIERVIRDNAGMNEVKI"
FT   CDS             1021077..1021409
FT                   /transl_table=11
FT                   /locus_tag="ES1_09100"
FT                   /product="Protein of unknown function (DUF464)."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33980"
FT                   /db_xref="InterPro:IPR007422"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJP7"
FT                   /protein_id="CBL33980.1"
FT                   CYRSER"
FT   CDS             1021412..1022080
FT                   /transl_table=11
FT                   /locus_tag="ES1_09110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33981"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJP8"
FT                   /protein_id="CBL33981.1"
FT                   "
FT   CDS             1022258..1023385
FT                   /transl_table=11
FT                   /locus_tag="ES1_09120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33982"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJP9"
FT                   /protein_id="CBL33982.1"
FT   CDS             1023733..1024104
FT                   /transl_table=11
FT                   /locus_tag="ES1_09140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33983"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJQ0"
FT                   /protein_id="CBL33983.1"
FT   CDS             1027571..1027786
FT                   /transl_table=11
FT                   /locus_tag="ES1_09170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33984"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJQ1"
FT                   /protein_id="CBL33984.1"
FT   CDS             1027783..1028775
FT                   /transl_table=11
FT                   /locus_tag="ES1_09180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33985"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJQ2"
FT                   /protein_id="CBL33985.1"
FT   CDS             1028803..1029231
FT                   /transl_table=11
FT                   /locus_tag="ES1_09190"
FT                   /product="toxin secretion/phage lysis holin"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33986"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJQ3"
FT                   /protein_id="CBL33986.1"
FT   CDS             complement(1030355..1031479)
FT                   /transl_table=11
FT                   /locus_tag="ES1_09210"
FT                   /product="Uncharacterized protein with SCP/PR1 domains"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33987"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJQ4"
FT                   /protein_id="CBL33987.1"
FT   CDS             1031773..1031979
FT                   /transl_table=11
FT                   /locus_tag="ES1_09220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33988"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJQ5"
FT                   /protein_id="CBL33988.1"
FT   CDS             1031982..1033868
FT                   /transl_table=11
FT                   /locus_tag="ES1_09230"
FT                   /product="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33989"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJQ6"
FT                   /protein_id="CBL33989.1"
FT   CDS             1034361..1035113
FT                   /transl_table=11
FT                   /locus_tag="ES1_09240"
FT                   /product="Integral membrane protein DUF95."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33990"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJQ7"
FT                   /protein_id="CBL33990.1"
FT   CDS             1035192..1035770
FT                   /transl_table=11
FT                   /locus_tag="ES1_09250"
FT                   /product="Propanediol utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33991"
FT                   /db_xref="GOA:D4MJQ8"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJQ8"
FT                   /protein_id="CBL33991.1"
FT   CDS             1035923..1039642
FT                   /transl_table=11
FT                   /locus_tag="ES1_09270"
FT                   /product="Cysteine protease"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33992"
FT                   /db_xref="GOA:D4MJQ9"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJQ9"
FT                   /protein_id="CBL33992.1"
FT                   AVMISTVTARKRKK"
FT   CDS             1039763..1040524
FT                   /transl_table=11
FT                   /locus_tag="ES1_09280"
FT                   /product="Predicted divalent heavy-metal cations
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33993"
FT                   /db_xref="GOA:D4MJR0"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJR0"
FT                   /protein_id="CBL33993.1"
FT   CDS             complement(1040568..1042577)
FT                   /transl_table=11
FT                   /locus_tag="ES1_09290"
FT                   /product="Predicted permease."
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33994"
FT                   /db_xref="GOA:D4MJR1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJR1"
FT                   /protein_id="CBL33994.1"
FT   CDS             complement(1042574..1043338)
FT                   /transl_table=11
FT                   /locus_tag="ES1_09300"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33995"
FT                   /db_xref="GOA:D4MJR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJR2"
FT                   /protein_id="CBL33995.1"
FT   CDS             complement(1043447..1044445)
FT                   /transl_table=11
FT                   /locus_tag="ES1_09310"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33996"
FT                   /db_xref="GOA:D4MJR3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJR3"
FT                   /protein_id="CBL33996.1"
FT   CDS             complement(1044442..1045113)
FT                   /transl_table=11
FT                   /locus_tag="ES1_09320"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33997"
FT                   /db_xref="GOA:D4MJR4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJR4"
FT                   /protein_id="CBL33997.1"
FT                   V"
FT   CDS             complement(1048310..1048981)
FT                   /transl_table=11
FT                   /locus_tag="ES1_09350"
FT                   /product="Vitamin B12 dependent methionine synthase,
FT                   activation domain."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33998"
FT                   /db_xref="GOA:D4MJR5"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR017342"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJR5"
FT                   /protein_id="CBL33998.1"
FT                   N"
FT   CDS             complement(1048978..1049838)
FT                   /transl_table=11
FT                   /locus_tag="ES1_09360"
FT                   /product="5,10-methylenetetrahydrofolate reductase,
FT                   prokaryotic form"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL33999"
FT                   /db_xref="GOA:D4MJR6"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJR6"
FT                   /protein_id="CBL33999.1"
FT                   IKDLL"
FT   CDS             complement(1049880..1051808)
FT                   /transl_table=11
FT                   /locus_tag="ES1_09370"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL34000"
FT                   /db_xref="GOA:D4MJR7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJR7"
FT                   /protein_id="CBL34000.1"
FT                   PNGSTVR"
FT   CDS             1052293..1053378
FT                   /transl_table=11
FT                   /locus_tag="ES1_09380"
FT                   /product="transcriptional regulator, CdaR family"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL34001"
FT                   /db_xref="GOA:D4MJR8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJR8"
FT                   /protein_id="CBL34001.1"
FT   CDS             1054149..1054841
FT                   /transl_table=11
FT                   /locus_tag="ES1_09390"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL34002"
FT                   /db_xref="GOA:D4MJR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJR9"
FT                   /protein_id="CBL34002.1"
FT                   VEGEAQDE"
FT   CDS             1054834..1055721
FT                   /transl_table=11
FT                   /locus_tag="ES1_09400"
FT                   /product="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL34003"
FT                   /db_xref="GOA:D4MJS0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJS0"
FT                   /protein_id="CBL34003.1"
FT                   AIGTVLSTGKYLKV"
FT   CDS             1055739..1057046
FT                   /transl_table=11
FT                   /locus_tag="ES1_09410"
FT                   /product="Membrane-bound metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL34004"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJS1"
FT                   /protein_id="CBL34004.1"
FT   CDS             1057097..1058287
FT                   /transl_table=11
FT                   /locus_tag="ES1_09420"
FT                   /product="Periplasmic protease"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL34005"
FT                   /db_xref="GOA:D4MJS2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4MJS2"
FT                   /protein_id="CBL34005.1"
FT   CDS             1058350..1058820
FT                   /transl_table=11
FT                   /locus_tag="ES1_09430"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:ES1_09430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL34006"
FT                   /db_xref="GOA:D4MJS3"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPr