spacer

EBI Dbfetch

ID   FP929056; SV 1; linear; genomic DNA; STD; PRO; 2728333 BP.
XX
AC   FP929056;
XX
PR   Project:PRJNA45959;
XX
DT   25-MAR-2010 (Rel. 104, Created)
DT   25-MAR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Synergistetes sp. SGP1 draft genome.
XX
KW   .
XX
OS   Fretibacterium fastidiosum
OC   Bacteria; Synergistetes; Synergistia; Synergistales; Synergistaceae;
OC   Fretibacterium.
XX
RN   [1]
RG   metaHIT consortium -- http://www.metahit.eu/
RA   Pajon A., Turner K., Parkhill J., Wade W., Vartoukian S.;
RT   "The genome sequence of Synergistetes sp. SGP1";
RL   Unpublished.
XX
RN   [2]
RA   Pajon A.;
RT   ;
RL   Submitted (23-MAR-2010) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
XX
DR   MD5; d2b64ec9564ff8e27c59bf0c3fa5bbd6.
DR   EnsemblGenomes-Gn; SY1_T_24530.
DR   EnsemblGenomes-Gn; SY1_T_24540.
DR   EnsemblGenomes-Gn; SY1_T_24550.
DR   EnsemblGenomes-Gn; SY1_T_24560.
DR   EnsemblGenomes-Gn; SY1_T_24570.
DR   EnsemblGenomes-Gn; SY1_T_24580.
DR   EnsemblGenomes-Gn; SY1_T_24590.
DR   EnsemblGenomes-Gn; SY1_T_24600.
DR   EnsemblGenomes-Gn; SY1_T_24610.
DR   EnsemblGenomes-Gn; SY1_T_24620.
DR   EnsemblGenomes-Gn; SY1_T_24630.
DR   EnsemblGenomes-Gn; SY1_T_24640.
DR   EnsemblGenomes-Gn; SY1_T_24650.
DR   EnsemblGenomes-Gn; SY1_T_24660.
DR   EnsemblGenomes-Gn; SY1_T_24670.
DR   EnsemblGenomes-Gn; SY1_T_24680.
DR   EnsemblGenomes-Gn; SY1_T_24690.
DR   EnsemblGenomes-Gn; SY1_T_24700.
DR   EnsemblGenomes-Gn; SY1_T_24710.
DR   EnsemblGenomes-Gn; SY1_T_24720.
DR   EnsemblGenomes-Gn; SY1_T_24730.
DR   EnsemblGenomes-Gn; SY1_T_24740.
DR   EnsemblGenomes-Gn; SY1_T_24750.
DR   EnsemblGenomes-Gn; SY1_T_24760.
DR   EnsemblGenomes-Gn; SY1_T_24770.
DR   EnsemblGenomes-Gn; SY1_T_24780.
DR   EnsemblGenomes-Gn; SY1_T_24790.
DR   EnsemblGenomes-Gn; SY1_T_24800.
DR   EnsemblGenomes-Gn; SY1_T_24810.
DR   EnsemblGenomes-Gn; SY1_T_24820.
DR   EnsemblGenomes-Gn; SY1_T_24830.
DR   EnsemblGenomes-Gn; SY1_T_24840.
DR   EnsemblGenomes-Gn; SY1_T_24850.
DR   EnsemblGenomes-Gn; SY1_T_24860.
DR   EnsemblGenomes-Gn; SY1_T_24870.
DR   EnsemblGenomes-Gn; SY1_T_24880.
DR   EnsemblGenomes-Gn; SY1_T_24890.
DR   EnsemblGenomes-Gn; SY1_T_24900.
DR   EnsemblGenomes-Gn; SY1_T_24910.
DR   EnsemblGenomes-Gn; SY1_T_24920.
DR   EnsemblGenomes-Tr; SY1_T_24530.
DR   EnsemblGenomes-Tr; SY1_T_24540.
DR   EnsemblGenomes-Tr; SY1_T_24550.
DR   EnsemblGenomes-Tr; SY1_T_24560.
DR   EnsemblGenomes-Tr; SY1_T_24570.
DR   EnsemblGenomes-Tr; SY1_T_24580.
DR   EnsemblGenomes-Tr; SY1_T_24590.
DR   EnsemblGenomes-Tr; SY1_T_24600.
DR   EnsemblGenomes-Tr; SY1_T_24610.
DR   EnsemblGenomes-Tr; SY1_T_24620.
DR   EnsemblGenomes-Tr; SY1_T_24630.
DR   EnsemblGenomes-Tr; SY1_T_24640.
DR   EnsemblGenomes-Tr; SY1_T_24650.
DR   EnsemblGenomes-Tr; SY1_T_24660.
DR   EnsemblGenomes-Tr; SY1_T_24670.
DR   EnsemblGenomes-Tr; SY1_T_24680.
DR   EnsemblGenomes-Tr; SY1_T_24690.
DR   EnsemblGenomes-Tr; SY1_T_24700.
DR   EnsemblGenomes-Tr; SY1_T_24710.
DR   EnsemblGenomes-Tr; SY1_T_24720.
DR   EnsemblGenomes-Tr; SY1_T_24730.
DR   EnsemblGenomes-Tr; SY1_T_24740.
DR   EnsemblGenomes-Tr; SY1_T_24750.
DR   EnsemblGenomes-Tr; SY1_T_24760.
DR   EnsemblGenomes-Tr; SY1_T_24770.
DR   EnsemblGenomes-Tr; SY1_T_24780.
DR   EnsemblGenomes-Tr; SY1_T_24790.
DR   EnsemblGenomes-Tr; SY1_T_24800.
DR   EnsemblGenomes-Tr; SY1_T_24810.
DR   EnsemblGenomes-Tr; SY1_T_24820.
DR   EnsemblGenomes-Tr; SY1_T_24830.
DR   EnsemblGenomes-Tr; SY1_T_24840.
DR   EnsemblGenomes-Tr; SY1_T_24850.
DR   EnsemblGenomes-Tr; SY1_T_24860.
DR   EnsemblGenomes-Tr; SY1_T_24870.
DR   EnsemblGenomes-Tr; SY1_T_24880.
DR   EnsemblGenomes-Tr; SY1_T_24890.
DR   EnsemblGenomes-Tr; SY1_T_24900.
DR   EnsemblGenomes-Tr; SY1_T_24910.
DR   EnsemblGenomes-Tr; SY1_T_24920.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01990; SECIS_4.
DR   RFAM; RF02276; Hammerhead_II.
XX
CC   This is a reference genome for the metaHIT project
CC   DNA source: Departments of Periodontology and Microbiology, King's College
CC   London -- http://www.kcl.ac.uk/
CC   Sequencing technology: 454
CC   Genome coverage: 47x
CC   Annotation was added using ab initio prediction IMG/ER --
CC   http://img.jgi.doe.gov/submit (Markowitz, Szeto et al. 2007).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2728333
FT                   /organism="Fretibacterium fastidiosum"
FT                   /strain="SGP1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:651822"
FT   CDS             498..2609
FT                   /transl_table=11
FT                   /locus_tag="SY1_00110"
FT                   /product="Acyl-CoA synthetase (NDP forming)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27621"
FT                   /db_xref="GOA:D4M6X6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6X6"
FT                   /protein_id="CBL27621.1"
FT                   /translation="MQEANKALLSHPLRKLFAPESIAIVGASSSLERLTGRTLRYLQSF
FT                   GYGGAIYPINPKADVISGLPVHRNVTEVEGPIDLAILSIKAKLIPDALRACADKKIPFA
FT                   LIYSSGFSETGDRALQEEVSAIARDGGIRVLGPNCQGLANFAEGIPLTFSGALYEVPRP
FT                   LPGHVALVSQSGAFGFSSFGVGLEHGVRFRYVATTGNQSDLDAVECADYVLDDPEVRLL
FT                   MLYLEGLEDGAGFLRLVRKARERDIAVAVLKAGRSPSAREAAKSHTAALTGDDRVWSAV
FT                   FSQYGVIPMEDIDDIIGIGQVLGAEKRMSGGRSAILTTSGGAGIVMADCLNDVGLSVPV
FT                   FSHDTRSRIEAAIPPFGASRNPVDMTVQISEQPENFRSVFDAVQEDPELDSIVTSLSMI
FT                   VGHAGDVMTDTMIESYAKSPKPQAAVWMIDHQHGGSFIERLKTAGIPIFQSFRQCARAL
FT                   RELNRWGAFKPPAAPEVGGNAPILPQWKDAMTEYDAKVFLSRYDIPVTRERLCLNLEEA
FT                   CDAAEELGFPVALKGMAASVLHKTEAGIVALDVRSFEELRGALKTVRKHLADYVGDGAV
FT                   QGFLVSEMVRGGFECIVGVKRDPVFGPMIAVGLGGIYVEVLGDVSLRHGPVDEEEALNM
FT                   IRQLKGYSFLSGTRGSKPRDIRALAGIVSRVSRLAAIETDLLELDINPVFVLEEGKGAV
FT                   AADALVVKA"
FT   CDS             complement(2781..3224)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00120"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /function="deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27622"
FT                   /db_xref="GOA:D4M6X7"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6X7"
FT                   /protein_id="CBL27622.1"
FT                   /translation="MAEVQVRIQRFGRAREFPLPAYATEASAGLDLRASEPCVIAPGAR
FT                   ALVPTGIRLAIPCGYEAQIRPRSGLALKHGVALPNSPGTIDADYRGEVKVILINLGDEP
FT                   FVVESGDRIAQMVFAPVTRVAWCEVETLDATERGEGGFGSTGR"
FT   gap             3529..4477
FT                   /estimated_length=949
FT   CDS             complement(5280..6851)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00150"
FT                   /product="excinuclease ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27623"
FT                   /db_xref="GOA:D4M6X8"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027299"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6X8"
FT                   /protein_id="CBL27623.1"
FT                   /translation="MADGPAPQQEGARGERNVARPGAKNSARQGGAIKEKVAAILRSLP
FT                   ERPGVYIMRDAEGTVIYVGKAIKLRRRVSSYFRHSNFASPRLRKLVSLVEDISVIRTET
FT                   EAEALIVEARLIRRYSPFFNVDLKMNDRYPYIRVTDEAFPRLEITRVKRDDGAVYLGPF
FT                   VSAGNIRSLMRLAERYFPLRVCRADLKPDPGKRPCIEYSLGHSMGACAGLCTQAEYRER
FT                   VGDVILLLEGNTRELIERLHRRMDAAARRMDFEEAAHCRDTMRALWRISRQRVSSALQE
FT                   DLDSETWHVLNQTQRAFGLRTIPWRMDAFDISHTAGHDTYGCCVVFEQGRPNPSLYRRF
FT                   RIRGLAEGEVDDFASIEETVRRRYRHVLDQSEPMPQMALIDGGPVQLEFAMRALAELEM
FT                   ELPLVALAEREELLFLPNRPDDPIRLDRSSPVLQLMQRMRDEVHRFAITTHRRARNARM
FT                   KRSSLEDIPGIGRARASQLLVRFGSTERIAALSTDELAGAPGVGPVLARKILEHLNGSD
FT                   AQRVRA"
FT   gap             6895..7129
FT                   /estimated_length=235
FT   misc_RNA        complement(10986..11259)
FT                   /locus_tag="SY1_24930"
FT                   /product="Bacterial RNase P class A"
FT   CDS             11547..13076
FT                   /transl_table=11
FT                   /locus_tag="SY1_00180"
FT                   /product="metal dependent phosphohydrolase"
FT                   /function="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27624"
FT                   /db_xref="GOA:D4M6X9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6X9"
FT                   /protein_id="CBL27624.1"
FT                   /translation="MQLIIAALIFAAGVGVGYLILQAWDNTRLTGVKNQTLLMLQEATD
FT                   AAERLKQDRLTEARDEVSRLRQEANRDAKERRAELQRVERKLEQREENLERKLDRVSHK
FT                   EDELRLKQEAIEKRGADLEALIRQQGDKLEEIAQMTKEEAQEILLRKTEEDAQYLIGLR
FT                   LKELEERAHREADRRARDIVVAAMQRCAVESAGEATVSVVPLPSEEMKGRIIGREGRNI
FT                   RAFEMLTGVDLIIDDTPEAVTLSSFDPVRREVARRAMERLVVDGRIHPARIEELIDKAT
FT                   HDVEDEIISEGESAVLEMGIKNIHSELVRTLGQLKFRFSYGQNALSHSLEVAQIAGAIA
FT                   AELDLDEELARRSGLLHDLGKAVDHQVEGPHAAIGADLAQRFGERPEVVSAIASHHDTL
FT                   EVSSVYEVVVALADAISASRPGARRESLDAYIKRLEKLEELAMGFNGVSKAYAIQAGRE
FT                   VRVVLTAGKTDDGSVYKLAYDIARKIEAEMKYPGQIKVNVSRETRASEFAK"
FT   CDS             13076..13873
FT                   /transl_table=11
FT                   /locus_tag="SY1_00190"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27625"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Y0"
FT                   /protein_id="CBL27625.1"
FT                   /translation="MRVLFLGDVAWSVGRRALACALPELRREWGGFDFVVVNCENAAAG
FT                   KGMTEKIFKEFLDLGVDGMTSGNHIWDKNDFGVVLGSDARIFRPANYPAVCPGQGCGVL
FT                   ERGGRRLGILNLEGQVFMPPIDSPFYAADACLEELRAQGGPELPILVDFHAEATSEKEA
FT                   MGFYLDGRVSAVLGTHTHVQTADERILPGGTAYLSDVGMTGGHGGILGVKKESAMPRFL
FT                   TGMPARFEMCTELPAVNGAVVEIDESTGRARSIVRVQKAVELP"
FT   gap             14000..14234
FT                   /estimated_length=235
FT   CDS             complement(16795..18075)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00230"
FT                   /product="Obg family GTPase CgtA"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27626"
FT                   /db_xref="GOA:D4M6Y1"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Y1"
FT                   /protein_id="CBL27626.1"
FT                   /translation="MVRAGRGGNGALSFRREKFVPKGGPDGADGGTGGSVILEAVGGVV
FT                   TLADFEYNRRFQAGHAGHGAGAMKTGANGADLKVLVPCGTLVRDESGRVLADLVEPGQT
FT                   FVAARGGRGGKGNAHFANSVRRTPRFAEKGDPGEERTLTLELKLIADVGLVGFPNAGKS
FT                   SILAAISGAKPRIAGYPFTTLSPNLGVLAVDDQQIVVADVPGLIEGAHENKGLGLQFLR
FT                   HIERTRVLLHVVDLSEEDVLKNLEVVEAEFRAYGADLDGRPCIVVGNKTDLSGTEENAR
FT                   VLKREMERLGRPCLLVSALRGDGIPELIREVVALVRAHPRPVGRTTLAEAPEVQDVQEL
FT                   PRRRGGAPEPVEVRRLSDGRFRVDHANLERAVGRINFEHEDAMLKFSRLLKRLSVEEAL
FT                   EAAGAHEGDRVLIGDAEFDFQPERIME"
FT   CDS             complement(18269..18556)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00240"
FT                   /product="LSU ribosomal protein L27P"
FT                   /function="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27627"
FT                   /db_xref="GOA:D4M6Y2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Y2"
FT                   /protein_id="CBL27627.1"
FT                   /translation="MIYKFDIQFFAHKKGQGSSTNGRDSNPKYRGVKVYAGTEVTAGSI
FT                   LVRQCGTHLHPGKHVGLGRDFTLFALVPGKVEYAVKGDRRYVSIVPALAN"
FT   CDS             complement(18887..19198)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00260"
FT                   /product="LSU ribosomal protein L21P"
FT                   /function="LSU ribosomal protein L21P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27628"
FT                   /db_xref="GOA:D4M6Y3"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Y3"
FT                   /protein_id="CBL27628.1"
FT                   /translation="MYAVVETGGKQYRVQEGDRFRVERLDGEAGSEVVFGKVLMVGGDT
FT                   GVRFGTPYVEGASVRAEVLAQGRGKKVLVFKYKSKKNYRRMQGHRQYFTEVVIRGIDA"
FT   CDS             complement(19626..20840)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00270"
FT                   /product="Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27629"
FT                   /db_xref="GOA:D4M6Y4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Y4"
FT                   /protein_id="CBL27629.1"
FT                   /translation="MGNEGQKKFHIGLLPRLIIAIVLGVVVGTMARSAELPLIIQIGAT
FT                   FNSIFGNFLGFCIPLIIIGFVVSGIAELGEGAGKTLGLTVLIAYASTLFAGLLAYFVDV
FT                   SVFPSFLKVGSIVLEDAQNAEETMLKGLFSIDMPPLMGVMTALLLSFIFGIGIAVTHST
FT                   SLKNGFSEVQHIIEKLVAGVLIPLLPLHVYGIFANMTYAGTVMDIMSVFVRVFAIIILL
FT                   HVAVILIQYTIAGTAAGKNPIKLIRRMLPAYFTAIGTQSSAATIPVTVACTKSNGVSDR
FT                   IAEFVCPLCATIHLSGSTITLTSCSIALMMLNGMDVTLGGLFPFILMLGITMVAAPGVP
FT                   GGAVMAALGILSSMLGFNDSMLNLMIALYIAQDSFGTACNVTGDGAIAVFMDVMTRGKQ
FT                   GQASA"
FT   CDS             complement(20904..22133)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00280"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /function="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27630"
FT                   /db_xref="GOA:D4M6Y5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Y5"
FT                   /protein_id="CBL27630.1"
FT                   /translation="MKIMKKLEAALAAELERLKQEGRMKGKEEIIVEVKRAAGSRGPRY
FT                   LLEGRGGKEFIRMNSNSYLGLALREDMIAADEEGTRRFGVGPGAVRFISGTFKAHRDLE
FT                   HRLAAFHGREDAMIFSAAYVTVGGVITSLISKETFVVSDELNHNSIINAIKLGRPPFRA
FT                   VYKHNDLGDLKRCLDEAKAGTAKRVLVVTDGIFSMRGDHAPLKEIQELVHSYDEHFAEG
FT                   AFLVVDDSHGVGACGRTGHGTEEMTGARVDVLIGTLGKAYGVNGGYVTASRALITYLRE
FT                   HAAMYIYSNPITVGEACATMKALDILESDEGAKILEHLRVMTKRFEDGLVKLGYETIPG
FT                   EHPVTPLVLHDTDRTRAMVAHLLENGVLATGMTFPVVPRGAEEIRFQINADHTEADIDE
FT                   VLAAIGSFGK"
FT   CDS             complement(22209..23171)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00290"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /function="L-threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27631"
FT                   /db_xref="GOA:D4M6Y6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Y6"
FT                   /protein_id="CBL27631.1"
FT                   /translation="MKRIMVSGCLGQIGTELVTRLRRDYGAANVLATDVREDAAHALPE
FT                   GPFEILDVREAERYAECVSKFKPDTIYHLAGILSANAEKKPQLAWQINIQGLCNALEMG
FT                   REKGCAVFFPSSIAAFGPETPHDKTPQDTIQRPNTIYGITKVAGELLAEYYHKKWGVDT
FT                   RGVRFPGLISYKTLPGGGTTDYAVDIYYQAVQAARYTSYIAAGTYMDMMYIPDAIDGMV
FT                   QVMEADPARLVHRCCFNITAMSFEPEQVAAAIRVRIPSFVMDYDVDPVRQAIADSWPNS
FT                   IDDSAARAEWDWNPKYDLNAMTDDMLKNLRLKLGDEAKF"
FT   CDS             complement(24632..25459)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27632"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Y7"
FT                   /protein_id="CBL27632.1"
FT                   /translation="MEKNGLKPDITSRENLFLDLTKAFESVASSEDRSGYNAALKELSS
FT                   VLLEASQDGNALHALKLERQCIAVEQYLKETDSDILDKQLSRSGEAELSLKLVQDPKTY
FT                   REHVESIFPNGIRGIPRGDGMYTFVSGQISYLGVGKRYFPAQEDARTEYYAARQANLRA
FT                   GLEHFQELQREALFPEAVKLEKEIQELNLIEAPKIFVEPREDGQTYKGEIIHVNEEQGY
FT                   CLQRIGSGLYVHRLDRLDVSPERGQNLKIAYARDGSTARVEPLVQKNKKTLRR"
FT   CDS             complement(25800..26099)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00320"
FT                   /product="carbon storage regulator (csrA)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27633"
FT                   /db_xref="GOA:D4M6Y8"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Y8"
FT                   /protein_id="CBL27633.1"
FT                   /translation="MLVLSRRINESIQIGTDVEVMVIDVRGDVVRLGITAPQATQIWRK
FT                   ELWDVIVAENRVAAEAAKRSAKVEGADETPQLPVSTFSRLSKIPTVRLRERDEE"
FT   CDS             complement(26099..26584)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00330"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27634"
FT                   /db_xref="GOA:D4M6Y9"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Y9"
FT                   /protein_id="CBL27634.1"
FT                   /translation="MSATTIATERFGEVSYGDEDVLAFPRGIPAFEDRHRWILVGSEDN
FT                   AIKWLQNLEDPALALPVTTPDAVRPDYNARIPEDELELVGSMDPADLALLIVVSIPEGA
FT                   PWNMTANLRAPILLNLKTRKAVQVIALNEEYPIRHAVFPDDVRTRMRSQAAAAGGQG"
FT   CDS             complement(26795..30754)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00340"
FT                   /product="Flagellin and related hook-associated proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27635"
FT                   /db_xref="GOA:D4M6Z0"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Z0"
FT                   /protein_id="CBL27635.1"
FT                   /translation="MYSRATSVGSYKTLLSSLQGNYRNIQNLQKQLATLKKYSNLSENP
FT                   SAISRALELQSAIGANEDYKENGENAVALLKHAEGVLDQVLNAAKAIRTLVIQAGDAAL
FT                   SKSDREIIAKQIEANRQTILDALNTKVAGQYLFGGTSTGEAPFVLNADGTLTYRGTDER
FT                   IKYALSNVLTGDVSFTGSEVLPNKEKAYFVCSHYVPLDWQWKGREEKVQITVGNRTISV
FT                   FIPERWIDEVATGKTKPTDYNQFRDPGEVSGISLDDLAALVNRSLEEQGADMLVRASVE
FT                   KDLASGRQQMVIKSHTGEKVGITGWPTTDYTPMPQSIAGIQFKKTGTTAGGNLKVETPN
FT                   WNASLLGGTADISLSGLKDKALTVVTTAKDGTQEKKTYTFAADPANVKALLDELNTAGV
FT                   LPAGVTASSRNGKLVLTSADGKSIRVDGTAAEQLFGAARRSEAAKYSGLMGKASVLGWR
FT                   DDSLGKGITVNVDGKDYDFEFAGMRSISDLVAEINKKIPVDAGDVPVASVVAGRLVLQS
FT                   SRGQVTVKDHGAAGGVQQLFGEAGPVKSSTSSLSVKVGDKLSVTVYVNEGDTLTDVAEK
FT                   LNAIEGVYSRTSADADQLVAVAKRVGELPADSLSTNAAAESLHYPSLTITGSGGALALF
FT                   DFTFAEDAETGEQRGVIASKPQTRPVDHSHMDVFDVLGMETALKSVEFENGRTLKVGQL
FT                   KDPTKPYDPKTNPYQGKPLHWRVMSGGHTADITLNPGEYTMDDLAARIRNAGAGWLDVT
FT                   VDVYNKDGRSEDGTESGLGTSYNGEKATQRLVIRGLKGEQVLFLDMNDQHYADEMGLST
FT                   SLRTTPDMGVKSIVFPEAPCVDDELGVKVRVQMNCGKTYDVNITKKAVVDPATGEVDRV
FT                   KVMREIVNQVNAQEGANVMGLTVPVDKNGAEIPHSASIHFLSGEPFSVVDLPFSDPEWS
FT                   DYAGGIAAQLGIHGGVSANLKRTEAPMKDGQKFGASGVLRFESLGRSVTIDVSENDTVK
FT                   DVMDRLRSQAKDWLYVNYFDAHLGQEGRQSGDYPILSIAAKDGSAVNVVDVKGTIAKKH
FT                   LGLSTGIQGEKDVSGMEWSVGETEGSVFSITVAGYTHTIDMTAMRDVNGNGKMDAKDLV
FT                   ATINARMQDYDVKAELNDEGRLVLWSPRGYSIRAEVTKVKADGTPMTTAGDRTAEFFGG
FT                   TASEVKTCYRGGYKLDDPANTRKPQGIFVQNTTNRSGANERKQNGYEMFGDVTAAVRAG
FT                   NRTGLSEVMLPRIDAFIDNVLSVLSSNGAMQNRYKANMDRLTTENTLLTETHDELATVD
FT                   PAEIATQLMMANYVYQSNLAVIAQLIQPSLLDFIR"
FT   CDS             complement(30781..32109)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00350"
FT                   /product="Flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27636"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Z1"
FT                   /protein_id="CBL27636.1"
FT                   /translation="MNQALPSGGISGLTAVSGPTTGTATQFYVESKDHRLISISDVEGS
FT                   LAKRMGIVNKASVVTIDVEETDTLTTIRNKINEKYQAELGITAPEEWVHASLKQDSDQS
FT                   WYLTIASDVPGEAQRITLMGGADGNDQVLRRLGLMRLEQIGTVSATDKTPVYREVAAIS
FT                   TVAEDASFTFNGVRYLSSDNRFKEARRIPASGGSSDYSASKLAQVEEGMWFNLKHAGST
FT                   AITVRHHVRSGTIKALEEARDGIIPNLQGQLNDLTWGLVNHVNAYQYSGYGIGGDITTT
FT                   GVAFFKPLGTRTRAASNLSVNDAVVADNALIGAAMGRKNAAGVAVSGVSGGSGDGSNAL
FT                   RMANLASARVLKGGTMTIRGVYDAMLSQVGSKAAHAQLMSTAQDSLAEQIGLQREAVSG
FT                   VNLDEELMDMITLNRCFGAMSRYVTTVDEMLNAIINGFGLVGR"
FT   gap             34841..35339
FT                   /estimated_length=499
FT   gap             38641..39201
FT                   /estimated_length=561
FT   CDS             complement(40128..40448)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00460"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27637"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Z2"
FT                   /protein_id="CBL27637.1"
FT                   /translation="MDDEHFHVRFTPLAYEDMDEIDDYISVTLGDPEAAEKLLSKIEQE
FT                   LQHLTRYPRIGAQPRDTFLASRGYRKLVVENYLVFYILHEAEHEAVVMRVLYGAREYRS
FT                   LL"
FT   CDS             complement(40441..40701)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27638"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Z3"
FT                   /protein_id="CBL27638.1"
FT                   /translation="MSTIRPIECLQDTNAIAALCRQKDEPVFLTKEGDDGLVIMTTQAY
FT                   ARQFCLLDVYRKLAAAEQQLVDGEPLLNADDVFRRLREKHG"
FT   gap             41278..42370
FT                   /estimated_length=1093
FT   CDS             complement(42972..43388)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00490"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27639"
FT                   /db_xref="GOA:D4M6Z4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Z4"
FT                   /protein_id="CBL27639.1"
FT                   /translation="MEDYLFYDSKLAVNARELQSLYRYTEWGHSRSVEGIQAMIDGTSL
FT                   CFSARHDDKLVGFCRIITDFVYRASLWDVIVHPAHQGRGLGGALADYALTHPAIRNIPI
FT                   VMAYTTGWMRFLRGRGFETQRGLMMLMRCPIEYS"
FT   CDS             complement(45346..45996)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00520"
FT                   /product="ribosomal protein L25, Ctc-form"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27640"
FT                   /db_xref="GOA:D4M6Z5"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Z5"
FT                   /protein_id="CBL27640.1"
FT                   /translation="MEPREETGKGANGRLRRKGYTPCIFYGPQMEKSVQGKLKTRDVER
FT                   ILATGRWESMRLNVTLPDGTEEMCIIREVQVNPLTDCPLHVDFLRLIKGRKITVNIPIE
FT                   VLGRESAPGVKDGGVLETLREVEVETLPMNIPDVLTVDVSALQIGDAIHVRDLALPEGV
FT                   ELKADPDEIVAVVVMSRGVGESAAAEGEEPADVEVVAKGKAAREAEGDGEKSE"
FT   CDS             complement(46108..47067)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00530"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27641"
FT                   /db_xref="GOA:D4M6Z6"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Z6"
FT                   /protein_id="CBL27641.1"
FT                   /translation="MKDLKIFSGTAHPDFAKRICSELGVRLSAARHYRFSDGELGLSLD
FT                   ESVRGADVFVVQPTCEPANDNLIQLWIMSDAFKRASAYRVNAVIPYFGYARQDRKTKPR
FT                   EPITAKLVANLLTHSGVDRVITADLHAGQIQGFFDIPVDHLTGMPLLASYFRDSLSEEI
FT                   PKGEVVVVSPDVGGVSRARSFAIMLKSDLAIVDKRRSHEVANVSEVMDIIGEVEGKTAI
FT                   LVDDIIDTAGTICNAAAGLKERGCRRVFACATHAVLSGPAMERIEKSVIEKLIFSDTIP
FT                   MPEAKRSSRVQQLSIAPLFAEAIMRVHSERSVSSLFDN"
FT   tRNA            complement(48530..48603)
FT                   /locus_tag="SY1_T_24920"
FT   CDS             complement(49683..50171)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00560"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27642"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Z7"
FT                   /protein_id="CBL27642.1"
FT                   /translation="MKTRTLASGAMIAALYAVLTVAVAPLSYGPVQFRVAEALTLLPLY
FT                   LPEAVPGLFVGCFVANAFGGYGLIDMAAGSCATLLAAVLTRRASNLWLGALAPVLVNAI
FT                   VVGGMLHLVAGAPLGLTALYVGAGEAGACFLVGIPLMRALIRQGILCGRHGAGIPSDR"
FT   CDS             complement(50530..51300)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00570"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27643"
FT                   /db_xref="GOA:D4M6Z8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Z8"
FT                   /protein_id="CBL27643.1"
FT                   /translation="MNDCFGAVWSNLGAFLDVLRGLSASEAMDLSPEGGFCLSTRSRSA
FT                   SENWVWLQPDLVTQERAEAALRFFGDRGLPFVWPLPGDCEAAETLRAAGLKEAGQLEVM
FT                   SLPPTPIRGRGGKELTFRTVRTREEALRWASVAWLAFGGEPPVPVSALNGAEAMADSPL
FT                   RLGAAMAGEEAVGTFLLSPFAASLGVYYFAVLPGYRRRGAAMAMMGEVLRAAKELGTER
FT                   IVLQATPAGVPFYRAAGFESHGAIPLFSNSDDVF"
FT   gap             51745..52088
FT                   /estimated_length=344
FT   gap             54694..56116
FT                   /estimated_length=1423
FT   CDS             complement(56734..57171)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00610"
FT                   /product="Flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27644"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:D4M6Z9"
FT                   /protein_id="CBL27644.1"
FT                   /translation="MPVNGVAGAVNTDPSAATGAVRQNELDKNAFLKLLIAELSNQDPL
FT                   NPMEDREFIAQMAQFSSLEQMQNMNKTLESMAQASKFDAVSYIGKAISFNKITKDEKGK
FT                   EVETPTAALVRAVFFDPQKGPILDTAEGQVELAKVLGVAAP"
FT   gap             57883..59225
FT                   /estimated_length=1343
FT   CDS             complement(59866..60321)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00650"
FT                   /product="Flagellar FliJ protein."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27645"
FT                   /db_xref="UniProtKB/TrEMBL:D4M700"
FT                   /protein_id="CBL27645.1"
FT                   /translation="MNQRIQRFDRILKLREDGRRAEQVTLAAERREERGVMDRLSALEG
FT                   ERAEAIAEFRGGDERVTNGADLWFQRQFIDAINTNIDRGRQSLQDVRQRILGTEARLVE
FT                   RHKDVRIMETYVDRLKTADFKERLDAEQLELDDVATLHCARGKRGGR"
FT   gap             60327..60677
FT                   /estimated_length=351
FT   CDS             complement(61131..62108)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00670"
FT                   /product="ATPase FliI/YscN family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27646"
FT                   /db_xref="GOA:D4M701"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M701"
FT                   /protein_id="CBL27646.1"
FT                   /translation="MSGADGATAGTDLLAVLEADLRQAQLVKVNGRVVQVVGLVAESQG
FT                   PDVRVGDLCHICFRNGSSALDAEVVGFREDRVLLMPLGNLQEVGPGCDVVSTNRPLEVP
FT                   VGPALLGRVLDGLGQPIDDRGPVIAKDFYPLHAMPPHPLKRQMVDRPLSVGVRVIDGML
FT                   TLGMGQRIGIFAGSGVGKSTLLGMMARYTTADVNVISLVGERGREVREFIERDLGPEGA
FT                   ARSVLVVATSDQPPLIRLKAAMTATAIAEYFRDAGRNVLLMMDSVTRVARAQREIGLAI
FT                   GEPPATRGYTPPCSSCCPGSWSAPERGSGGASRGSTPSWWRATT"
FT   CDS             complement(62207..63856)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00680"
FT                   /product="ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27647"
FT                   /db_xref="GOA:D4M702"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M702"
FT                   /protein_id="CBL27647.1"
FT                   /translation="MLERLTLWNIGGIRRADLAFGRGLTVITGESGAGKSSVVRAIELV
FT                   GGKRGEVQLLRAGEDEGGAEACFGTDARFPELSDALQPEEGTLLARRTLLRGGRARSSL
FT                   QGLQIPLATYSVAAARLLRIQSQFAQMELLDDARQLAMLDSCTSREARDTARELCRVFD
FT                   EARARSQELRAMSRRREEIERRYANAQEVLALVRKVAPEPGLEAGLEASLTELARRIVR
FT                   RERAQDALNRLFGGLSEPGLLDGVKNAVETFQELLPDEARQRVQQRLREGLHAIEDAVD
FT                   EARDELSGQEEDAGERDRLEARLGALRRLKRLSSSADEEGLLTYCREASLNLEWLEKSY
FT                   PKLEELTGESLKLRKRANALAMELRRSRQEAAAALSQRVNALLKDLAMEGTSFELHLRE
FT                   LGKLRRDGADEAEFALRDGTRVGRVDKIASGGELSRLLLALQLSLPQEWTPPTLVFDEV
FT                   EAGLGGRAAVLSGMKLKELSRNAQVILVTHEASIAALGDAHVLIQRSGGESQIEAIEGE
FT                   ARVREIARMLSGSPDLAEAQEHARRLLTEGLW"
FT   CDS             complement(63859..64734)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00690"
FT                   /product="Predicted sugar kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27648"
FT                   /db_xref="GOA:D4M703"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D4M703"
FT                   /protein_id="CBL27648.1"
FT                   /translation="MNDLGMIVNLHKPEAVEMARRLLRWGQANGCSFLLPHLEASALTA
FT                   AGLSDEEWLNTVKLAVVIGGDGTFLRAARYVLDSDIVLHGINLGHLGFLASSKPEEAEC
FT                   DLKSILEDRFDVLNRRVLRCVLYRDGVPRYTIYALNDVVLSKNAIARLLHIEVQFNGRF
FT                   FGILPADGVIISSPTGSTAYALSAGGPIIPPHLDSMLLAPLCAHTLYSRPLIAAATDRI
FT                   SLIPRSSSRDITLTQDGQLAYEVFTDDRIDVDLPPDKLIRTVVLPGRNFLDLLQEKLGW
FT                   GQSRPGVNRE"
FT   CDS             complement(64784..65314)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00700"
FT                   /product="dCTP deaminase"
FT                   /function="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27649"
FT                   /db_xref="GOA:D4M704"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="UniProtKB/TrEMBL:D4M704"
FT                   /protein_id="CBL27649.1"
FT                   /translation="MILSGREIVREMGSGIVIDPFDERRVNPNSYNLSLHGELLVYRDE
FT                   VLNMKTPNATEALHIPPEGLTLTPGRLYLGRTAEYTRTEKYIPMLEGRSSTGRLGLCIH
FT                   VTAGFGDIGFAGYWTLEIFCIQPVRIYAGVEICQIYYHTIAGEYDLYKSGKYQNNRGIQ
FT                   PSLMYREFQQDRG"
FT   CDS             65519..66577
FT                   /transl_table=11
FT                   /locus_tag="SY1_00710"
FT                   /product="uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27650"
FT                   /db_xref="GOA:D4M705"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D4M705"
FT                   /protein_id="CBL27650.1"
FT                   /translation="MKEKKNSTVREVRQLPLDATFNVLGVVSRLTRKKDRNDKPFWDIS
FT                   ITDGTGDLEGKIWGGSNWWNLSGGDRYPLDPLNLGDLKFEGAAVGLQGKVSEFREQTQY
FT                   NFNDVYYVDQEKYPPHSFVRRSPLSDERMEGEFRALLAEMREPLKSFLEAVFFKHGLWK
FT                   KFMAWPAAVSMHHAYVGGLLEHSLAVALGAKALARHYADRGYPVDVDLATAGGLLHDLG
FT                   KLDSYSLNPAPQMTIPGNVAEHIVLGYHRFMVLAEQEGLDDGVALALGHIIVSHHGRRE
FT                   YGSPVLPATQEALIVAASDDLDFKMFCWRSQIDGLEAGHDTTDYIPLLERRFWRGLPAK
FT                   AASGGGAEEKSE"
FT   gap             67458..67588
FT                   /estimated_length=131
FT   CDS             67707..68885
FT                   /transl_table=11
FT                   /locus_tag="SY1_00730"
FT                   /product="Predicted multitransmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27651"
FT                   /db_xref="GOA:D4M706"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:D4M706"
FT                   /protein_id="CBL27651.1"
FT                   /translation="MRRLLGRRGQVLGLTLLRLAVSLAAAAAVYWGTDYWTTRIWNCEE
FT                   SLIVRVLGMGPETPVPPARGEQESFPTLQRQLTLLILTGDQRGVTANVKVVRLDGSGLD
FT                   PIEGRRYLLVQDVFEGGEVQYSIADAYRVPSLVAFVAGVCLCLLALTGAAGFWALAGLA
FT                   LSLVVLIWGMIPLMTRGWSPMAMAFAAILLVSSATIFCVVRRSCYRSAALLGSLSGAGC
FT                   GFLLGAFMVWAWQLSGLAGEGAALLASTLPGIDMQGILLASILVSAIGAVLDVAVSVTA
FT                   SMAELVSYAPDIPLRRLWTAGISVGSEVLGSMINTLILAYLGSSLPMAILICSAGANLL
FT                   GILNDPYIGQQIVQSLAGTVGLLCTIPTTAFFFVVQEGWNRRRSGATEARNG"
FT   CDS             68878..69831
FT                   /transl_table=11
FT                   /locus_tag="SY1_00740"
FT                   /product="Exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27652"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:D4M707"
FT                   /protein_id="CBL27652.1"
FT                   /translation="MGSTGGGRVCAAVDIGSNSIKLRVGCCAAGGVQVLLDTTEVVRLG
FT                   GCLRDGAIPEETMGNAVRVVSEMVGRARRMGAEPCLVGTMALRVAANAHEFLSLVHRRT
FT                   GLEVRILSGEEEASYSWKGASADFARNGGDLVLFDTGGGSTEFVFGRRGAVERIQSVPV
FT                   GAVSLTERFFAEDPPPKLALDEAMACVREALSANGIARAHPGTAPAVLGLGGGAVAIGS
FT                   VKDGSATFIPTRLHGMMLTRKDVAEQVELYASLPLAERRRIAGLPASRADIVLGSACII
FT                   LGAMRALDVECFTLSINGLRHGVLLEMCEGPRSDGE"
FT   CDS             69874..70578
FT                   /transl_table=11
FT                   /locus_tag="SY1_00750"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27653"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:D4M708"
FT                   /protein_id="CBL27653.1"
FT                   /translation="MRTMKVRKGFYGFLAAVLAAAVCASATDRAWAASAQGIISDSIDV
FT                   LHDMAKQEDADAMADVLKDAHAVAIVPAMVKAGLIIGGEYGEGLILRREKGRWYGPSYY
FT                   NLGGGSLGLQIGAQKISLVLVVTNEDGVRAFLNSRTKLGADVSVAAGPTGRRAEAATDA
FT                   QARASIYSYSMTKGLFAGVSLEGSVISVSVKRNEDYWKKKLSADDALKQPAKDKRILPL
FT                   TGALDNLARKAR"
FT   gap             71037..71172
FT                   /estimated_length=136
FT   CDS             complement(72192..73394)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00770"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27654"
FT                   /db_xref="GOA:D4M709"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4M709"
FT                   /protein_id="CBL27654.1"
FT                   /translation="MMNMLSRIKDLAREYERDAVALRRHFHAHPELSWQEARTTDRIAE
FT                   ELGKLGIPVLHRGYGGTSSGLIADIEGARPGRRVALRSDIDALPIHEENDVEYRSQNDG
FT                   VMHACGHDGHMAGLLTAARILTQIRDELPGTVRLLFQPAEEDGPRGGARVMIQEGALQG
FT                   VDGIFGLHLFSLYPTGKVLYRSGPCMASADGWDLVVTGKGGHGAAPEKAVDPVVAACTL
FT                   GCALQTIVSREVAPTDTAVISITSVESSTKTRNIIPESVTLMGATRALSPEMQDRVEAA
FT                   MRRIAEGVALTTRCRIDLNYMRFYPAVINDPKLTQILKETAEAMFGADAEEAPVNMGSE
FT                   DFSFYGRAVPATFAQLGVGDPAQPGTRCPHHSPTFNLDEAQLKRAAALHAGFAWSFLNG
FT                   D"
FT   CDS             73529..74923
FT                   /transl_table=11
FT                   /locus_tag="SY1_00780"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27655"
FT                   /db_xref="GOA:D4M710"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4M710"
FT                   /protein_id="CBL27655.1"
FT                   /translation="MLQPQRMGREPMLKLIFSFTLPSIAGMLANALYNIVDRMFVGRLV
FT                   GTMGLAAISVCFPFMLLLLSLSLLFGIGAVPMISGALGEKNDDLAEAVLGSALAAAALV
FT                   SVLVSVVAFIWMDPLLRLSGANEELLGPSREYLRVILLGAPFGMLSFVMNFAIRAEGRP
FT                   NFAMATQVLGAVANIVLDALFVWGLKWGVAGAAWGTALAQLASLLWVASFYWRRLGHLR
FT                   LRLQHCRLQPRLLGRLTALGFPSALTEVSFSLFYVLFNQSLAKYSGPLAVSALGAFMGW
FT                   DSLLFLPVVGICDGVQAIFGFNWGARRPLRVLEALKLALILGTGYFMGSVVVVHFFLWD
FT                   MMRLFSTDPELLTIAVVGGRVAYAGVIFTGVAMVTNSFFQGIGLSGLSLFLSLCRQFVF
FT                   LIPALLIMPRIWGAIGVWGAFPALDAGGGALSILLLWGQCRRLGLLRCEARRLRLARLR
FT                   RAGGGA"
FT   CDS             complement(76250..77593)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00800"
FT                   /product="Na+-dependent transporters of the SNF family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27656"
FT                   /db_xref="GOA:D4M711"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="UniProtKB/TrEMBL:D4M711"
FT                   /protein_id="CBL27656.1"
FT                   /translation="MSDGHNERENWGSRIGFILAASGSAIGLGNIWRFPYMVGMNGGAA
FT                   FLVVYLLLVATIGATVMLGEFALGRRMRKAPVPAFWQASGTHTWTLVGWMGTIGGSFII
FT                   LSYYAVIGGWTLKYIVASLQDLMPQAVEGQSRDVFNHFVGSPTEVIAYFLAFMAMTVGI
FT                   VLGGIGKGIERACKVMMPLLFLIMLVLIARAVTLPGALQGLDFYLRPDFSKLTWPALLD
FT                   ALSQGFFSLSLGMGIMVTYASYIRDEEHLPSSVAYVVFYDSLAAFLAGLVIFPAVFSMG
FT                   LEPTQGVGLTFIVLPGVFARMPHGEIFSALFFVLLFFAAITSSMSLFEVTVAHGMDDLK
FT                   WSRRKSSLVMGVIITLLGLPSAASLSGSPKLWGMDFLSAMDFLSNHIILPLCAILTCIF
FT                   VGWRFLDRAEDEISNHGTYRFKLLRAWAWIIRIVAPVAIGIVFYKGLF"
FT   CDS             complement(77732..79117)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00810"
FT                   /product="argininosuccinate lyase"
FT                   /function="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27657"
FT                   /db_xref="GOA:D4M712"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D4M712"
FT                   /protein_id="CBL27657.1"
FT                   /translation="MALWAGRFEKDMDQLVKEFNASIGFDVRAYRENIEGSIAHVAMLA
FT                   KQGIVTEAERDAIVAGLERIREGLDAGTIRFTVEDEDIAMGVEARLIKDIGDVGKKLHT
FT                   ARSRNDQSLLDTTMLLRREMREIERALVDLMKVILDRAEAGTDVLMPGFTHMQHAQPIT
FT                   VGFWFMAYFQMFRRDMDRLQDCRARTDFCPLGACALAGTTLPIDRQATAEALDFSAPTE
FT                   NAMDTVSDRDFMIEFLSAASISMMHLSRWAEEFVWYNSTEFSYLALDDSFCTGSSIMPQ
FT                   KKNPDIAELLRGKVGRVYGDLMGLLTVLKGTPLAFNKDFQEDKEKVYDAIDTWKASLRI
FT                   FEKMIEAASFRSDALNAQLEKGFLNATDAAEHLVVKGIPFREAHEIVGHMVRACEKKRC
FT                   RLEDLTDTDLALIDPRLSRSTVGDIGIRACVNARRSYGGTAPAEVRRQVEAGREWLARA
FT                   RGD"
FT   CDS             complement(79174..80169)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00820"
FT                   /product="N-Dimethylarginine dimethylaminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27658"
FT                   /db_xref="GOA:D4M713"
FT                   /db_xref="InterPro:IPR003198"
FT                   /db_xref="UniProtKB/TrEMBL:D4M713"
FT                   /protein_id="CBL27658.1"
FT                   /translation="MPNIAKTMIDLDAQLEHGQEMANVKAIPGERWFSLETRIEEDFKE
FT                   YWGGDWGCSSEYARLRAVLLHRPGKEVEGFDPGAVRFREAVDPEKFRSQHDALAQYYRD
FT                   HGVQVFYTPGVREDRPNAVFCRDKLFMTPEGAVICRLGMAERRGEERYVAQACADLGIP
FT                   IVKTIAGDGIFEGANAMWVDRRCVILSLSVRANRSGYDQMASELTRQGVTDVIPMQIPY
FT                   GHCHIDGLLNIASEDTVLIHAMQVPYEVVDRLKKKGFKVLETPSLTETKYGYATNFVAI
FT                   DNGHVVTSNQAPQAVELLERNGIKVDVLDLSELNKGRGSVHCMTAFLKRD"
FT   gap             82484..83439
FT                   /estimated_length=956
FT   CDS             complement(84583..86073)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00860"
FT                   /product="Formate hydrogenlyase subunit 3/Multisubunit
FT                   Na+/H+ antiporter, MnhD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27659"
FT                   /db_xref="GOA:D4M714"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:D4M714"
FT                   /protein_id="CBL27659.1"
FT                   /translation="MDDRVLLLPILLPALAAAALPLRRFKGRTGFCAFAGGAVLSNSAL
FT                   LLYLAARPPVGTLTLLRLSHDLSLALRLDGAGAAFAALLACLCPFVALYGLGYMSRTPH
FT                   RDKPFFVCFALAYGAAAGVALAANLTTLCLFCQLLILAVLPITRREGQRIAEVAFSLPL
FT                   GWGVFCTLLSLAFATAFIGNVDFVPGGCLPADALRKPDLLYLIYLLGFLGFGLETAVLP
FT                   LRGWPVASAEAPAPASALLNAVAVANAGVFAIIRLTWYVFGPDALNGSWAHLAAFALAC
FT                   VTTVYGACMALSSQRLKLRLAWSTIGQLAYVLLGTLLLTPSGLSAGMTQMAAHALIKAN
FT                   LYFCAGAILCQSGRRFLFDMRGWGFGMPATFLAFLLSALALVGLPPMAGFIAKWRLGIA
FT                   AASAGASSPIGFFGLAAMLTSALLTTFYVLQVLCVAVMPGRGFNLRAANYGITDPGPAM
FT                   LIPIGLLAASALLLGLWADPVLGFFERAVPGTLPEAIP"
FT   gap             86312..87264
FT                   /estimated_length=953
FT   CDS             88135..88398
FT                   /transl_table=11
FT                   /locus_tag="SY1_00890"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27660"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="UniProtKB/TrEMBL:D4M715"
FT                   /protein_id="CBL27660.1"
FT                   /translation="MATIQIRVDDNTKAAADSLFSSLGLDTSTAVRIFLMKALEHNGIP
FT                   FAVSHRVPTLELMEAIRDTRERRNLHGPFKTAEEAVASMLED"
FT   CDS             88886..89611
FT                   /transl_table=11
FT                   /locus_tag="SY1_00910"
FT                   /product="Sulfite exporter TauE/SafE."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27661"
FT                   /db_xref="GOA:D4M716"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D4M716"
FT                   /protein_id="CBL27661.1"
FT                   /translation="MDWVVAAAMMGVTVVGGVVASVCGFGFGAVAMATWPYFLPYQQAV
FT                   AVSALCGLSTALMIAVPHHRSINFKILLPCSLVALCCSAASVQLSLGAAEKFMIHALGA
FT                   MLIAVCLYFIFLGGTIRIKGTPLNGVIAGAIGGTCAGLFSVGGPPVAIYLLAATDSNEE
FT                   YRATLNASFCFTSGISTFVRWHNGVITSTTFHLWLLMLAALALGVFLGNKIFYRLDAKR
FT                   LRFAVYGYMAVSGVTMLLK"
FT   CDS             complement(89793..91001)
FT                   /transl_table=11
FT                   /locus_tag="SY1_00920"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27662"
FT                   /db_xref="GOA:D4M717"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4M717"
FT                   /protein_id="CBL27662.1"
FT                   /translation="MASEIMEKAQSIRNYLVECKRRIHRHPELGMHEIETAAFVRSELK
FT                   KLGIELQPIDTPVGVVGIVRGQKDAPGRVIALRADMDALPIQEEAAVPDASEVAGVMHA
FT                   CGHDAHTAMLLGAAKILTSMPDRFSGVVKLIFQPAEETLGGSELMIRLGCLENPTVDVI
FT                   LGQHGIAEFATGDIAFREGPSMASSDTFSVTVKGVGGHGAYPHNSGADALLASANCVMS
FT                   LQGLITRQFNAVDPVVLSICTFHGGTAKNIIPAEVTFGGSIRCQSPASRSRIRDVMDHM
FT                   ISSIVAGYNCTHELDYVYGVPPLVNDPDVVHAMRSAAAKLLGEEHVKTMSQARMGSEDY
FT                   ACYCEKIPASCFARLGIRQEGKEPTRFHSPTFVFDEEALPVGAGFFVQAVLELNGAIAG
FT                   PTL"
FT   CDS             91475..93019
FT                   /transl_table=11
FT                   /locus_tag="SY1_00930"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27663"
FT                   /db_xref="GOA:D4M718"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="UniProtKB/TrEMBL:D4M718"
FT                   /protein_id="CBL27663.1"
FT                   /translation="MKKTFALCFALAMLYAGVAFAASRGETLRVGVSIDAKNFDPQNAV
FT                   DTYSFSMQKQIYEPLFTVDGKTRKLTPVLAEKVEVLDDHTYKFYLRKGVKFHNGEEFTA
FT                   DDVVFSLTRVTDPKSSVFAKSKGVWIDPKGFEVIDKHTVIVRTNGPVGGWLGSMKHPYA
FT                   MILNRKAVEEAGADYFRKPVGTGPYKFVSWTKGERVEMEAFDDYWGEKPYARKLTFVVL
FT                   PDDSTRIIALETDKVDMIYAVPPSDFERLQNSDRVKAVKAPGLVLLHLAMNMDSPKLKD
FT                   SRVRKAIDAAINKEAYVQVVYNGNGIPGEGPLPTASSWFPENPEKWGYDPDLARKLLEE
FT                   AGVKDLELNLWVMNAADRVNGATVLQSMLGAVGIKVNVSVFENAVISDKVRKEPEKYDM
FT                   YAATWGMQTNRDAGVYWQSVITTTSIASTNSARISDPEIDNLMDEANHSIDEEKRGQVF
FT                   QKIWDRVNDLHPWVYLCQADELHGAQKDLIGVDELYDGKINLLTNIHYPEQTERLK"
FT   CDS             94093..94926
FT                   /transl_table=11
FT                   /locus_tag="SY1_00950"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27664"
FT                   /db_xref="GOA:D4M719"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D4M719"
FT                   /protein_id="CBL27664.1"
FT                   /translation="MFKYTMIRLRRSYLALFGLFILLVLIVCAVFADQLAPYGYAQQDY
FT                   MMICKPPSTLHWLGTDEFGRDILSRLIYGSRISLQVGLIAVSISLVVGGLIGAVSGYFG
FT                   GRLDNVLMRLMDVQMAIPTILMAIVISSVLGPGLFNLMVAVGITYIPKFARLTRASVLS
FT                   IKDQEFIEAARAMGASHKRIICLYILPNCAAPLIVQSTLSVANAILFAATLSFLGLGIQ
FT                   PPYPEWGGMLSAARPYLRNSAHMSIFPGLAIMFTILSLNFLGDGLRDALDPKQKR"
FT   CDS             95953..96933
FT                   /transl_table=11
FT                   /locus_tag="SY1_00970"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27665"
FT                   /db_xref="GOA:D4M720"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M720"
FT                   /protein_id="CBL27665.1"
FT                   /translation="MSDKPDKFIEVKHLKKYFTVSSGLLHAVDDVSLDIPRGRTLGLVG
FT                   ESGCGKSTLGRVIIGLIEASGGEVLFDGEDALKFEGAKRGEFRRRAQIVFQDPFSSLNP
FT                   RMSVSQLIAEPLIINEVCRSHKELNEKIGELMDLVGLASRLTTSFPHELDGGRRQRIGI
FT                   ARALALDPDFIVLDEPVSALDVCIQAQVLNLLADLREQRGYTYLFISHNLSVVRYVSDE
FT                   VAVMYLGNVVEKADNSTLFKSPLHPYTQALLSAVPVASVEPKKQRIILEGDVPSPVNPP
FT                   AGCRFAGRCARRGDACTSETPALVEIEPGHFVACHRLKDQLVRHV"
FT   CDS             96926..97513
FT                   /transl_table=11
FT                   /locus_tag="SY1_00980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27666"
FT                   /db_xref="UniProtKB/TrEMBL:D4M721"
FT                   /protein_id="CBL27666.1"
FT                   /translation="MSDAPERHGSTERTLRWFCGVPVLTNPLLLMDLASALVILWFVTV
FT                   LVMALAQVVFGGGALAGTHLAAASIYASYLVLLVGVLFVVVCLLFYRRGYVMCYRFEDN
FT                   GVFVETLRARNVPGASGAHVRPFAVGVPEGVVGSVARDVDWSDVRSLRELTGMNSFQLR
FT                   GKYGRLAQIYCPDEKTYREALAFARRKVERHA"
FT   CDS             97506..98222
FT                   /transl_table=11
FT                   /locus_tag="SY1_00990"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_00990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27667"
FT                   /db_xref="GOA:D4M722"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4M722"
FT                   /protein_id="CBL27667.1"
FT                   /translation="MLKDGKRTMNKQVYLSLRSDILSGRYHDGQQLLQAELAEEYHVSR
FT                   IPVREALMQLSSEGLVQIIPYKGAVVASLSIEELHEIFEIRYALESLILRYVVQNITEE
FT                   SAARVHNLLLESTQTPPERRSRKTNWEFHRALYEIAEKPRLLELIESQYNKIDRYVQMD
FT                   ITLPNVQENAFKSHDAILQACRVGDAVEATVLLHEHMVTALRRLDRFLQQEEVRAPDSN
FT                   RSTTLFMPLINRRVLR"
FT   CDS             98304..99293
FT                   /transl_table=11
FT                   /locus_tag="SY1_01000"
FT                   /product="Uroporphyrinogen-III decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27668"
FT                   /db_xref="GOA:D4M723"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="UniProtKB/TrEMBL:D4M723"
FT                   /protein_id="CBL27668.1"
FT                   /translation="MLTHKQRIENALALKENDRTPYSMWMHYPNRDRHPRRLAELALKA
FT                   QREYDLDFIKYMPFGLYTTIDMGVDLDVYEGFEKAPTQHEPVIRDVRDWDRIRPIDGTR
FT                   GEYAVVLESQRILMEMMEEHVPFLQTLFSPATTLAKMCSPAVLVRHMREDPARVHRVLE
FT                   MVTDTTIRFARASADLGADGFFYASQLSGRQTMEKAEHEAFVEKYDLAILNAVKDRTWF
FT                   NVLHLHGAQVRIDEVQHYPVQGLSWHDRDEGPSMEEVRKYSTKAFVGGLSWGENWLTKT
FT                   EEQVVGEVREMCGRPGLILGPGCVIEPHTPKKFLELVHKTVVERSCCR"
FT   CDS             complement(102905..103111)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27669"
FT                   /db_xref="UniProtKB/TrEMBL:D4M724"
FT                   /protein_id="CBL27669.1"
FT                   /translation="MNCDCYELLLRQGDCKSSLNKKTFLEIRKISQFAKIDRGKFRCKV
FT                   IVHNNDRFVTQAAHADKMREQRA"
FT   CDS             103307..103801
FT                   /transl_table=11
FT                   /locus_tag="SY1_01040"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   small permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27670"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D4M725"
FT                   /protein_id="CBL27670.1"
FT                   /translation="MFLTRFYSRLMALFRVVVGILFVAIIILTITQVFCRFVLDSPLVW
FT                   SEELSRLLFVWMTMFGGPVLTYQRAHLAIPELVRSLPEKTQGWLDLLLNLIVAVMLAIM
FT                   TATSPKLLKVSWHITSGALKLPFTFWRAAAPFGCFFMLCSILIRLPVMIRRVCEKKEEA
FT                   R"
FT   CDS             103798..105072
FT                   /transl_table=11
FT                   /locus_tag="SY1_01050"
FT                   /product="TRAP transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27671"
FT                   /db_xref="GOA:D4M726"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D4M726"
FT                   /protein_id="CBL27671.1"
FT                   /translation="MIALMFILLAALTLLGMPIAFATGVSSLIFLLYQGIPLNVLSQNI
FT                   VSGIDSFTIFSVPFFYLAGELMNFSGITDRIIDMAKALVGHMRGGLAQVNILASVFFAG
FT                   ISGSATADTAALGSILIPAMKKEGYDADFSAAITAASSLIGPIIPPSIGLVLYGVLAQQ
FT                   PVGKLLAAGILPGFVIAISQMVFTHYYSIRKNYPTSPRATFKQARRAILRGTPALMMPI
FT                   IVVVGILSGMFTPTEAAAVAVLYGFFMGAVVYREASLRTTWSLLANVALNSIKVLLIIA
FT                   FASMFSWVVTRAQVPTTVLNALLQLSSNRYVLLGLITLFVFIMGLFMIPSAIQVVVTPI
FT                   LVPIILKLGIDPIHFGVLLVFTTGIGSITPPVGVCLSLAAEIADTSYKDLVKTMIPIYI
FT                   PMLIATLIIAYVPWISTFIPDYFLK"
FT   CDS             105109..105927
FT                   /transl_table=11
FT                   /locus_tag="SY1_01060"
FT                   /product="Uncharacterized protein, putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27672"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:D4M727"
FT                   /protein_id="CBL27672.1"
FT                   /translation="MEKHELYRMTWKEVENAFKKDPVILIPLGSTEQQGPHTPTGDYRC
FT                   AEAVAKAVSKRTGAYMTTCIPFGYSEYFRGFPGSVSLQPKTFISLMEDICCCFLDHGIK
FT                   RIMFFNGHAGNNPLLDRVSRMILRERGIMIPNVNLWSLLTPAFRKSVFDDPKTSAHGAE
FT                   PLTSMTWYLNPEDMRMELLPERPRINRQVQGMDVENLTTLTYDGIGFSVFMNMEDISPD
FT                   GIMGNALLASPENGKKLFDEVIRNACKLVEKWKTVNTCWPSGEGHIVEND"
FT   CDS             105970..106941
FT                   /transl_table=11
FT                   /locus_tag="SY1_01070"
FT                   /product="tripartite ATP-independent periplasmic
FT                   transporter solute receptor, DctP family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27673"
FT                   /db_xref="GOA:D4M728"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="UniProtKB/TrEMBL:D4M728"
FT                   /protein_id="CBL27673.1"
FT                   /translation="MHKKFVAVAAVLFLLLSFASSAFAAREIHYSTWASSGEAAYTGME
FT                   KFKELVEKGTNGELKVFLYPADQLGKTTEQFEQVQMGTIHMMSSGQPPMTEIEYLSLPY
FT                   LVKNLDNWKLILNSDIGKEWNQKCLSDYGVRILGLLPRGPRVISANKIINTMDDLEGMK
FT                   IRSPERDYYVDTLVAMGAQPTTMSFGEVYTSLQTGVVDGQENPIETIVAAGFHEVQKCI
FT                   AMTNHINKPAFVVINEEFFGGLTEEQREILIEAQAEAEKLTQALMEQQQVELLKSIKDA
FT                   GVTVTTPDLKPFIEATRKVRDVLGTKVWGEERYRKITEMAQR"
FT   CDS             107049..108221
FT                   /transl_table=11
FT                   /locus_tag="SY1_01080"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27674"
FT                   /db_xref="GOA:D4M729"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4M729"
FT                   /protein_id="CBL27674.1"
FT                   /translation="MDFISLEKDAIGWRRHIHQHPELGFKEFETTKYIRERLEEFGIAD
FT                   FIPLKETGVAAVIHGASAGPCIAFRADIDALPTAEDSGYPWPSLNPGVCHACGHDVHTA
FT                   VLLGLSKALQQERTKLAGSVKLIFQPGEEIMCGAESIIRSGVLEDPIPEAIVGLHIWPQ
FT                   TPCGDVAFCHGPMMASSDSFTITVTGKQGHGAHPEVCVDALYIAAQVLIAVQGIVAREV
FT                   SPTDPSVVTIGTIVGGLAPNITAGEAVMKGTMRCMTLETRSYIKEALERIARQTAIAHK
FT                   GNATVKFAGPGIPPVISDEKVLREVEIAAQQALGEDHIRELKEPSMGSEDFSLYLKKIP
FT                   GAFYRLGTALKDNAATHKSLHSPQLFVPDEAIIAGIRVMYQFAVNRLGKG"
FT   CDS             109222..110223
FT                   /transl_table=11
FT                   /locus_tag="SY1_01090"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27675"
FT                   /db_xref="GOA:D4M730"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4M730"
FT                   /protein_id="CBL27675.1"
FT                   /translation="MIVDEQNEAGGLLGGRPIELIVYDTKSRNEDAVNAARRLVVNDGV
FT                   CVIVGDLSSGINIATAPIVARGKVPQISTLGTNPLVTVDNKGNVRPYSFRICFTDPYQG
FT                   ALAADLAYNDLGKKKAAILYNVGSDYAHGLREFFVKNYEKLGGEIVADEGFRGDDVDFR
FT                   AQLTTIKAAGADILFLPGMGKDMGLAIKQARELGFDGSIVGGDGYSDVMIEIAGDAMKG
FT                   THWVSHTYFEDPGMVPIYERFQKRYNDVCKEFVSTAMAADAMYWVFDAIRRAGVDEGPA
FT                   IAKALEGTKDLKLNHATLTIDPATHNPLNKAGIILRVDDNLERKFYKKVEPK"
FT   CDS             110560..111066
FT                   /transl_table=11
FT                   /locus_tag="SY1_01100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27676"
FT                   /db_xref="UniProtKB/TrEMBL:D4M731"
FT                   /protein_id="CBL27676.1"
FT                   /translation="MGLSWSAMRKVLEHENICDSLKGRVQYFVTRYRESHDQEGRVAVR
FT                   LDGNEIFKSNFYDGEIKRREAWNEINASKGRPTDYAESGEQMELEALNKGGFERFAFYD
FT                   AFYRYQNSGINDSLQSSDPVVRLFAILDKRVGKRRLHKMISEIEQQPIWLKPFYRLRLE
FT                   SDGVI"
FT   CDS             complement(111339..111773)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27677"
FT                   /db_xref="UniProtKB/TrEMBL:D4M732"
FT                   /protein_id="CBL27677.1"
FT                   /translation="MDSMEYKGYINKVFGYSLQYPDIFFDGTFKEDGSEVVMESIHKKY
FT                   LLKAWGRDLKGKENAKSLLQSLKKDFEKNGNVTIKHSEKLRKNAFSIGYTDPDDRDVLM
FT                   AQCCVVNGRRAAFFVFKYPHDEHEVFGDILSRMAKSFEVF"
FT   CDS             complement(112057..112140)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27678"
FT                   /db_xref="UniProtKB/TrEMBL:D4M733"
FT                   /protein_id="CBL27678.1"
FT                   /translation="MTQACKEADKDAPVIMGSPTSPVWSTT"
FT   CDS             112425..112928
FT                   /transl_table=11
FT                   /locus_tag="SY1_01140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27679"
FT                   /db_xref="GOA:D4M734"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D4M734"
FT                   /protein_id="CBL27679.1"
FT                   /translation="MEFRDRQYEVFNMFDKQWALATAGTLEDFDGCTIGWGSLGSLWGS
FT                   RSDGRLIVTIYVNPLRYTSEYLLKNDCFTVSFFEENYRRDLLTLGTKSKRDCDKFAMTS
FT                   LTPERHGQGVVFREANLTFVCRKLYWEQFNPDHLDSEVMREIYSNRPPHYQFIGEIMEV
FT                   LDKR"
FT   CDS             complement(113162..113458)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27680"
FT                   /db_xref="InterPro:IPR027890"
FT                   /db_xref="UniProtKB/TrEMBL:D4M735"
FT                   /protein_id="CBL27680.1"
FT                   /translation="MLNGSGILIGLASFLLIGLFHPIVIKCEYYFSDRVWPVFLVGGLA
FT                   FCTASLFAEDPTFSAILGVAGFTSLWSIHELKQQTKRVERGWFPRNPKRAPEE"
FT   CDS             complement(113484..114332)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01160"
FT                   /product="O-Methyltransferase involved in polyketide
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27681"
FT                   /db_xref="GOA:D4M736"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016874"
FT                   /db_xref="UniProtKB/TrEMBL:D4M736"
FT                   /protein_id="CBL27681.1"
FT                   /translation="MNESRKASAGLGFKVPISETALLTLYFKAQETQRPDRLIEDPRAV
FT                   EILEKLGVDMSRFRDKKMSQVGTIIRTRRFDRETRRILADWERPVVVHLACGLDDRFLR
FT                   TDSGKGVQVDLDLPDVMEVRKRFLPPSERNPQIGASMFETGWMDELLERYPEHRFAFIM
FT                   EGVLMYLNGTDIEGLFQNLAQRFPGAELHFDSVSTWMVRHSKMHDSIREYGDDVRFTWG
FT                   LDGLRDIEGWDPGLKFVEVEYYINQELRRWGWAVLLNLIPAMAKGAKMLRYDIRQANER
FT                   A"
FT   CDS             114843..116120
FT                   /transl_table=11
FT                   /locus_tag="SY1_01170"
FT                   /product="RND family efflux transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27682"
FT                   /db_xref="GOA:D4M737"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:D4M737"
FT                   /protein_id="CBL27682.1"
FT                   /translation="MKVFKMLSFGAIAAGIAWGVWYGFFRDEGTEYVYRTQPVTRGSIS
FT                   ATVSATGSVNPVEMVDVGTQVSGTIKEIYVDYNSRVTKGQLIAMLDTDMLQSRIEEAKA
FT                   ALALAQARTTSAKASVADADRTFKRNKELWGRDLIARSELDAAETKLSLARASLAENNA
FT                   QVVQAKASLKQAETSLGYARIVSPVDGVVIARKVDVGQTVAASLQTPTLFSIARDLTRM
FT                   QIEASVDEADIGRIAEGQRAICRFDAWPDTTFEGTVTQVRLKSTVVSNVVTYTVIIRVD
FT                   NSELKLKPSMTANVTIVTEEKKDALKVPAAALRFTPPGDVLAALSDASGAEQEEEGEGS
FT                   IMGLPPMRRRNGVRSGDEDEPVVWVVEDGKIVGSVPVGEQGISDRTWVEVLNTQLKEGQ
FT                   ELAVAFSTAGAAVAAEGEAVVVRMGR"
FT   CDS             116117..116848
FT                   /transl_table=11
FT                   /locus_tag="SY1_01180"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27683"
FT                   /db_xref="GOA:D4M738"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M738"
FT                   /protein_id="CBL27683.1"
FT                   /translation="MSLPDAASERAACPLIEVEDLVKVYRTGDVELRALDGVSFSVAHG
FT                   EFVAVMGPSGSGKSTTMNMLGCLDSPTDGRYLLDGRDVAHLSGDELAKVRNGKLGFVFQ
FT                   GFNLLPRLSAVDNVALPLVYAGVPARERRERARGALERVGLGARLEHRPNQMSGGQQQR
FT                   VAIARALVGRAPLILADEPTGNLDTRTSEEIMDLLVEVNREGKTVVLVTHEPDIAAYAR
FT                   RILKFKDGRLVSDETASGREE"
FT   CDS             116851..118065
FT                   /transl_table=11
FT                   /locus_tag="SY1_01190"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27684"
FT                   /db_xref="GOA:D4M739"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4M739"
FT                   /protein_id="CBL27684.1"
FT                   /translation="MFETLRTALSSLLANKTRSLLTMLGVVIGVGAVIAMVAVGNGASV
FT                   QMQDLVSGLGSNLLILSPGAPRSGGVRQSGGARLTLSDVRAVTEECWSVLRAAPLVNLS
FT                   SQLIYENQNWPSRVTGTTSSYFDVDNRSIYLGRLLDDEDERSASKVCVIGQTVATQLFG
FT                   TTNPIGKNIRINKIPFEVVGVLAPKGGGSMGQDQDDTVVVPITTAQRRLVRSSLADSVH
FT                   MALIQVRDVSMLEGGMADIRALMRQRHRIGRGKDDDFEIWNMTQMVESLQQSTWVMSAL
FT                   LGAVASISLLVGGIGIMNIMLVSVTERTREIGIRMAIGARARDIRLQFLLEALVLSLLG
FT                   GALGILLGMAASWGVTKFLTWPTSVSSGAIALAAGFSGFVGVFFGLYPAWKASRLRPID
FT                   ALRFE"
FT   CDS             118095..118445
FT                   /transl_table=11
FT                   /locus_tag="SY1_01200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27685"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D4M740"
FT                   /protein_id="CBL27685.1"
FT                   /translation="MLFLWYPRCSTCRKARDWLDAKNLSYTFRDIVQEPPTVQELQEWQ
FT                   RRSALPLKRFFNTSGMNYRALGLKDKLPEMSEEEALRLLASDGMLVKRPLLVTEEIVLI
FT                   GFRETAWVDAFK"
FT   CDS             118489..118584
FT                   /transl_table=11
FT                   /locus_tag="SY1_01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27686"
FT                   /db_xref="UniProtKB/TrEMBL:D4M741"
FT                   /protein_id="CBL27686.1"
FT                   /translation="MPEKDITERQPEGSPKGGTEGLFGLKGSSSR"
FT   gap             118864..120031
FT                   /estimated_length=1168
FT   CDS             120480..120554
FT                   /transl_table=11
FT                   /locus_tag="SY1_01240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27687"
FT                   /db_xref="UniProtKB/TrEMBL:D4M742"
FT                   /protein_id="CBL27687.1"
FT                   /translation="MGFFGLYPAWKASRLRPIDALRFE"
FT   gap             123435..125030
FT                   /estimated_length=1596
FT   gap             125363..125705
FT                   /estimated_length=343
FT   CDS             complement(126226..126813)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01290"
FT                   /product="2'-5' RNA ligase"
FT                   /EC_number="6.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27688"
FT                   /db_xref="GOA:D4M743"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:D4M743"
FT                   /protein_id="CBL27688.1"
FT                   /translation="MSEGRSAEDRDTASLIRAFVAVTVPDGAARTLELLLTRLVPLGRL
FT                   RWVTRAQLHVTLRFLGERTPDAIERVRRALAPIAFPPFEVELSRAGAFPSLERPRTLWL
FT                   SGTRGAAELTALAARLEDALAEAGIPRERRPFVPHLTLARCSGEPLSPALLRALEQVPP
FT                   VSWTCCGIELMRSRLTPRGAIYTPIPLEGVAP"
FT   CDS             complement(126791..127465)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01300"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /EC_number="5.4.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27689"
FT                   /db_xref="GOA:D4M744"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4M744"
FT                   /protein_id="CBL27689.1"
FT                   /translation="MLSAVLFDMDGLMFDTEALNLRAWAAAGEGHGYAITPEVMHDQIG
FT                   LSLPKTRSMMQERFGPAFDFDLVRGDRIRWTERWIEEHGLPEKPGLRRVLAWLIERRVP
FT                   RAMATSSDRGIVGFYLKHTDVGECFDLILTGDRVEQGKPAPDIFLKAALELGADPAGCV
FT                   VLEDSYNGIRAAHAAGMMPVMVPDLLSPTPEIAALTYRVVGSLNDVIPVLEALADERRP
FT                   ER"
FT   CDS             complement(129059..129763)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01320"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /function="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27690"
FT                   /db_xref="GOA:D4M745"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:D4M745"
FT                   /protein_id="CBL27690.1"
FT                   /translation="MEKREQLYEGKAKKVFATDDPKRYVVEYKDDATAFNGEKRGTIAG
FT                   KGVVNNRMSNILFRMLEANGVPTHFVEELSDRETLVRAVEIVPLEVIVRNVAAGSFSKR
FT                   YGVEEGRVLRNPTLEFSLKDDSLGDPLINDSHILALGLATEEELRTMHEMAFKVNDLLK
FT                   DYFLKIGVKLIDFKIELGRCDGRIVLADEISPDTCRFWDARTNEKLDKDRFRRDLGHVE
FT                   DAYQEMFKRVTQ"
FT   gap             131127..131146
FT                   /estimated_length=20
FT   CDS             132896..133615
FT                   /transl_table=11
FT                   /locus_tag="SY1_01360"
FT                   /product="Histidinol phosphatase and related hydrolases of
FT                   the PHP family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27691"
FT                   /db_xref="GOA:D4M746"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4M746"
FT                   /protein_id="CBL27691.1"
FT                   /translation="MMLRADLHTHTIASGHAYSTVGEMARSAAAKGLDLIAITDHAPSM
FT                   PQTCGWMHFANLHTLPREVCGVTVLRGVELNVRNMEGETDLPERVLRRLDWIIASLHEH
FT                   VLPSGQETDYTPVYLALAEDPFVDMMGHPESPEYAFDMDRVLPLWAERGKVVEFNEAHI
FT                   FTGSQKNRRNALRLAEACARWGVTVAVDSDAHSEWDVGCTSKAAEMLTEMGFPEELVLN
FT                   LSAERVLDFLQNRTRRL"
FT   CDS             136007..137563
FT                   /transl_table=11
FT                   /locus_tag="SY1_01390"
FT                   /product="Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27692"
FT                   /db_xref="GOA:D4M747"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:D4M747"
FT                   /protein_id="CBL27692.1"
FT                   /translation="MSRMSSPAIGIDLGTRNALVAFLDEDGAVRLIPNRWGTTTTHSVV
FT                   GWEDGAWVVGEDAVRLGLRGGSVWWDLKRKVGTSFRAFPDGRPRAAQDLLVPLLEALRE
FT                   DAEVCLKSFVSSCVLTVPACFTLPQREAVIRAASAAGLDARIVSEPTAAALAFGRQGRF
FT                   LVLDFGAGTTDISAVESEGGVWQVLESVGTDTVGGYEFDVALAEWLRESLLLDKFDAGD
FT                   VRWQLLLQEAERIKIALSDCWSVHWTPLALGGWAPPELTVYREDMERLMRFSIRRLIHT
FT                   VRRLWDRYGPEHLLLVGGSSRIPLLQEILEREVALPERLSLSAEDAVARGAALYTASGR
FT                   ERLLLDALSGDLNALWCGQTLTLIPSESVLPAHAEVVLEAARTGRATLEIRQSRNELRD
FT                   ESVRLGSLDLEVDAGEELRLACLLSASGRFTASLTRGTGECVPIPLVLEGTQAGRSPEA
FT                   ENDRRLRELKLSLVSLETLLSDSQRARLHLLFRRAEGAPSDPEVMGLLEGLVKDLKRAV
FT                   S"
FT   CDS             137634..138662
FT                   /transl_table=11
FT                   /locus_tag="SY1_01400"
FT                   /product="DnaJ-class molecular chaperone with C-terminal Zn
FT                   finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27693"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniProtKB/TrEMBL:D4M748"
FT                   /protein_id="CBL27693.1"
FT                   /translation="MEMNLFGEVKASLRALGLEPGATEADVRSAFRRLALTCHPDVVGQ
FT                   GGALRFQQIAGAYSLLKGLAPDELRQLSGAGWRQQRSLVKRRTSTFLDWYRRRRDRARQ
FT                   EAEEARRAEREEERRQAEERSERVDRVLEQYDRSLSRRLERMSKSADAAQLNDVLSRLG
FT                   SSVAEVRRLALGRVGTLINRAEVRQAVSDLLCRWDVDEKTARLVGALPMEAGVLRRLAA
FT                   DVASRADQFPNSLVMSLLALRSRDVSPDPILMERYLVSVRPDCVAAILRYWPDDSAPSD
FT                   AALRRLLGSEDAQVLVPLLSAMKQRFPHAVPHFRGRLEELLEHPAPAVRVWCRVLLAQG
FT                   GV"
FT   gap             138781..139492
FT                   /estimated_length=712
FT   CDS             complement(139622..140722)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01410"
FT                   /product="L-alanine-DL-glutamate epimerase and related
FT                   enzymes of enolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27694"
FT                   /db_xref="GOA:D4M749"
FT                   /db_xref="InterPro:IPR001354"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="UniProtKB/TrEMBL:D4M749"
FT                   /protein_id="CBL27694.1"
FT                   /translation="MSKIKNVKVKVVKVPLKTTWQTSLYATSTRAHCVVKIETEDGIDG
FT                   YGEASPAAAFMGETAYTMEVIIAKYFKPMLIGKSVLDISGINDTMDRIFSGNTSAKAAI
FT                   DIALHDAAGKALKVPVYVLLGGKCRDSFDLAWSMGFKEFDKSVDEAREYVKKGFKVMKL
FT                   KVGKGVEEDAKLVGRLRETFGPNVPIRLDANQGFTPGDAIALMHRVVEFNPECFEQPVP
FT                   KWNYEGMRHVREHSCGVRIMADESISSLHDVMNVIKNGCADFFNIKVGKVGGLYRACQV
FT                   AAAVEAAGFQAAAGSNLELGIGEAASAHFITSQPAVCLPSDAFCGTGLHTENLIKTPLA
FT                   MTPQGTFSCNNAPGLGVEVDENIFEK"
FT   CDS             complement(140799..141641)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01420"
FT                   /product="Beta-lactamase class A"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27695"
FT                   /db_xref="GOA:D4M750"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D4M750"
FT                   /protein_id="CBL27695.1"
FT                   /translation="MADNTVRKIPCREIYERIAKLDAFTGLYVEAIESGEVVEINPNRA
FT                   LCSASIIKLPILALALKDVGEGRLDWKKTYQIASANRVGGTGVLRELDEIREASLEKLA
FT                   FLMIALSDNIAANQVIDLISMDRITPFCRSLGYTNTRCERKQLDMQAIREGRNNYTSAG
FT                   DAGRMLSAVARGELVNPVASRLIHSIMSRQMCRNKLPAKIPAIAYWAVQDGMTLPAGSV
FT                   LAANKTGELLDVQHDAGIFTLPDGRRYVIAMLTGEVKDANDAVNAIADVSRIVYDAMK"
FT   CDS             complement(141684..142820)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01430"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27696"
FT                   /db_xref="GOA:D4M751"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4M751"
FT                   /protein_id="CBL27696.1"
FT                   /translation="MKTDVSKYLTLRRDIHRHPELSNHEVETTRRIREFLALDGLELRP
FT                   IGGLNGGFVNVNTGMEKTLCMRADIDALPLHEETGVSFASENNGVMHACGHDMHTAIAA
FT                   AIACELHKVRELLKCNIVVLFQPAEENNPDGGAKPVVEAGFLEDQHVDEVYGLHMWPQL
FT                   PVGDIEVCPGPIMAASDRFSVRITGRTAHAAEPHLGVDAIAIGMDIYCALVQKLRREVS
FT                   PCDSMTISIGSFKTSGRYNIICPEAVLEGTIRTTSDGTRAFLPKRIAELSSTIASSYGG
FT                   SADTNVNRGYGIVVNDVDLFRRFSTCAVKTLGPEHVHTNIRPSLIAEDFYYYGKRVPSL
FT                   YFHLGCQSEYSLHSNRFLPKEEALTVAVDLMTDYFLSQ"
FT   CDS             complement(142932..143765)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01440"
FT                   /product="Predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27697"
FT                   /db_xref="GOA:D4M752"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniProtKB/TrEMBL:D4M752"
FT                   /protein_id="CBL27697.1"
FT                   /translation="MTNFALLQTDIEFCNPEANFSHVRSMFAEAMKKTPRPDVVVLPED
FT                   WASGFSDEMFRHMEKYAEPEDGPTVTMCKGLAREYKVWLVAGSASILHRDGKMRNTTYL
FT                   IDREGEIVGDYSKMHLYSDMDEDVPFEHGDKIEVYDTELGRLGMMICYDIRFCELSRTY
FT                   ALKKADVLVVASDFPNPRVNHWRTLLMARAIENQMFVVACNRVGSSPMGTYCGHSIIID
FT                   PWGDVIAEGSDGEEIVTGSIDYTKTREVRDLIHMFRDRQPHLYGDTLLRPQAQLP"
FT   CDS             complement(143804..145105)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01450"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27698"
FT                   /db_xref="GOA:D4M753"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D4M753"
FT                   /protein_id="CBL27698.1"
FT                   /translation="MIFNLNPLWGFLPLLLYIILMLMGKDMNVSVLLCVILGAVLNGES
FT                   IMGFANTIKNSLGSFCAMIGFIIVLGSGLAEVLSRTRVAHNLVYTVVSRFKLKNKKMAI
FT                   LISMATSTLMVSLLGTLAGSNAIIAPILIPIVASVGLTPSTLGVILHGAGATGLYIGPF
FT                   VPPVVTIMGLTKITYGSFMMNAGIPLAIIVWGSTFFMACWTQRRTEGKETYAETDKEAT
FT                   SFVPDERCKRATWVFLIVMAIMIVYGLYIGAGASYAILVMMAASIIVGMVGGLSLKDSL
FT                   TTMITGGSKMFWMFFMFVLFDPFLNYVSASGAFNAVAELMKPLIDVGGKVAFLMLSAAV
FT                   GVFGISGTGVAQAQITHELFLPMVNSMNIEMAIWSLIVLVACQITFFVTPTVDMVGQMG
FT                   LARSKNIKAMLANGWVLTIITFGYVLVRAILYTM"
FT   CDS             complement(145246..146112)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01460"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27699"
FT                   /db_xref="GOA:D4M754"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4M754"
FT                   /protein_id="CBL27699.1"
FT                   /translation="MNEMKDVASKIRGLYDTFSKGHQSLAEFILNNPQESAFLSISALS
FT                   DKTGISAPTITRFVHKLGFDGYATFQRELYEAQAQIMPFSQLKSLLRNSAGSSPETATG
FT                   KGALFLGIEANLRLMEALYTPQLQEAFTRTLGIIQNAHKIYIAGQRSSFSIAHYLSFML
FT                   QRIYSNVVPLNATASALPSELSDVREDDCLVAISYSRYTKATYNVVSYFHRLGCKIAAI
FT                   TDSPTSPIALKASEVMIAPNGEYFSPVCAMTLCNCLIAALGSLDVQRTLERMELQDNIA
FT                   IEHDIYL"
FT   CDS             complement(146339..147328)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01470"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27700"
FT                   /db_xref="GOA:D4M755"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4M755"
FT                   /protein_id="CBL27700.1"
FT                   /translation="MFHYANYIYAVYRERSFSKAADKLFITQPALSIMIRKAEEELGLP
FT                   IFDRSHNPIGLTPFGVEYVQALKEIHAIEQRLRELIEQTRTLQRGHLSIGSSNLCVDYF
FT                   VTRHLVQFHRQYPNVDLTVRNLNTLDAKHLLDLGELDFVITNRPYDDKKYVQKVCFREC
FT                   LILVVPSDFEVNKGLEAHCLAPEELGDTVFSLPGRRTVSLSLFAQVPFILLSSQNYLRQ
FT                   YTDFLFRERNISPTILLELEQSATSYNFANLGMGATILSNRLIQNNADTTKLCFYKIDS
FT                   DHADRDTFLSFRRGVYFSDAMRRFAELFLEAHSVVDDESMENLSSTDR"
FT   CDS             147513..148550
FT                   /transl_table=11
FT                   /locus_tag="SY1_01480"
FT                   /product="Threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27701"
FT                   /db_xref="GOA:D4M756"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:D4M756"
FT                   /protein_id="CBL27701.1"
FT                   /translation="MIDLRSDTLTLPDEPMLRTILTARLGDDGRLDAEGRGEDLAVNEL
FT                   EDMAAEVSGKEAGLLCASGTMGNQAALLTWCRPGDTVLIDELQHLDRSEKTAFTPRFGQ
FT                   LKKVTYRSDASLMPNTASMEEELKNGPVKLICIENTHNYTGGACIDLKRMAEIRSLADR
FT                   YGVPVHMDGARVFNAAAFLGTTVKEIARYVDSLMFCVSKGLGAPVGSLLCGTRKFISEA
FT                   KEMRKLLGGAMRQAGIIAAPAIYALKHNVERLREDNENAQFCASLLKDLKKVKAQQNVQ
FT                   TNIMMLDMEGAGITPQEFCARAKERGLLIRPIIGSFVRLVFYKGITRSDAERAAAIVRE
FT                   IDGEL"
FT   CDS             148572..149828
FT                   /transl_table=11
FT                   /locus_tag="SY1_01490"
FT                   /product="Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27702"
FT                   /db_xref="GOA:D4M757"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="UniProtKB/TrEMBL:D4M757"
FT                   /protein_id="CBL27702.1"
FT                   /translation="MRVGGKKVSLTTQVFLAMILGSIAGLVDGKTMVQLGFLGDIWLNC
FT                   IKMIVVPMVLCTIVTGIVSQDSLTSLRRVSVRIIAYYVVTTVLACIVGIVVAMLLQPGK
FT                   FADFAGLATQEVKGGVDITLADFLKGLFSTNMVKTFADGNIVQTLVIAILLGIAILRIA
FT                   NQEHKEVMRKFFNGFNSMIFSLIGMIMSVSPIGVFFLMGSSFGKYGAGIFTSMAVLVGT
FT                   YYAACLAHVIIVYGGFLMAFKPHINPLRFIRDSAEVWVYTISTCSSIATIPVNIKVAEE
FT                   KFGIPERISGFTIPLGSQMNTDGSVLLYACVILFISQMIGQQMTLLQLINVIFISTILS
FT                   MGGGGIPGSGIVKLMVVVQSAGLPLEVVGVIAAFYRLFDMGTTTNNCLGDLVGTVIVGK
FT                   AEERYAMAENGDGASSQSR"
FT   gap             149899..150546
FT                   /estimated_length=648
FT   CDS             151969..153309
FT                   /transl_table=11
FT                   /locus_tag="SY1_01510"
FT                   /product="Recombination protein MgsA"
FT                   /function="Recombination protein MgsA"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27703"
FT                   /db_xref="GOA:D4M758"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M758"
FT                   /protein_id="CBL27703.1"
FT                   /translation="MEERSLFEDEASQPLAARMRPRTLDEFVGQTHLLGPGCVLRRLIE
FT                   EDHVSSMIFWGPPGVGKTTLAGVIAQRTRAAFINFSAVTSGIKEIRAVMQRAEEGRRLG
FT                   GRTIVFVDEIHRFNKAQQDAFLPFVERGSIVLIGATTENPSFEVNGALLSRCRVFVLKA
FT                   LTAEELAGLLSRALSDPRGLGRYRAEVAPDMLNAIATFANGDARAALSTLEMAVLNGEP
FT                   CGNGIRVTEEMLAQCTSRRSLLYDKGGEEHYNLISALHKSMRNSDPDAAVYWLARMLEA
FT                   GEDPLYVARRVLRFAGEDVGLADPKALEIAVAAYQACHFIGMPECSVHLTEAVVYLSLA
FT                   PRSNAMYTAYAAARSDAMEQLAEPVPLVIRNAPTRLMKELDYGRGYQYAHDAPDRLTDM
FT                   QCLPDSLRGREYYRPTEQGYEARCKARLEQIRAWRRAHGDGAERYGQ"
FT   CDS             155212..155391
FT                   /transl_table=11
FT                   /locus_tag="SY1_01530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27704"
FT                   /db_xref="UniProtKB/TrEMBL:D4M759"
FT                   /protein_id="CBL27704.1"
FT                   /translation="MMGGERMSVEVQERVALWRVPDPTEPPLTPEEIAGVEQARAERAA
FT                   GLGRPIAEVIRDLL"
FT   CDS             155388..155642
FT                   /transl_table=11
FT                   /locus_tag="SY1_01540"
FT                   /product="Cytotoxic translational repressor of
FT                   toxin-antitoxin stability system"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27705"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:D4M760"
FT                   /protein_id="CBL27705.1"
FT                   /translation="MMWTVTVMPTAEKQLARIPNPDKGRILAAIVALEDGIEGRDVRPL
FT                   AGGRDYRLRVGKWRVLMDVDDENLAIYINRVGPRGDVYK"
FT   CDS             155712..155756
FT                   /transl_table=11
FT                   /locus_tag="SY1_01550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27706"
FT                   /db_xref="UniProtKB/TrEMBL:D4M761"
FT                   /protein_id="CBL27706.1"
FT                   /translation="MAVSSCVGGSLLEW"
FT   CDS             155791..156150
FT                   /transl_table=11
FT                   /locus_tag="SY1_01560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27707"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D4M762"
FT                   /protein_id="CBL27707.1"
FT                   /translation="MPNFPDPFAGNVERKMSREELVQALRIDIAGELEAIFLYDAHAQA
FT                   TDEPLARKVLMEIRDEEKAHVGELTTLLSRLDPNWSESLAGGEGEVLETMQELGIAPAE
FT                   GASDGQSTVGSLISK"
FT   CDS             156165..156989
FT                   /transl_table=11
FT                   /locus_tag="SY1_01570"
FT                   /product="Uncharacterized protein, linocin/CFP29 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27708"
FT                   /db_xref="GOA:D4M763"
FT                   /db_xref="InterPro:IPR007544"
FT                   /db_xref="UniProtKB/TrEMBL:D4M763"
FT                   /protein_id="CBL27708.1"
FT                   /translation="MDDFLGRSASPLDEEFWSALDRTVVETAKGLLTARRFLPLCGPLG
FT                   AGVQVVPVDRPVRTERTEDGFTFAEGRTYVELPQLTEDFWILWRDVEAAKREGLPLDLH
FT                   AAHMAAQALCRREDRMVFYGVKRLGVEGLLSVGGTNVLDRGDWSAGESAFTDIAAGMAV
FT                   LQQKGRIGRITLVLSQDLFVQLHRIQPGTGLTEIERIRSLLEGRLFQTPVLQPGTALLL
FT                   CPQPQYMDLVVGQDIRTAYAEQLDLNHRFRILETACPRIKSPDAVVVYRSAQ"
FT   CDS             159849..161108
FT                   /transl_table=11
FT                   /locus_tag="SY1_01600"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27709"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M764"
FT                   /protein_id="CBL27709.1"
FT                   /translation="MEYIKRAVEDIALHSDKTFKSLLVTGARQTGKTEMIRKLFPDKKY
FT                   VLIDDPFVEDQANNNPNLFMMLNQPPVVYDEVQRAPGLFRYIKIACDGTDDKGLFCLSG
FT                   SQPLELMEKASESLSGRIGIIEMSPLSQREIDGDAFNAPFLPTMEYVRERNKTAKAPNN
FT                   LWERIHRGGYPALQDPEIDWGVFFSSYVKTYLERDVRKLSAVQDLNDFRRFMVAVAART
FT                   GQRVNYSNIADEIGKDQTTVKSWMSILEASGIVYLLEPYTPGVLRRAIKTPKAYFRDTG
FT                   LAAYLTRWLTPETLANGAMSGAFFETFVISEILKSYSNRAIDYRYCVSYYRGRDRKKVK
FT                   KNGAMIEIEGEIDLIIEENGVLHPIEIKQSSSVAADETSAFLVLDKVNEKRRGAGAVIC
FT                   NCPQPGMLRENVLQIPVWFV"
FT   CDS             161480..162811
FT                   /transl_table=11
FT                   /locus_tag="SY1_01610"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27710"
FT                   /db_xref="GOA:D4M765"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D4M765"
FT                   /protein_id="CBL27710.1"
FT                   /translation="MQENQSGKGVWKFLVYSLFGLFMFFCPLTLGGKMTIPVDHIINFI
FT                   LQDLLPGAKVYILIVMYVGAALPFIRRTWNKDGLTLFFSFAKVVGAVAGTVIYFNVAPA
FT                   WLAQKDFGPFLFEKLSLPVGLVIPIGSVFLAFLSSFGLMEFTGVFMTPVMRPLFKTPGR
FT                   SAIDAVASFVGSYSIALLITNGVYRQDKYSAREAAIVATGFSTVSATFLLIVAKTLGIM
FT                   DHWTLYFWVAMFVTFAVTAVTARLWPLSWMPETYATGVRSEDPVREGSLMRRAWDAGVE
FT                   VAENVPPLPQMVWKNFTAGLDMAFSVIPSIMSIGLLGLVLARYTPLFEWMGLMFVPIFE
FT                   LFGVSQASLGGTAAAVSLPEMFLPAILIAKTGTPLLKFVIAVVSISEILFFSASIPCIL
FT                   GTDIPIKLWEIVVIWFERVVLSILITIPIAMLLGFSDVVQAVAP"
FT   CDS             complement(162988..164166)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01620"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27711"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:D4M766"
FT                   /protein_id="CBL27711.1"
FT                   /translation="MVITNGFTYIAFLMFVAGSLLALEKYARWKVFNVVPPLVWIYVLN
FT                   MIFCTMGLFNSEACKTAYSALKNNLLYAMIFVMLLRCDFRKLARLSGRLIAIFLGCSVT
FT                   LAAGFIVLYPVFKGFLGADTWGAVAALYASWVGGSANMAAMQAALPVDAGAYSCALALD
FT                   TVCYSLWIALLLLAVRYSSKWNAATKADTSKLDALADTANAQVAAEKKLATGSDWIFLV
FT                   GLSLAVSAASQWIGAEANAALKGAGFAMFDKGTCTTLFVTVLGLVCAMTPLGKLPAVEE
FT                   LSNIYLYAVVSLLASTATIVDLVAAPMWVVYGLLILAIHVALMFFLSKLFHWDLCMVST
FT                   ASLANIGGAASAPIVATAYDQNYAGIGVLMGVLGAAIGNFAGLAMGALLKTF"
FT   CDS             complement(164208..165305)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01630"
FT                   /product="muconate cycloisomerase"
FT                   /function="muconate cycloisomerase"
FT                   /EC_number="5.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27712"
FT                   /db_xref="GOA:D4M767"
FT                   /db_xref="InterPro:IPR001354"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="UniProtKB/TrEMBL:D4M767"
FT                   /protein_id="CBL27712.1"
FT                   /translation="MRITRIRLGRISVPLRVPFKTALRSVDSVEDVVVEVHTDAGTIGY
FT                   GEAPPTGVITGDTTGAIVGAVQDHIGRAILDRDVDDLEDLLQRVQRSIVHNTSAKAAVD
FT                   MALWDLYGQLHHIPVYKLLGGARKCIVTDITISVNPPEEMARDARDAIGRGYDCLKVKV
FT                   GANPALDVERLSAVRRAVGDDVCIRIDANQAWRPREAVRILNAMQEKGLAIEFVEQPVK
FT                   AQDIDGLRYVTEHSDVPVLADESVFSPEDAMRIMQTRAADLINIKLMKCGGLTNALKIA
FT                   SAAEVYGVECMIGCMLEAKISVNAAVELACAKRIITKVDLDGPVLCSEDPILGGAVFRE
FT                   KEITVSDEPGLGIRGVEPGRIAYID"
FT   CDS             complement(165329..166717)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01640"
FT                   /product="Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27713"
FT                   /db_xref="GOA:D4M768"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:D4M768"
FT                   /protein_id="CBL27713.1"
FT                   /translation="MSKYLLAVLAVVLAGTVGGGFPALAAPLDAERTAGLDAALDAMIG
FT                   SEGTCVPGLGVIVYKDGTRAYSKFLGRRHIDAQDPSLDRPFTEDSRFRVASVSKQFTAL
FT                   AVLQLTEQGKLDLDADVSQYLGFSLRNPHFPDTPITLRMLLSHTSSIRDGRAYAIPPQY
FT                   GVKEFFVADGKFYEEGTHFAPAEEAPGKYFRYSNLNYGLLGTIVEAVTGERFDRYMRAH
FT                   LLAQLDIKGSFNPGDFTKEELALLGSIYQKQKDGQWDEKGPWVAQIDDYGDEAPDRDTV
FT                   AVNNPDIRETDSWYGLADYKPGTNATVFSPQGGLRVSCAELEHLLQLYLNDGVYNGVQV
FT                   VRKDLLDEMFRVQWQFDPDHPNGNTYGGSIEAYCLGVYPLLGTGRSRPAKDLDVNLKGH
FT                   LGEAYGLLSGVMVRTGTRDGFIYIMNGEAVAEDDDPRSEGTFSGNYIWEETMMNAICSN
FT                   AFAD"
FT   CDS             complement(167981..168757)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27714"
FT                   /db_xref="UniProtKB/TrEMBL:D4M769"
FT                   /protein_id="CBL27714.1"
FT                   /translation="MMRKIFPALAALLLFAALTAVAGAEAVEQRAFALKDPVTLYAKPD
FT                   ESAKSWEVSLPDEGVKVPSAIRDKDDALWYKVTVDGRTGWLFNEGIRLLMGGKSRVAES
FT                   VYKRCAGVRSRVMKKPGSAWQEGTTTDETDGTLVTYTTEGGAFQALKTGDGVEDVYFCA
FT                   NGSEACKTFLGFDPIDMHKDKLRAKVGTPTVRETPDGERDVSILSYELGNRRMTMAFHL
FT                   RNDRVEWFELYRGRTGEAAEGWSLEAIRAREEARED"
FT   CDS             complement(170311..170415)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27715"
FT                   /db_xref="UniProtKB/TrEMBL:D4M770"
FT                   /protein_id="CBL27715.1"
FT                   /translation="MTFQLPKQCAPERRCGLPAAPGMTEGPCGTEARS"
FT   gap             172785..173142
FT                   /estimated_length=358
FT   CDS             complement(173160..175070)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01710"
FT                   /product="Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27716"
FT                   /db_xref="GOA:D4M771"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D4M771"
FT                   /protein_id="CBL27716.1"
FT                   /translation="MNVKYLGDLLTLGAALGLLLPFAGAAEAGTKPAPLLPMEDFFRNP
FT                   ESAAYAISPDGRRLAYAKPWKSRMNVFVRDLDSEEERRVTSAEERDVGGFFWKGNDRIV
FT                   YVQDRGGDENFHVYITNLEGTASRDLTPFEKVRAGVLDDLEDDPRHMLISMNRRDPEVF
FT                   DVYRCDLDSGELTKLAENPGSVVGWMTDHEGRLRVAIETDGVNTNLLYRTSEDQEFRKL
FT                   LTTSFKDSFDPILFSYDNRLLYVASNLSRDKEAIYTFDPEANKLLDLVYENDEVDVGGL
FT                   MHSKKRKIVTGVHYTTDKTRYHYFDEESRKLRTALEAFFPDHEVSVTDMDDEEQRCIVR
FT                   VWGDRTRGAYYFYDRTNNALKKLADVSPWLKEEDMSPMTPITYRSRDGLTIHGYLTIPT
FT                   GAVSRDLPLVVIPHGGPSAREYWGFDAEAQFLANRGAAVLQVNFRGSTGYGKKFWTAGF
FT                   KQWGRAMQDDVTDGVKWAVDQGIADPKRLAIYGGSYGGYAALAGATFTPDLYACAVSYV
FT                   GPSNLFTLLASIPPYWEPLREMEYEEIGDPSKDKALLEEVSPLFHADRIHIPLMVAQGA
FT                   NDPRVNKAESDQIVEAVRKNGRDVLYMVKENEGHGFHNEENRFDFYRAMEDFFRKHLGL
FT                   R"
FT   CDS             175506..175871
FT                   /transl_table=11
FT                   /locus_tag="SY1_01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27717"
FT                   /db_xref="UniProtKB/TrEMBL:D4M772"
FT                   /protein_id="CBL27717.1"
FT                   /translation="MTKLLNRMTDEVQAVGRIAFGAADRRGKIVAAVGDGERLRYTVNG
FT                   GPREAFDDAGLRTLTAEFVRFALDSDLSCLALEVEGVDALSPQASEAAAEGALAGACAF
FT                   TKYRTQGAARANWPPLR"
FT   CDS             176915..177865
FT                   /transl_table=11
FT                   /locus_tag="SY1_01740"
FT                   /product="GSPII_E N-terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27718"
FT                   /db_xref="GOA:D4M773"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="UniProtKB/TrEMBL:D4M773"
FT                   /protein_id="CBL27718.1"
FT                   /translation="MEVKRRKLGEILLQMKLVSPEELRLALEDQARSPGKRLGAILIER
FT                   GGTTSQALTSALGRQFMLPVVKVANYGDVAARHAVPRELMESLKAFPLEFQEHGTVLLV
FT                   AISDPLDVVTRNILRAKISFPIRFALAPEEDILEALREAVSDPPPPPPAPAPAPASFGA
FT                   ATPLSIKTLRAKHPLLGEMLLRAGVITQQQLSMVLVIQERARKRLGEILLSEGIITSSR
FT                   LAEALSEQLKLPLLSLAEEEPEPEAIRLVPRNIAARLNLLPLRIEADGRLLIAMADPLD
FT                   ILAQDEVQMMVSGGIRIGVATQESIYQNLPRFYNR"
FT   CDS             complement(177945..178100)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01750"
FT                   /product="Histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27719"
FT                   /db_xref="GOA:D4M774"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="UniProtKB/TrEMBL:D4M774"
FT                   /protein_id="CBL27719.1"
FT                   /translation="MKNAGASGARWACILGPEELAKGCAAVRDLEEGSQTEVPLAQVPD
FT                   YIQNHE"
FT   CDS             complement(178097..179269)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01760"
FT                   /product="histidyl-tRNA synthetase"
FT                   /function="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27720"
FT                   /db_xref="GOA:D4M775"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="UniProtKB/TrEMBL:D4M775"
FT                   /protein_id="CBL27720.1"
FT                   /translation="MRRARRFGGRAGEIAAEREMNAMEIKAPRGVRDILPEESWKWAYV
FT                   VNTAARTMADFGFSEVHLPLFEQTELFARGVGDTTDIVEKEMYTFTDRGGRSLTLRPEG
FT                   TASMVRAAVENGLCAQGTAAKLWCWGPMFRYERPQKGRYRQFYQIDAEYLGVAGPMADV
FT                   ETIDLSAELFRRLGMKNLEVVINSVGCPRCRPVYREALLQHFQARRGELCETCLERMDR
FT                   NPLRILDCKEPGCGTVADAAPAIYESLCDECRSHFEEVRSGLERLSFRYRLDKRLVRGL
FT                   DYYTKTAYEILSGDLGAQNAVCGGGRYDNLSEAIGGPRLPGVGFACGLDRIVLVMEQQG
FT                   CTFGRRPQARAYVAALDGASRGRPRSWPTSCGARASQRNRTRRTEASRRR"
FT   CDS             179565..180134
FT                   /transl_table=11
FT                   /locus_tag="SY1_01770"
FT                   /product="GSPII_E N-terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27721"
FT                   /db_xref="GOA:D4M776"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="UniProtKB/TrEMBL:D4M776"
FT                   /protein_id="CBL27721.1"
FT                   /translation="MGATRKKIGEILLRSRRVAPEALQRALEEQAKNPQKRIGAILVEL
FT                   GFLTDRQLTEALGLQFMLPVVKVSDYMANIAAQNECPRELMEKFNVFPLEFQERGSVLL
FT                   IAIADPLDVATQDMLRTKLPIPLRFALAPAQEIREALMEGRMPGAAAVPGMQRGPAVGV
FT                   PLGGVQAPLGADPRPAGRRPCAAGRT"
FT   CDS             180148..181842
FT                   /transl_table=11
FT                   /locus_tag="SY1_01780"
FT                   /product="Type II secretory pathway, ATPase PulE/Tfp pilus
FT                   assembly pathway, ATPase PilB"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27722"
FT                   /db_xref="GOA:D4M777"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M777"
FT                   /protein_id="CBL27722.1"
FT                   /translation="MNSAIVPSVAALQMKQPRLGDVLIQAGAITKEQLAQALQLQKTTG
FT                   KRLGEIFISEGIISDTRLAEALSTQLRLPLFSLTRYHPMPEAIKMVPRAVAERLSLIPL
FT                   TIVDDGLLLITMSNPLDLLAQDEIRMLTGRNLKIGISTHEEIAKNLDRLYNLQNNLEEA
FT                   IVEIDPDTEINKELDVTASTEDAPVIQLVGNLLQQAVREGASDIHVEAYEKSARVRFRV
FT                   DGQLYTAFEYPVSLHPSVASRIKIMSGMDIAERRKPQDGRILIRVDGRRIDLRASILPT
FT                   MNGEKAVLRILDQESSNVGLDRLGLEPDDMEKIQMFCEMPWGIMLVTGPTGSGKSTTLY
FT                   SMLQRINQPDVNIITVEDPVEFSVAGINQVFVNEKAGLTFESALRSILRQDPDKVMVGE
FT                   IRDQKTAQIAIRAALTGHFVLSTLHTNDAPSAATRMVDMGVAAFLVSASLSGVIAQRLV
FT                   RRLCPLCREEYELAPKTCEELRVPVGTRAFRARGCNECRNGYKGRRGIYEIMVLDDDLR
FT                   RMVLEGASNLDLRNAAIEKGMKTLRQSGINAALAGFTSLEEVLTSTL"
FT   CDS             183015..184250
FT                   /transl_table=11
FT                   /locus_tag="SY1_01800"
FT                   /product="Type II secretory pathway, component PulF"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27723"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D4M778"
FT                   /protein_id="CBL27723.1"
FT                   /translation="MNFKYRVRASDGNIQEGQLEAESQGLALQALREKGLLVLSMNAAT
FT                   AGGREVGSSGAGLSFFEKLQRIGAVPAKAKMVFFRQMATMVQAGLTLSMAIDIIAEQER
FT                   SMVFKDVLLDVKGRLDRGIPMSQAMRAHPSVFNNMMISLVQAGEEGGLLDNSLERVAGL
FT                   LEKQAALKSKIRSAMFYPSFVIFFAVAVVVVFIAFILPKFQQVFRGMNIELPALTEMLF
FT                   SLGEYCTENWLSIVIWTLAVVGVLGFLLRSKATKPMMDRVKLKLPVIKSLVFKSGMARA
FT                   TQTLAALVTAGVPILRGLEMAENAAGNEVIRQGFADLQASAKQGVHLGDAAKRAKVFPI
FT                   LVCQMMRIGEETGHLDDMLERVARWYDQELDEQIKAMTSLMEPIMIMFVGGLVAVIALA
FT                   IFGPITAAMSQM"
FT   CDS             184351..184851
FT                   /transl_table=11
FT                   /locus_tag="SY1_01810"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27724"
FT                   /db_xref="GOA:D4M779"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4M779"
FT                   /protein_id="CBL27724.1"
FT                   /translation="MKMRKGFTLVELLIVIVIIGILAAAMLLSSGSATASAEASNIVSN
FT                   LRSLKAATMMFYADSMDAIAAVNGLLPGTVTVDALKGYTDNPERFADGKGYLFKSNTNK
FT                   NWFVGVDLEKLKMSSTMDEVMKKLEGKKDTLALISTTDATSAPANTTPSINTTHKVVWM
FT                   VAR"
FT   CDS             185084..185311
FT                   /transl_table=11
FT                   /locus_tag="SY1_01820"
FT                   /product="Protein of unknown function (DUF1659)."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27725"
FT                   /db_xref="UniProtKB/TrEMBL:D4M780"
FT                   /protein_id="CBL27725.1"
FT                   /translation="MPVSSTLRRSTVALKLNAGKNPKTGSTMVKSCSLAGIRGGADPEA
FT                   IVNVAELVAPVLAHPVTRVERTEVRTLERQ"
FT   tRNA            186360..186435
FT                   /locus_tag="SY1_T_24530"
FT   gap             186536..187180
FT                   /estimated_length=645
FT   gap             188802..189454
FT                   /estimated_length=653
FT   CDS             189701..191446
FT                   /transl_table=11
FT                   /locus_tag="SY1_01880"
FT                   /product="alpha-glucan phosphorylases"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27726"
FT                   /db_xref="GOA:D4M781"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="UniProtKB/TrEMBL:D4M781"
FT                   /protein_id="CBL27726.1"
FT                   /translation="MIQRLHRSDLGSSLRTLMENDPAFRPIAYFSMEVGLRESIPTYSG
FT                   GLGVLAGDILKSAADLGVPMAGVTLLYRKGYFVQGFNADDWQQEKPAVWDPAQELTLLP
FT                   NRISIRLQGREIQVGVWVYEIIGESGYPLPVYFLDTDFEPNHPDDRKLSWYLYGGDNRY
FT                   RLCQEFVLGVGGLRVLRDLGYKNIDTFHLNEGHAGFLTLELMREMGYYDPDKIREQVVF
FT                   TTHTPVPAGHDYFEYSLIDQVFPDEARSTLHRMLPDVPGVSMTELGLRYSRYVNGVAKK
FT                   HAEVSNAMFKMETVDWITNGIHPATWISSGMRKLYNKNIPGWEEDPGRLVQALTIPKED
FT                   LWAAHQASKLRLFARIMETNGVQLDPDVLTLGFARRAATYKRADLLFSDMARFRKVAGN
FT                   RKVQFVFAGKSHPNDNGGKALLQKIRRVARELESEIPIVFIDNYNMEIASLLTQGVDVW
FT                   LNTPIRPREASGTSGMKCAMNGIMNFSILDGWWIEGWIEDVTGWSIGPVPDEKDMGASY
FT                   DESLDAVDLYDKLEKKIIPTYYDDHDRWVSMMQHTIALDASFFNTHRVVREYASKAYSI
FT                   SFRGM"
FT   CDS             191452..192915
FT                   /transl_table=11
FT                   /locus_tag="SY1_01890"
FT                   /product="glycogen/starch synthases, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27727"
FT                   /db_xref="GOA:D4M782"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:D4M782"
FT                   /protein_id="CBL27727.1"
FT                   /translation="MSGAGGEAVKVLFVTTELAPFSKVGGLGDVAGSLPKALCQAGMDV
FT                   RVVTPAWPGVLEKVAAAGIKTTAMSRPACAAYNWQVREAKVVRAEVDGVTVYFLSAEDY
FT                   TGDMYPRQLDFWTVSPFAVFCMQALELHRATGWRPDLYHCHDWTTAFLPCALAWHRHYR
FT                   YAGERSVLTLHNVEYQGVFDPHPFMEASGLEPWSFNLSALEFYGRVNLLKGGIVATTAV
FT                   TTVSPTYAGEIQTHESTRELADVLYQQRGKLRGILNGIDTRYWNPEHDRALPARFTARD
FT                   LGGKQACRRELLRRTGFDVETEAPVVVCVSRLVEQKGFNLILEALDELPALGAKFVFLG
FT                   SGQGWIEGALERAAAAHPDYIRFFKGYDEPLSHLLYAGGSIFLMPSVFEPCGLSQMIAM
FT                   RYGTIPVVREVGGLRDTVTDADSPEGGDGFTFLTCDAKGMLWALRRAVARFRDQPSWQI
FT                   IVERAMKRDFTWTRSAELYKALYRETARC"
FT   gap             192963..193797
FT                   /estimated_length=835
FT   CDS             complement(193813..194826)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01900"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /EC_number="3.1.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27728"
FT                   /db_xref="GOA:D4M783"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:D4M783"
FT                   /protein_id="CBL27728.1"
FT                   /translation="MSLFADDKNLALELVRATEAAVMASGRWFGRGSKNDVDRSAVEAM
FT                   RYMLRGVAMKGVVVIGEGEKDEAPMLFNGEEVGAGEGPEMDIAVDPIDGTRLLAQGLGG
FT                   SISVVAAADRGSMFSPQDLFYLDKIVTGVEAADCIDIQAPVHVNVKAVARAKGKAVEDI
FT                   TVVMLDRPRNEKIRDEVRAMGARLRMIPDGDVSGALTTCLLGNETADLLLGSGGSPEAV
FT                   ITACAVKCLGGNMQCRPFFRDKKDEEKANARGLTRDTVLTLNDLVKSDNVFFAATGASD
FT                   GDLLKGVHYQGSHIQTSSLCMRGISGTVRYISAVHSPKKLSEMGSAIDYSPNKNNR"
FT   CDS             complement(195196..196455)
FT                   /transl_table=11
FT                   /locus_tag="SY1_01910"
FT                   /product="serine hydroxymethyltransferase"
FT                   /function="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27729"
FT                   /db_xref="GOA:D4M784"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniProtKB/TrEMBL:D4M784"
FT                   /protein_id="CBL27729.1"
FT                   /translation="MDKDADRYLRDVDPEIADVIVEEYRRQNDQIELIASENFTSRAVM
FT                   AAMGSVLTNKYAEGYPAHRYYGGCEVVDKAEDLARDRAKKLFGGDHVNVQPHAGSQANM
FT                   AAYFACLEPGDTILAMNLTDGGHLTHGSPVNFSGKLYNVVPYGVRKDTETIDFDQVREL
FT                   AKKHHPKLIVCGASAYPRIIDASKFREIADETGALVMFDIAHIAGLVAAGAHPNPVPYC
FT                   DFVTTTTHKTLRGPRGGMVLCKECFAKKVDSAIFPGMQGGPLMHVIAAKAVAFAEALKP
FT                   DFKDYQHRIVANCKRLAEKVMERGFRLVSGGTDNHLILVDLTSKGVTGKDVQIALDRAG
FT                   ITVNKNTIPFETLSPFVTSGVRIGTAAVTTRGFGAEEMDRIAGWIDRVVTHIADEAEIG
FT                   KVRAEISELCAAKPLYPGLY"
FT   CDS             197123..197854
FT                   /transl_table=11
FT                   /locus_tag="SY1_01920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27730"
FT                   /db_xref="UniProtKB/TrEMBL:D4M785"
FT                   /protein_id="CBL27730.1"
FT                   /translation="MRKTMFSLSLPLLAAAIFLLTQAVPAECLTAEDVKSYVDAAKALN
FT                   LNGDNLKIGSESAEEILKDDHFMALLRGRLRIARLLKAASDAEGGEGTYALHVEAGPIV
FT                   AFLCQGGAPTLDRLVQGAVEQVVKPLQLEATLKELPRYYEAIVATADWQKKFGKIMGEG
FT                   EYPSIQRGKIFHIAGFPEIGDKPYYTAAMDIELKDDTMYLSEWDASAEGWLYSFWMRRW
FT                   REGTMETAKIAVDLLNKALGQ"
FT   gap             197957..198860
FT                   /estimated_length=904
FT   gap             201715..202232
FT                   /estimated_length=518
FT   CDS             202566..204311
FT                   /transl_table=11
FT                   /locus_tag="SY1_01960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27731"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D4M786"
FT                   /protein_id="CBL27731.1"
FT                   /translation="MDEATLEPTRESVLEEIKKCRQKIGTLLMIYFMVVLLQVVSGAGN
FT                   LLLLFLGTAGGMSILGKALFAALPLLMWFYSQRPSSTGGVLMFYAVVEGIQAAILLAVV
FT                   SVGSFFFGFDGPSSVAMLPFVVLLVFGVVGGLLVLFVKLFRSASRLGQLMAAVGGASGN
FT                   FRAACLDAVMVVVAIVCYLAPALPAWDSVQSSRNLREELNQAPEVKIYRVKEVINCMAG
FT                   SPDGSLLALGTEKGLYVWDTGGRECVWSDDCLAVQRVRFSPGGRYLAAAGRGRVEGTSD
FT                   LAVYEVEGFRRLPGFDWPEHEEHKEKVFHDMVFRPDEETLLVLWHRSWIWNRMPQGWYG
FT                   DEADAVREREKDLGHDLDTVDLFCTEGNIKKNALSSFRRIRKGLSVDFDLCVEGSAYFA
FT                   SDASCFVYSIEGMQKEFNRFCLMDTEKWQEQLFHLSGYQLILWGIKPWYEWRLNANGTR
FT                   AYLLCEKELKEGGYEGVLLELDLQTGRTRELKSRGWRLALSADGEQVVMLAGNNQVSGV
FT                   VLIALNFLNLDTLAEKQLLYKVVQRDQGDSWRFIWLKPRLFAVAMKSEYGGTLTFIDLK
FT                   EGEDK"
FT   CDS             204308..204790
FT                   /transl_table=11
FT                   /locus_tag="SY1_01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27732"
FT                   /db_xref="UniProtKB/TrEMBL:D4M787"
FT                   /protein_id="CBL27732.1"
FT                   /translation="MTTWSHDKQLEMLQLIKLSYEMTSTCLKGEGGHGGYVPSYTDDLG
FT                   FTGAHFKNLDAMEGHDGHFHYTTRPRKLSAFLKYSEGPDSAVRRSLANKNKKGCRIGID
FT                   PATLLSVDRRRGLLCAYARPAFFKDCSSSRGSPVASAILVRSSPIRNRFRAVSVAR"
FT   CDS             207447..208691
FT                   /transl_table=11
FT                   /locus_tag="SY1_01990"
FT                   /product="conserved hypothetical protein TIGR00275"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_01990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27733"
FT                   /db_xref="GOA:D4M788"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniProtKB/TrEMBL:D4M788"
FT                   /protein_id="CBL27733.1"
FT                   /translation="MERFDAIVIGGGPAGLMAALRAAELGERVLLTEKNASLGTKLLLA
FT                   GRGRCNFTNAEPDPAAFIARYGEKGRFLWSAFSRFGPAETLAFFQKHGVETVTERGGRV
FT                   FPAEGGGQRVLNALLMLCRKFGVRILRSSPVRSLKVRDGRVERLITEVEELEANRFIVA
FT                   TGGKSYPRTGSTGDGYRFAEQAGHAIVTPMPALVPLKTHETWVKLAHGCNLRNVRVTAL
FT                   VDGKRVDERFGEMEFTNFGVSGPVIMDMSSSVPDWMAQGPLSLSIDLKPALTREKLTER
FT                   VRRDLEKFSARRFAGALKGLVPGPLIPMILELSDVPEDKPAAYVSSEEAEATADLLKDI
FT                   RLTVNGLWSFNNAVVTRGGVSLKEVDPATMRSKRCENLYFAGEVLDLNGPSGGFNLQIC
FT                   WSTGWVAGEGAQQPG"
FT   CDS             208757..209959
FT                   /transl_table=11
FT                   /locus_tag="SY1_02000"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27734"
FT                   /db_xref="GOA:D4M789"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4M789"
FT                   /protein_id="CBL27734.1"
FT                   /translation="MNDVIERIRELAGEFEPEVIALRRHFHSHPELSWQEERTTDRVQE
FT                   ELRKLGIETVHRGYDGTSSGLIADIQGGAPGKCVALRADLDALPVTEENDVEYRSQNEG
FT                   VMHACGHDAHTAGLLGAAKILMQIRSELRGTVRLLFQPAEEAGDRSGARAMVEEGALHG
FT                   VDAAFGLHVASIFPSGELLYRRGPCYAACDVWNLTIEGKGGHGSAPELAVDPTPAAFQI
FT                   GSAFQTVISREVSPRDTAVLSVGCLETSSRAFNIIPERVKMVGTVRTFERSVQDAVESG
FT                   MRRLSSDIASAFRCRAELDYQRSTAATFNDPAMTDLLIRAGTDLFGPEAMVEAPLNMGS
FT                   EDFSCFAEAVPSTYLQLGTAAPDRPGTHRPHHSAKFDLDEAQLKRAAAIHAAFAWTYLS
FT                   R"
FT   gap             210048..210436
FT                   /estimated_length=389
FT   CDS             complement(210682..211437)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02010"
FT                   /product="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenases, DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27735"
FT                   /db_xref="GOA:D4M790"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D4M790"
FT                   /protein_id="CBL27735.1"
FT                   /translation="MKERIYRAILTLAFTLSLLSLRAGMASAESLKFTGSPHFLPAPLM
FT                   VVGVYTPEGQANFAPFHRGGVLASGKDGGPMRIGFGIKGDAEKSWTYQCLKKMKACTVN
FT                   LPSVKYLAEAELLGRYSGRPLSGDAPLLSENGGFQDKLAVTKLTAVKGSAVNAPMIEEF
FT                   PISLECELEEDMPIAEGSKSRLMILVVRKVWADEAYLDAGGKINPKTADPDSSIVFFSH
FT                   SHAANGGFYGYGEMLGKSGPISDAYRQKK"
FT   CDS             complement(211458..212174)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02020"
FT                   /product="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenases, DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27736"
FT                   /db_xref="GOA:D4M791"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D4M791"
FT                   /protein_id="CBL27736.1"
FT                   /translation="MKGYRLLGVLAAALLCTPAQAAKVEVETGARLLPTTACLVGTYDA
FT                   EGRPDAAIIDRVGIAETPSKQRMIFYVAVNPKRQTAKNIEATGAFTVNVMNAALVPQGD
FT                   FCGTVSAASGDEYFDKFSVTGLKLEKGSDVNAPVLTECPVTLECKLVKTLEFPDGQHRV
FT                   FLGEVASYHVAAEALDGDKTAPVSQFDPQKSGMAVYFAGSAEGSGYYALSAPLGSGMSA
FT                   EKFPWPNGLEPKPAGH"
FT   CDS             complement(212417..212785)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27737"
FT                   /db_xref="UniProtKB/TrEMBL:D4M792"
FT                   /protein_id="CBL27737.1"
FT                   /translation="MGTILSTWVVYFFLSLMICLRQRLISRRPALIKPLSDSHSSFLAG
FT                   SLLICGCKPQMLRRSLMSRRGIVAASRRRWFIASVVDHDLDALDLFLCPCHSLPLHTQV
FT                   SPKDLPAAAWDDIFSDDL"
FT   CDS             212887..213126
FT                   /transl_table=11
FT                   /locus_tag="SY1_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27738"
FT                   /db_xref="UniProtKB/TrEMBL:D4M793"
FT                   /protein_id="CBL27738.1"
FT                   /translation="MLARRANISPSDAMKRTFRRGEDAVQGEGFAPPVNDASHRLRQIA
FT                   LGFLVLLGALAVLTGVPGWDILPKVFKAGIATLM"
FT   tRNA            complement(213226..213301)
FT                   /locus_tag="SY1_T_24910"
FT   CDS             213513..215165
FT                   /transl_table=11
FT                   /locus_tag="SY1_02050"
FT                   /product="Phosphoenolpyruvate carboxykinase."
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27739"
FT                   /db_xref="GOA:D4M794"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/TrEMBL:D4M794"
FT                   /protein_id="CBL27739.1"
FT                   /translation="MATIGAYDEENFKKVNKTQVRPTVEAVFYGNNVHRVLDLKEAYNL
FT                   AKNSPGTVELTGMPVYHPTEQELPQDANVLLFNDGAIFGRTAAARRIVGWPGVDANALC
FT                   TVVREAIFNTRHRRMYQADAYVGLDEDFMVKAHLLLPEGYENNLYNWMINFQYDNERYR
FT                   PRYAASRRISDTDGDIFFFADPDWSHPDFPLGLAFFSPEENCAAVLGLRYFGELKKGTL
FT                   TLAWGIAARNGYAACHGGLKRYTMKDGRKFVMAAFGLSGSGKSTITHAKHDGRYDIMVL
FT                   HDDAFIVNIKDKYAIAMEPTYFDKLADYPIGCEDNKYLLTIQNCGATVTGDGRKVAVTE
FT                   DMRNGNGRSIKSRLWSPNRVDRIDEPLNAIFWLMRDPTIPPVLKLEGPSLGAVLGATLA
FT                   TKRTSAERLAPGVDPNALVCEPYANPFRTYPLSMDYERFKTLLADGVDCYILNTADFMG
FT                   AKVKKEHTLGIIEAIVEGRARWVPFGDLPGLKTLDMPDFKVDLNDAAYREQLKARFQDR
FT                   LNFVIARETERGGVDRLPPDAREALEAVIAAMR"
FT   gap             215553..215769
FT                   /estimated_length=217
FT   CDS             complement(217453..218019)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02080"
FT                   /product="Micrococcal nuclease (thermonuclease) homologs"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27740"
FT                   /db_xref="GOA:D4M795"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="UniProtKB/TrEMBL:D4M795"
FT                   /protein_id="CBL27740.1"
FT                   /translation="MERMLKRLVLAFLALLAGWLGLEHWQGQTGDVLSAPVVRVVDGDT
FT                   IVVSVEGSNRKVRLIGVDTPETVKPNTPVQYYGKAASDFTKRELTGRRVWLEYDAEPTD
FT                   RYGRHLAYVWLTSPPESADEASVRRDMFNAQLLTGGYARVLSIKPNTRYRELFARLEQE
FT                   ARRTGIGLWGQEGRSTGRSGARSRH"
FT   gap             218948..219797
FT                   /estimated_length=850
FT   CDS             complement(220106..220291)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27741"
FT                   /db_xref="UniProtKB/TrEMBL:D4M796"
FT                   /protein_id="CBL27741.1"
FT                   /translation="MPLAMVAAEAGAGPEALARRYRVSRQAMALRLRSISALVRAERPD
FT                   PLTAALSCGGTFCPSA"
FT   CDS             complement(220291..220638)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02120"
FT                   /product="Domain of unknown function (DUF955)."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27742"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:D4M797"
FT                   /protein_id="CBL27742.1"
FT                   /translation="MFQDGLLGPAREAAASLLRSTMPRMSAPPVSLSVICDHLDIEVYA
FT                   QPCDAFGALLAEVRGRRVLMVNTSIPLVRARFSIAHELGHALLGHRSALERPSLSDERQ
FT                   DARPTSSRRSS"
FT   CDS             complement(220644..221066)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02130"
FT                   /product="Predicted transcriptional regulator with
FT                   C-terminal CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27743"
FT                   /db_xref="GOA:D4M798"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4M798"
FT                   /protein_id="CBL27743.1"
FT                   /translation="MASIGANIKARRRALGMNQEELARKLGVTQANISRIESSVKGLSS
FT                   DMLLPIASALSCDVRELLGLKCDDRTELSALGEDARTFVTRTLENDPQLALYLRSFVKD
FT                   QDSFTEEDWKFLASSLRLALGYAVDAIKTRRVRDGF"
FT   gap             221935..223662
FT                   /estimated_length=1728
FT   gap             225467..226311
FT                   /estimated_length=845
FT   gap             227218..228510
FT                   /estimated_length=1293
FT   CDS             229026..231764
FT                   /transl_table=11
FT                   /locus_tag="SY1_02170"
FT                   /product="Flagellin and related hook-associated proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27744"
FT                   /db_xref="GOA:D4M799"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:D4M799"
FT                   /protein_id="CBL27744.1"
FT                   /translation="MVVMHNIPALSAYNTVNRTSSSLQKSIQKLSTGLRINSAADDAAG
FT                   LAISEKMRAQIRGLDRAVSNSQDGISMIQTAEGALNETHSILQRMRELSVQSANDTLTQ
FT                   QDRGYIQLEIDQLREEITRIGNTTQFNKKKLLNGDAAVLWSSDNLNTKAIINGGLRQID
FT                   QFGQKKASEGNYKIDVRAEPGQAEVKKSDIFKIKHKDVITDVTLNAVAGAKGVSVNNVP
FT                   AGDYTINKAAAAVTDTAPALQGAYNAKSFHASGAQLTFKKITAPVAGASDASITVAGVK
FT                   INLTNLVKDDEPGKVRDKVVAALTTKEAKQEFAKAGYAIKLKESGTDKLDIVAVKTDGT
FT                   DALGKGAGLIQYTPGAVTPADAIDVGDGTSGLDNTLVSIDDPAKKTLTATNTNAINTNA
FT                   NILFEVTNVNHDSDSVTLKATVSKLGVDGKTSTVTYEGIVLKGGEAPTNLGDKLGLGAA
FT                   AAFTLKLEGYGSYGFEKGSKLVYNVSKGNDGADPKADVKLTVSGKQNQEWDGKWGTDVT
FT                   RNSASYGLKSDLVKGKDISFKNYYLNEKTGEVMEGTVKLTLNDDFAATPTGELAKFHAT
FT                   YVGEVARGDVKLRDLDKFWDSQGVFSQKDAKTLTITQGDGKQTSVTLYANDTLKDVQDK
FT                   LNAAIGVGLGQAKYVDGEGGKHFVDFVDTASGNSESVAGTFVIRSVVSGSAGTISFSGD
FT                   ENIINALSLNVIQDATESSYTVSVKDAHSGDIVASNVQITGNRLYGVVNPNVDVEFDAM
FT                   AGVSAKWDSARKGFVYAAKDYSTTLHLADNTTVFQIGANEGEDMGINIGDMRAHALGLN
FT                   AVLVTDRESAARSITIIDNAIDKVSTQRAKLGAYQNRLEHTINNLNTAAENLTSAESRI
FT                   RDTDMAKEMMNFTKLQIMLQAGTSMLAQANQLPQSVLTLIR"
FT   CDS             231925..232317
FT                   /transl_table=11
FT                   /locus_tag="SY1_02180"
FT                   /product="FlaG protein."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27745"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7A0"
FT                   /protein_id="CBL27745.1"
FT                   /translation="MQVNLSAKAVLPAAPEGLPAAGGGVPEGVRPPEAAQAAPDVLRED
FT                   PAASPEREPDRDAQKDVLEKVLEVVNLLAPDRHLKYEVIEEADMVQIQVVNNEDGQVVR
FT                   RIPADEIIEMVKQIHKALSERLDVVA"
FT   gap             232399..233284
FT                   /estimated_length=886
FT   gap             234517..235817
FT                   /estimated_length=1301
FT   CDS             236022..236276
FT                   /transl_table=11
FT                   /locus_tag="SY1_02200"
FT                   /product="prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27746"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7A1"
FT                   /protein_id="CBL27746.1"
FT                   /translation="MFTIDTAPATQVRERFKDYCDDVERTNKALIVTRRDKPQVVVVSF
FT                   AEYNRQLNNERYLAKLRRSREELDNGEGQTMTPEELDAF"
FT   CDS             236276..236542
FT                   /transl_table=11
FT                   /locus_tag="SY1_02210"
FT                   /product="toxin-antitoxin system, toxin component, Txe/YoeB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27747"
FT                   /db_xref="GOA:D4M7A2"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7A2"
FT                   /protein_id="CBL27747.1"
FT                   /translation="MHEDTTFSPTALEDFSYWAQNDRKTLAKIKALIADIHRNGLMSGI
FT                   GKPEKLLGQSGEYSRRITTEHRLIYRLDEDRLKILSCRGHYQE"
FT   CDS             236867..237640
FT                   /transl_table=11
FT                   /locus_tag="SY1_02220"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27748"
FT                   /db_xref="GOA:D4M7A3"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7A3"
FT                   /protein_id="CBL27748.1"
FT                   /translation="MEDRISLEGKVAVISGGAGGIGLGTARVLGRHGASVALLDLKAEA
FT                   GEAARAELAGMGIDAMFVRCSVTSEAEVTAAVDAVVGRYGRIDVLFNNAGVTVRKTVVD
FT                   LTEAEWDFVLGVGLKGTFLLSKHVIPVMAKGGGGSIINTGSGWGLKGGDKAAAYCAVKG
FT                   GIVNLTRAMAIDHGPQNIRVNSVNPGDTDTDMLRDEGRQLGEEEGAFLRDSARGRPLAR
FT                   LGTPEDIGRAVLFLASDLSSWVTGAALVVDGGGIA"
FT   CDS             237666..239048
FT                   /transl_table=11
FT                   /locus_tag="SY1_02230"
FT                   /product="glycine dehydrogenase (decarboxylating) alpha
FT                   subunit"
FT                   /function="glycine dehydrogenase (decarboxylating) alpha
FT                   subunit"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27749"
FT                   /db_xref="GOA:D4M7A4"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020580"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7A4"
FT                   /protein_id="CBL27749.1"
FT                   /translation="MSKRNVPYIPNSDPAIQAGMLKAIGARSIDELIERNIPKELLMKE
FT                   PLKLPAPFTAEGDLVRHVSAILDKNRTAQELTCFLGAGCWNRYVPALVDEVIGRSEFLS
FT                   AYAGEPYEDHGRFQACFEYESMMAELLDCDVVNVPNYDGSQAAGTSLRMATRVTKRDEV
FT                   LVTAALNPDVLQAVRTYLDPDVALTLVDYDRRTGRVDLADLEKKLSHKAAAVLVMNPNF
FT                   FGIVEEEAEEAARMAHGAGALFLVYAEPSLLGVMKPPFQYGADIACGDIQGLGIHMNYG
FT                   GGVAGYIASEDRPEIVREYPSRLFGLAPTTHGEWGFGDVMWERTSFANRDHAKEFVGTH
FT                   AALWSIAAAVYLASMGPEGMRELGQTILQRSLLARRRLASVPGLTVCPLSGTPFAEFVV
FT                   RFEGRSVAEVNEALLARGILGGYDLGAKFPELGQCALLCVTERTTEEDIDGLTAALTEI
FT                   LG"
FT   CDS             239065..240651
FT                   /transl_table=11
FT                   /locus_tag="SY1_02240"
FT                   /product="glycine dehydrogenase (decarboxylating) beta
FT                   subunit"
FT                   /function="glycine dehydrogenase (decarboxylating) beta
FT                   subunit"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27750"
FT                   /db_xref="GOA:D4M7A5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7A5"
FT                   /protein_id="CBL27750.1"
FT                   /translation="MDKIADKRDTSLTKFHQASWNEPIIYELSVKGQRGVLVPQVSEKV
FT                   ALEVGDGVSSLPACMRRETPPDLPEIGQPQLARHYNHLSQENLGVDSNIDIGQGTCTMK
FT                   YSPKVNDRLASGPKVADMHPLQPDGTAQGILEIVWRLGRLFGEISGLECFSVQPGGGTH
FT                   GVLALASIVRAYWQKRGEEGRDTVITTFFSHPSDAACPIVKGYKVIVLPPDEEGLPDLE
FT                   AFKAALDEHTAALFMTNPEDTGIFNRRIREFTRLAHEVGALCCYDQANANGLLGITRTV
FT                   EADFDMSFFNLHKTFSSPHGCGGPAVGMITCRKEFRDCMPVPLVEHSPERGYYLDFDLP
FT                   HTCGKVKSFWGVAPVVVRAYAWIMSLGAEGLKEASRVAILNNNYCMKRILDIKGASISF
FT                   PAHAPRVEQVRYSWQKLKEDTGFGTADVSRRIPDFGTHYWSSHEPWVVPEPFTIEPSES
FT                   YSREDLDAYCDVLKEIARECYEEPEVIRAAPLNSTVHHTSHDYFDDPERWALSWRNYRQ
FT                   KYTGYFQPRKK"
FT   CDS             240652..241764
FT                   /transl_table=11
FT                   /locus_tag="SY1_02250"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27751"
FT                   /db_xref="GOA:D4M7A6"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR011386"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7A6"
FT                   /protein_id="CBL27751.1"
FT                   /translation="MKIAFLVNPVAGMGGAVALKGTDGAETLRRALALGAVPRAHLRAG
FT                   AALSAALPVPDGVRFLSCGGEMGEAILASLGIPCGVVYAPEGRTSGEDTRRAARAMAEA
FT                   GADLIVFAGGDGTARDLCAALEGRAVPVIGVPAGVKIHSAVYGVTPVRSGQLLAKFMNG
FT                   QVRDFTRADVMDIDEEAFRQGHVNARFYGCLTVPLDRSCLQDRKSGGMARDEYDRTAIG
FT                   AWLADQMRPGRLYLVGSGTTTQAVMDALGLPDTLLGVDAVRDRRLVGRDLTERAILEMA
FT                   RPGDTTLIVTVIGGQGHVFGRGNQQLSPEVIRTAGRENVVVAATPAKLNALFPRPLLVD
FT                   TGDADLDRALSGYVPVVTGWARRQMCRLSR"
FT   CDS             241882..242634
FT                   /transl_table=11
FT                   /locus_tag="SY1_02260"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27752"
FT                   /db_xref="GOA:D4M7A7"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7A7"
FT                   /protein_id="CBL27752.1"
FT                   /translation="MARYEELEGRRVMVTGAASGIGLATACRFAEEGARVFVVDYNAEA
FT                   LEETRKAHPEFAGFSPADVSREEDVAAAFRQMDRELGGIDVLISNAGISVRNGVLDVSY
FT                   SQWNRTMGINLGGMFLCAREAGRRMKEQGGGVILMTASTNGTEGHRWYADYNASKAGVI
FT                   LLTKTMALELAPVVRVNCVCPGYVLTPMQRAEYTDEMLAKVNEGIPMKRHAEPEEIASL
FT                   YAFLASDDARYITGADVRIDGGETAGLY"
FT   CDS             242854..244329
FT                   /transl_table=11
FT                   /locus_tag="SY1_02270"
FT                   /product="transporter, NhaC family (TC 2.A.35)"
FT                   /function="transporter, NhaC family (TC 2.A.35)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27753"
FT                   /db_xref="GOA:D4M7A8"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7A8"
FT                   /protein_id="CBL27753.1"
FT                   /translation="MIALLKLSPIAVLAGMMIGGIDILLSAPVAFVCAVLVAMATEHYS
FT                   FGELQDAALDNLRHFLIVFLILQAAYAVAECFMSTGVAAAIINMALSMGMTAKLVAPAC
FT                   LVVTAILSVATGTSWGTFAACAPIFLWLNHIVGGSTVLVIAAAVGGSCFGDNIGLISDT
FT                   TVVSSGMQNVSVIDRVRHQGVWSGLCLLLGVAAFYFASVSMGLSDVAGSAEEAIRQIPD
FT                   TVWAALEEKRPAAVTLLHQVQAGVPYYMVIPLVLVLILAARGTSTLICLAAGILSSLVF
FT                   GFAAGTVTSLAAFGERVYAGFSDAGGWSIAMMLWVGAFGGVMRKMNAFDPIAAAVLKCV
FT                   SRVRQLMFANAALCLLGNAALADEMAQIVTLSPIIRNLTEQNVEGDPKALYRLALRNAT
FT                   FADAMAVLGAELIPWHAYMAFFAGIAWAVYPLAAGTVSLGDIILHNYFAWIAVGSMLIL
FT                   TWTGWDRFVPLFALPTEPEVRLRRAADPEPKEK"
FT   CDS             244664..246175
FT                   /transl_table=11
FT                   /locus_tag="SY1_02280"
FT                   /product="S-layer homology domain."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27754"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7A9"
FT                   /protein_id="CBL27754.1"
FT                   /translation="MKKFAAAIAVAVLFAFAAPVFAATNPFMDVPMNHWAYDAIGQLAA
FT                   HGILSGYPDGTYKGKQPTTRYEMASALARALAVVDMTKASKQDVEMLKKLVVEFKDELE
FT                   ALGVKVENLDERVSLLEERLGGWHIHARLRLDIENYEDRDAPESENKVYLKQGRLWIER
FT                   WFGDEENPMHAVIRLDEGTKNWSRFYAEIPFFFETTLTAGRFVWDLEDEYYLGGATSLP
FT                   ETGSFAAYDSILTDRTMDALGLEKQWGMGKFIAYVAHPSNEYYDRGGKAPKTLGAWELF
FT                   AMGKLQFTERFGFDLGLQAFLGDNAEYIDTASSSGWSFDNLWTIFAGLRFNFNDDIALK
FT                   GIFYHQQLNGDVWVPGAAGGVWKDADLDSANHWKLIVDVNQEALKFTSLWLEYGQMDKN
FT                   FIVPAELGGNGALFTTDAFSYVLPDDLKYWRVALGQEWNDKWATHLFYNGYNFDTDVDL
FT                   TEWGLGVQYTYNPSVKFGLNYVKIDWDDDKKNDDHVLRFRTQVVF"
FT   CDS             complement(246336..246473)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27755"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7B0"
FT                   /protein_id="CBL27755.1"
FT                   /translation="MPREKILILVKACPEPSKGYIETTCVAGITEVGEMRRLLPVPFSR
FT                   "
FT   gap             247020..248286
FT                   /estimated_length=1267
FT   CDS             complement(249007..249579)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02300"
FT                   /product="MTH538 TIR-like domain (DUF1863)."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27756"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7B1"
FT                   /protein_id="CBL27756.1"
FT                   /translation="MTKVKEKVFYSFYYKQDVMRVQNIRQMGVLEGNEPVEPNKWEEIK
FT                   KKGDDAVRKWIDEEIARCSCVIVLIGAETASRKWVKYEIKRAWNANRGLMAIYIHNLSP
FT                   VNDSLASKGLQGQNPLCSFWLRSDEQVLELYTVAPVKNPSEWDAYDEIHENLNCWVQEA
FT                   IDVRKKYARYTCVPTTVKRIFGKSLEH"
FT   CDS             complement(249579..250022)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27757"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7B2"
FT                   /protein_id="CBL27757.1"
FT                   /translation="MIKGGRNMPEGYDRVAHLGFIQGAINRMAGNSFLCKGWAVTLFSA
FT                   LSAFVVSAEGSHVLCVPWLLAAAVLVFWWMDSWYLRMERLFRRLYDRVRLGDEAGNPYD
FT                   MSFKPFMGEEQCVFRIMFSRSTLPVYSVMLVAALVLFFVRRGC"
FT   CDS             250770..250970
FT                   /transl_table=11
FT                   /locus_tag="SY1_02320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27758"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7B3"
FT                   /protein_id="CBL27758.1"
FT                   /translation="MEVLNMAANAPEQRVMSVSPRRIAAMVNIKTANLNREEAKKLMLD
FT                   EMAERFDEAWAQQEKWKEARA"
FT   CDS             complement(251265..251495)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27759"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7B4"
FT                   /protein_id="CBL27759.1"
FT                   /translation="MTVAQVAERKALYRRFRNLSDQDAARVLQLIDELEDPEPNEETLA
FT                   ALKESERIAHDPSVKGYSSAAAMMADILADV"
FT   CDS             complement(251993..252265)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02350"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27760"
FT                   /db_xref="GOA:D4M7B5"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7B5"
FT                   /protein_id="CBL27760.1"
FT                   /translation="MKTDSVIRARIDSDVKHKADAVFARRGVSASTVIRAFFSTVAETG
FT                   ALPIELNVPNEETAAAIRDGRAGLGVRRFDNAASMFATLDEEDGE"
FT   CDS             252371..253057
FT                   /transl_table=11
FT                   /locus_tag="SY1_02360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27761"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7B6"
FT                   /protein_id="CBL27761.1"
FT                   /translation="MVQRYRNQINEAATPAAFGRNYVDGAATGVNVAGAIAGAGDELRR
FT                   FAEVRKRQQDEWDAATVMNAQTEYARQMAEWMDDPETGKLQTLKLGAARGLTDETFQYA
FT                   DELAEKIAGGLENENQKAAFLRIAERAKLPYWKQASEYEGEDPPGQPEPLQPLPDRRGQ
FT                   GVQAPAAPRQKRSKMIPDGTPYDPPAPSGHPPCRGGKRVGLRLSPPCRESREGTAGLWG
FT                   AGCSPT"
FT   CDS             253042..253935
FT                   /transl_table=11
FT                   /locus_tag="SY1_02370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27762"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7B7"
FT                   /protein_id="CBL27762.1"
FT                   /translation="MLPDVKARRTGKFDDWRGYRNGKHNGEDWAAPEGISRAVEEADSD
FT                   LEAARIAVVVSEDPVAALAMTEGSEYLLPDTAAGLRKKLSGEVERLERQAAAEAEKAAA
FT                   YAATDALMDRFGTDERAAWNAMENDPSLDPETRERIWGKYKARLSDRERWEAQRDRDYM
FT                   SGWMDKIADSSSLEEAQQLIQDSGADGKQRVQMERWAAQIHRPEKFKEDVRDWAQAFKE
FT                   VTNGQIKTDEELIYRWGGRLSSSTMKSLVRMFYKERASGTGKKGADYVGYSFSKAITTA
FT                   ILRGISRTRNRPGLRS"
FT   gap             254375..255892
FT                   /estimated_length=1518
FT   CDS             complement(257780..258478)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02400"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27763"
FT                   /db_xref="GOA:D4M7B8"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7B8"
FT                   /protein_id="CBL27763.1"
FT                   /translation="MGSIAEARAEGDWYARNMNAANLEEVYRTRLPRVRQYLEAEIGFV
FT                   RSFLSGRERVLELGAGYGRIVKELAPFTASIVGIELSEASVAFGKEYLKDVPNAELKVM
FT                   DAHHLHLAAEFDVVLCLQNGLSAMKGDPLNLVRQAVSVLLPGGRALFSSYSPKFWEHRL
FT                   AWFQEQAEKGLLGAIDPDRTKDGIIVCRDGFEARTFSLEDLEALGNAIGCDHFLEEVDA
FT                   SSVFLVVTKP"
FT   CDS             259114..259488
FT                   /transl_table=11
FT                   /locus_tag="SY1_02410"
FT                   /product="ASCH domain."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27764"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7B9"
FT                   /protein_id="CBL27764.1"
FT                   /translation="MKALSIKQPWASLIAGGYKTIEWRSWRTHYRGPLLICSGKTPDDI
FT                   YFEFDPDEARQNWPLGVAVATVELVEVRPFEPKKDAEAAMMEEDALPSVQGFSWVLENP
FT                   VVVPDTPPVRGKQGLFEVVL"
FT   gap             259591..260110
FT                   /estimated_length=520
FT   tRNA            complement(260233..260308)
FT                   /locus_tag="SY1_T_24900"
FT   tRNA            complement(260315..260390)
FT                   /locus_tag="SY1_T_24890"
FT   CDS             complement(260912..261472)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02430"
FT                   /product="DJ-1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27765"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7C0"
FT                   /protein_id="CBL27765.1"
FT                   /translation="MASAAVFLIDGFEETEALTTVDILRRGDVEVTTVSLTGRGDAVSS
FT                   RGVSVRADALFDDAKDKDFDMLVVPGGTVEYARHEGLRTLVQKYDAAKKRLAAICAAPL
FT                   ALERAGVLKDRRAVCYPGMEPQIPSAILGTENVVTDGHVTTAKGPAITPFFALKLLELL
FT                   CGKERADEVAKDFLIPLIGGGQR"
FT   CDS             complement(262933..263211)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02450"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27766"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7C1"
FT                   /protein_id="CBL27766.1"
FT                   /translation="MNDLLSLGILYVLGIFVLIYFFTVLPARKKHKRVQAMHAAVKEGD
FT                   EIVTIGGVIAQVLSRDGMELVLKLNDAGTTMKIVVYAVQSIRKTGTR"
FT   CDS             complement(263281..264459)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02460"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27767"
FT                   /db_xref="GOA:D4M7C2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7C2"
FT                   /protein_id="CBL27767.1"
FT                   /translation="MNLWEECKGLQDYIVGIRRTLHQIPELGTDLPKTQAAICAELDKL
FT                   GIPYKKNVGDSGLIGTIQGGKPGKTILLRADIDALPIQEDTGLPFASKHEGRMHACGHD
FT                   THAAMLLGALRVLNEHRAELAGNVKFVFQTGEEVCKGAKVAVKEGVMDGVDAVFGMHIG
FT                   SIFEGMPLGSFAIAPGCIMASFDRFVLTVKGTGCHGSTPEKGVDPITIASNIVLSLQEV
FT                   IAREIAAPKAAVLTIGKIAGGFAYNVIPNEVVIEGTIRAFEDPVRQHLAKRIGEIGKGV
FT                   AATFRGGCDFEMDWGAPPVVNDDAMAKLAAEAAAKALGRENVVTAFNPVMGGEDFAYYL
FT                   EKAPGAFMALCSVNPEKHADAPHHNPKFDVDEDVLYRGSVVFVSIVEEFLGR"
FT   gap             264555..264769
FT                   /estimated_length=215
FT   CDS             complement(264918..266102)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02470"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27768"
FT                   /db_xref="GOA:D4M7C3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7C3"
FT                   /protein_id="CBL27768.1"
FT                   /translation="MNLWKECEGLQDYIVGIRRALHQIPELGTDLPKTQAAVCAELDKL
FT                   GISYKKNQGDSGLIGTIQGGKPGKTILLRADIDALPIKEDTGLPFASKHEGRMHACGHD
FT                   NHAAMLLGALRVLNEHKAELAGNVKFVFQTGEEISRGAKVAIKEGVMDGVDAVFGTHIG
FT                   SILDPNIPSGTLIVVPGCAMASFDRFVLTVKGTGCHGSTPEKGVDPITIAANIVLSLQE
FT                   VIAREIAAPKAAVLTIGKIAGGFAYNVIPNEVVIEGTIRAFEDPVRQHLAKRIGEIGKG
FT                   VAATFRGGCDFEMDWGAPPVVNDDAMAKLAGDTAKKVLGAENVITSMPAPNMAGEDFAY
FT                   YLEKAPGAFMFLSSSNHEKHTDIPHHNPKFDVDEDVLYRGSAMFVGLVEEFLGC"
FT   CDS             complement(266158..266826)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27769"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7C4"
FT                   /protein_id="CBL27769.1"
FT                   /translation="MSEHDHMAEWKKGSILIGAPTNLIAAATAFIPVLWLCSTHHCWPD
FT                   WNVVLTAWGMTAASFGAFYLVEPISYYAALGMAGTYLGFLSGNIGNMRVPVAALALEAT
FT                   DSQPGTIQAEIASTMAICGSIIMNLFFTTLAAVVGTAVVAVLPKFIVTGLTKYSAAAIF
FT                   GGTLGNFAIKYPLVGVFALGLPLLLHWAIPSIAAWLLIVISVFGSITFARVLYGMGMGK
FT                   "
FT   CDS             complement(266860..267591)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27770"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7C5"
FT                   /protein_id="CBL27770.1"
FT                   /translation="MQDGQSYLDIANSSIIWMLCAITVGIAFLQAILFMCMARRTRLRA
FT                   GIPAEISSKALRVGLITSIGPALGVFIVMVGLMAAIGGPMAWMRLSIIGAAPTELTAAT
FT                   YGAQASGVELGGTGYDLTVMSVSWFAMALNGAGWLVFTGLFTPAVEKLREKASGGDSRW
FT                   LVVLSGACSLGIFGYLVHGELRKSSGHATAAIAGALCMLFLVKFVVPKCPKLMEYSLGI
FT                   AMLFGMACALVYDMYFAVMPQ"
FT   CDS             complement(268164..270206)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02500"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27771"
FT                   /db_xref="GOA:D4M7C6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7C6"
FT                   /protein_id="CBL27771.1"
FT                   /translation="MSIRGKLKLMVTVVFLIIVTMTLVTHFRSTSIVSDLQERTGNEIV
FT                   TGSAGVIREYLDKYASVTRMAAAEVRHAILENPDVQRKDLEALMASLAGSVESLGLVGL
FT                   YLGTSSDGQLYSSDGWNPEGYDSRTRPWYQAALKAQGGEPIFTTPYVDATTGTSILSVV
FT                   QPISDRSGGLIGVVGVDIKMEALEQFVVSQKMFGHGSGAMILEDGLLVAHTNQSFVLKA
FT                   NLLNPADFSDSVSAFARRMVAGETGFARYEFQGEPHHAFFTPVGNGFFFYIFLPTKVME
FT                   ARTHALTVLNVTMALIAIAFSTIFILFIIRGLSRAIRGMTSVTDVLSGGDLTARFEASG
FT                   RDELARIAGLLNSMLDSISGALSRVRGEAEESSRQASTLAALSQETLASMEEVSASVAQ
FT                   VNGLMEAASASTEATGVSVSEIAASAQSSAQASTDGAQQAAQVAEAARNAAEEVTKVLK
FT                   SMSSVGDAARQSLQGIRELGQSVDSISGFVATITSIADQTNLLALNAAIEAARAGEAGR
FT                   GFAVVAEEVRKLAEESGRAAQEVSKLIANLQKESESSTVMTESAGPLLQRAMEDAESAQ
FT                   RRLDAAQEAIESLNQGIQSIAAAAEKQAASSEEIAEAMKNLSDSNAKIMDSTAAIRDSS
FT                   HETTTAAESIATAAQSMAETSERLNGLVDAFVLDEKRDHPAFLKG"
FT   CDS             270491..271318
FT                   /transl_table=11
FT                   /locus_tag="SY1_02510"
FT                   /product="Organic solvent tolerance protein OstA"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27772"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7C7"
FT                   /protein_id="CBL27772.1"
FT                   /translation="MGLAALLALWLAGAAFAVDEQGLPDKAKLSANRMRFDSTTGDFLA
FT                   EGEVLITADGLTVRAPRGSGNVPRREAAFDSGVTASGTWMGDAVDLRAGRLTLNFAEAP
FT                   ACRLQDGVKGAVGTMGLDADRLTLIGAGGVGSPTEEDQQTKFWIVGAHRLEDRSRGLTF
FT                   GADSIEGVLREGALASMTAKDRVWVRGRPKQSGEPVSINGDHALYSLQRGSVVLSGRVV
FT                   AVQGGRTLRSDSIVYFPDQNRVEALGGITRNESGTVSADRAEITIDLKRERRK"
FT   CDS             complement(272235..273326)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02530"
FT                   /product="DNA protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27773"
FT                   /db_xref="GOA:D4M7C8"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7C8"
FT                   /protein_id="CBL27773.1"
FT                   /translation="MDSTLKAALLMNAAHAPLPAFRKLCENYAPEDLKREELWDALNLT
FT                   PSVRKNLSRLLREGDWPEREEERAARFGARFLTVDDPDCPARLQDLSQPPIGLYVKGKL
FT                   DVALPSAAVVGTRRCSAYGKTVAEALGRALARGGLMVVSGGARGIDAAGHRGCLAEGGV
FT                   TVAVLGTGIDRVYPMEHRELFAQIAETGALVSEYPMGTDGAAWHFPERNRLIVGMTGRT
FT                   VVVESPEDGGAMISARLALDLGREVWCVPGRITEGVCRGTNRLLRDGAEPLVDVDEFIH
FT                   CATGRYGQLVLDLDEPAARPQPPLSTDEKVVLALLQRQGGRTMDELLAESGLDLVTLQT
FT                   CMMTLSASGLAVVSGPGRFSAGV"
FT   CDS             273610..275412
FT                   /transl_table=11
FT                   /locus_tag="SY1_02540"
FT                   /product="heat shock gene repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27774"
FT                   /db_xref="GOA:D4M7C9"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7C9"
FT                   /protein_id="CBL27774.1"
FT                   /translation="MTERQLSIILAVVYEYIKTGEPAGSRTITKKYIKGLSPATIRNEM
FT                   ADLEEMGYFYQPHTSSGRLPTAKAYRVYVDSVTARARSRSSRGAEAWRRELMGRRSGIE
FT                   DLLNYVTNLLSRLTNCVAVAAVSGLDSMEIWHIDLMPLGGKNVLALIVLKGGLVHHTEF
FT                   TLPCEVEPGLLEELSRRINTIACEHSWSEVHDVLYQYVLGGLEEAETACRAAISDVDRF
FT                   LTEQNYRFFSSGAKHILSLPHFQALSRLQAVLTLLEQEKPLASMVEQCRQASDLRVSLG
FT                   DENETDGMQESAMILIPARACQQKAVLGLIGPLRMDYERSISVLEAVADALDDEAGEPG
FT                   RLRKEEALNAQEKNKRAGRKGLPTRMSRNAGDDRTAEREMSAMTEERLKEDYLIPEAED
FT                   ALGDSEAEAMSRPVKEYSIGEDGVLIEETPEPEEKAKGKEKEEGAAHPPAKEPDEGAEE
FT                   RVAELERQLAVARADFYNYRQRAMRERQDLRRRAMEDLIVSLLPVLDNLDRALSVPEDG
FT                   SAKDILAGVKMVSRQFLSVLDEMGVSAIPAKGERFDPALHEAIGAVPVEDAEEDGAVVD
FT                   EQLRGYRTKDRVLRPARVLVGKAE"
FT   CDS             275520..277358
FT                   /transl_table=11
FT                   /locus_tag="SY1_02550"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27775"
FT                   /db_xref="GOA:D4M7D0"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7D0"
FT                   /protein_id="CBL27775.1"
FT                   /translation="MSKVVGIDLGTTNSCIAVQEGDQTTIIPNNEGARTTPSVVAFTKD
FT                   GERLVGQLAKRQAIVNADRTIMSIKREMGHDYHVEIDGKKYTPQEISAMILQKLKRDAE
FT                   DYLGEKVTQAVITVPAYFTDAQRQATKDAGTIAGLEVLRIINEPTAACLAYGENRKEEH
FT                   KILVFDLGGGTFDVSILDVGEGVFEVLATAGDNRLGGDDWDNRIVDWMVSEFKKTEGVD
FT                   LKNDSMAMQRLREAAEKAKIELSNMTETTISLPFITATQAGPKHMEMKLTRAKFEEMTA
FT                   DLLDRTAVPTQRALSDSGLDPSKVDKVLLVGGSTRMPMVQKKIVEIMGKEPTKGINPDE
FT                   CVAAGAAIQGSILTGDHKDIVLVDVTPLSLGLETLGGVFTKVIERNTAIPVSKSQVFTT
FT                   AANNQAQVEIMVLQGERSMAADNVKLGQFVLDGIPPAPRGIPQIEVTFNIDVNGILNVS
FT                   AKDKGTGKSQKITIQSSNLSKDEIERMKNDAETHADEDAKKRSAAEVRNEADSAVFGAE
FT                   KLINDYGDKMTAEEKGKLNSQIDDLKQAIDKKDEAAMRRAKEALEGTVQAFSTRLYQAA
FT                   GAGAEGAAAENDAGGAGAGGGDGETVDAEFSDKGNA"
FT   CDS             278851..279765
FT                   /transl_table=11
FT                   /locus_tag="SY1_02570"
FT                   /product="DnaJ-class molecular chaperone with C-terminal Zn
FT                   finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27776"
FT                   /db_xref="GOA:D4M7D1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7D1"
FT                   /protein_id="CBL27776.1"
FT                   /translation="MAVQYKDYYEILGVPRSASVDEIRKAYRKLAKKYHPDVSKEKDAE
FT                   QRYKEVNEAYEVLKDPDKRQKYDTLGMNWQAGQDFTPPPGWQGGGAGGGFRVDFGGDAG
FT                   GFSDFFKTLFGGGLSDLFGGAGGGNFSSAGGYSPVRRDSEVDLELPLEEVVRGGTHTMV
FT                   MTAPGGERRELNVRLPKGVTEGAQIRLPGKAAGGGDVYVNLHLAPHPVFSVSGCDLTRE
FT                   VKVAPWRAVLGGDVQVETLTGSVTMKMPPGIQDGQRLRLRGKGLPKRGSGNGDLYVRVR
FT                   IEIPRHITDRQRELWQELERSGE"
FT   gap             281819..283061
FT                   /estimated_length=1243
FT   CDS             283453..284607
FT                   /transl_table=11
FT                   /locus_tag="SY1_02600"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27777"
FT                   /db_xref="GOA:D4M7D2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7D2"
FT                   /protein_id="CBL27777.1"
FT                   /translation="MLKKILASLALVLLLAGSGLAADPIRIGYLVALTGDNAPFGITEA
FT                   NMARMIVDEQNEAGGLLGGRPIELIVYDTKTRNEDAVNAARRMIESDRVCVIIGDLASG
FT                   INIATAPIVNRGHVPQISTIGTNPLVTVDEKGRVRPYSFRICFTDPYQGAIAADLAYND
FT                   LKKTKAAILYNVGSDYAHGLREFFTENFKRLGGTIVADEGFRGEDVDYRAQLTTIKASG
FT                   AEFLFLPGMGKDMALAIKQARELGFDGTIVGGDGFSDIMFEIAGDAMKGTYWINHTYME
FT                   DPEMAPIYERYQKRYNDVCKEFLDGAMAADAVYWVFDAITRAGVDEGPAIAKALEETKG
FT                   LKLHHATITIDPATHDPMNKAGVVLRVDDDLKTEFYKKIEPKAE"
FT   CDS             complement(284854..285291)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02610"
FT                   /product="Predicted acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27778"
FT                   /db_xref="GOA:D4M7D3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7D3"
FT                   /protein_id="CBL27778.1"
FT                   /translation="MELNTKRFHELTNEELYAILKFRVDVFVVEQNCPYPELDNCDQAA
FT                   IHVYLKDENGIQAYLRVMDKEIESEYVSIGRVIAAKRRCGLGSQILKEGLLVAQKQFGA
FT                   KQIYLEAQTYARRFYEKLGFQQISEEFLLDGIPHIKMLLQI"
FT   CDS             complement(285515..286246)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02620"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27779"
FT                   /db_xref="GOA:D4M7D4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7D4"
FT                   /protein_id="CBL27779.1"
FT                   /translation="MADERTPILSVQDLSVNYGAIQALRGISLDVFPGEIVAVIGANGA
FT                   GKSTMMNAIMGDVPRASGRVLLEGRDLPRRSHQVVTSGVSLAPEGRRVFAPLTVLENLR
FT                   MGAFPLSDRSAIEEQERKVFELFPRLLERREQYAGTLSGGEQQMLAVGRALMARPKVLL
FT                   LDEPSLGLAPIIINEIFKELTVINRKLGTTILIVEQNAKKALQLSHRAYVIQTGSIVKE
FT                   GASKDLLVDPEIEAVYLGGRK"
FT   CDS             complement(286250..287032)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02630"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27780"
FT                   /db_xref="GOA:D4M7D5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7D5"
FT                   /protein_id="CBL27780.1"
FT                   /translation="MNPTSKSAVLELKGVNKFFGGVQAVSDMSFVIRRGELAGLIGPNG
FT                   AGKTTIFNLVTGVYDTNGGDIKFMGKNVNALRSYQVIRLGIARTFQNLRLFPGSTVLEN
FT                   VMTAAQQHHGYSFFEAITHLGRWRGREAAIRGESMELLEQVDLADRAEQAAGTLPYGLQ
FT                   RRLEIARAIALQPQLLLLDEPAAGMNADEVHDLNELITQLHQKLGLTILLIEHHMDMVM
FT                   AICPHIICMNFGAKIAEGSPQDIRQHPEVLKAYLGEEE"
FT   CDS             complement(287032..287931)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02640"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter membrane
FT                   protein 2, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27781"
FT                   /db_xref="GOA:D4M7D6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7D6"
FT                   /protein_id="CBL27781.1"
FT                   /translation="MVEGYASGVVTLLAINLIAALGVSLFTGFTGIFTLGHAGYMAIGA
FT                   YTAAILTVEYEVHFAAAILAGGVLSMVLAYLIGLPTLKLVGDYYAIVSLGLGEAIRLII
FT                   ENWNSVTRGARGYPGIDNYTSMTVAVSFFLVLCVLMFFLINSRYGRAFKACRDDYVAAS
FT                   LLGFNTAHFRVLSLAISAFYCGVAGALLAGYMSFIQPVMFDQVKSTELVSIVVFGGLGS
FT                   TSGCLIGTTILTLVTELFRPISQYRMLVYGAVLVLIMVLRPEGIMGTNELTPAYARRVL
FT                   KRWRKSPAAGPDEKGGSR"
FT   CDS             complement(289013..290131)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02660"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27782"
FT                   /db_xref="GOA:D4M7D7"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7D7"
FT                   /protein_id="CBL27782.1"
FT                   /translation="MVLAVSGAACAAEGPIKIGYLAALTGDYAQYGITEVNMAKMVVSE
FT                   TNAAGGVLGRPIELVVYDTKTRNEDAVNAVRRMIESDGVCVIVGANTSGINIATAPIVN
FT                   KGRVPQISTIGTNPLVTVDNKGKVRPYSFRICFTDPYQGALAADLAYNDLKKTKAAILY
FT                   NVGSDYAHGLREFFTKDFQKLGGTVVADEGFRETDVDYRAQLTTIKNSGSDVLFLPGMG
FT                   KDMALAIKQAQELGLDVTVIGGDGYGEFMNEIAGDAMKGTYWINHTYLGDPVMAPIFAR
FT                   YKETYHDECKEFVNGTMAYDAMWWVLDAIKRAGAAEGPAIAKALEETKGLKLNHATLTI
FT                   DPEDHNPLNKAGIILKVGDDLNTEFYKKIEPK"
FT   gap             290442..290558
FT                   /estimated_length=117
FT   CDS             complement(292277..293212)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27783"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7D8"
FT                   /protein_id="CBL27783.1"
FT                   /translation="MALKTAQKKLKRILTCLLPALAAAFFTVGAEAVQTCPPRVVIDFE
FT                   YAEARDFHEGLAAVKSNDAWGYIDSLGRMVLPFVYRVPEAGPFSEGVAFVGDRYIDPDG
FT                   KPVFGDATFEGGLPFSQGFAAVQHGGLWGFIDMTGRFAIAPSFEAAGSFSQGLAPVRRN
FT                   GLWGYVDAAGHMKIPPQFLSAGPFSEGLAPVEVEGRFGYIDVAGRDRIRASFDEAGPFK
FT                   YGLAPVKRHASYRAWGYIDARGRLVIPHRYNGALPFSEGVAGTATDARWSFVNVLGENV
FT                   LNNQYDEVRPFSEGLAAVRQEDLWGYIRAQ"
FT   CDS             293514..295013
FT                   /transl_table=11
FT                   /locus_tag="SY1_02690"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27784"
FT                   /db_xref="GOA:D4M7D9"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7D9"
FT                   /protein_id="CBL27784.1"
FT                   /translation="MVELKVRGGDAAGWSGGAVVLLLREEDCRSVPEVPCRDAVKELAA
FT                   RKDFTGKTGTSLRVPLLSGGVRNLFLVGLGNGEDEACNAEAVRNALTAALREAGRHRCE
FT                   SALVPMAHLNVGAGRPFGPEAPDWSVVVGEAAGLSGYAFDKYKERKEDDEEGPFALREV
FT                   LVPGLDEAAARRGMTYAAAQVAARDLANEPGCVINPPALADRAQAMAEELGLACEVWDE
FT                   ARLKEERMGALLAVGSGSATPPRLIRLSYVPRGGKARGKVVFVGKGITFDSGGLDIKPA
FT                   SSMTTMKGDKSGACCVMGILRGAAEMKLDVEVHGILASAENMPSGSSFRPDDIVRARNG
FT                   KTIEINNTDAEGRLVLADALCLASEMRPDAIVDIATLTGACAVALGNWRAGLFSRSDGL
FT                   SEALLASARRRGERFWRLPAEDDRIAEKLKSPFADLVNSGQRYGGATFAALFLGNFVDR
FT                   AIPWAHLDIAGVDFMEKAWGVYARGASAFGVRTCLDYLASL"
FT   CDS             complement(295090..297396)
FT                   /transl_table=11
FT                   /locus_tag="SY1_02700"
FT                   /product="Aconitase A"
FT                   /EC_number="4.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27785"
FT                   /db_xref="GOA:D4M7E0"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7E0"
FT                   /protein_id="CBL27785.1"
FT                   /translation="MVKLYDEGVYLVHGAEVVPESEADKVRQLTGKDADKATALQGTIA
FT                   WGILEAHNTSDSMERLKIKFDAMTSHDITFVGIIQTARASGMERFPLPYVLTNCHNSLC
FT                   AVGGTINDDDHLFGLSAAKKYGGIYVPPHIAVIHQYMRESFAGCGKMILGSDSHTRYGA
FT                   LGTLAVGEGGGELVKQLLGDTYDIARPGVVAIYLKGKPAPFVGPHDVALAIVRAVYKNG
FT                   YVKNKVMEFVGSGVSSMTTDYRNGVDVMTTETTCLSSIWRTDGDTKTFLERHHREGDYK
FT                   ELNPAEIAYYDGCVEVDLSAVRPMIALPFHPSNGYTIDELYGNLKDILQETEAAAEKVA
FT                   EGRARFTLLDKITPDGKLLVQQGVIGGCAGGNYTNVVEAAHCLKERSCGDGEFCLSIYP
FT                   SSQPVFTDLDRKGFLADLMDAGAVIRTAFCGPCFGAGDTPANNALSIRHTTRNFPNREG
FT                   SKPGQGQMAAVALMDARSIAATAANEGKLTSAENFECQWGDVPEHDYDDRAYRARVYQG
FT                   WGRAAPETELRSGPNIKPWPEMEPLTENVLLRVASKILDEVTTTDELIPSGETSSFRSN
FT                   PLGLAEFTLSRRDPEYVGRAKAIQALEEERRAGRQPDDAGLKEVFALIKKIPGQESVDP
FT                   MKVEIGSVVYANRPGDGSAREQAASCQRVLGGLANIVQEYATKRYRSNCMNWGMIPFHL
FT                   KGRPDAFDVDDYIYVPDIRRALDDDLKDIPAYVLKDGRASKVCLYVQDMTAEEREIIKA
FT                   GCLINFNRNRRKRGK"
FT   CDS             298680..299009
FT                   /transl_table=11
FT                   /locus_tag="SY1_02720"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27786"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7E1"
FT                   /protein_id="CBL27786.1"
FT                   /translation="MIVTTTNDLEGWRVVDYLGIVSGEVILGVNFIKDFGAAIRNVIGG
FT                   RSAGYEEELQDARERSLEEMQQRARALRADAVLAVRVDYEVLGPNGGMLMAACSGTAVR
FT                   LARVE"
FT   CDS             300217..301827
FT                   /transl_table=11
FT                   /locus_tag="SY1_02740"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27787"
FT                   /db_xref="GOA:D4M7E2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7E2"
FT                   /protein_id="CBL27787.1"
FT                   /translation="MKRSILCLLLAGLVFSASGAWAAGPRDVTIGLTADAHSFYPFTLN
FT                   ETINNAIMQHVFEPLVDLDRDLKFMPLLAESWDVNEDASVWTFHIRKGVKFTNGNDFNA
FT                   DDVVYSFGMAQLAGKSAFVYALATVEKYEKVDDHTVRVTCKAPNALLLCHLKDVYMLDK
FT                   ETCEAHDEDYNANNPMGTGKYELAEYVRGDRIVFKRNEGYWGEKPQAENVTYKPITNAG
FT                   TRTANMMTNAVDMIVDVPVRDVSMLEKQKDITILKAPSLRIIYLNPSCVESPSKDSKFP
FT                   LVSPTGKNPMVDKRVREAMYRAINEDEIISKVMNGYAVPAATYCPEGYNGYNPDVKRLA
FT                   YDPALAEKLLDEAGYPRQADGMRFTVTLDASNDRYINDAAIAGAIAGYLEKVGIKVNLN
FT                   LMSRNVFFSYIGATNKSGDNTHLCQTGWADSGGEGALIAMDCIYSMKPGEYVKQGWGGV
FT                   NRGYYQNPEVDKLIEEAMQTVDAEKRSDLVKRAWKLAADDTAYIPLHFQMDLYAVGSRI
FT                   DYAPRYNKFVYAWDISFKD"
FT   CDS             302953..303849
FT                   /transl_table=11
FT                   /locus_tag="SY1_02760"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27788"
FT                   /db_xref="GOA:D4M7E3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7E3"
FT                   /protein_id="CBL27788.1"
FT                   /translation="MSETRKGRLRAFFQSEFFYNFRRSPAAVAGALIVVLVLLVALIGP
FT                   YFTVQDPYNMAELQLSDAYKPPFWMEGGDPKFLLGTDQQGRDMVSAIVYGSQVSLVIGL
FT                   LGTLMASAIGIVLGLASGYFGGKVDALIMRIADVQLSFPSMLIALFLMSILGRSVANIL
FT                   LSLMLVGWVRYARTVRGETLSVKRNEYIEAAHVIGLPNWRILFRHVLPNVFASIVVLST
FT                   MQVGGFILTEATLSFLGLGVPISRPSLGMLCNNGFTVLYSGLWWVSILPGLYIMIIVFG
FT                   INLLGDFLRDEMNPKLK"
FT   CDS             303860..304846
FT                   /transl_table=11
FT                   /locus_tag="SY1_02770"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27789"
FT                   /db_xref="GOA:D4M7E4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7E4"
FT                   /protein_id="CBL27789.1"
FT                   /translation="MDDRLLLQVKGLRTWFHTFKGVVKAVDDVSFDIRVGEVLAVVGES
FT                   GGGKSVTGFSVIRLIDEPGRIESGEVLFAGRDLMKLSEREMNRVRGKDISMVFQDAMTS
FT                   LNPVYTIGQQIDEVLRLHTSMGRADRRRASVELLRSVGISNPEGRLGSYPHQFSGGMRQ
FT                   RVVIAIALAARPRLIIADEPTTALDVTVQAQILRLMTDLIHAEGCSLMLITHDLAVVSE
FT                   IADRINVMYCGRIVESGPARAVIDGSLHPYTLGLIDSIPDLNREQGRFKTIPGIVPNMF
FT                   DLPRGCRFSPRCERAQDLCRTSAPDLRELEPGHCVACHFPIHREVRS"
FT   CDS             304843..305844
FT                   /transl_table=11
FT                   /locus_tag="SY1_02780"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27790"
FT                   /db_xref="GOA:D4M7E5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7E5"
FT                   /protein_id="CBL27790.1"
FT                   /translation="MTPILSVRGLEQRFDLDRSFLSQIRFERGRVVRRKRVVHAVNGIS
FT                   FDVPEGRVFSLVGESGCGKSTAARSIIRLLEPKGGTVTYRGQDITHVPERRMLPLRRKL
FT                   QMIFQDPYASLDPRQSVFDILSEPMLFHGVVAGRREARERVLALLERVGIRPEQASRYP
FT                   HQFSGGQRQRIGIARALAVNPEFIVADEPVSALDVSIQAQILNLLMDLKEEFRLSYLFI
FT                   AHNLSVVKHISDEVGVMYLGRIVEKGSRDQIFSNPMHPYTKALFSSIPTLSGHNMNRFA
FT                   GIQGEIPSAMDLPSGCCFHTRCDYAMPVCSAELPPEREVEPGRFVQCHLFCR"
FT   CDS             305916..307334
FT                   /transl_table=11
FT                   /locus_tag="SY1_02790"
FT                   /product="Aspartyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27791"
FT                   /db_xref="GOA:D4M7E6"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7E6"
FT                   /protein_id="CBL27791.1"
FT                   /translation="MNAKEWKKKVCVEPKNGYERLSAEERERMNAYCTAYKAFLDAGKT
FT                   ERECVQESVRLAEAAGFRPYVRGMALEAGDRVFFNNRGKMLILAVVGRLGLEEGVQMTA
FT                   AHIDSPRLDLKPNPLYEDSELAYLKTHYYGGIRKYQWVTIPLELHGVVAMKDGRTLSVT
FT                   LGGERGEPRLVISDLLPHLGAEQNKKPLSEGIKGEQLNLLIGSEPLSGNGGEEGEEGAK
FT                   DRVKLNVMKLLYEKYGFTEEDFISAELEAVPAFDAVDVGVDASMIGAYGHDDRVCAFAA
FT                   LRAVLDLDAAPERSAVCVLADKEEIGSVGVSGMRTAAFDTFMEDLCQAQNVPLRACLER
FT                   SFCLSADVTAAFDPNFPDVFDKRNAARFNRGIALNKYTGARGKSGASDASAETVAAVRR
FT                   WFDDAGVTWQMSEMGKVDAGGGGTVALFMANRNIDTLDAGVPLLSMHAPFEVAAKLDCY
FT                   MTFKAMEAVCRAHR"
FT   gap             308577..309796
FT                   /estimated_length=1220
FT   CDS             309829..311736
FT                   /transl_table=11
FT                   /locus_tag="SY1_02810"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27792"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7E7"
FT                   /protein_id="CBL27792.1"
FT                   /translation="MALFTSEGPEDPPSPLRVPFIDKIRTNAAFALCVAMSLFHLYTAG
FT                   IDLLQTPVQRAVHVGFVLVLVFLLHPLRRWRWIDALLVLCSIAGTGYIALFSDAIALRG
FT                   GKVLPYELVLGTLTLIAVLEAGRRVLGRTLPLLGLAFLLYCRYGRYAPSIFMHRGYSLE
FT                   RIVQHLYLTTEGVFGVAVGVSSTFIFLFILFGAFLSGSGGARFFNNLALSLTGRSPGGP
FT                   AKVAIVASGLLGTINGSSIANVATTGAFTIPLMKKAGYTPEEAGAIEACASTGGQLMPP
FT                   IMGAGAFVMSEFLNVPYARILSAAIVPALLYYAGLFLNVHLRARRAGLKGLGGDAPGVR
FT                   EVLRDDGHLLLPLLLIVVMLMRAYTPLKAAFWGILVMVGVAGLRRHTRMGPRLVVKALA
FT                   DGARGAVGTGIACAVVGFVVGGSSLTALGPTLSDNILDLAGGALLPTLFLAMGACLLLG
FT                   MGLPTTANYIVTSTVVVPALVKMGVPPLSAHMFVFYFGIMADISPPVCLASFTAAGIAG
FT                   ANAAGTGIRALLFALTSFLLPYLFIYNPAILMEGGSPLSVLEVSVGAAVGIVAFAAALQ
FT                   GWWGVRLSVPLRIVALAAGALCFVPYTPLRLAGILASLGLGSAARWGGSFFVKESGVRK
FT                   "
FT   CDS             312352..313152
FT                   /transl_table=11
FT                   /locus_tag="SY1_02820"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27793"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7E8"
FT                   /protein_id="CBL27793.1"
FT                   /translation="MAKMSDYAGASPREVRRMIREGKWDRPTSGMCAGHVQANLVVLPR
FT                   DLAYDFLVFAQRNPKPCPILDVTEPGETEPRLIAPGANIATDIPRYRVWEKGKCVDEPT
FT                   DVTKYWKRDLVGFLVGCSFSFEGALLQAGIGVRHIECDCNVPMYITNLQCRPAGQLKGP
FT                   MVVSMRPIPHAQVPKAVLCTGRFPSVHGAPIHIGDPAAIGIADVTKPDFGDAVDIRRGE
FT                   TPVFWACGVTPQAAIMAACPEFAITHSPGHMFIADPMDSDYAVF"
FT   CDS             313208..314413
FT                   /transl_table=11
FT                   /locus_tag="SY1_02830"
FT                   /product="Mn2+ and Fe2+ transporters of the NRAMP family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27794"
FT                   /db_xref="GOA:D4M7E9"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7E9"
FT                   /protein_id="CBL27794.1"
FT                   /translation="MEQKSKKGTMQVLLGAAFLMATSAIGPGFLTQTTVFTQQLLAAAG
FT                   FAILATIVVTAIVQLNIWRILCVSGLRAQDVANRVLPGLGYFLAFAVALGGLAFNVGNV
FT                   GGAALGLNTVLGLPLHYGAVISAAIAIFIYLNKDLGKAMDYFTQFLGVLMIALMCYVAV
FT                   KAAPPLDVVVKETLAPGTIDWMVILTLIGGTVGGYISFSGAHRLLDAGIRDVKDATRAA
FT                   VNGILVTSVMRVLLFLAVLGVVYVVAGEDAVALDKNNPAADAFFRGAGEIGRRMFGVVL
FT                   WAAGVTSVIGASYTSVSFLRTLFKVIDRNYRWWMIGFICVSTAVNVLVARPVALLILAG
FT                   TINGLILPLALGSILLGAYKKEVVGPYRHSILLTLTGWAVVAFTLWMGVQALPNIMKIF
FT                   NS"
FT   CDS             314481..315212
FT                   /transl_table=11
FT                   /locus_tag="SY1_02840"
FT                   /product="conserved hypothetical protein TIGR00370"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27795"
FT                   /db_xref="GOA:D4M7F0"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7F0"
FT                   /protein_id="CBL27795.1"
FT                   /translation="MDAKILPAGETCLFVDFGEKIDMEINRHVQAIKRALLDRPFKGMK
FT                   ELVPTYRSLSVYFDPLTVDLPALKKRLEQELEGAGPADSASTTEVCVPVFFGGEFGPDL
FT                   GEVAAHTGLSEDEVVRRYSESPLYCFMNGFTPGFPYLGGMDPSLETPRLKTPRELIPAN
FT                   SVAIGGAQAGAYSIASPGGWRIIGRVPYDLYDAGREPAVAIQAGMWVHFYPVTMERYRE
FT                   IEAEAKSGTYRIEYREKGAAR"
FT   CDS             315209..316279
FT                   /transl_table=11
FT                   /locus_tag="SY1_02850"
FT                   /product="biotin-dependent carboxylase uncharacterized
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27796"
FT                   /db_xref="GOA:D4M7F1"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7F1"
FT                   /protein_id="CBL27796.1"
FT                   /translation="MRLVIQKPGTLTTVQDLGRWGHQALGMPVSGAMDAPALARGNLLL
FT                   GNPAGAAALEVTLMGPTVLFEEGEGAVAITGGDLSPRLNGVPVPNWTIVAVREGDVLSF
FT                   GGMTGKGCRAYLCVAGGIDVPLVMGSRSTYMKAGTGGFEGRKLAAGDALPVGEPWVLWR
FT                   YTAGVGCPEDLRPDYAPKAPLRTVLGPQDSYVKPDGVKTFFEAEYKVAASADRMGYRME
FT                   GDAVIEHVKGPDIVSDGIPMGAVQIPGQGLPIVMMADRQTTGGYVKIGVVHAFDVARLS
FT                   QRVPGAAVRFTQISQEEGIEISRREAAALKALQEHVTAAAGASAKAFRGLGRRASGAMK
FT                   VRVDGVEHTVTWERLS"
FT   CDS             316299..317060
FT                   /transl_table=11
FT                   /locus_tag="SY1_02860"
FT                   /product="Uncharacterized proteins, homologs of lactam
FT                   utilization protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27797"
FT                   /db_xref="GOA:D4M7F2"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7F2"
FT                   /protein_id="CBL27797.1"
FT                   /translation="MPYKVDLNSDLGESFGAWKMGMDEDVLTFVSSANVACGFHAGDPL
FT                   VMKNTVAAARAAGVAVGAHPGYPDVVGFGRRGMVCSADELYTDVLYQVGALKAFCEAGG
FT                   LKLQHVKPHGAMYNSAAKKLEEAMAIAQAVKDAGDGIILMGLAGSKFDEAAEKLGIPYA
FT                   AEAFADRGYMNDGSLVPRRMEGAFVKDVEVAARRVIRMVKEGVVEAVDGTVVRLKPQSI
FT                   CLHGDSPTAVQMARTLRARLEEAGIEIAPLK"
FT   CDS             317120..317713
FT                   /transl_table=11
FT                   /locus_tag="SY1_02870"
FT                   /product="selenium metabolism protein YedF"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27798"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR019870"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7F3"
FT                   /protein_id="CBL27798.1"
FT                   /translation="MITINAMGKACPEPVIMTKAALEKGATELEVLVDNAVAASNVTRL
FT                   LEGQGFQVERRENAGEFRLTGRRDGAAAATAPASASCPQSGARLAVLVTGKTLGREDKE
FT                   LGEVLIKGFMGTLSKLGTPPAVLALMNEGVKLALPEASTCDHLKDLEKAGTRVLVCGTC
FT                   TNHFGITEQVGVGTVSNMFEILEAVTGADRILSV"
FT   CDS             319441..320325
FT                   /transl_table=11
FT                   /locus_tag="SY1_02890"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27799"
FT                   /db_xref="GOA:D4M7F4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7F4"
FT                   /protein_id="CBL27799.1"
FT                   /translation="MKRFAAGMLWLLPLLILLGLFTVWPALRTVDMSFYTRYNYFRDLV
FT                   FERGLDNYAYLWNDPEFWRSLDNTFFYTAWTLPLSVGIGLALALALNAIGPFKRLFQTI
FT                   YFLPFVTSTVAIALVWNWIFHLDHGLLNAMLQGVGLDPIPWLRDPRWARVSLVILGVWK
FT                   SAGYNVLIFLTGLQTIDAQYNRSAAVDGAGFWRRTFFITLPLLSPTLFFVCVISAINCF
FT                   KVFDLPFILFRSTPGPSNCGMTLVYYIYEKFYNQHHYGIASAAVLLLFGFITLFNLIQF
FT                   RLARRVIHYGRGK"
FT   CDS             321204..322505
FT                   /transl_table=11
FT                   /locus_tag="SY1_02910"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27800"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7F5"
FT                   /protein_id="CBL27800.1"
FT                   /translation="MFHARALLRGILGSVLAGLLVASALPASAEARKLQFWHVMTGANA
FT                   EALEEIVNRFNQANEDCAVELVYQGHYRDLFAKLEGAAKAGSLPHLAMIYNNRLISYVK
FT                   NGFVDPMEPMLFDAGNGFSEEAWADIPAFLRDGSVWDGKHYALPFNKEGFLLFYNKKML
FT                   ADKGITPPATWEELSAAAEALTGKVGDKDVVGLALNNSVAIDGSFWVEQAGGHIYDEAA
FT                   DRITFNEEPGVKAYEFLVSMIRKGHAKIIREEKYMFGPFGRGEAAMGITYMSQLPNIIE
FT                   LCAANGVEFGSVELPKGVRKACMFTGTNVAIFNTVPEIERRDAFRFLRFFLTPEIQSLW
FT                   GTRSGCLPLSWKVLNSREFHEFAEKENPAKLAILPSFKYGFSDPKILNGYAIHDNMSKA
FT                   LDAILLENVPVKEALDKAADQAWKEIQESRKSFN"
FT   CDS             322596..323147
FT                   /transl_table=11
FT                   /locus_tag="SY1_02920"
FT                   /product="Predicted secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27801"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7F6"
FT                   /protein_id="CBL27801.1"
FT                   /translation="MVLLAHCILNPNAKIAGAAQTRGAIPGVLEGLLQDGVGIVQLPCP
FT                   EQTFGGCRRWGMTREQYDVPCYRKHCRSLLEDVVDQMEDYLRNGYEVLGIVGVDGSPSC
FT                   GVDRTCAGYKGGEIASMPSLPSFSCVDGRGVFMECLTSMLQSRGLSIPAVGIDEGIQEA
FT                   LSWKELLKGLRGGSARPCGS"
FT   gap             323260..323697
FT                   /estimated_length=438
FT   CDS             325393..326544
FT                   /transl_table=11
FT                   /locus_tag="SY1_02940"
FT                   /product="N-Dimethylarginine dimethylaminohydrolase"
FT                   /EC_number="2.1.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27802"
FT                   /db_xref="GOA:D4M7F7"
FT                   /db_xref="InterPro:IPR003198"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7F7"
FT                   /protein_id="CBL27802.1"
FT                   /translation="MPKVVNSWNDFDPLKHVIVGRADNCCIAPSEPASKAKVPLDSPMR
FT                   GMTGPRPLDTVEKANAQIEHFVKELEKRGVKVDRPEPMQWNQAVVTPHFMTGSMFGCMP
FT                   PRDVLLTVGSDIICAPMSFRSRFFEYLAYSKVLRRYFDEDPDFRWIAAPRPELGDASYD
FT                   MHYYDGHITEEVLLERTAKLEMVTTEHEILFDAADVMRVGKDFFIQHGLTTNRKAMEWI
FT                   RRMYPECRIHAVNFPGDPYPIHIDATFVPLRPGLILNNPQRKLPEEQRKIFEANDWQIV
FT                   EAAMPAHKEPPALCYSSVWLSMNCLVLDHKTVFVEASETAQMEQMDKLGMNVIPIPFRD
FT                   AYPFGGGLHCATADVYREGGCEDYFPKQVKDVTLVEFGKMKNG"
FT   CDS             326676..326786
FT                   /transl_table=11
FT                   /locus_tag="SY1_02950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27803"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7F8"
FT                   /protein_id="CBL27803.1"
FT                   /translation="MLGSWTLDSFIIGSVILFAVPIIACIHRQIQQGKCE"
FT   CDS             326786..328321
FT                   /transl_table=11
FT                   /locus_tag="SY1_02960"
FT                   /product="Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27804"
FT                   /db_xref="GOA:D4M7F9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7F9"
FT                   /protein_id="CBL27804.1"
FT                   /translation="MTTGIELYRWGVFAVASAILIAVGWWTNVRLKKKAAMTHLSGDDE
FT                   KAFLLGSNEMGPFVAAGTLMATGYSGWGFIGSPGTAYAYGTIEILANFLFAPAITFGAL
FT                   FFAGFMRKQGERFGALTVPEYLANTHRGSQGMRRLVHFLAAIATFVFLSVYMIGQIRAV
FT                   ASVASEWLGTSPHMSAIIFMAVVMIFTMQGGLLAVAITDTIMCCGMVIASCIVYYVITQ
FT                   DISLTELIAKVGEIKPEFINPTTSNPYGDPKYSVFLVFVYATLFTTVLPYMSVRFLAMK
FT                   KDMNIPLVALYMAPMGFAMSFVPLVGLYMFYKDPTWPQALAADAPAGAHIADHAMPVFL
FT                   NTYLSPAVASIISLFIIFAMLSTISSVLQVQAAALSHDLYVSAAGKESRYADLLDRGTV
FT                   VVTTVLGIVLTFFAPQGMLNRIAYIGTGGLISMLVGPTIIRTFIEGNLLTCLLSMITGF
FT                   FGNVYLVLIYGKFGWVEAPIIAGIAGSLVYMIVGYVTNGMRARPLDSEEAAAA"
FT   CDS             328524..329747
FT                   /transl_table=11
FT                   /locus_tag="SY1_02970"
FT                   /product="arginine deiminase"
FT                   /function="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27805"
FT                   /db_xref="GOA:D4M7G0"
FT                   /db_xref="InterPro:IPR003198"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7G0"
FT                   /protein_id="CBL27805.1"
FT                   /translation="MKDIHVFSEIGRLKQVILHRPGNELSNISPDLMADFLFDEVPFLR
FT                   GAMAEHDAFAAMLKSCGAEVIYLEDLAAEAIENAGVREAFVDEFIGETCVTSKDEIRML
FT                   KDFLLGIPKTRDMVLQIMAGTRRSSFPKRDHTSLVDFVDVEYPFVTNPMPNLYFTRDPF
FT                   SLIGSGVSLNHMWSTVRNRETLFGKYIFKYHPRFKDSAIPFYYDRDIPYHIEGGDQLVL
FT                   SDKVLAIGISQRTEARAIELFAERLFKGPDGFETILAFKFPAKRAFMHLDTVFTMVDRD
FT                   LFTIHPEIQQHLEVIAVTMKDGELRFEYQGRALEDVLKKYLHLDKVRLLPCGGGDPVDA
FT                   PSEQWSDGSNTFAVAPGEIIVYDRNVVTNKSLEDAGVKLHVIPSAELSRGRGGPRCMTM
FT                   PVVREKLL"
FT   CDS             329802..330575
FT                   /transl_table=11
FT                   /locus_tag="SY1_02980"
FT                   /product="Uncharacterized protein, putative amidase"
FT                   /EC_number="3.5.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27806"
FT                   /db_xref="GOA:D4M7G1"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7G1"
FT                   /protein_id="CBL27806.1"
FT                   /translation="MEQRNKKFIQNITWPEYAKAAKDGVLIIPVGSTEQHSQHLPLSVD
FT                   VIISENFARILTEEIDAYVAPSIAYGYKSNPTSGGGPLFPGTIDLKGNTLVTLTKDILL
FT                   EFIADGWKKIILMNSHYENQAFLAEAADLTIGKQQEEFPKVILTSWWDNVSQDIIPAVF
FT                   DERPFRGWDLEHAAVTETSLMLYFAPELVKVELLSDDGIGDDVPRYQRYPVSKTLIPKT
FT                   GALYTSMTSTAEKGKLITDDVIKNFLRFLKKEFNL"
FT   CDS             330616..331980
FT                   /transl_table=11
FT                   /locus_tag="SY1_02990"
FT                   /product="Purine-cytosine permease and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_02990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27807"
FT                   /db_xref="GOA:D4M7G2"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7G2"
FT                   /protein_id="CBL27807.1"
FT                   /translation="MVEDRTQITETMAETAEERRGQDYPLTEVPASARAGLFSLSMVLA
FT                   GFTFFTSVMWAGGELGVHYKFWPDLMYVVIVGDFLLGTYAAVLGYIAFSTGLHAGLLSR
FT                   FCFGNKGSRWSDFLYGFTQIGWYAWGTALITDLVLQLAGITKENTASYPYIYVILIIFF
FT                   GFFFVMTAYGGYKAMELLSIVAVPLVTCLILYSIYVSTVKVGGLEGLQKILPKEPMTTA
FT                   AAMTLVFGTFVSGATQSTNWSRFASKGWHAVIASFVGFFIGNGLMIFAGAYGGYVYQDP
FT                   DVARVMAMQGMAIPAYVLLILNVWTTQDNEIYCFSVACCNAFRIKARKGITLTGAVIAI
FT                   IMALGGIYNYLIDFIIISGTVIPPIGGTMLADWLIKHKRRYSKIAETEFKDYNLTGIGA
FT                   YIIGAAAALFSPGIPPINGIIAAFIAYPILDKILQAMGMSQDHRVLAPGEGKQQV"
FT   gap             332520..333130
FT                   /estimated_length=611
FT   CDS             333228..333314
FT                   /transl_table=11
FT                   /locus_tag="SY1_03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27808"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7G3"
FT                   /protein_id="CBL27808.1"
FT                   /translation="MLREGMSPEIVARFTRLPLDEVEALKRS"
FT   CDS             333393..334412
FT                   /transl_table=11
FT                   /locus_tag="SY1_03020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27809"
FT                   /db_xref="GOA:D4M7G4"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7G4"
FT                   /protein_id="CBL27809.1"
FT                   /translation="MLRRSSIAWKLAFAVLLSFAIAPQMEGAEPKPEWKVDFVNEDLAA
FT                   DFKYMNWRMSIDPFPEEKLSKLKELGCSTDVSRAGMDTLRTAGGADFTEKQFDWILSTL
FT                   KEKVGVTPDKLTVMDLRGETHGLIDGNVFMYWIPNNYVNEGTPTEKVLEIEAGLLDELK
FT                   KQDTVKMYQTKDWGADHESPMLEYKKPVIRSEEDLVKSKGAKYVRFADTNHFRPDDHEV
FT                   DLFVAFMANLPADEWLFMHCYAGEGRTTNFMVMTDIYKNYKVASFDDIAARQGLIGPVD
FT                   VRTEVATTGKKHYKMKASIERRIFLQQFYNYAKDTDFKGKTWTEWCRERDLTLQYFPD"
FT   gap             336738..337084
FT                   /estimated_length=347
FT   CDS             337372..338793
FT                   /transl_table=11
FT                   /locus_tag="SY1_03050"
FT                   /product="High-affinity Fe2+/Pb2+ permease"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27810"
FT                   /db_xref="GOA:D4M7G5"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7G5"
FT                   /protein_id="CBL27810.1"
FT                   /translation="MKFGFCKAWVRPLAGALLLVALLLSLGTRDAAAAAKKRYENWKAV
FT                   AADMAVEFEEAQKDILADQWKDAHKHVNNAYFGYYEVQGFEKNVMVAISAARVSHIEGQ
FT                   FAAIKHALLGNTQGEKNALLSQVEDLKLKVYRDAMVLDGDLDESEPDSAGAAIYANTSL
FT                   KRPDFLGAPAAIEAVASASSGEAGSEAAAMPAPQKRQRTDPNWITFVTAFGLLVREGLE
FT                   AILVIVAIVAYLIKTDNKNLLKGVYVGSFAAILASIALAWVLQEWMGEQSGVARELLEG
FT                   WTMFLAVAVLFYVSNWMLSKADTIAWERYISGKVQQSIDRRSHWTLIFAAFIAVMREGA
FT                   ELILFYQASFTGGMSDPVYIVYGIAAGVAVLVAVWIAFRYFSVRLPLKAFFLFTSILLF
FT                   VMCVSFMGKGVQELTEADVITGRTVIPAMNGFTIEVLSIYDRAETLIPQIMLVIAALWI
FT                   TIPHLFSRKKPAEGE"
FT   CDS             338890..339483
FT                   /transl_table=11
FT                   /locus_tag="SY1_03060"
FT                   /product="Uncharacterized protein probably involved in
FT                   high-affinity Fe2+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27811"
FT                   /db_xref="InterPro:IPR018470"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7G6"
FT                   /protein_id="CBL27811.1"
FT                   /translation="MKKLLVALMVLCMALVAGVAFAAPAAEKPGESGFAEIPIGEEQQV
FT                   GPYNVAAVYFQAVDMYPAGKNPSKEDSDMHLEADIHLKPEDAVKYGFGNGDNIWPAYLT
FT                   VKYEIIDKAGKTAMEGSFMPMNADDGPHYGANIAKGLKVGAYKLRITIEPPTDYLLHTD
FT                   PETGVPAKEGAAEYFKTHVAEFDWNYTGEQLQNK"
FT   CDS             342395..343582
FT                   /transl_table=11
FT                   /locus_tag="SY1_03090"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27812"
FT                   /db_xref="GOA:D4M7G7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7G7"
FT                   /protein_id="CBL27812.1"
FT                   /translation="MYLRMVTSSLVRRASRLIIAVLAIAIGATILSGLVTIYYDIPRQL
FT                   GREFRSYGANLIILPKGDARITREELVKVRDVLGSDRIVGMAPYRYQTVKINEQPYIIA
FT                   GTDLPEAKKNSPFWYVEGQWASAEEPDRVMVGREIADTLNLSLGDAFTVQGVKYGHQAV
FT                   ASGQNLTAEENQKRDLASQNFSRRFSVCGIVTTGGAEEGFIFADVDMLDELVGDAFRCD
FT                   VVECSVVADATQLASLSAKLEAEVPGALPRAVRRLTQSQDIVLGKLQALVLLVTVVVLI
FT                   ITMISVYTTMTAMVAERYREIALKKALGAENGLVMGELLGEGVFLGFIGGALGVWLGFE
FT                   FAQRVSLNVFGRAINFQWSLIPITIAVFIAVTVLASILPVRRVMDIHPAIVLRGE"
FT   CDS             344366..344779
FT                   /transl_table=11
FT                   /locus_tag="SY1_03110"
FT                   /product="Major membrane immunogen, membrane-anchored
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27813"
FT                   /db_xref="GOA:D4M7G8"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7G8"
FT                   /protein_id="CBL27813.1"
FT                   /translation="MKKHTLLLVGAAALMVAGTAGFMNLRPVGYRDGVYSGSASGAFGE
FT                   TKVTLTIADGRIAKCDMEALDDDGNVKDAHYGEGSSEANFRMAQTALQGIGEYPKKLIE
FT                   SQNVDGIDAVSGATVSLLDFRNAVKQALEEARR"
FT   CDS             344776..345183
FT                   /transl_table=11
FT                   /locus_tag="SY1_03120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27814"
FT                   /db_xref="InterPro:IPR025531"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7G9"
FT                   /protein_id="CBL27814.1"
FT                   /translation="MTRRLAVFEAFLGVLLALTPFVLWPVCSMPKPDGGHMLCWYSGIL
FT                   ITAIGVLVVLFSILAWWKSWSFLLAAAAALLAWLAPNDIIHIAGTGWAVGLCGMANHAC
FT                   RAVTMPVVGWIVLAIVLIGIAGLVSGFVGKR"
FT   CDS             346408..347091
FT                   /transl_table=11
FT                   /locus_tag="SY1_03140"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27815"
FT                   /db_xref="GOA:D4M7H0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7H0"
FT                   /protein_id="CBL27815.1"
FT                   /translation="MAPVLRLNDLCREYRRGGRRFLAVDHVSLDVEAGSCVSIIGRSGS
FT                   GKSTLLNLAAGMLSPTAGSVELLGQNLADLEDARLSRLRCDAIGFIPQGPSALPGLTVL
FT                   ENVLLPFVLWPHGGDGEGAARLLLSRFGIEGLADAYPEDLSGGELRRALIARALVNRPS
FT                   IVIADEPTSDLDAVSRRGVMECLAALQDDGTTLLVVSHDLDTLDFADRVYTMVDGRLTE
FT                   GNGLS"
FT   CDS             347186..348268
FT                   /transl_table=11
FT                   /locus_tag="SY1_03150"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27816"
FT                   /db_xref="GOA:D4M7H1"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7H1"
FT                   /protein_id="CBL27816.1"
FT                   /translation="MNGDRVKRVLCGMRELGVTDFLLMDPLSILYLTGQDVRPMERFFA
FT                   LCLRGGGRPILFANRLFGLKEDPDLEVVLHSDGDPVMALVTERLHRGNVGKLGVDKGMP
FT                   ARFLLSLLERWAPEDLIVASPAVDLARGVKDAEERERMAASSRVNDQAMGRFKGLVHEG
FT                   VTEAEVARQLLDIYLELGAEGFSFSPLVAFGANAADPHHAPDGTILKEGDCVLFDVGCR
FT                   KDGYCSDMTRTFFWRSASEHHRQVYETVRRAQETAEAGVRPGVRLCDIDALARDVITAA
FT                   GYGPNFTHRLGHFIGLETHEYGDVSPADCRMTEPGMIFSIEPGIYLKDDIGVRIEDLVL
FT                   VTEEGCERLNRYSKELEVLR"
FT   CDS             351457..352794
FT                   /transl_table=11
FT                   /locus_tag="SY1_03180"
FT                   /product="tRNA nucleotidyltransferase/poly(A) polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27817"
FT                   /db_xref="GOA:D4M7H2"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7H2"
FT                   /protein_id="CBL27817.1"
FT                   /translation="MTGGTLPGCGFLEVVEMRHLRVLKTVERTGVRAWLVGDSARMIEM
FT                   GIEPEVMTLAVDAKDLSSLSDRLDGATVDARGTFPVLRGSVLGAPFRAYSLQGDTIADD
FT                   LARRDLSIEAIALRSDGGVVDPFGGRRDIRNRVIRLTGDDVELIDRDPLRIVRILRFAA
FT                   ELGMDVFWRTDMDVREFLRCHAERMNAIPAERWGREIISGMKERPWRFISLCDHYGLLP
FT                   VFLKDLEDLKSVPDGRGRTFFSHVMATLSVIERRLPTHKIMQDEAFILAGLFSRIGTRS
FT                   LNAGDEGERRRNKALTSSFLSQWNIPAETIRAAQAIIDGYRRFYELRTEEDLCGAVLEH
FT                   GADAMAAGLDFAGCIARAEGLPHLETLSENRWRLAQVLRRFKAVALQTGGASRFLGGDE
FT                   VMSLLRLAPGRIIGALLDGLDVAVGTGRVTNRAQAEEWIVSHARSV"
FT   CDS             352778..354148
FT                   /transl_table=11
FT                   /locus_tag="SY1_03190"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27818"
FT                   /db_xref="GOA:D4M7H3"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7H3"
FT                   /protein_id="CBL27818.1"
FT                   /translation="MHAPSDTVAAISTAWGEAGIAVVRVSGSCAVPLARSILRFGPKGF
FT                   PPPRTMRLAALLDGADNAIDQVLAVHFPGPHSFTGEDVVEVHTHGGTLVAQLCLEGLLR
FT                   RGARMAEPGEFTRRAFLNGRMDLSQAESVLGIIRSRSEEALRAAARTLSGEFSEFVRQI
FT                   RDELLTLQGDLEVGLDFPEDAAPAVDPIGLYDALETLRITLRDLEDRCSLGLLLREGIR
FT                   VVISGRPNVGKSSLLNALLKQSRAIVTAVPGTTRDIIEETVTYRGIPIRLVDTAGLRVP
FT                   SDEVEASGIERARAALKQADICLWLLDGSAPLEDADRDYIRSLGTRESIIVLNKADKAL
FT                   AVTEDDLRAIVPEGRTLAISAKTGEGLDALKEAIAAIATAGGALDVGLNVTARQLSELR
FT                   ACAEAIAEAQRVLEADMGQDVTAALLGTARKALERTLGIAADDDLLDSIFSRFCVGK"
FT   CDS             354536..356104
FT                   /transl_table=11
FT                   /locus_tag="SY1_03200"
FT                   /product="histidine ammonia-lyase"
FT                   /function="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27819"
FT                   /db_xref="GOA:D4M7H4"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7H4"
FT                   /protein_id="CBL27819.1"
FT                   /translation="MIMNPSAVKRVVMDGKSLSLEGFVAVARFGASVELAGSALRAMER
FT                   SRSLAEKIAGEKRAAYGITTGFGDFQKVAVPEEMSNQLSTNLILSHCTGTGDPYAAEVV
FT                   RGMMLLRANALCGGVSGVRPVLVQMLVEMLNRGVTPVVPQKGSLGSSGDLAPLAHMTLP
FT                   LLGRGRALYRGVEMSGAEAMEKADIPTLSTLACKEGLGMTNGTCAMTSVGALALYDTIC
FT                   AAQLADVIASLSFEGLTALKDAFDPRVHQVRGQRGQIRVAANMRRLMEGSEILDRCQGD
FT                   RVQDAYALRCVPQYHGAVRDALDYVLDKVEIELNAVTDNPLLFLEDEAVISGGNFHGEP
FT                   MAIPFDTLGIACSELANISERRTERMVNAALSNGLTPFLTTKAGVNSGFMIVQYAAASM
FT                   VSENKVLAHPASVDSIPSSANQEDIVSMGTTAARKAGWIVQNTLSVLADELLTACQAID
FT                   VRRRLDTHGQGITPLHEALLKHVRERVAFYEVDREIWPDIVEVEKMVRSGELLEIVRAH
FT                   VPDLE"
FT   CDS             complement(358456..359451)
FT                   /transl_table=11
FT                   /locus_tag="SY1_03230"
FT                   /product="[citrate (pro-3S)-lyase] ligase"
FT                   /EC_number="6.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27820"
FT                   /db_xref="GOA:D4M7H5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7H5"
FT                   /protein_id="CBL27820.1"
FT                   /translation="MGEVSVDTIYRPERDAALAALLKANDLTLPEGADEGVGLYEDGHL
FT                   VGCGFLKGNLLQGVAVDAAHRGEGLSATLITALIQRAVQRGITYWQVITKPDMERFFAG
FT                   LGFRRVADARPYAVLLEAGSGSASAYSEGLRRQAEGRPTPRACVVMNANPFTLGHRRLV
FT                   ERAASENPWVWVLAVREDRSEFPFDVRFRLMREGTADLTNVEVLSGGEYVISARTFPAY
FT                   FTRQESLASAQGTLDAAVFCDLVAPALGVARRYVGTEPFSPSTARYNEALLEQLPKRGI
FT                   QVVVVERASVNGEAVSASRVRAALAAGDWDTVRAMTPDSTYRYLQERRAG"
FT   CDS             360888..363575
FT                   /transl_table=11
FT                   /locus_tag="SY1_03250"
FT                   /product="Predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7H6"
FT                   /protein_id="CBL27821.1"
FT                   /translation="MDSSISSVKIGTRGEEYAAMHILEVTSIPDVASVLSERQSADESD
FT                   VIAAYRDGMAVMLSEAHQRWKAWGSGSRDVSVELMWLTRSVANQPYAASIRLFLVSRAL
FT                   AVDRAAAEDAVRSIARDCSTTLDLQRYEYRPLPHGEFATSLSELQTDAIRLLVREGRIR
FT                   NLQNAILPWCFSFDVIRKSGQDLARIANELASHPGCAFSVQLMPVSYSPQEAAVVDSLS
FT                   QNLETLQRGVMTQGVGSVGFTLAERPAEVYKYYSENKDRALFRYNIAVLAPERAAEQIM
FT                   QRLFGQLNAGRDGAVAVKNVSIPVADVGFPWNDHPLPWAINQRLHELTQPADAAVGQGG
FT                   DLLRVCGQLPGIITAEEAAELFRLPIGSRTVAAGLTVNESGGRKKTYAENVVDGADIEV
FT                   GQLKSSSGGNTIGFSVDDLTKHALIAGTPGSGKTTFAVGLLDRLWKRYNIPFLVIEPAK
FT                   NEYRALVRSIPDLQVFTPGKDFISPFIFNPFLPPKNVRLGAYKSTLKTAFAAAVSMSSP
FT                   LDKIFEEAVNNCYSEFRWLDSYTSANKGRVFNIADFIRCFRETFEAIGYVGEALNIGRA
FT                   GTVRLGSLSNLFDHYHSIPIEDLLSRPTVIELAAIENNDQKALLIALLLLSILAYVNAN
FT                   YVGEGRLKNVILLEEAHVLLGGGTNAVQGEADPGAIAQELIKRMLAEIRAYGVGMVIAD
FT                   QSPRKVTADVVALTDIKVAFRIVEAGDRQIVSDSTNMDAAQTERLGRLRPGEAFLFFGR
FT                   LDVPEEVRIPDYRLEQEIGVTLSDEAIRERSTYWRTRQRDLRPYPECGFVRYCAETCRP
FT                   DLRELAREAAKRIFAKNFKGDTRDFEVLRSVFGSISQRVRAELNDEPFSAELLACTKCH
FT                   LWRRIRYGTRIDVSDALIRNSLQK"
FT   CDS             363586..364380
FT                   /transl_table=11
FT                   /locus_tag="SY1_03260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27822"
FT                   /db_xref="InterPro:IPR025331"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7H7"
FT                   /protein_id="CBL27822.1"
FT                   /translation="MGDGNDLGFTKNIESTENIGNIESTENTLSESVELSEGAGLERSA
FT                   DLDAPPQDIAEDTELPDAPDAGPDGSYGLTDLEEDTSADFENLNESDASEACPDEIPED
FT                   GDTDTEENPSLEAEFEEQRRADDAIRETLRDDIREDPEFIDANGDLIWAPNGGFVENPE
FT                   TVAVQPGSVVLQRWGNESGHHFTEFGTPYEKVSLPWKETEPRYFEILRPLEDVARGTVA
FT                   PWFRQPGGGIQYRTELREFEMTRGASPYLREISFDEALKLKR"
FT   CDS             364684..365853
FT                   /transl_table=11
FT                   /locus_tag="SY1_03280"
FT                   /product="Putative virion core protein (lumpy skin disease
FT                   virus)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27823"
FT                   /db_xref="GOA:D4M7H8"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7H8"
FT                   /protein_id="CBL27823.1"
FT                   /translation="MAMFGRNPNEAAYVGGRKHFTDVIKNTGPGNLLIWLNGEEDFNTN
FT                   STLIVAESEEALFFRDGIVEEVFDGGKYVLSTENYPFISRLRNLFSGGISTFNCKVYFV
FT                   RKAHSMEILWGTDSPIQVRDPVLRIATSVTARGAFKVQVDNSKLFLIKLLGNNVQQLTQ
FT                   EELTRYFRREFMQHIKSNIARAIRESNEEILGICERQALLAEHLTPILREPLADYGVRL
FT                   VNFTIEAIDIPEQDPNRQKLEAAYANKGVMGILGNDWGRQQATEILHDVANNPGAGGVA
FT                   ATGAGLGMGMVAGGVFNSMAQQMFAPMQEPRPEERPFPQGPSGGRFVQRDGPGGAKRCA
FT                   HCGADNPEDSLFCGRCGTRLDAPEATCGNCGAVLPPESRFCNKCGTPRN"
FT   CDS             365869..366546
FT                   /transl_table=11
FT                   /locus_tag="SY1_03290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27824"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7H9"
FT                   /protein_id="CBL27824.1"
FT                   /translation="MKNGILWLILKALFPVLFNAVFFLADIQPKNASVWISYVFVHSAY
FT                   VLLLLTPRFTVRSRSAALFGTTLGGLGLFFFLAELALGSVLIAVRPEGWRTAFFLQLVL
FT                   SVFHIAALTSTMLADQHTAGGETVREAELRTFKGLLYEMRRAVDEAGEGEEARLLRRTY
FT                   DLMASSPVRSHPSVLDIERDLEAAIRALPRVGASGENREDIARRAEEIQRLIRERNHLL
FT                   KRT"
FT   CDS             366564..367478
FT                   /transl_table=11
FT                   /locus_tag="SY1_03300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27825"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7I0"
FT                   /protein_id="CBL27825.1"
FT                   /translation="MLTKAKCPACGGALELNPGLERGICVYCGSEFLVQEAIQKFKAEI
FT                   DGLPTLKNMLIRAEQKLSDGDLKGAEALYEEILKGAPTCHEAWWGKFRSLLEGGYLPIR
FT                   LVDCQHRVISLIKQGFIENAKKELKDIVAALDRADLQYLFGNNTTNALRAIEYAPEELK
FT                   GVYQQKLDQILKDCKKISEDMKKLLTAREEELRKASIQEKKAVFLLVLGAILGGIMGYF
FT                   WRGVIFGFILGMLWASETMKVKMIFLIILGTILVGGIMGYFWTGVIFGFIFGFILEVIR
FT                   EGRNEKGSADATTTDASLSSQTQ"
FT   gap             367984..368751
FT                   /estimated_length=768
FT   gap             373289..373556
FT                   /estimated_length=268
FT   CDS             375304..375549
FT                   /transl_table=11
FT                   /locus_tag="SY1_03360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27826"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7I1"
FT                   /protein_id="CBL27826.1"
FT                   /translation="MKQFLRFLNRLEEEKIYYRLNKVREEAVMAEIAVPGERWEVEFME
FT                   DGSVEVERFVSTDGVSGCADMDHCPELDDLFERFSE"
FT   CDS             complement(375712..376269)
FT                   /transl_table=11
FT                   /locus_tag="SY1_03370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27827"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7I2"
FT                   /protein_id="CBL27827.1"
FT                   /translation="MALQASLLLIGLMLLYASGKSYWNIERSGIPKIVDLKTLYATSSE
FT                   YARVTAKLKDTGIHIPKDEHDSESYFYVIELEDKLVLIESLHKQKEGRAHTFFVRPHPY
FT                   EGTHVEMYFSVLAAASNRPVRDVRAEYADTMLQYFEDNPKTYNVILLLIGALLFGSGAL
FT                   WTIKARNGKAMIRAIFTFKDDE"
FT   gap             376893..377812
FT                   /estimated_length=920
FT   gap             380310..380529
FT                   /estimated_length=220
FT   CDS             381928..382293
FT                   /transl_table=11
FT                   /locus_tag="SY1_03430"
FT                   /product="Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27828"
FT                   /db_xref="GOA:D4M7I3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7I3"
FT                   /protein_id="CBL27828.1"
FT                   /translation="MTAFKRDLMSWSRDDLLLMALTAYFEGMDLTRQERRVAVMLAESK
FT                   SAKEICATIFITENTLKYHIRNINRKLGIKTRREIPALLAALTSEAERKGWLRRPAKVV
FT                   SLAEFRARRGLQPAALV"
FT   CDS             complement(382355..383389)
FT                   /transl_table=11
FT                   /locus_tag="SY1_03440"
FT                   /product="Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27829"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7I4"
FT                   /protein_id="CBL27829.1"
FT                   /translation="MKDLKQDVRALLESYRARGSFTKAVCAVSKNGKTILELSMGCGLE
FT                   TFFDLGSVTEVYTTTAILHQEALARLALEERLDRLLPFAPLGPATRSRFERLTVRDLLT
FT                   HASGIPAWYPFYARQGSFWDVLEHVLSVEPPAQGPVHSDVNFMILGEVVRAKCAGLKES
FT                   LADLNAAIGASSTYGPVDPGICAETENGNRAEAQRCADMGLPFEGFRPADRPIVGTAND
FT                   GNAFYFFKGVAGHAGIFASARALLKLGRIYLDGGSSGDREWLRHKAVEEAFRDHGGGWG
FT                   LGWSLSDVFPKGVGHASLSGPSLWLTPDWRIAAALLVNPLTADPAPDLSDLRRQLHAML
FT                   LQSL"
FT   CDS             383722..385332
FT                   /transl_table=11
FT                   /locus_tag="SY1_03450"
FT                   /product="Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27830"
FT                   /db_xref="GOA:D4M7I5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7I5"
FT                   /protein_id="CBL27830.1"
FT                   /translation="MSEPRVGPTLRVVLESFWEVIDFMSEEKIEGQRAGERILSLPLVG
FT                   EIKDSYLNYAMSVIVGRALPDVRDGLKPVQRRVLYAMSELGLRHNSAYKKSARIVGETM
FT                   GKYHPHGDSSIYDTMVRLAQDWSLRYCLVDGQGNFGSVDGDRAAAMRYTEARLHELGEL
FT                   MLADIDEDTVEWGPNFDESLKEPLSLPSVLPNLLVNGSTGIAVGMATNIPPHNLREVTD
FT                   VLCWLLEEGINPAEASLADLMERLPGPDFPTGGQILGRQGIYDAYRTGRGKVIVRGRMH
FT                   VEDGRRGKVNVIVTEIPYAVNKTTLIETMVKAAQDKVIDGIQDIRDESNREGMRIVLEL
FT                   SRDANPDLVMRQLYKRTQLQATFGVINLALDRQTPRLLPLASILGLFLSYRRDVVRRRT
FT                   QFRLNKASGAGPHRRGAAEGGGPDRRGDPPHPGGRERRRGGAGADRPVWILPASGPGDF
FT                   GHAPAPPHGLAARETGGGDAPASGGHRVLREDSGGSPDAGRGDPGRAGGPGEALRGRAE
FT                   DGDPGQLPGDAGRAVDPGE"
FT   CDS             386328..386948
FT                   /transl_table=11
FT                   /locus_tag="SY1_03470"
FT                   /product="phosphatidylserine decarboxylase
FT                   precursor-related protein"
FT                   /EC_number="4.1.1.65"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27831"
FT                   /db_xref="GOA:D4M7I6"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR004428"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7I6"
FT                   /protein_id="CBL27831.1"
FT                   /translation="MRFARDGFFTIAASVLLTAFAALFSLALGAAMGAFTLFVLWFFRD
FT                   PDRSTPDRENAFFSPADGRVVEILEVEHPFTGPAVRVGVFMNVFSVHVNRAPCAGQVAF
FT                   LDYVPGKKVAAFAAKASEVNERNFVGLSTPRGPVMMVQIAGLLARRIVCRLKLGDVLEA
FT                   GQRYGMIRLGSRVDIYLPREVRLTVKIGDKVYAGVSLIGEVER"
FT   CDS             386945..387703
FT                   /transl_table=11
FT                   /locus_tag="SY1_03480"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27832"
FT                   /db_xref="GOA:D4M7I7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7I7"
FT                   /protein_id="CBL27832.1"
FT                   /translation="MSFFRRKRGSARKPLEFRQIAPNMVTSGNLLCGVFSLMLTTQGMF
FT                   VPAAWLVFFAVIFDGMDGKVARMLGGGSQFGLEFDSLADLVSFGVAPSILIFQTSLRGF
FT                   GGLLGAAAACFFALCTALRLARFNVVHVPGPFQGLPAPAGGLFVSSFVLAGADLPAGAM
FT                   AAVLALTGFLMISSIPYANLKRLTKRSADRRKCLALSSLLVLSFAFLRNAAPLFLFFAY
FT                   VLSGLLHFDWGRWLLRPEARDEEPRSHEAR"
FT   gap             388011..388573
FT                   /estimated_length=563
FT   CDS             complement(388913..389302)
FT                   /transl_table=11
FT                   /locus_tag="SY1_03500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27833"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7I8"
FT                   /protein_id="CBL27833.1"
FT                   /translation="MALITCRLCRKIFTAAAGRVCPECQKRLDDLYLDVRNYLRDNPKV
FT                   AFNVETLADALGADIRDVQGLVDLGYLERDLPRGGELQENDSRQKLAKEFEQSLTQMRA
FT                   AAAAAAQRKPVSYGQELYSDKGRKK"
FT   gap             390098..391477
FT                   /estimated_length=1380
FT   CDS             393898..395337
FT                   /transl_table=11
FT                   /locus_tag="SY1_03530"
FT                   /product="prolyl-tRNA synthetase"
FT                   /function="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27834"
FT                   /db_xref="GOA:D4M7I9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7I9"
FT                   /protein_id="CBL27834.1"
FT                   /translation="MARNITARSVDYSQWYLDVIKAAELADYAPVRGCMVIRPTGYSIW
FT                   ENVQRYFDDAFKRTGHVNAYFPLLIPNSFLQKEAEHVEGFAPECAMVTHAGGEELEEPF
FT                   AVRPTSETVIGHMYSRWIQSWRDLPVLINQWCNVMRWEKRPRLFLRTSEFLWQEGHTAH
FT                   ATEQEAREETLRMLEVYRKVMEEELALPVITGEKTAGERFPGAVATYTCEAMMSDAKAL
FT                   QAGTSHFLGQNFARAFEIRFQDRDGELATCWTTSWGISTRLIGAIIMTHSDDDGLVLPP
FT                   HIAPVKVVLLPISKDERQAEGVLLPMARELSGQLDEALGGLYTAVDTQFHMRPGDRFFT
FT                   HLQRGVPLRLELGEKDVQSGTVRVVRRDTGEKADLSRDALVPAVQKLLEDVQSNLYRRA
FT                   LSFREAHTAQASSYDELKAILAERGGFVEAYFGGTPEDERRIREETGGVTPRCIPLVDA
FT                   STGRCIVTGKEGRRTIFAKAY"
FT   CDS             395423..395809
FT                   /transl_table=11
FT                   /locus_tag="SY1_03540"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27835"
FT                   /db_xref="GOA:D4M7J0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7J0"
FT                   /protein_id="CBL27835.1"
FT                   /translation="MTHYNLPHDHGQDVQVVLERMPAAQRFEEAAMSFQQLGDPTRLKI
FT                   LWILCHCRECVSDIAAAVGMSDAAVSHHLQLLKRSGLIVGSRVGKEIHYTLSDERRAGL
FT                   LHRMMDALFEITCPKEDLPGPRSV"
FT   gap             396163..396248
FT                   /estimated_length=86
FT   CDS             397757..398062
FT                   /transl_table=11
FT                   /locus_tag="SY1_03570"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27836"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7J1"
FT                   /protein_id="CBL27836.1"
FT                   /translation="MTIMPERTPGAAALNEEKRAALKALKTVRGQVEGIIRMIEEGRYC
FT                   VDISNQLLASSALLRRANVLVLRQHMHHCVRDAVEHGDVDAKLDEISDLLAKIIGR"
FT   CDS             398199..400754
FT                   /transl_table=11
FT                   /locus_tag="SY1_03580"
FT                   /product="copper-(or silver)-translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27837"
FT                   /db_xref="GOA:D4M7J2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7J2"
FT                   /protein_id="CBL27837.1"
FT                   /translation="MKRESYDVTGMSCAACSARVEKSVAALPGVEEVAVNLLKNGMTVR
FT                   YDEGVLSSADVVAAVVKAGYGASLRGGAGERREARGPAQDVALQEYLGLRTRLVASLVF
FT                   ALPLSYLSMGRMMGWPMPSCFLGVENALVFALTLLLLALPVAFINFKFFRVGFGALAHG
FT                   SPNMDSLIALGSSAALVYGVYAIYRMAWAAGRGDAATVSRFSMDLYIESAGMILTLITL
FT                   GKFFEARAKRRTSDAITRLMDLAPRTAVVERDGAEVEIPIEELERGEIAVVKSGQAIPA
FT                   DGVLTEGAAAVDESAITGESIPVDKVPGDRLVGATTVRGGWLKMRVTGVGEETTLAQIV
FT                   RLVDEATSSKAPIAKMADRVSGVFVPIVIAIALATGAIWLLAGRGVEFALSMAISVLVI
FT                   SCPCALGLATPTAVMVGTGRGAASGILIKSAEALERLHDIDTVVLDKTGTITQGTPVVT
FT                   DVLCPAMDQREFLRAAASLESRSEHPLAAAVTARAEAEGLELLSVEDFAQEAGAGVRGV
FT                   VGGREWRAGNRRVLEAAGLYDERAKELEQKLADEGSTPMFFVTEGRLAGVIAAADVVKP
FT                   TSRQAVGELRRMGLRVAMLTGDNRRTACAIQRQVGLDEVTAEVLPQDKEGEVRRLQEAG
FT                   RKVAMVGDGINDAPALARADVGIAIGAGTDVAIESADLVLMRSSLMDVAGAIQLGHAVI
FT                   RNIKQNLFWALFYNALCIPVAAGVLYPLWEVKLSPMLGALAMSFSSVFVVSNALRLRRF
FT                   RPSYASADPIVEASGAAEGDEGKGVMKVKKLLHVEGMMCQNCVKHVRTALSQVSGVSGV
FT                   EVSLEDRTALVTLSGDVADAVLTKAVTDAGYEVKSVEAA"
FT   CDS             401392..402906
FT                   /transl_table=11
FT                   /locus_tag="SY1_03590"
FT                   /product="transporter, NhaC family (TC 2.A.35)"
FT                   /function="transporter, NhaC family (TC 2.A.35)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27838"
FT                   /db_xref="GOA:D4M7J3"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7J3"
FT                   /protein_id="CBL27838.1"
FT                   /translation="MDKNIDAAGNFDNLQTVEEEFLGEPGGGKKEPGSRTPRKANLIEA
FT                   LFTFGFLIVVMSVSIIKFKLDPHIPMFVGVIAAAVMGLWLGYKWESLENAMIKGISQAM
FT                   QSIIILAIIGMLIGVWIVSGVVPSMILYGLKLLSPQLFLPAAVLICSITSLATGTSWGT
FT                   AGTMGVALMGIAVGLEIPLPLAAGAVISGAYFGDKMSPLSDTTNLAPAMAGTDVFTHVK
FT                   AMIPTTVVAYLAALGLFAYMGMGYGGTETSLESIKLIQDGILSQFKVSPVLLIPPALVI
FT                   VLVAMKMPAIPGIVIGLLTAAFLAPIYQGASLGDILKCAHYGYVSETGVEVIDTLFTKG
FT                   GLEGMLFSISLTIIAMMFGGIMEETGQLETIVNAVLFRLKSYAGLIVSTEVTCLFSNIT
FT                   MPEQYISIVIPGRMYAQSYRERGLHPSQLSSTLEGMGTVSGALIPWNTCGAFMSNALGV
FT                   PTALYFKYCFFNLFMPLVVAVFAFLKFNVRYMTEEEKAQLAETGRC"
FT   gap             403055..403486
FT                   /estimated_length=432
FT   CDS             403527..404627
FT                   /transl_table=11
FT                   /locus_tag="SY1_03600"
FT                   /product="Uncharacterized conserved protein related to
FT                   dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27839"
FT                   /db_xref="GOA:D4M7J4"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7J4"
FT                   /protein_id="CBL27839.1"
FT                   /translation="MRDIRVMIWGFGAMGSGIARMLLKKTGVEIVGVVVGRKHLHGTDV
FT                   YQYLGEERGSRPELLFGGTELIRNGACDVVLLGTDSFTRSAFEKVKLCVEHGLNVITTA
FT                   EEMAWPWAQEPELSLEIDRLARQHGVTVFGTGINPGFVLDLLILAITGTCEDVKSIEAA
FT                   RINDLSPFGGAVMHEQGVGITPEEFKRRLAANDLAGHVGFPESISAIAAGLGVEITKIE
FT                   QTKDPIISKVHRETPYAKVEPGNLAGIRQQGWGRTADGRAFIHLDHPQQVRPEAEGIDT
FT                   GDYITIDAGGYTLKFSGKPEMPGGIGTIAMVVNMIPQVLNAPAGADRPSGAPDPARDPG
FT                   RHEPVRPRAAGGAPRLPQGGLRRAAH"
FT   gap             405896..407217
FT                   /estimated_length=1322
FT   CDS             407713..408828
FT                   /transl_table=11
FT                   /locus_tag="SY1_03640"
FT                   /product="Predicted amino acid racemase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27840"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7J5"
FT                   /protein_id="CBL27840.1"
FT                   /translation="MRYPQIRVDLDKLLENARVLSGLLSAHKLKFHYVTKCFCAWEPMV
FT                   DALADAGIRNFADARLENIEVLKRWARSAMLLRVPMISEADDVVCLCDVSLNSELAVIE
FT                   ALSDAALTLGRTHEVILMVELGDLREGALPEDVMPMVEQILTMRGVKLAGLGVNFNCYG
FT                   GVIPTPAKLKELADLAKEAQNRCGYEFEYVSGGNSGSLPLVFDDRIPSGINHLRIGEAF
FT                   LLGHETSYGSSIPGMLHDVFTLRCEVIEKKLKHSVPSGERGLNAFGEPPAEMEDRGMIQ
FT                   RAIIAVGGQDTFPFSLTPRMEGLRYLGHYSSDHTIFDVTHAKGDVHVGGTLDFDVDYKA
FT                   LLMIFMSKYVEKVPVWAGQYFMMAVGMKKPS"
FT   CDS             408839..409753
FT                   /transl_table=11
FT                   /locus_tag="SY1_03650"
FT                   /product="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27841"
FT                   /db_xref="GOA:D4M7J6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7J6"
FT                   /protein_id="CBL27841.1"
FT                   /translation="MDSRALRGNLLLLVTSAIWGFGFIAQQFGSRALPPFSFNACRFAL
FT                   GSASLLPLIVIFGWHDPARRRARAASRRLSVQGGLLNGGVMFLGAWLQQAGIAETTAGQ
FT                   AAFLTGLYILFVPLLGLFMHHRVPLTTWCAGILALVGLYLLSVREDLSVSRGDVFEIAG
FT                   AVFWALHILCIDAYVKRTDPLEFSFWQFAFCALFSVGTALSLEPGGFAHVGDALLPILY
FT                   CGVVSVGIAYTLQVVAQKDVIPAHAALILSVETVFATLGGAVVLGENLGLRGYVGCVLM
FT                   FSGMILAQWHGLRGGMRPADVRT"
FT   CDS             409770..410270
FT                   /transl_table=11
FT                   /locus_tag="SY1_03660"
FT                   /product="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27842"
FT                   /db_xref="GOA:D4M7J7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7J7"
FT                   /protein_id="CBL27842.1"
FT                   /translation="MLETERLAIVEAAESDIGWIVAQENDEENRRFIWVGTYEEHLAEI
FT                   ADPGHRLLVIRRKDGVETVGYALARLDFMSERFELRRIVIAQKGRGYGRESMEALMKYA
FT                   FETLKFNRFWLDVYPDNAVGIKLYESLRLHRDGVLRQNYKSDRGYLDQIIYSMLKEEYF
FT                   HST"
FT   CDS             410506..411951
FT                   /transl_table=11
FT                   /locus_tag="SY1_03670"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /EC_number="3.4.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27843"
FT                   /db_xref="GOA:D4M7J8"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7J8"
FT                   /protein_id="CBL27843.1"
FT                   /translation="MMTLDALRREPVFRHFYDICQIPHGSGNERALSNHVLAWARELGL
FT                   EAERDAVNNVLVRKAAAPGREAAPGVLLQAHLDMVCEKAPGVEHDFARDPIRWVLERDL
FT                   LSTGGCTTLGADDGVGVAMAMELLQDDSLEHPALEALFTVAEETDFSGALNFDAGKIRS
FT                   HFLINLDHAEGDSLLCGSCGGMRADICLPVTAEPLPAGFAACRLAVSGLRGGHSGEDIH
FT                   RGHGNANVLLARLLMVAERRGARLASIRGGSFRLAIPRDAEAVVCLDPAEEPALREDLA
FT                   ALAEDLSRELAVSGDEVRVTLEREPEAPAAAAEPGPVISALVLTPDGIFQMNEMLEGLV
FT                   DTSDNLGEVRFDGRELRLTLELRSARDSLRTYLYQRMERLAGLLGGSCRCDDLYPGWEF
FT                   RPRSPLRELCVGAYEALFGAAPRVLTAHAGIEVGCLLQRRPDLDAVAIGPDAWGFHSPS
FT                   ERVSVPSVRRTHRYLRRVLSSVS"
FT   CDS             412007..413440
FT                   /transl_table=11
FT                   /locus_tag="SY1_03680"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27844"
FT                   /db_xref="GOA:D4M7J9"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7J9"
FT                   /protein_id="CBL27844.1"
FT                   /translation="MMDERLELERGGRGPSFLERITAPHTYAILFFLAVLAVIGTWLLP
FT                   AGEFDRVLNEAVGRNVVVPGTFKAVEQTPVSFFGLFTAYMEGFIEGADVVGFVFFAYTS
FT                   WYVVLRTKALHAAVGAMLRVFGESQRRYIMPFFLFVFGFCASIFGMFEESFGFLPLFVG
FT                   MAIAMGYDGMVGAATVAVGVGMGYSAAIMNPFTVILAQKCAELPLLSGWPFRLVLSLSF
FT                   FAVSALYVARYAARVKADPTQSLLHGVDMGELHMDHDELVSMKFSLRHKLVCLICLGAV
FT                   GVLMWGVIAQGWYFNELGALFVLMGILGGVVGGLGVNGTAKAFADGFCDIAAGCLLIAF
FT                   GRTMLVILQKGHIIDTVAYYCSLPLSVLPKWLAAEGMLVVQNLINFFIPSGSGQAVVTM
FT                   PIMAPLADLLGISRQVAVLAFQFGDGLSNVMWPTADIPIICAIAHIPLNKWYKFFLPLF
FT                   GIGLLMQAAGIAAAVLLGL"
FT   CDS             complement(413521..415791)
FT                   /transl_table=11
FT                   /locus_tag="SY1_03690"
FT                   /product="Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27845"
FT                   /db_xref="GOA:D4M7K0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7K0"
FT                   /protein_id="CBL27845.1"
FT                   /translation="MTSGRALRVGSPAGRLLLAVLLALTPLLRPMAAGAAEDWTPPTDV
FT                   VQAQDEISRDIAQRQAAVEAELGDGKLTSIDIAARMRQLDRLIATASEDAAGWGFSAEQ
FT                   REQYARLLSDLSLDWSAYNSMLQSQPPRATDASGLPASQDLPAVADIDFSDDLLMRIQK
FT                   AANELDVQMFYLQSKLGVLKLSQSDIESLKGGAGADDGSPTPPKLQELKLELARVRMAA
FT                   SWAQVLAAKRSCDANVALIRSMRAQLASVKGRLTFPEALLNARVASLDREIDETAVQLE
FT                   NGRAMLLSAASDLTKAYAAMKSADVFPLTAASSRYLERKTNTNKLEYSATFLEDKVRCL
FT                   REAQDLWRKRYKLFHDQVSGQDIWQYRSDARSRMAELERQLEAIQLMKSELQRSIATMT
FT                   EQAEGTDGRTRQNLGQALQNAKDTVANVLNLYSSLIPNQIFLLQTFYDEASEKLNAVRI
FT                   AEKVGSFGKATVMDFLNTKLWEGEGYAVTVIKLVTALLVFISSFFLSSWGSRWIQRWIL
FT                   YGLPSQTTAAGAAQRIVFYVLWFAFVLIALQIVNIPLTAFAFLGGAIAVAIGFGAQNLF
FT                   NNLISGFILIFSRPFKVGDIIEVDGTNGIVEDIGSRSTCIRTWESFDVIVPNRYLLENR
FT                   VTNWTGSDVKKREVLKVQVAYGTDTRRVEELLTKVIRDHSKALKDPSPFVLFRNFGESS
FT                   LEFEMYYWVDLTAASTMKVASDMRHHIASLFRQEGIEIPFPRTDVYLVPPIEGSEAQGT
FT                   LDP"
FT   gap             417629..418312
FT                   /estimated_length=684
FT   CDS             420617..421603
FT                   /transl_table=11
FT                   /locus_tag="SY1_03730"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27846"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7K1"
FT                   /protein_id="CBL27846.1"
FT                   /translation="MKKTVALLLVALVLFPSMAFGVDSSQEAKRFKVWFDTGGGPGESY
FT                   GTVLQNGAAAAARDLDLDIVFVYSDWNAEKMLENFRQGLTSKPDGMVVIGVPGDDAYEP
FT                   LIDQAYAQGALVTCVDTPLPRLYQKYQSRGFGMIGPDNYNQGRMLAERCVAQFDLKKGD
FT                   RVMVWGLKSLPGRGRRAQAILDVFEKAGLTADYIEISPEINKDATLGGPVLTGYLSSHE
FT                   DCRLVVIDHGALTAQSGNALRSAGMDPDRVAVAGFSLSPATAEAIRSGYLDLVGEGQPY
FT                   LIGYLAVVNLVQSRLCGFGGLVIDTAGGFVDKDNIEQIAPLAEKGVR"
FT   gap             422950..422950
FT                   /estimated_length=1
FT   gap             425097..425726
FT                   /estimated_length=630
FT   CDS             425824..426933
FT                   /transl_table=11
FT                   /locus_tag="SY1_03780"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems, periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27847"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7K2"
FT                   /protein_id="CBL27847.1"
FT                   /translation="MKKFVAVLALSWAFALPAFAAEAEKVPVIRMAYTMTTHQQGFTIA
FT                   LQKGEAFKDFGVWFKPVVEKEKYDLYRGDKKMARFEVIVTKSGSEAASLFAQNHLDLTT
FT                   NSFPAMLSAIDNGTPIKVLAPIQADGIAMVGRLDSPVNDWDSLLAFIKEAKAPVKLGYH
FT                   SPTSAPKVLVEAALFEAGLRLTGDANATKQEADVLLVDLKGVANFNPALTSGQVDFWVA
FT                   PAPIPQVAVLKKQGKMILDLKTLPPAGKWDHFPCCVTAAHVNVIEQHPDILDAYLELLT
FT                   KSSAWCNAHKDEADELSAVWFGVPVEATRMSEMTYSTNPDAKWFRNASLYPEMLNKMGQ
FT                   FKNLLKGKTLEESKELVFDFRYAEKQNAK"
FT   CDS             426937..427773
FT                   /transl_table=11
FT                   /locus_tag="SY1_03790"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27848"
FT                   /db_xref="GOA:D4M7K3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7K3"
FT                   /protein_id="CBL27848.1"
FT                   /translation="MKHCLSRGALSLVAPALFLLFWHYASLRIDNAVVLPKIEDVLAIL
FT                   LHPTKDLLNMGSLVGNVTVSFVRVFGGYLLAVFVAVPLGLAMGYWNWLNRMLGLMAGLF
FT                   RPIPPLSWIPLVLAWFGVASMATILGIEEGAWYPFFSNIKISMLFIIFIGAFFPILVNT
FT                   IGGVQSVRVTLIDAVRVLGASPWQVVRYVILPYAAPQVFTGLRVGLGVAWMCLVSAEMM
FT                   PGSISGVGYLITHAYTVAQTDVVIAGMIAIGVMGILIDSLFILIERRAFQWQSLYR"
FT   CDS             427778..428545
FT                   /transl_table=11
FT                   /locus_tag="SY1_03800"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27849"
FT                   /db_xref="GOA:D4M7K4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7K4"
FT                   /protein_id="CBL27849.1"
FT                   /translation="MIKESDLLRIEGLAKHFTSDQGRDVVALSDVNLSVKENEFVCIVG
FT                   PSGCGKSTLLRILAGLELPSGGRALMKGVEIKGPGRERGMVFQEYSLMPWRSVEENVWM
FT                   GPELLGRPTEERKAVAAHYIELVKLSGFERAFPHELSGGMRQRVAIARALMNDPEILLM
FT                   DEPFGALDSHTRIILQKELLKIWQAHRKTILFVTHSVDEAVFLADRIVVMSARPGRIIL
FT                   EEPLDLPHPRRRDNAVYARTLENILTLLEAEQT"
FT   gap             428947..429822
FT                   /estimated_length=876
FT   gap             431260..431618
FT                   /estimated_length=359
FT   CDS             431699..433345
FT                   /transl_table=11
FT                   /locus_tag="SY1_03850"
FT                   /product="ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27850"
FT                   /db_xref="GOA:D4M7K5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7K5"
FT                   /protein_id="CBL27850.1"
FT                   /translation="MMKYRVKRMTVSSSAAWALSFCLVLSSVFAGTAWAGEPQVLRIPI
FT                   DEEPDSFNVARVSDYYSAMVASQVIEGLTGIVVRDGREVAVPACAESWETSEDGLTWTF
FT                   RLREMKWADGEPLRASDFVYGISRVLDPATASPISGKVRFIKNAGDVLLGKKQPSELGL
FT                   EAPDDRTFVVRLEHPVPYLLQSAAGTAMFPARRDVVEKFGDAYGTDADKVVGCGPFNLA
FT                   DWVHNSSIAFVKNPLYWDADNVKLDRLEMKVVAEESAKVGDFENGGLDLVSIYSVEWAK
FT                   KLDEKGGYVKNVVAMPETKYVFFNQTVPPFSSPKVRLAFSLALDREEIYRDVSLGLDPA
FT                   AWGWLPPAMGLDGENFRKLAGDPIKDLAAAHPDPRALLAEGLKELGMSEAPEGLKIVLM
FT                   CHNATRDFAEYLQQAYKTRLGVDLELDPVEWPVFQERNRNLDYQMGYKSYYADFNDPSS
FT                   MMDLWITGTRTIPTGWSNERYDALVREAGQSADKALRAKDYAEAERILLEEGTIAPYAY
FT                   STGFDYVHPYVKGYAAPTFTAMLYKTVSVER"
FT   CDS             433385..434941
FT                   /transl_table=11
FT                   /locus_tag="SY1_03860"
FT                   /product="Putative p-aminobenzoyl-glutamate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27851"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7K6"
FT                   /protein_id="CBL27851.1"
FT                   /translation="MKETGRAQKKWTLRAMDAVERAGNALPDPALLFVILTALTIAASY
FT                   FTAKSGVSVSYEGVNSATGTIETIHAQAYNLLSLEGFHYMVTSVIKNFTGFFPLGTVFT
FT                   IILGVSVCEGTGMLNALLRKLVSKTPKALISAMIVFLGVMSNVASSTGYVVLVPLGAVT
FT                   FIACNRHPIAGLAAAYAGVSGGWTANLLLGSNDPLYAGMSTQAANILNPDYVVQPTGNW
FT                   YFMVASTVLVVLIGTWVTDHIVEPHLPLYQPEEDARVQDLTLDEKKGMRAAGFAALIYV
FT                   VVMLLLIVPSGGLLRNPTTGQVLGSPFMSGIIFFMMLLFLIPGVAYGVASGKIKSSRDL
FT                   TNLMSTGIAGISSFLVLLFFAAQFTFFFNKSNLGIIISVKGAHFLESVGLVGLPLLWVF
FT                   ILVTAFINLLIPVDTAKWAMMAPIFVPMFMHLGYAPELTQLVFRIGDSATNIITPLMPF
FT                   FVMIVAYFQKYDKKAGIGSVLSTMLPYSIALLVGWILMLSLWFVLKLPIGPGAPLFYGN
FT                   I"
FT   CDS             435143..435328
FT                   /transl_table=11
FT                   /locus_tag="SY1_03870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27852"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7K7"
FT                   /protein_id="CBL27852.1"
FT                   /translation="MKKRLTIALASVLYLWIMNALTVNWLGEPCSAGFDCVHPRVKGYA
FT                   APTFTAMLYKTVSVEK"
FT   CDS             435354..436295
FT                   /transl_table=11
FT                   /locus_tag="SY1_03880"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27853"
FT                   /db_xref="GOA:D4M7K8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7K8"
FT                   /protein_id="CBL27853.1"
FT                   /translation="MTRFVLKRLIYALVALFVASSATFFIIHSVPGNPIEAMTEKLPES
FT                   LRRQTFERYGFDRPLLEQYGLFWKRLLTEGDLGESLRYRGRSVGDILARYAPVSGVLGL
FT                   TSILWGAGLGVALGVVAALHRGKALDYAVMLLAILGVSVPNFVLASLFQYFLAVRLGWF
FT                   PVTGWGGFAHVVLPALALSFYSTAQYARFMRASCLDVLSQDYILAARARGMSRFHLVRR
FT                   HVLRNAVLPIVTLLGPQIALMFGGAFVVERLFSVPGLGFYFVSSVGDRDYTLIMGQTVF
FT                   LSALYILSILAVDLLYGFLDPRIRFARDGGAS"
FT   CDS             436295..437251
FT                   /transl_table=11
FT                   /locus_tag="SY1_03890"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27854"
FT                   /db_xref="GOA:D4M7K9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7K9"
FT                   /protein_id="CBL27854.1"
FT                   /translation="MEPRPNWCPAEAGDGEGFCPEDFRFVERPDEAPFASRPSVNYWQD
FT                   AWRRLKRNRAALLSAALLAFVAALCVLGPALTPYGHEALNMAEKNLGPSAAHWFGTDKM
FT                   GRDLFTRVAVGGRVSLIVALVGALIDILVGLLYGGVAAGLGGAVDNAMMRLADVLSSIP
FT                   YLVLAVLVSLILGRGMASLLIAMTLTGWCNMAYLVRGQVLQIREQEFVLTARALGTSPW
FT                   RILWKHLIPNIMGVMIVAVTFDIPLFIFGEAFLSYIGLGIQPPMTSWGALASGAQQQML
FT                   FYPWQLFFPTLFISLTMLSFQMLGDGLRDALDPRARD"
FT   CDS             438376..439368
FT                   /transl_table=11
FT                   /locus_tag="SY1_03910"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27855"
FT                   /db_xref="GOA:D4M7L0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7L0"
FT                   /protein_id="CBL27855.1"
FT                   /translation="MTQTTRGRVPLLRVERLCRYFRLPGGRTLKAVDDVSFEVFRGETL
FT                   GLVGESGCGKSTLGRTVLGLHPATSGSVLFDGLDVHAARGADRLRFKKRAQIVLQNPYA
FT                   SLNPRMTVGDIVAEGLDAHRLCRDKEEREERVCRLLTRMGLRPEFRSRYPHEFSGGQCQ
FT                   RIGIARALAVEPEFLVCDEPISALDVSIQAQIVNLLVDLREDLGLTSLFIAHDLAVVRH
FT                   ISDRVGVLYLGALVELAETDRLYGEPLHPYTRALLSSIPDVDPDNPMNARRVRLKGEVG
FT                   SPIDFQCGCRFAPRCPQAEERCRQFRPELREVSPGHLVACHREEPFAGY"
FT   CDS             complement(439418..441061)
FT                   /transl_table=11
FT                   /locus_tag="SY1_03920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27856"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7L1"
FT                   /protein_id="CBL27856.1"
FT                   /translation="MKTMQLKGLLFFVLAYGVLASAGCGGGDSEEQGISGPAPNPYLSA
FT                   PLYGTTHFDPAQSDSTPYGPPKGSFTIDPVRQPISYGGPVNIITLASTSPRFMWGVGSD
FT                   RVAYINAAEKQWAEVARLDAPAYLSPDMGPVAPGAHKTIGEMSFEGKTSRDIHQVFVTN
FT                   YGAKYNARLANGVYSVVDKDNVLYATYGYGVYAFALKDAANPAAGIEVRHSIADAADAI
FT                   QGAGARAVLYGLNMTYDGHIILNFENGVSVLNRTLDAASAQTILFPGEHTSNSLAVDEK
FT                   GGIYVVTNKRMHKLVWTGSRLSDAEADGAWSSPYDAPEDAVPPIVKFEPGSGSTPTLMG
FT                   FGKNADRLVVITDGSRRMNLVAFWRDEIPQDFVQQDGTQSRRIAGQIPVTCGYSQLPTW
FT                   IQSEQSVVVSGYGAFVVNNLPLESDTMARLPKILGAATLGPVYPSSRGVERFRWDPKEH
FT                   RWASVWRRSDVSSTSMIPVHCRNGNMALVSGYGAQGWELTGMDWDTGATVHRTIFGKSN
FT                   YGNGAYAILQFLPNGDLLFNSLVGPYRVSY"
FT   gap             441535..442700
FT                   /estimated_length=1166
FT   CDS             complement(442782..443837)
FT                   /transl_table=11
FT                   /locus_tag="SY1_03930"
FT                   /product="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27857"
FT                   /db_xref="GOA:D4M7L2"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7L2"
FT                   /protein_id="CBL27857.1"
FT                   /translation="MKGFAMLKIGSVGWIEKDRPKCGPMDAICRPLALAPCTSDVHTVW
FT                   EGAVGERHNMILGHEGTGEIVEVGELVKDFKPGDKVIVPAITPDWNSLEAQGGYSMHSH
FT                   GMLNGWKFSNVKDGLFGEFFHVNDPDGNLALLPENIDLKVAPMLSDMVPTGFHGAELAD
FT                   VQYGDEVLVIGIGPVGLMAVAGANLRGASRIYAVGTRPVCIEAAKFYGATDFIDYKGGT
FT                   ISEQALRLTKGRGVDKVIIAGGTVDTFAEAVKSLKAGGRIGNVNYLGSGATIDIPRVEW
FT                   GVGMGHKAINGGLMPGGRLRMEKLSRLVSVGKLDLSPLITHPFKGFEHIEEALYLMKEK
FT                   PKDLIKPVVLL"
FT   CDS             complement(444474..445124)
FT                   /transl_table=11
FT                   /locus_tag="SY1_03950"
FT                   /product="pyroglutamyl-peptidase I . Cysteine peptidase.
FT                   MEROPS family C15"
FT                   /function="pyroglutamyl-peptidase I . Cysteine peptidase.
FT                   MEROPS family C15"
FT                   /EC_number="3.4.19.3"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27858"
FT                   /db_xref="GOA:D4M7L3"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7L3"
FT                   /protein_id="CBL27858.1"
FT                   /translation="MQNKVLVTGFEPFGGEPVNPAGEVLKLLDGKRLEGCQIVTQEIPT
FT                   VRFLSLESLRSAVTREDPIVVISLGQAGGRSEITPERVAINVDDFRIPDNGGNQPVDEP
FT                   VIEGAPAAYWSTLPIKSMVRAMRDAGVPASVSNSAGTFVCNHLFYGLMHFLATEGNARR
FT                   GGFVHIPYMTEQARRLGEGNGLPVATMALGIETAIRAALTVREDLRETGGRLH"
FT   gap             445444..446949
FT                   /estimated_length=1506
FT   CDS             447418..447567
FT                   /transl_table=11
FT                   /locus_tag="SY1_03970"
FT                   /product="LSU ribosomal protein L33P"
FT                   /function="LSU ribosomal protein L33P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27859"
FT                   /db_xref="GOA:D4M7L4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7L4"
FT                   /protein_id="CBL27859.1"
FT                   /translation="MADIIGLTCTQCKRRNYTTTVNKKKQSKKLEIKKFCKWCNASVLH
FT                   KESK"
FT   tRNA            447649..447724
FT                   /locus_tag="SY1_T_24540"
FT   CDS             447770..447973
FT                   /transl_table=11
FT                   /locus_tag="SY1_03980"
FT                   /product="preprotein translocase, SecE subunit, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27860"
FT                   /db_xref="GOA:D4M7L5"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR022943"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7L5"
FT                   /protein_id="CBL27860.1"
FT                   /translation="MTKEAVNSIPGVAFLREVRAELKKVTWPTKKQVWYWTLIVIVFTL
FT                   GVSLYLGLIDFLLTWAFSGMLG"
FT   CDS             448661..449086
FT                   /transl_table=11
FT                   /locus_tag="SY1_04000"
FT                   /product="LSU ribosomal protein L11P"
FT                   /function="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27861"
FT                   /db_xref="GOA:D4M7L6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7L6"
FT                   /protein_id="CBL27861.1"
FT                   /translation="MAKKVVGQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKQFNAK
FT                   TSDQAGLIIPAVITVYADRSFTFELKTPPAAVLLKKAAGVESGSGVPNKTKVGSVSRAK
FT                   VREIAEYKQRDLNANDVEAAMRMIEGTARSMGLEVRD"
FT   CDS             449199..449903
FT                   /transl_table=11
FT                   /locus_tag="SY1_04010"
FT                   /product="LSU ribosomal protein L1P"
FT                   /function="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27862"
FT                   /db_xref="GOA:D4M7L7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7L7"
FT                   /protein_id="CBL27862.1"
FT                   /translation="MKHSKRYRAAAEKVELGKLYGLREAVELYKQIATAKFNESLEVHV
FT                   RLGVDPRHADQQVRSTVGLPHGTGVTRRVLVLAAGEKQKEAQDAGADIVGGEDLVQKIS
FT                   GGWLEFDAVIATPDMMKSVGRLGKVLGPRGMMPSAKTGTVTFDLTNAISEIKAGRVEFR
FT                   VDKAGITHNAIGRREFTVDQLFENAKAILQAIYKARPASVKGTYVKSVTIAPTMGPGIA
FT                   VDPLDVQREVSA"
FT   CDS             450189..450719
FT                   /transl_table=11
FT                   /locus_tag="SY1_04020"
FT                   /product="Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27863"
FT                   /db_xref="GOA:D4M7L8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7L8"
FT                   /protein_id="CBL27863.1"
FT                   /translation="MPASVKYELVADLKEKLERSNAIFVAEYRGMTVAASTALRARVRA
FT                   AGGEMKVAKNTLFSIAIKEAGLPELPEDLTKGPNIFTLSYGDPVSVAKVLKECATDKTQ
FT                   KAFVLKGGMLGSTVLDLQQLHALADLPSKDVLIGQVVRTIAAPISGLVNVLSGTVRGLV
FT                   TCLAQIRDKKDAA"
FT   CDS             450815..451198
FT                   /transl_table=11
FT                   /locus_tag="SY1_04030"
FT                   /product="LSU ribosomal protein L12P"
FT                   /function="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27864"
FT                   /db_xref="GOA:D4M7L9"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7L9"
FT                   /protein_id="CBL27864.1"
FT                   /translation="MTHEELIKAIEEMSVLELSELVKALEEKFGVSASAAPVAMMAMPG
FT                   AAAGAGAAAGEEKTEFDVVYKGPGSNKIAVIKVVREITGLGLKEAKELVDNPPKPIKEG
FT                   VSKEEAEELKKKLAEAGADVELK"
FT   CDS             451587..451976
FT                   /transl_table=11
FT                   /locus_tag="SY1_04040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27865"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7M0"
FT                   /protein_id="CBL27865.1"
FT                   /translation="MSDQPAKKVSAPANKKKLILIGAAVVLVILNVMWTLLQNKFTPRV
FT                   DALKEEFTKIEARLSKLEKDALPDVEAIRSELNALKLMSEAYENRSSQLLKAEEAQLAS
FT                   LESQLAMQRERVESLKKLGAAEDGK"
FT   CDS             452496..454304
FT                   /transl_table=11
FT                   /locus_tag="SY1_04060"
FT                   /product="GTP-binding protein LepA"
FT                   /function="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27866"
FT                   /db_xref="GOA:D4M7M1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7M1"
FT                   /protein_id="CBL27866.1"
FT                   /translation="MRQENIRNFCIIAHIDHGKSTLADRLLERTGTVQSREMKNQLLDS
FT                   LSLERERGITIKLVPVRMDYTSPDGKKWVLNLIDTPGHVDFAYEVSRSLAACEGALLVV
FT                   DASQGVEAQTVANAYQAVEQGLEILPVINKIDLPSAREENAKQEIQDVVGLDASDAVLA
FT                   SAKDGRGIDEILERVVQRIPAPEGDAGAPLQALVFDSVYDNYHGVISYVRVVNGVIREG
FT                   QNVLFMQTGSVYSVEEVGVFRPGFTPVEQLGPGEVGYIAASIKTLAEAPVGDTITEAAR
FT                   PAARPLPGYRKVKSVVFCGFYPVERDNYPQLREALEKLCLNDAAVTFEPETSVALGFGF
FT                   RCGFLGMLHMEVVRERLSGEYGVELVATAPNVVYEVVTPSGAVIEAHRPSDFPDAGEIE
FT                   EVREPYIKLSVFLPSEFVGKVMQLVQDRRGVYKSMDYLTPERVRLIYEMPLSEFIIDFH
FT                   DKLKSQTRGYASLDYEFIGLRASDLVRVDVLVNGEAADAFSFICHREQAYHRGHAAVTK
FT                   LKALIPSQLFEVPIQASLGKRVIVRVNVKALRKDVLAKCYGGDITRKRKLLEKQKEGKK
FT                   RMKQIGKVSIPQEAFLAFMQVEGDGK"
FT   CDS             454294..455484
FT                   /transl_table=11
FT                   /locus_tag="SY1_04070"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27867"
FT                   /db_xref="GOA:D4M7M2"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7M2"
FT                   /protein_id="CBL27867.1"
FT                   /translation="MENRDACPRKAEPVLPRGARPSLYLHVPFCAAKCGYCSFYSRRAG
FT                   DGEVAAWLDALEAEARAWRDRLGGRVPPRTLYVGGGTPSLLTPGDWRRVLRILEVMADL
FT                   SPLEEASVEANPSSLTKEHLAVWRDGGFTRVSLGVQSLDDGELRRIGRLHDAAGALRAM
FT                   AMVLGAGLHLSVDLIFGLPGQTLRSWSASLRGVLAAGVGHLSTYQLTLEPDAPMSRQSL
FT                   SLPDGYPLYRYAQWFLAKNKFLQYEISSFAPSGAECRHNLAYWRQEPVLPLGPAAWGYL
FT                   DGWRWSNPPTLEAYLEAARCGFPDPLAGAERLSPRARALEAAILALRTRWGIDRLEFAR
FT                   RWGTGVLREVEGVLLGLPPRLLRTEEGALALTPSGMRVGNAVWTELMALEDRGAGD"
FT   gap             455633..456192
FT                   /estimated_length=560
FT   CDS             459415..460281
FT                   /transl_table=11
FT                   /locus_tag="SY1_04100"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27868"
FT                   /db_xref="GOA:D4M7M3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7M3"
FT                   /protein_id="CBL27868.1"
FT                   /translation="MGQIFASLRRRGAWRKGYKLILGNSSLTIGLAIVALMCIVALVPE
FT                   SIATHSPNDHNVDAILQPPSAEHYFGTDNFGRDLYSRVVWGARVDLQLGLVAMIVPFVV
FT                   GSLIGLLAGYYGRWIDALLMRILDIFLAFPFTLVIIVIVAIIGPGTANLYIAMWLVGWR
FT                   TYARLIRSEVLVIRDAEYVQAARVLGYSDARILLRHILPNVVSSCIVYGASDVVMCMLA
FT                   GAAMSFLGLGIQPPTPEWGALIAGGRAFISKAWWLTALPGLCLAIVGTGFSLVGDGLSD
FT                   LLRTKGR"
FT   CDS             460294..461289
FT                   /transl_table=11
FT                   /locus_tag="SY1_04110"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27869"
FT                   /db_xref="GOA:D4M7M4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7M4"
FT                   /protein_id="CBL27869.1"
FT                   /translation="MSDILLEVKDLRTHFITGENMVKAVNGVSFSVRRGETFGLLGESG
FT                   CGKSATCRSITRLINPPGQIIGGEILYEGTDLLKLPMDKLRRLRGREISMIFQEPMTAL
FT                   NPVLPIRTQIFESLDPQMSRAQKRARALELMHLVGIPSPEKRIDEYIHQFSGGMRQRVM
FT                   IAIALASQPHLLLADEPTTALDVTIQDQIMKLIGGLKKRMNMSVILVTHDLGVVSQMCD
FT                   RVAVMYAGHVMELCDTVTLFFHPRHPYTHGLFRSLPYGKGTRTRLEPIAGAPPSLENLP
FT                   AGCPFEPRCDWAEECCRAGLPPLTEIAEGHFTRCYFYAKLPDEVRFSTRM"
FT   CDS             461309..462319
FT                   /transl_table=11
FT                   /locus_tag="SY1_04120"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27870"
FT                   /db_xref="GOA:D4M7M5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7M5"
FT                   /protein_id="CBL27870.1"
FT                   /translation="MDTLDKDTALIRVRGLKKYFPLKRQLTDFISGNPQEVLKAVDDID
FT                   LDIQTGENLGLVGESGCGKSTLARTIIRLYTPDEGSVLFDGKDITRMEKQELRKVRRDL
FT                   QMIFQDPYSSLNPRMSVREMLMEALTFHKVCHKTEMEKRFYDLLSMVGIGAEAADRLPG
FT                   EFSGGQRQRIGIARALAPAPRFIIADEPVSALDVSIQAQIINLLEELQERLHLTTLFIS
FT                   HDLRVVRHISHRVAVMYLGRIVELADTEALFEHPAHPYTDILLRAEPPLDPRLRSTETA
FT                   ISGELPSPIHLPSGCRFHPRCPNARKECSEREPLLSGVGSGHFAACHYPLLSRGG"
FT   CDS             complement(462362..464035)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04130"
FT                   /product="Predicted aminopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27871"
FT                   /db_xref="GOA:D4M7M6"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7M6"
FT                   /protein_id="CBL27871.1"
FT                   /translation="MLNDTERDFLSKLNGTEIERDLREITRYERPSGSEGERLAHEYVA
FT                   SRLEENGMPPLRTTFPAWTFSFGEARMRFWLRGKEGSLPVKIWGYSPDVWEKPVRGRAV
FT                   FVPPESFPPDSIAWFADRSSWSAGDLEGKIVLSTTRSAIAIQDAFERGAFAYVFCWPYG
FT                   DEDVIHESAVCAGWGASLPEDVELYPQIPVFAVNRTGGNRLMELAASGDLDIELRGHSR
FT                   SEVRKLPLLEACLPGDSPYFILLGSHMDAKHHGATDNGTGCALMLALALRFSSLKRRPF
FT                   GLRFCWWSGHEFSKYAGSSNYALERFGELDKYCLCYINADVPGAKGSEDFSQVAATPDF
FT                   MALARGAVRDVTGQDGEHFGPVNSYDQSFYNIGVSSCFIWSSQTAPDSPHASGKGGMPW
FT                   WWHTEEDTFGKHDMEVLMQDCRLYALGTRRILEPGWLPDDRALWDRLIGELEKIDDRQV
FT                   PDLHSILVSLKTSRERLAGKSGLKERLFVIRKLNQALYCQRAPYFQDFRMGEAYVPGLS
FT                   LPLEALATQSLTDRAKFVLDRYILAQRNRLLSLAQELERL"
FT   CDS             465845..466762
FT                   /transl_table=11
FT                   /locus_tag="SY1_04150"
FT                   /product="rRNA methylase, putative, group 3"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27872"
FT                   /db_xref="GOA:D4M7M7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7M7"
FT                   /protein_id="CBL27872.1"
FT                   /translation="MAERFSGGKGGPRRSGGEGRRRPDLRGPGRPTEARRGGAPRGEPP
FT                   RRSAERPLPPDDVCWGRQPVLDLVRNTPSRCTRLLIANNVRPPYLDELVDLARAGRVVY
FT                   QLVAPEALDKLCPGERHQGVACRLTETVPVDLEPFLKALPAEAPALIVVLDHVEDPHNL
FT                   GAIVRSAEAAGAAAAVYSRRRSALPGGTVVKTSAGASLRLPMIPVVNVVRTLAQLQAAG
FT                   FWTVGLEGRAGASLWEDGLPARLALVVGAEGEGLSRLVGESCDQLLRIPIQGGVGSLNA
FT                   SVAAAFGMFEWSRTRASASAQGGD"
FT   CDS             467337..467780
FT                   /transl_table=11
FT                   /locus_tag="SY1_04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27873"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7M8"
FT                   /protein_id="CBL27873.1"
FT                   /translation="MTEDSYTALEAYTTVTGMRADSLPDIAERIFLQDRPDGPQGYYVR
FT                   REDGRETSWLSVRWTDKEAGKVNVDMEANLVLGPKDVESRYWSGEGTVRKGVLKADGDY
FT                   DGQGSATFTFKGDSVQVVVSEDIAPDVDVTLDGTYVRQRLTKP"
FT   gap             468004..469651
FT                   /estimated_length=1648
FT   CDS             471355..472206
FT                   /transl_table=11
FT                   /locus_tag="SY1_04200"
FT                   /product="lipoate synthase"
FT                   /EC_number="2.8.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27874"
FT                   /db_xref="GOA:D4M7M9"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7M9"
FT                   /protein_id="CBL27874.1"
FT                   /translation="MTEPRAAMRKPEWLKIKVQGGRPFQEVEALLKALHLNTVCQEANC
FT                   PNRMECYGKRTATFIILGRNCTRNCTFCNVSRERPDPVDPLEPEHVAAAVRSLKLRHAV
FT                   ITSVTRDDLPDQGAGQFAACVRELRAQCPETTVELLIPDMQGREDLLDVILAERPEVLN
FT                   HNVETVPALYPRVRPQADFERSLGVLRYAKSKGFKTKSGIMVGLGEREDEVIDVMRRLR
FT                   EGDCDMLTVGQYLQPTARHIAVHEYVTPETFERYRIEALELGFARVASGPFVRSSYKAE
FT                   AL"
FT   CDS             472273..473337
FT                   /transl_table=11
FT                   /locus_tag="SY1_04210"
FT                   /product="Predicted phosphatase homologous to the
FT                   C-terminal domain of histone macroH2A1"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27875"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7N0"
FT                   /protein_id="CBL27875.1"
FT                   /translation="MPLEIVRNDITKMKVDAIVNAANSSLLGGGGVDGCIHRAAGAGLL
FT                   EECRTLGGCETGSAKITGGYGLPCRYVIHAVGPVWRDGRHGERDLLASCYRTSLELAKE
FT                   HGCESVAFPLISSGAYGYPKDRALRVAVDTISEFLFRNDMTVYIVIFDRRAYQISAKLF
FT                   RDVAEYVDDHYVEEHADRNEAQRRRRSFPEWEAELLRSAEVLEDLDEVHECVPRDPARK
FT                   RGPMSPAGPLKDLDEVVSRIDESFSRMLLRKIDEKGMTDVECYKKANIDRKLFSKIRSD
FT                   VDYRPSKPTALAFAIALELPLDEAKDMLMKAGFALSRSSKFDVIIEYFIRNGNYNVFEI
FT                   NEALFAFNQSLLGA"
FT   CDS             complement(473355..474020)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04220"
FT                   /product="Uncharacterized protein encoded in toxicity
FT                   protection region of plasmid R478, contains von Willebrand
FT                   factor (vWF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27876"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7N1"
FT                   /protein_id="CBL27876.1"
FT                   /translation="MKENLTEIVFVLDRSGSMSGLESDTIGGFNAMIEKQRKGDGEALI
FT                   STVLFNDQSEVLHDRADVKDVRPLTEAEYSVGGSTALLDAIGGAIHHIGNVHRYARPED
FT                   VPERTLFVITTDGQENASRRYGLRKVRQMIELEKSRYGWEFLFLGANIDAIETAERFGI
FT                   GRDRAANYCSDSEGTRLNYDVMSEAISTVRLRQPLSADWKRRIDEDCRRRSGRKGDAE"
FT   gap             475729..476098
FT                   /estimated_length=370
FT   CDS             complement(476231..478129)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04250"
FT                   /product="Carbon starvation protein, predicted membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27877"
FT                   /db_xref="GOA:D4M7N2"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7N2"
FT                   /protein_id="CBL27877.1"
FT                   /translation="MITFFVALAALIVGYCTYGLFVTLVFKPDDRRTPCQVHPDGVDYV
FT                   PLPIWRAFLIQLLNIAGLGPIFGALSGAIWGPSVYLWIVLGTIFAGAVHDYLSGMLSMR
FT                   NDGASISELTGMYLGPTMKTVMRIFSVVLLVMIGVVFMVGPAQLLSRMIMGAGRDFNLP
FT                   RTAAVSIQAAPAVAAPKTEAEKTAAPKADEGKVPVEAKPAPIEEAKPEAPAEEAKPAPV
FT                   EEVKPEAPAAEVKPVPAEEVKPETPAEEAKPAPTEEAKPEAAAAEEVKPVAEPEMVYGL
FT                   TEAEWVKYLTIAILVYYFLATLLPIDKVIGRFYPIFGLCLILMAVLIGGATVMNHLNGT
FT                   HPMIELWDGLYNMHPKGATTPIWPLMFITVACGAISGFHATQSPMMARCLTSERQGRFV
FT                   FYGAMVAEGIIALIWASAGIAFYNTFGSPITTEGLFLARGGNSATVYDISKGLLGSMGS
FT                   ILALLGVVACPITSGDTAFRSARLTLADWFKIDQKAIKPRLMLALPLLLIGYAISFVDY
FT                   GIVWRYFSWSNQTLAMIALWAGAVYLCRNVSPVSGFMAAIPATFMSAVSSTYFCFAPEC
FT                   LGFATKFSEGLTLCGVTVDGVQLSYGIGLVFALVLFSIFFGVHRSANYYKSLKKGA"
FT   CDS             479377..480387
FT                   /transl_table=11
FT                   /locus_tag="SY1_04270"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27878"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7N3"
FT                   /protein_id="CBL27878.1"
FT                   /translation="MKKWALCVGTVLVLGLAVSAMAADVLVGACIYKFDDTFMTGVRNA
FT                   MNAEMKEHSGSLEIVDSQNRQPDQNNQVDTYITKGVNALIVNPVDRTAAAPLMLKAKAE
FT                   GLPIVFVNREPQEEVMKSYDKTWYVGAKAEESGTLSGQIIADYFKANKAADKNGDGKIQ
FT                   YIMIRGEQGHQDATLRTEYSVKAMKDSGFELEELGSDTANWDKVQGANKMSGFISAVGL
FT                   DRIEAVLANNDDMALGAIEALKAEGYNAGDPAKFVPVVGVDATAPALEAMKDGSMLGTV
FT                   LNDAVNQGKAAVRVAVAAAEGREVTKESIGYDVTDERYIWIPYRKVTSENYKEFM"
FT   CDS             480508..482007
FT                   /transl_table=11
FT                   /locus_tag="SY1_04280"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27879"
FT                   /db_xref="GOA:D4M7N4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015862"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7N4"
FT                   /protein_id="CBL27879.1"
FT                   /translation="MSEYVLEMKEITKTFPGVKALDRVSLNVRPGTVHALMGENGAGKS
FT                   TLMKCLFGIYSPDGGEILLDGTPVRINSAREAMDDGISMIHQELHPIRFRPVMENVWLG
FT                   RFPSTFGVVDHKAMYDRTLALFKDLELDVDPAAQAGSLSAAKLQMMEIARAVSTNARII
FT                   IMDEPTSSLTDRETEHLFKIINRLRKQNIAIIYISHKMEEILQIADEVSIMRDGHYIGT
FT                   WPASELTMDGIIQRMVGREMTDRFPPKLVAPSEELVLKVEHLSSPLKSSFQDISFELRR
FT                   GEILGIGGLVGAQRTEFVEALFGLRDVASGTVLKDGEPSLSHSPREAKAHGLALLTEER
FT                   RATGIFGILPVLENTVIANQKHYAHLGVLNDRERIEAASESCGELNVKTPSLDTLIQNL
FT                   SGGNQQKVLIARWLLTNSDVLILDEPTRGIDVGAKYEIYTIMLSQIAQGKSIIMISSEM
FT                   PELMGMSDRIMVMCAGRVTGMLNRDQFDQVEIMRLATQFSK"
FT   CDS             482061..483335
FT                   /transl_table=11
FT                   /locus_tag="SY1_04290"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27880"
FT                   /db_xref="GOA:D4M7N5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7N5"
FT                   /protein_id="CBL27880.1"
FT                   /translation="MAERRITREKYNHFLRTSGASVLILGVILKAVQAVPALSGIKEAL
FT                   SLKSVYDLPVFLMIIGAVVALKGVVAARGRGAEGEAEDVVLSRKSFGAFLTNYAILLAM
FT                   LVLVVVICVIQPRFMQVRVALDVLTQSSTRLIIALGICFTLLIAGTDLSAGRMVGLAAV
FT                   VSTSMLQTSAYANRFFPDLPQVSVWLPILLAVLACMAFGALNGFLVAKYDMHPFIATLA
FT                   TQVIIYGACSLYFDMPPNNSQPIGGIRPDFTALGQMKVFASSEPGGFPGISILIPIAAV
FT                   ICVLIWFILNKTVFGKNVYAIGGNREAAVVAGISVFRNIMGIFILASCLYGIAGVLEAA
FT                   RTAGATNNYGNGYELDAIAACVVGGVSLNGGIGRVSGIVSGVLIFTIIQYGLQFVNVSP
FT                   MWQQVIKGVIIAAAVAIDMTKYRRR"
FT   CDS             483344..484360
FT                   /transl_table=11
FT                   /locus_tag="SY1_04300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27881"
FT                   /db_xref="GOA:D4M7N6"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7N6"
FT                   /protein_id="CBL27881.1"
FT                   /translation="MEGLSMESLYRHVGTEEQVYGVRRLILDEGNARGAAVYQVSTAGG
FT                   LDFDVLPDSGLDVGRLRWRGVNVNYMTKNGYDAPSRFLPVPDNFDHTFPGGMMYTCGLL
FT                   SVGPQCRDEEGDGEFHPLHGRYHGQSARGLSASAEGGVIRVSGTVRETEQWRHNLSLKR
FT                   VITAPAWGSELLVEDEVTNLTPQPVEYALLYHCNFGWPLLDADATLELPEDRKVTPRSP
FT                   WAEAGLADQCRCTAPIDGEEERVYFNEVRPAGEDPRARLINRRLGIGAELSWSLDTLPI
FT                   LSQWKCMRSGEYVLALEPSTCYTMGRLEERRHGSMRTLAPFASVRTRVRLRFFDPED"
FT   CDS             484372..485568
FT                   /transl_table=11
FT                   /locus_tag="SY1_04310"
FT                   /product="galactokinase"
FT                   /function="galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27882"
FT                   /db_xref="GOA:D4M7N7"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7N7"
FT                   /protein_id="CBL27882.1"
FT                   /translation="MQGIRDMYGRMLSRFQELFGTGGGAPALFRSPGRVNLIGEHTDYN
FT                   GGHVFPCAISLGIWALAAPRQGTDLVRLHSMNFEEAGTTEAPARGLEYRQERGWANYPL
FT                   GVLRVLEEAGHPLPAGLDLLFWGDLPGGAGLSSSASIEVLTARVADGLFGMGLQGVETA
FT                   LLAQRAENDFVGMKCGIMDQFAITMGRRNCAVFLDCRTLDFKLVPLNLDGFRIVISNTN
FT                   KPHALAGSEYNLRRAQCEAALEDLRRVRPVKALGELTEPGFKYLSGVIRNPVNLRRARH
FT                   AVTENQRTLHALAALEMSDLALFGRLMNQSHVSLRDDYEVSCPELDALVELAWRQPGVV
FT                   GSRMTGGGFGGCTVSIVEAPCVEAFVRDVGAGYAKATGLRADFYEVDAADGAGRMERP"
FT   CDS             485602..486591
FT                   /transl_table=11
FT                   /locus_tag="SY1_04320"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /function="UDP-galactose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27883"
FT                   /db_xref="GOA:D4M7N8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR025308"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7N8"
FT                   /protein_id="CBL27883.1"
FT                   /translation="MAILVCGGAGYIGSHNVRALLDRGSEAVVVDNLWTGHRPAVPDGV
FT                   PFYEGDVRDAALMDRIFSEHKIEAVLHFCACSLVGESVEKPLLYFANNVGGMQSLLEAM
FT                   VRHGLRQIVFSSSAAVYGEPSRVPILEDDETKPTNPYGETKRVMERMMHWVGERHGIRY
FT                   VSLRYFNVAGAWHDGSLGEDHRNETHLVPIILQVPLGRRDCVTVFGDDYPTPDGTCIRD
FT                   YVYIEDLAQAHLMALDYLAKGGESRILNLGSGDGYSVMEMINAARRATGRDIPVKVGPR
FT                   RAGDPARLVADSALAGRVLGWRPQVTSMEDIIASAWHWHSAHPQGWGN"
FT   gap             486828..487036
FT                   /estimated_length=209
FT   CDS             488507..489694
FT                   /transl_table=11
FT                   /locus_tag="SY1_04350"
FT                   /product="galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27884"
FT                   /db_xref="GOA:D4M7N9"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7N9"
FT                   /protein_id="CBL27884.1"
FT                   /translation="MEIKAVYEKMLPRFRELFGEGEPTLYFAPGRVNLIGEHTDYNGGH
FT                   VLPCAISLGIWALAVRREGNRVRVGSMNFDDRPPTETGRSGIELRVEWGWANYPLGMLS
FT                   TLEVHRYPIPSGLDILFWGELPVGAGLSSSAALEVLTACVVNDLFGLRIDRLNMAIMGQ
FT                   ETENRFIGTQCGIMDQFAVSMGRKGCAVLLNCAALTHLYVLLYSGGYQIVIADTNRRQS
FT                   AGREDYNLRCRQCEAACEAIRRVRPIRTLCELSVEDFNRLESEIPDPVNRRRARHAVTE
FT                   NQRTLDAARALSLADLRTFGLLMRASHLSLRDDYEVTCPELDALAELAWRQPGVIGARM
FT                   TGAGFGGCTVNVVERHLVSRFIRDVGAGYELQMGCAPRFYVADAADGAAKVRLPK"
FT   gap             492367..493314
FT                   /estimated_length=948
FT   CDS             complement(493403..494644)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04380"
FT                   /product="sodium--glutamate symport carrier (gltS)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27885"
FT                   /db_xref="GOA:D4M7P0"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7P0"
FT                   /protein_id="CBL27885.1"
FT                   /translation="MSFEVVDGVFTISENAVFSTAMACVLLLLGYRVKRKVPFLEKYCI
FT                   PAPVIGGFLFMFVTFIGHNTGTFAFKFDSAFQSPFMLAFFTTVGLGASFELLKKGGLLL
FT                   ILYWLCAGVISIVQNVIGITVGDAVGLPAPYALLSSAISMIGGHGAAGAYGRTFEELGY
FT                   AGAMGVGAAAATFGLISGVMVGGPLARRLIVRYNLKPQEDNGSYAEIESINAAEGVKLT
FT                   GLETIQNVAAIIICMALGMVVSGWIGKLLGMSFPDYVGAMFVAVALRNLNEKFQFYKFS
FT                   FSLSDKIGDVMLNLYLGLALMTLRLWELMDLMGGMLLIVVAQLVFMCVIAYFVVFRILG
FT                   SNYDAAVMCAGLCGHGLGATPSAIVNMTAVTEQYGMSRKAFMIVPIVGAFLVDIIYQPQ
FT                   TIYFIKKFVEGITK"
FT   CDS             495240..497219
FT                   /transl_table=11
FT                   /locus_tag="SY1_04390"
FT                   /product="oligopeptidase F. Metallo peptidase. MEROPS
FT                   family M03B"
FT                   /function="oligopeptidase F. Metallo peptidase. MEROPS
FT                   family M03B"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27886"
FT                   /db_xref="GOA:D4M7P1"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7P1"
FT                   /protein_id="CBL27886.1"
FT                   /translation="MKGLRTRRALPLLAAACFSCAGLAAGGAAAGVEKFDALTRGVVPM
FT                   NFAMRFEAPEAMGDGTGGVPERRDVPEAMRWDLEAIYPSFEAWERAFSDLTPKIDALAG
FT                   FAGRLGEGPKKLLEYLKAEEAVSLELEKLYVYANMKSHEDLRETRPMELASRIEALSAR
FT                   HGVVTAFFAPEVLELPEDELRRWVRGEPGLKLYAFFVERLLREREHILPRAEEALLASA
FT                   REATAAPENAFSLLTNADLKFPTIRDEEGRSVELTEERWYKLSRSPSRDVRRAAFEGIY
FT                   GTYGSFKNALAALYAGSVKGDLFYARARRYKDSLEAALFGDNVPRSVYENVVDTAARCA
FT                   PLMHRLVALRKRALKLDRLHYYDLNVPIAEEPREDIPYERACRMVAEALAPLGEDYVAN
FT                   FKRGLAERWIDVYENRGKRKGAYSWGSYATHPYVLLNYNGTLNDVFTLAHEMGHSMHSW
FT                   YSHRNQPQVYGDYTILLAEVASTTNEALLLGHLLKTAKTEEERKWLLSYYYNMVRTTFF
FT                   RQAMFADFELQVHARAEEGGALTPEWMSGLWRELNERCYGPDMAPDELLWVEWARIPHF
FT                   YSAFYVYKYVTGFTAANAFASAILAGEPGAVDRYLTFLKSGGSDESLNILRRAGVDLTS
FT                   REPFDRTMKLFQERLEEGERVWGR"
FT   gap             497508..497798
FT                   /estimated_length=291
FT   CDS             complement(498707..499204)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04420"
FT                   /product="Diadenosine tetraphosphate (Ap4A) hydrolase and
FT                   other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27887"
FT                   /db_xref="GOA:D4M7P2"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7P2"
FT                   /protein_id="CBL27887.1"
FT                   /translation="MQQLYATWRMDYISAPKPEGEGCIFCAFPAERRDEERFILHRGEA
FT                   CYVIMNLYPYNPGHMMVLPFRHTSDYQSLTEQEVREMHRFTAHAVKVLGKLMHPDGFNL
FT                   GMNLGKPAGAGVAGHLHRHIVPRWTGDCNFMPVLSETRVVSEAIEDTYRRLRTVWNEEM
FT                   MV"
FT   CDS             499290..500009
FT                   /transl_table=11
FT                   /locus_tag="SY1_04430"
FT                   /product="Ribulose-5-phosphate 4-epimerase and related
FT                   epimerases and aldolases"
FT                   /EC_number="4.1.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27888"
FT                   /db_xref="GOA:D4M7P3"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7P3"
FT                   /protein_id="CBL27888.1"
FT                   /translation="MGRPVRYNLITGSRKGEIVTLLERERNAVVEYGRRLVERGLTRGT
FT                   GGNVSVLSRERRLFAVSPSGMDYFETRPEDVVVLDMEGNVADGARRPSSEVEMHRLIYL
FT                   EREDVGAVVHTHSVYATAVSCTREAQAGGLPPVHCAAALAGGDVRCTAYYPFGTRELAE
FT                   AACEGMRGRFAVLLGNHGVLAAGSDVGHAFALAEQLEFACEVLVHAAAVGTPALLSSSD
FT                   LLAARERFRDYGQGRRE"
FT   CDS             499987..503628
FT                   /transl_table=11
FT                   /locus_tag="SY1_04440"
FT                   /product="ATP-dependent exoDNAse (exonuclease V) beta
FT                   subunit (contains helicase and exonuclease domains)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27889"
FT                   /db_xref="GOA:D4M7P4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7P4"
FT                   /protein_id="CBL27889.1"
FT                   /translation="MDRDAASSFWDGALLPDGTPEGQRAAVTSSDGLITVGAGAGTGKT
FT                   WVLSNRYARLLLTDADCLPCDILTLTYTDAAAGEMRRRIEDRVRALMDVPDAPVSQERR
FT                   REVLEGFSEAWISTIHAFAARLVRESGLALDVDPRSAVVSGPQTERFWARVRDALEEAG
FT                   LGELADACGSSHLRAVARELDQDPLISAAVGRWGAEALKDLAREAAELHADLGHRWEDM
FT                   MRWGDEALREDDPQARAAGREVLALLRLSWRRAWATWRDVFDALAEDIRAAGAAAQASG
FT                   RNVPDRLLMEFMERWEGRLSGPEAADDELRTFYLEVMDRERLKGGNSGLLKKVKEVLGT
FT                   TLGAWQEAEEDEGTPALSAPSPDAPLPEPERLMRSALLRFCAAAWGLWDAERRRRGLLS
FT                   FSDMILQARAAVESGKAQRTFRHILVDEFQDTDPLQFGMIETLRHEGVRSLFAVGDPKQ
FT                   SIYGFRHAEPSLFAEAIGRADARVTLDVSFRTRGALLTRLNDLFAHIWRDGLGTSEAMS
FT                   RLEFEPLSPAGSGERGAGTTAPFSVLLAVKEGRAVLGARRRLAGALARRVARWVEEGRT
FT                   VWDKGLNALRPLRYGDFAVLARTRGSHELLEDAFAAAGVPAVQDRSRDYFSRGEVTDVI
FT                   CLLRAAEDWEDGAAVFGWLMSPFSGVPIDEARRCLERIGGTLRTGRGVMEALKEALPDA
FT                   AARLERTSLIGRRNGPAAILSPLDRDRRWLANLPEKERLRALRNVRRAVAIARSFQRGS
FT                   ASSLAACADWMDRALRRGVDMEEPAWHGEGVNAVLLSTVHASKGLEYPVVAIFDTAKRR
FT                   RPRTLCPSRTLGAAFADLPDELSASRPSAREPLSMAWERALTRQGEREEDLRLLYVAAT
FT                   RAQDSLIHCGLVTFGKEGSAPAEKGGWTSIVLDWMQGRGDCGPDLTGPDVELIPSGDGA
FT                   QPAGKPQRAVPTPAPVAVARPDSGTRELAVLSATSFSLMEWCPLAWRRRYRQGLDLAWE
FT                   APRGAAEEDGRGGSDLGSLAHWILARWPSAEGDAEAELERWLTDPRALRSLPTLLRDVW
FT                   REEENRNALRPWLLHFVGSEAGVMVRGALPLGARREAGFRVEVGGLALSGAMDVVWREG
FT                   EIWRVLDYKVTLMQNAPEELYSAQLDLYALAARKGAELAGAPCRRVEAGLVFLRERSPL
FT                   RMRKVEDWEAIEGRVRAAARLGAVRDLPPREEHCPRCPWRSSCPAAR"
FT   CDS             complement(503700..504245)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04450"
FT                   /product="probable proton-coupled thiamine transporter
FT                   YuaJ"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27890"
FT                   /db_xref="GOA:D4M7P5"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7P5"
FT                   /protein_id="CBL27890.1"
FT                   /translation="MSNSNAASIRSATAAMVEGALCIALAVVLSKVNLFALPNGGSVDA
FT                   GLAPLFIFAWRRGLRWGVAAGALAGVVKVLLGGYIVHPVQVVLEYPLAYAMTGLAAAFS
FT                   CKKPLGQAMGLVLGFLAQTGCHVVAGAIFFAQYAPKGQNPWVYSLLYNAPTLGAKYLLS
FT                   AVAAWLLWKALERALPKR"
FT   CDS             complement(504660..506030)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04460"
FT                   /product="uncharacterized domain HDIG"
FT                   /EC_number="3.1.4.-"
FT                   /EC_number="2.7.7.19"
FT                   /EC_number="2.7.7.21"
FT                   /EC_number="3.1.3.-"
FT                   /EC_number="2.7.7.25"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27891"
FT                   /db_xref="GOA:D4M7P6"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7P6"
FT                   /protein_id="CBL27891.1"
FT                   /translation="MEITPAALKAVAALRHAGFDAYPVGGCVRDSLVPLIGTPQNPSDP
FT                   ASVRAILDCAPSDWDIATNAAPEHVRSILGGRLAAKPGLRHDTVMTSVDGTPVEITTFR
FT                   GGAATIEEDLACRDFTVNAMALNADGRLLDPFGGANDIRSGVLRAVGDPAERFREDGLR
FT                   ILRGLRFAAVFGWDIEPDTALVMHMEKDLLRDIAVERTRAELVKMLCGVHVGPVLRKFW
FT                   NVLSVAAPEIAPTVGFRQNNRHHHLDVWKHTIAVVEAAPAVPILRLAALLHDLGKPACY
FT                   TVDAAGIGHFYGHAARSAEIARDIMARLRFSDEIRRRVVTLVEHHGDILTDTPSRRTVR
FT                   RMVSNLGVDVFHDLLALRRADIAGHKVETCGKAMAACVRFEELLAELEAENACFSLKDL
FT                   AVRGGDIMELGYRGPGIGKALRALLDAVVEERVPNEREALLELLRHDVMPGLDGPAS"
FT   gap             508162..508488
FT                   /estimated_length=327
FT   gap             510053..510728
FT                   /estimated_length=676
FT   CDS             complement(510947..512410)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04500"
FT                   /product="FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27892"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7P7"
FT                   /protein_id="CBL27892.1"
FT                   /translation="MELIQDGANVNAKNDTGTTPLMIAAGNNPNPEVLKGLIEAGADVN
FT                   AKDKDGWTPLMIATQDSSNPEVLKVLMAAGADLNAKNTGGGTPLIVAAYNNTNPEILRV
FT                   LLRAGVNVDERQKDGWTPLMAAARYNSNPEVLKILLEAGADLNAKDEDGGTPLMAAARY
FT                   NSNPEVLKILLEAGADLNAKDEDGWTPLMLAIRYNTTQEVLKILLEAGADVNAKEEDGV
FT                   TPLMLATSKNTPETLTALLEAGADLNAKNKDEGTPLMAAAQHSSNPEVLKVLIAAGADL
FT                   NAKNKDGGTALMFAAIHNSNPEVLKVLIAAGADLNAKDEDEWTPLMFAAYYNSNPEVLK
FT                   VLLEAGTDVNAKNKVGATPLMAAAWHNTNPEVLKVFIEAGADINVKNKVGATPLMAAAG
FT                   SNPNPEVLKVFIEAGADVNAKNKDGSTPLMAAAGSNPNPEVLKALLEAGADAKAKNNEG
FT                   QTALDYARMNEKLKDTEALRLLEDKAGQN"
FT   CDS             complement(512608..513054)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27893"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7P8"
FT                   /protein_id="CBL27893.1"
FT                   /translation="MQNTQDELEREDEETIVGEATEDTNEATHDDAEARHWLKVFAALA
FT                   FWGLGFLLFYNGGPGVFKSFVSPMDFENHYLFYGAAAFVAMVVCGANTLACIVIGHRKN
FT                   ANLFMLFIAVSFISIFVVLSLFGAVFSFFAGQATTPYRRQDDDW"
FT   CDS             complement(513192..513824)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04520"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27894"
FT                   /db_xref="GOA:D4M7P9"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7P9"
FT                   /protein_id="CBL27894.1"
FT                   /translation="MVYGYMRISTGDRTVDVQRDALVSAGIPEENIYSDTITGSTRISR
FT                   RPEFEKLRERLRQGDILVVWKMDRLGRSILDLITTVFDLLDRDVTVRSITDAVDSSTPQ
FT                   GRALFGILDTIADLERENVRERVRAGMRAARQRGTHCGRPRMANREMAEAIREHLRRDA
FT                   SVRDIARQLNISVSLIYKVLREFPDQDAEPAPPMPEETEDGPELMIP"
FT   CDS             514005..514181
FT                   /transl_table=11
FT                   /locus_tag="SY1_04530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27895"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Q0"
FT                   /protein_id="CBL27895.1"
FT                   /translation="MALDIPSPWFVESLELAPAAKRLDIHLDFQKGSKFTCPECGAEER
FT                   KVHDTANALMCNV"
FT   CDS             complement(514742..514951)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27896"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Q1"
FT                   /protein_id="CBL27896.1"
FT                   /translation="MVFSEKEHHFMNGCLNALIVRLPFNEVQCVEDLKNVLISLMKIDI
FT                   PIKYFMIDQEVEDITGLYIANETA"
FT   gap             515190..515714
FT                   /estimated_length=525
FT   CDS             518314..518958
FT                   /transl_table=11
FT                   /locus_tag="SY1_04580"
FT                   /product="ABC-type metal ion transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27897"
FT                   /db_xref="GOA:D4M7Q2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Q2"
FT                   /protein_id="CBL27897.1"
FT                   /translation="MKRLPEFWKAVGDTILMEVWAGSICFVVGLFLGVVLTVTRPGGIL
FT                   ERPALYHVLDKLVNLFRSIPFIILLTALMPLSRLLTGTAIYVRGAIVPLVFGAAPFFTR
FT                   QVESALAQMDKGLVEAALSMGSSPLEVIFRVYLRESVAPIARGTTITAISLLGLTAMAG
FT                   AVGAGGLGDFAIRYGHDRNMTDITWVTVILLVAAVSVVQWLGERIARRSTH"
FT   gap             524072..524959
FT                   /estimated_length=888
FT   gap             528349..529128
FT                   /estimated_length=780
FT   CDS             529927..530022
FT                   /transl_table=11
FT                   /locus_tag="SY1_04660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27898"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Q3"
FT                   /protein_id="CBL27898.1"
FT                   /translation="MKPETGILLFVGGMMMCMGMMMRMYTMDAVR"
FT   CDS             530442..531272
FT                   /transl_table=11
FT                   /locus_tag="SY1_04680"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27899"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Q4"
FT                   /protein_id="CBL27899.1"
FT                   /translation="MKKAFFAAAVLALALTGTATAAQTVRLGLVGGIYEDFWAPAKEEL
FT                   AKEGIDLEFVPFTDYVTPNRALSDGDIELNAFQHDIYLQNEIKEYGYKLTNIGGTFIEA
FT                   MNIFSRKVKSVSEIKDGDTVAIPNDVTNGGRALKVLAASGLITLKESAGFSPTVADVEK
FT                   YNVKVEIKEMAANIIPAALPDVTAAVINGNYAMDFGFKLEDAIFRDTSLNEKPYWNLVA
FT                   ARTADLEDPAKVELYGKVMKAFRSEATKAVLDKMFGGYVVCAGWDEDFLAPFRK"
FT   CDS             531298..532128
FT                   /transl_table=11
FT                   /locus_tag="SY1_04690"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27900"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Q5"
FT                   /protein_id="CBL27900.1"
FT                   /translation="MKRVFFAGAILVAFLGLTGAATAAQTVKLGVVGSLYEDMWAPAKE
FT                   ELAKEGIDLELVHFSDYVTPNRALSDGEIDLDGFQHDIYLQNEIKEYGYRLTTVGSTFI
FT                   IPLNLYSRKVKSVADLKDGDVIAIPNDPTNGGRALKVLAAAGIVRLKDGASFSPTKEDI
FT                   EEYKVKVEISEMAANTIPSVLPDVAAAIINCGYAMDFGLTAEDVLFNDTSVSDREYWNI
FT                   IVARTADLEDPAKVELFRRIVKAFQSPATKAVFDGKFGGQFLPAGWGEDLLKRP"
FT   gap             535773..536610
FT                   /estimated_length=838
FT   CDS             539210..540208
FT                   /transl_table=11
FT                   /locus_tag="SY1_04740"
FT                   /product="glycerol 3-phosphate dehydrogenase (NAD(P)+)"
FT                   /function="glycerol 3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27901"
FT                   /db_xref="GOA:D4M7Q6"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Q6"
FT                   /protein_id="CBL27901.1"
FT                   /translation="MRFAVLGAGSFGTAVANSLARRGLETVLWCRDPEQAQVIASVHRN
FT                   PRHLKGYGLAPSLEATPDMAAALATASHVITAIPTQSLRDVLERVRGLPVEGKRFLSLS
FT                   KGIEITTGLLPHRIFAEVLPGASLAAMSGPSHAEEVVRDLPTAVIAASEDLEVAMDWQA
FT                   RMNSPHFRVYTSGDVLGVEMGAAVKNVIAIAVGVACALELGDNARAALATRGLAEIMRL
FT                   GVAMGANPLTLAGLAGVGDLMATCYSAHSRNFRFGLAVGRGKTPALAAEEVGEVVEGAH
FT                   TVRALTAYARRAGIELPIAEGVFAFLYEGASLHEVIEGLLFREPKPENRPT"
FT   CDS             complement(540288..541241)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04750"
FT                   /product="SprA-related family."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27902"
FT                   /db_xref="InterPro:IPR021973"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Q7"
FT                   /protein_id="CBL27902.1"
FT                   /translation="MNVTSMLSSGYLEPVIREPSSDKLRDDRWLGAQGAVRSSAAGEGS
FT                   LALQERSVLDQERALKAAAGGNAEVYTVYHYTVGADGRRYITGASVTMKGQEADLNRAG
FT                   NGLATQEIQPGVPQEAGAAEADETAEAPEAQPRTDAKSAEERQKDAQVQELKQIEREVI
FT                   AHEAAHMVAAGALGGGVSYTYTAGPDGKRYITGGEVPIQIQQGATPEETLRNMQQVQRA
FT                   ALAPADPSGQDRQVAARAAAMAAQARSEIASEGARKAARRTDATQEEAPSKAETVARGT
FT                   PVPPPEAAEPDPSKAGAAAVVASVRAADVMGQRAAA"
FT   CDS             complement(541397..543316)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04760"
FT                   /product="FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27903"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Q8"
FT                   /protein_id="CBL27903.1"
FT                   /translation="MFCTKCGAQIGDEAAFCEQCGARTRRGQSSDPASNPTEETKPHRR
FT                   APSPISDFMAWCMVGLECAIALYLGLYVFQNGFFINSTGYEVPQYLAFLADCALRLLCA
FT                   KMDSDVLTAKGYPAPSIAWAFFFPPIYLYRRGKALQRPHTLPALLSFAAMIASTGIFVS
FT                   AEIRRAEVEATASRTVSGIIRERFSMDVQCLKVKLTKRLFKGNYEALAQLSNGRALPIQ
FT                   VLEQQEDVFVSLRPAPLLLDELFSNLLSLGDQDTFSPAEAESVDEKSRDRRNATNLVSS
FT                   LRSLKAATFLFYADHAENGRERKVMELVNGQDGIAQLKAYLDNPERYGERYSISLWDAS
FT                   DGSQRLMVVCDLSGESEGVRQALQERARSVGLYEGRSQSLDDFYAGGDSVCMVAMPVNL
FT                   DMTPRITQAQRAELSDAFRSGSAARLKEVLQRERLSPDMMFEDGELLLRVAVKESPNAD
FT                   TIKALLALGANVNAERRDGRTALTAAADGGPLDVVKALLDAGANVNAKNRHTGWTVLMF
FT                   ALKEANPDVVRLLLNSGADVAAENSDGQTPLAFAVLQGASTNVLKMLLDAGADIEARDG
FT                   DDNTPLILAAQYTSNPDVLLVLLDAGADAGARNAAGLTALDLASTNPNLDGAPALQKLR
FT                   KKTQ"
FT   CDS             complement(543441..544988)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04770"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27904"
FT                   /db_xref="GOA:D4M7Q9"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Q9"
FT                   /protein_id="CBL27904.1"
FT                   /translation="MVLGTFAAAAAVSADVAAQAEAAGGVLDSILSSPFFTQLLDWVKD
FT                   ANGFLWGPQFLIPLLCGTGLFFSLRLGFVQVTKFGTACRKLFGDFSIFGEAAGKSGMSS
FT                   FQALATAIAAQVGTGNLVGAMTALITGGPGAIFWMWIAAFFGMATNFAEACLAQLYKDK
FT                   DESGQVVGGPAFYISRGLGGGVFARFLAAFFAVAIILALGFMGNMVQANSISDAFHGAF
FT                   NVDVRVTGAVLAIVAGVIFIGGVKRIAAVMEKLVPLMAILYIVVGLALIAMNAHLIPRV
FT                   FKDIFTCAFQAKAVWGGAVGVAVAKAARYGIARGLFSNEAGMGSTPHAHAVAKVNHPVE
FT                   QGVLGIIAVFIDTFVVLNITVFSVMSAGLLEEGFFKDGEPIMKGISVVQAAFENHFLGA
FT                   FGGPFIAICLLFFAFSTVIGWYYFGETNIRYLFGTKGLLPYQVLVMLFIFIGSVLKIDL
FT                   VWELSDFFNGIMVVPNLIAILLLSGKVVRLLDEYNRGIPYDAERIKADLPTPGDAKN"
FT   CDS             complement(545703..546332)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04790"
FT                   /product="Formimidoyltetrahydrofolate cyclodeaminase"
FT                   /function="Formimidoyltetrahydrofolate cyclodeaminase"
FT                   /EC_number="2.1.2.5"
FT                   /EC_number="4.3.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27905"
FT                   /db_xref="GOA:D4M7R0"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7R0"
FT                   /protein_id="CBL27905.1"
FT                   /translation="MKLTDLSLKDFTAKLGSDAPAPGGGSAAALSGALGAALVSMVCNL
FT                   TKGREKYAEFETLVVNTLKESDELAAALLEGVQKDTNAFDGVIAAYGMPKGTDAEKAAR
FT                   SEAIQSAYKVAILSPEETADNCLAVMRLSRDLLHKSNKNAASDLAVSALQAYAGLIGAL
FT                   ENVAINLAAIKDQNYVNDKRKWMDLASDEGEKLLKEVREGVRAMLA"
FT   CDS             546567..547505
FT                   /transl_table=11
FT                   /locus_tag="SY1_04800"
FT                   /product="Chemotaxis signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27906"
FT                   /db_xref="GOA:D4M7R1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7R1"
FT                   /protein_id="CBL27906.1"
FT                   /translation="MEDRAQAQADVREVSLKTGKKWEVVVFDLGGEAYAINVNKTREIL
FT                   RWQGCRPVPTTTEAFVGITTVRETILPLIDLRVFLGIRSPIPMERTKVMIVEFNDLRLG
FT                   FLVDSVERIRQVSADDLDSSKMSGISDKWVLYVIKNDARNILLLDYEAIIQDTAPAVAR
FT                   HMFDKNRISAYFNQVGNVEDFHILVADDSPLLRQQICDVLEQSGFSSVYPVKDGAEAHD
FT                   LLIGKHENFDLLISDIEMPVMDGLTLVSDLRADPCTAEVPVILFSSIMVKDLLERADKL
FT                   KIVHVLKPDIYKLVEGVMKIYQEKKEREGKS"
FT   CDS             548339..549529
FT                   /transl_table=11
FT                   /locus_tag="SY1_04820"
FT                   /product="Bifunctional PLP-dependent enzyme with
FT                   beta-cystathionase and maltose regulon repressor
FT                   activities"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27907"
FT                   /db_xref="GOA:D4M7R2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7R2"
FT                   /protein_id="CBL27907.1"
FT                   /translation="MAYDFDKVIDRRGTSCSKWDADPNKTIPGVEYPVDRDVLPVWVAD
FT                   MDFEVAPEITEALAERVRHGIFGYTKVPDACYDAIIGWQERRHGWRIKREWITFTPGAV
FT                   SAAHMAMQAYCQVGDTAIIQPPVYYPFYRTVHNNGGLLSCSCLRRSGSRYEMDFDDFER
FT                   RAAEDRTTVFILCSPHNPIGRVWREEELERVGEICMRHGVRVFADELHCDIVMPGYRHI
FT                   PFAGLNPEFAAHSITVISPSKTFNLAGLQATAAIIPDPEMRRRFENVKARNSLSDPNLF
FT                   AITAMEVAYSRGDKWLDEVLAYIKGNYDFLVEYMGKKLPKVKVMPLEGTYLAWMDFSAM
FT                   ESDERALQKRMLTRGKVWLDEGWIFGEGGAGFERIVLACPRSTLREAVDRMARAFE"
FT   gap             549717..550198
FT                   /estimated_length=482
FT   tRNA            complement(550598..550685)
FT                   /locus_tag="SY1_T_24880"
FT   CDS             550815..551261
FT                   /transl_table=11
FT                   /locus_tag="SY1_04840"
FT                   /product="conserved hypothetical protein TIGR00051"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27908"
FT                   /db_xref="GOA:D4M7R3"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7R3"
FT                   /protein_id="CBL27908.1"
FT                   /translation="MMEGRGAFVCRTRVRYGETDKMGIAYYGRYMDWFEMGRTEFCRAQ
FT                   GRSFTGWEAQGILLPVVEAHCRYKASLRYDDEIEIETAVVELSKVSVTFRCRVFRAADG
FT                   KLAAEGYTRHAFTSTDGRLLRHGNALADWLGAMTAGAGACRTPE"
FT   CDS             complement(551343..552605)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04850"
FT                   /product="Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27909"
FT                   /db_xref="GOA:D4M7R4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7R4"
FT                   /protein_id="CBL27909.1"
FT                   /translation="MSENGGKRKVSLLVKISIGFVLGVLFGFGIGPLLGTSPFLSGWVM
FT                   PFLDLVGKIFLTLLKMIIVPLVFASLVTGAASVGDTRKLGRIGVKTLALYLVTTAVAIV
FT                   IGLMLGNVIDPGTGMNIPTGLKAEAREAVPILDVILGIFPSNPLESMVKANMLQIIVFA
FT                   LFFGVSCILAGERGRKIADFFEGVAEVMYAMTHTIMQTAPFGVFALIAVTAAKYGLAIL
FT                   APFAKVIAAVYLGCVLHAVIVYSGMIAALCRRSPLWFFRGIQEAAITAFATRSSSGTLP
FT                   ITYSNVRSNLGVSEGVSSFVLPLGATINMDGTALYQGVCALFVAQAFNVPLTLQMQIGI
FT                   VVTATLGSIGTAGVPGSGLIMLTMVLTSVGLPIEGLALVAGIDAILDAARTCLNVIGDT
FT                   AVCAVVAVSEGEELLGGREQG"
FT   CDS             complement(555714..556073)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27910"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7R5"
FT                   /protein_id="CBL27910.1"
FT                   /translation="MNMKRITGRAILALLLASAIGAALALGADAASSARKRARLKNTPP
FT                   PGWQFEVGYTLWRAQRGLDATPQTWKKYQRERKRLAQRGKLRGLDTRLLNSVDWTIEEL
FT                   AEFLEVQQEQMRADN"
FT   CDS             556965..558245
FT                   /transl_table=11
FT                   /locus_tag="SY1_04910"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27911"
FT                   /db_xref="GOA:D4M7R6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7R6"
FT                   /protein_id="CBL27911.1"
FT                   /translation="MDLKELERRMIETRRDLHRFPEPAWTEFRTSALVAARLEGLGYAL
FT                   KMGSEVIDAGSVMGRPSEEEIDREIARAVEQGGDRERIERMGRYTGVTADLDTGRPGPT
FT                   LAFRFDMDCVDVGEDMSPDHRPAKEGFASVNPCRMHACGHDAHTAIGLGVAELLTEMKG
FT                   RLCGRVRLIFQPGEEGCRGAYAMMKKGVVDDVDFFLAMHIGGGVPTGTFGLNSLGYLAT
FT                   TKLDARFTGVPAHAAGAPHMGRNALLAAAAAALGLHSIAPHRDGAMRLNVGVLQAGTGR
FT                   NVVPAEALMKVETRGETQEVADYVYGRAEEVLKGAAEMYGVRVELSKAGEGTTARGDEE
FT                   LVRRVGAALRASGIFRSVLDTVRAGGSEDATWFMRRVQERGGEAAYMALGADIAAPHHN
FT                   GRFDVDERGMILGARAMAAIAESLLSQ"
FT   CDS             558272..558706
FT                   /transl_table=11
FT                   /locus_tag="SY1_04920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27912"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7R7"
FT                   /protein_id="CBL27912.1"
FT                   /translation="MSGMTRWGLFLAGLFAGATGGLFYLDHVVAGALCLAAASGALWFA
FT                   LRRREAEEPQERGMVSDADLSELALFVAELAVSGLKGVGRTIPPSTKEIEQLEGRLNVL
FT                   LDHMGVSDASRADLRSEFERIKGRTRRNEGGIALIRSRRL"
FT   CDS             558754..560655
FT                   /transl_table=11
FT                   /locus_tag="SY1_04930"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27913"
FT                   /db_xref="GOA:D4M7R8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7R8"
FT                   /protein_id="CBL27913.1"
FT                   /translation="MNKGQKFSAGYFLAALVLAWLFADLVYKPYMESRTEVPYSTFLAD
FT                   LENGAVDEVNLAAERIVYRLKAVSSDLSDRPVVGGIILDRSPAPVVRNVVRVLDPLLVE
FT                   KLASADVTFGGVAQQSAILDTVLGVLLPFLPLLLLWYFIFKRMSGGSGSVLSFGRSKAQ
FT                   ELQGEMTGVHFKDLGGVGEAEVELREIIDFLKEPERYNRFGAKLPKGVLLVGPPGTGKT
FT                   MLAKATAGEAGVPFFFITGSSFVEMFVGVGAARVRDMFEQAKKKAPCIIFIDEIDAIGQ
FT                   SRALSMTGNSEQENTLNQLLAEMDGFTPNTGVVIMAATNRPEILDQALLRPGRFDRQIQ
FT                   VVLPTEEGRRDILQIHTREVPLDDNVDLKALAKVTPGFSGADLANIANEAALMAVRRKA
FT                   EKVSAQDFDLAVERVVAGLQRRTPLTPAVRRRVAYHETGHALAACFLPGTDPVHRVSII
FT                   PTARGALGYTMQMPTEDQYIVGEAELQSRLAVLLGGRAAELLIFQEPSTGASNDLERAT
FT                   ETARRMVTEFGMSSRLGPVRYAGRAMTYLHSEAESRTDLGSSTFEAIDEEIRRLVSKAQ
FT                   ETAVELLKAHEATLHEAARVLQEKEAITGDEIREIIRRVEGSVPAEEKSADASLGGR"
FT   CDS             complement(560764..561759)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27914"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7R9"
FT                   /protein_id="CBL27914.1"
FT                   /translation="MEQSMEGLLLSFDERYPCWTPAMLALAELDRTAADDLTREGLLEF
FT                   GEGAYSLSPTGREAFLKLAGEACLPSRPGEAPDRKRAARWGELMLLLDKRHLQRWGVKE
FT                   YVAPFRFALPNVRGEDLFVMDGAAPGWRYPDAPVFRRMAEDFPETGVAARTRPMPGAEE
FT                   VRAWLAANAPGLRDAEFDLLYKSRYDFQDYAKFPPLPADPCGLFNADHFLFAFMPPPAP
FT                   ESLPEYLEKVGEFQMFLTMLRRLYLPGYVDLDAMDQDGVNWLLFAFTEERDAERCVKLL
FT                   GPIAEALPGPAAPLELWSVSLEGLRDYPGGQAETIWDILPFAAHSIYRLT"
FT   CDS             complement(562218..563165)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04950"
FT                   /product="EamA-like transporter family."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27915"
FT                   /db_xref="GOA:D4M7S0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7S0"
FT                   /protein_id="CBL27915.1"
FT                   /translation="MKEVHIDCGAAPSAEGKMARRDVLLLLAVAVVWGVNFAVVKTGLR
FT                   SVPPLFLVFLRYLFIVLPLIFFVKKPAVSWRTMAAYALLSGVGQFSFMFYSLKIGMPAG
FT                   LASVVMQSQAIFTLILSAQFMGERIGGAQLAGIGLAAVGLGLIGGPFGAAAVPTAAFLM
FT                   NLLAAFCWSSSNLIVKRASEESLRSGRSLDMMEMIVWSSIFVPLPMLGLSLVGDGPSAI
FT                   LQSLAQIDAAAVLSVLYLVVLSTLFAYSAWNQMIAAYSAGRVAPFSLLVPVTGLLSGML
FT                   FHEERVAPLQWAGIAAVVAGLAVFQLGERRPHAR"
FT   CDS             complement(563207..563935)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04960"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27916"
FT                   /db_xref="GOA:D4M7S1"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7S1"
FT                   /protein_id="CBL27916.1"
FT                   /translation="MNAQINGLTASILGGWTAELNVRSVMLRILMSVVLAAIIGCERSS
FT                   KRHSAGLRTFILVSLTSTTAMLTDLYLCQSAPERFPFISAAAVVGAAMISVNAILFSSR
FT                   SQIKGLTTAAALWSCGLVGMALGAGLYTVALISFLALFSSLALFPPIETYMKDKSNHFE
FT                   IHLELKSKGNLQYFVTTVRRLGIRIEDIESNPAYLNSGLSVYTVSLTINSAELKKYKKH
FT                   SEIIEALRSLEYISHIEEIN"
FT   CDS             complement(565644..566666)
FT                   /transl_table=11
FT                   /locus_tag="SY1_04980"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27917"
FT                   /db_xref="GOA:D4M7S2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7S2"
FT                   /protein_id="CBL27917.1"
FT                   /translation="MIERSCSVTFRDHIEFFEAIHETGRPVKAPKADDPEGGLVCLSAP
FT                   FAEILLETHSLFHGVSLNVLNISPRADIVIPYDFGGGVLGMDYLADGSYLLDESSGRMV
FT                   SPGDLFLLPPSGCRGSMTFRGGRPSRTIAFGGPGKILSDLLGEDGGALWAEALRAGSGY
FT                   GSEPRLLRAPQAMAGSFLQMLHYDYPTRVKRLFLEGKLMEILSRIIARGLPSEENEGNG
FT                   GDAFELERIRMIPGILMERIDNPPSISELAHELSVNSTTMKKGFKNIFGEPIYAHHRNL
FT                   CLSQAATLLLETDKSVFEIASDVGYSNSGNFGSAFKRRYGVSPIRYRQNGRSALPLQEP
FT                   "
FT   CDS             566883..568148
FT                   /transl_table=11
FT                   /locus_tag="SY1_04990"
FT                   /product="The GLUG motif."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_04990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27918"
FT                   /db_xref="InterPro:IPR011493"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7S3"
FT                   /protein_id="CBL27918.1"
FT                   /translation="MKSLRTRNLRSRRGALNIVVLFLLGIVLLANGGCGGSGRSENAAS
FT                   PFAGGQGTQEDPYRIATAEQLTKIRDYRDKSFILISDIDLSSYGNWDPIGTFNREIDDP
FT                   EKSEVAKSSLAFVGRFDGNGHTISNLTVNRPETVGVGLFGFVVGNAASQSIRNLTVSNA
FT                   DVKGACMVGGVVGVINGGITGIKLTGGNRVEGYAVGAVGGIAGMGYGAIENCTANASVT
FT                   SNGKGMQGLGLICGGGKWLTVRACTAEGNVTAKGFGAFSVGGLVGCIQESPIMENCAVK
FT                   ATIDASDEKSFMVGGLTGHAGNYDKSNPTLIRNCSADVDITVSASSKRVGGLVGGNLFV
FT                   SAFLEEHPTPSIYRITGCATSGSIKGNASQVGSIAGYGYDCSVTDCTSTLVWSGGAIKP
FT                   VGLMQSAGETPDPIGLDYYAGE"
FT   CDS             complement(568310..570370)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05000"
FT                   /product="Membrane glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27919"
FT                   /db_xref="GOA:D4M7S4"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7S4"
FT                   /protein_id="CBL27919.1"
FT                   /translation="MTPAPNARPAWRRSALWRRCLFLSLIVVPSVLAADYMSALLPHQG
FT                   GAPVELLLCALFGVLFAWISTGFWTALFGFFVLLFRYQGYRIIDPDAPLPDLPQDVRTA
FT                   VLIPIYNEDPKNVGAGVEAMWRSLSATGQEGRFDVFILSDTTDPDVWVREEEAWYGLRE
FT                   RLGMDGHLFYRRRPSNVKRKSGNVANFCRRWGRNYRYMIVLDADSVMAGTTWVRMVDAM
FT                   ERNPRIGILQTPPRGVNRETLIARVQQFANSLYGPVFAAGQNFWQLGDAQYWGHNAVIR
FT                   VEPFMRYCELPKLPGRGPLSGEILSHDFVESALMRRAGYEVWLAYGVDGSYEETPPTLI
FT                   DELKRDRRWCQGNLQHLRLIFTYGFFPTHRALFLNGILSYGSALLWLIFLIASSIQALL
FT                   DVLVEPNYFPQPNMLFPQWHVWYPEWALTLLSCTALLLFLPKLLCLIHALLIARSARRY
FT                   GGALRVLLGVAGETILSMLLAPIRMICHSRFVVVTLLGWGTGWGGQSRDDRGTTWGEAV
FT                   RAHWWAVLIGLTWGWLLHRVTPSFFLWLLPVVLPLALSVPLSVFTSRASLGRAAARLGL
FT                   FAIPEELHAPRELTDKAEALAERRRYSPLGISQEEGFRRAVADPHTNALHLAMNRRLRG
FT                   ALNPALVDRALSGEALSQKEKMALLNSPDSMRELHRKVWTLPERQGAPWGL"
FT   CDS             complement(570367..570756)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27920"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7S5"
FT                   /protein_id="CBL27920.1"
FT                   /translation="MTPTRCDPQAPRPEEVLRDRLLLYVRALRLPPREGLELVLKTMDE
FT                   LCPSGTSETLPAHAEDCDMKTAMEALRALCADRGLLPDADALPVPVPPYNRGSMPPARI
FT                   SMTRGGFSLRGLIRRLRRSEEGRTR"
FT   gap             572665..572882
FT                   /estimated_length=218
FT   CDS             complement(572989..574215)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05030"
FT                   /product="RND family efflux transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27921"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7S6"
FT                   /protein_id="CBL27921.1"
FT                   /translation="MHKKISRKFFTFGAVALIAVALAYAFRPLPLEVEMEEVARRPMTL
FT                   TVDEEGRTRVRDAYTVSTPVNGRLLRVEVRPGDAVAAGKTVVARMVPSVPTPLDARDEN
FT                   RGRADLAAAEAALKLARADRERAVADRDLAQMQLRRMRSLRASGAASQLQLDQAEREAR
FT                   TTAAALHNAEAAIAVREAERKGALSRLRRFGDSETAPQTTAADVIPICAPADGRVLRVM
FT                   RESEGPLSAGTPLMEVGDVEGGLEVVVELLSSEAVRVTSGDRVVLSGWGGDRPLNGIVE
FT                   KVEPFAFTKVSALGVEEQRVNVVVRFTDLTESLGRLGHGFRVEARIVVWEDRDALTVPS
FT                   GALFRNDGKQAVFVVEDGVARLRTVETGRDNGVEAQVLEGLRPGERVILYPASDLTDGA
FT                   RVVEREAES"
FT   gap             575511..575567
FT                   /estimated_length=57
FT   CDS             579055..579468
FT                   /transl_table=11
FT                   /locus_tag="SY1_05080"
FT                   /product="glycine cleavage system H protein"
FT                   /function="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27922"
FT                   /db_xref="GOA:D4M7S7"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7S7"
FT                   /protein_id="CBL27922.1"
FT                   /translation="MKEFNELIFKDDARYTQTHEWAKKEGNTVRVGVDDFSQSALGDIV
FT                   YAELPEVGAEVHAGAAFGSLESTKAVSDLNAPVSGKVVKVNEALADSPDLVNKDPFGEG
FT                   WMIEIEPSNPAEFDKLMAVDAYKEYAKGEHAKH"
FT   CDS             579484..580794
FT                   /transl_table=11
FT                   /locus_tag="SY1_05090"
FT                   /product="glycine dehydrogenase (decarboxylating) alpha
FT                   subunit"
FT                   /function="glycine dehydrogenase (decarboxylating) alpha
FT                   subunit"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27923"
FT                   /db_xref="GOA:D4M7S8"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020580"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7S8"
FT                   /protein_id="CBL27923.1"
FT                   /translation="MRYLSQTPEDTKEMLDAIGVKSVEDLFDSIPANVRRDAPIDIEPK
FT                   SEWALSKEIRALAAQNFSGTAFLGAGCYPHDIPAHIPYLAMRSEFLTSYTPYQPEVSQG
FT                   TLQAIFEFQTMTANLLGTEVANASMYDGANSVAEGALMAIRVKKKHKVAYSRLLHPHYV
FT                   EEMKTYFRPAGFEAVELPVLPDGRTDLSKVPDDVSAVVVQSPNFAGVVEDLEAAAKAAH
FT                   DKGALLMAAFTEAMAWGLLKNPGSCGADIVAGEGSSFGLALNAGGPALGLLACSMKNVR
FT                   TMPGRLVGQTVDRNGNRCFVLTLSAREQHIRREKATSNICTNSGHCALTAAMYMASAGR
FT                   GGLHAIAKLNHDKAAYLKGGLEKAGFKPLFNAPFFNEFAMKAPAGFEKKYGELLKKGFA
FT                   AGLDMGRFFPEYKGVYLFCATEVHTREAIDAFLKEVA"
FT   CDS             580797..582254
FT                   /transl_table=11
FT                   /locus_tag="SY1_05100"
FT                   /product="glycine dehydrogenase (decarboxylating) beta
FT                   subunit"
FT                   /function="glycine dehydrogenase (decarboxylating) beta
FT                   subunit"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27924"
FT                   /db_xref="GOA:D4M7S9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7S9"
FT                   /protein_id="CBL27924.1"
FT                   /translation="MKGYPGMRGIAYKEDLLWEKSRKGRVGISIPEADVPGADLDPSLV
FT                   GAEPNLPELSEVDVVRHYTRLSTWNFGLDTGMYPLGSCTMKYNPKINEAMAALPGFANL
FT                   HPLLPDECMQGALKLMYEFEQDLLKITGMKAATLEPAAGAQGELTGMLMIHAYHAHKGR
FT                   QRSKLIMPSTAHGTNPASGALCGYTPVPVELSADGVVTPDAIRAIMDEDTAGIMLTNPN
FT                   TLGIFENHVAEVAEIIHEKGGLVYGDGANMNALMGYVDVKKMGVDVLHMNVHKTLSTPH
FT                   GGGGPGAGPVVVGEALEPFLPVPRVRKDGDRYYLDFNIPLTIGRLQSFLGNFAVLVRGF
FT                   TYTRTMGRDLKAATEAAVLNANYVKAKLRGDYHLPFPQPSLHEVIFNDEEQKKNGVTTM
FT                   DIAKRLLDCGFHAPTVYFPLVVDSALMIEPTDTEPKEELDAFIAAMKDIAADARTNPER
FT                   VTNTPQNTIVSRPDETLAARQLILKGE"
FT   gap             582857..583351
FT                   /estimated_length=495
FT   CDS             complement(583418..584371)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27925"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7T0"
FT                   /protein_id="CBL27925.1"
FT                   /translation="MTELLNTFCRGRNIQLLWQPELETIPDRIAEGFVPIEMAEGTKSF
FT                   VDFRCLDHHNDYSHLPSACVTALKFYGTLGSDSPVRLMVNHTDADCVLTGVTLLGLLPR
FT                   KLLERLNPEVGVLDTDPLSVDFGDLLYGNAIRLWKVGMMSTKKSGWSWLYGMQLFLDIF
FT                   NHFTYYEGKTGELEERERARREKAFQDYDKAVTGPSGKVLLVAPSTVKGYDVQFFRQRA
FT                   FPATSLEGWRHWCVVSHVRKVGNVMLSCPNKEVAERAFGSGGLKNVFPRLPEIEGKEWG
FT                   GREAVGGSPRGIVVPAELLGSILTILEDSLLTKEGV"
FT   CDS             complement(584558..584635)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27926"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7T1"
FT                   /protein_id="CBL27926.1"
FT                   /translation="MGKKAGDEVELKTSRLTRYAVESVS"
FT   CDS             complement(584674..584850)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27927"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7T2"
FT                   /protein_id="CBL27927.1"
FT                   /translation="MRRRGICVKINAVYLEDNEETLSEVLVFSSAQDITTKIMNDMFGS
FT                   REYYEKLLAYAER"
FT   CDS             585260..586966
FT                   /transl_table=11
FT                   /locus_tag="SY1_05150"
FT                   /product="gamma-glutamyltransferase 1 . Threonine
FT                   peptidase. MEROPS family T03"
FT                   /function="gamma-glutamyltransferase 1 . Threonine
FT                   peptidase. MEROPS family T03"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27928"
FT                   /db_xref="GOA:D4M7T3"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7T3"
FT                   /protein_id="CBL27928.1"
FT                   /translation="MKVLRSRKLAIAAAALFLVSGASGALAAPRNELLIGNGNGMAVST
FT                   QPLADKAGQDVLDRGGNAIDAAVAVGYALAVVHPQAGNVGGGGFAVIHTADGGDYALDF
FT                   REMAPGAATRDMYLDKDGNVIPQESTRTYKAVGIPGTVAGMSAMLERFGTMKLDQLIAP
FT                   AIEMAEKGYELSERQAKSMADFADKFRKFPHSQGYFLHGDGTPYRAGELFQQADLAATL
FT                   KRIAAEGPKGFYEGKTADLIEADMKANDGLITKEDLKRYEVKWREPSTADYRGYKIVSM
FT                   CPPSSGGAIVAEILNVVENADMRALGCHTPAALHVMAEAMRQAYADRSEYMGDPDFMKV
FT                   PVEELTSKAYAKKIYDRIDPKGATPSSEVRPGLEPLKEGTNTTHYSVVDKMGNAVAVTY
FT                   TINESWGTGAAVKGAGFLLNNEMDDFSAKPGVPNVYGLVGGDANAIEPYKRPLSSMSPS
FT                   IVSRDGKTVLVVGSPGGSRIITTTLQVIQNVIDYDMPLNEAVSAPRFHMQWLPDELRIE
FT                   HDNGLSASDVEALTEMGYKLSLKPYMGDVNAIHIDLRTGKITGSHDSRMEF"
FT   CDS             complement(587074..587985)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05160"
FT                   /product="Parvulin-like peptidyl-prolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27929"
FT                   /db_xref="GOA:D4M7T4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7T4"
FT                   /protein_id="CBL27929.1"
FT                   /translation="MSKQFKLKFAAVFGVAVLAAACAAWAATEAPKPTEENQVLARVEG
FT                   REITEADVNAVLQSMGPQGMMMYGNPQGRQLILDEIVSMYLFSLEAEKEKLDGEQDFID
FT                   FMARVRTQSLAQRAMRNAVKDVKATEEEAQKFYDEHKDQFTQPERIHARHILISDDATS
FT                   ADTIARVQADLKAGASFDEEAKKLSLCPSAPQGGDLGEFTKEQMVPEFSDAAFALKEPG
FT                   DVSEPVKSPFGWHIIRLEGRTPAQLIPFDDVKDQILQDLTGQQQQERIKAKVEELKKAY
FT                   KVEMLAPVSDDAAAEAASDDAK"
FT   CDS             588192..588467
FT                   /transl_table=11
FT                   /locus_tag="SY1_05170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27930"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7T5"
FT                   /protein_id="CBL27930.1"
FT                   /translation="MRLIDTRVILGLSLWILGFALMTAGWLVDALFEGWGRIPSKVLYK
FT                   LGALIVAVPVIVLLWRASRLLYVHRIDIVLGINNAASFLTEAMKSL"
FT   CDS             588475..589020
FT                   /transl_table=11
FT                   /locus_tag="SY1_05180"
FT                   /product="CAAX amino terminal protease family."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27931"
FT                   /db_xref="GOA:D4M7T6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7T6"
FT                   /protein_id="CBL27931.1"
FT                   /translation="MHGILTAAAGLAAAAFMLYFPYTWCRLRGEDERDFGLKWFMGRGA
FT                   WRDVALALVLTLVPLTVVSMHWPVEWGGPGPRSLTPWQALDSLGGGVAAAFIEETFFRG
FT                   WLQTLTVRRWGPWAGIPLATLAFALIHLVTLVGWLRVATFFPGLVMGWLRWRHGSVLPS
FT                   ILYHALCNVWAVWWAPIP"
FT   CDS             complement(589246..589305)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27932"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7T7"
FT                   /protein_id="CBL27932.1"
FT                   /translation="MAFTAVAQTVAGAHHLLAV"
FT   CDS             complement(589306..589581)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27933"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7T8"
FT                   /protein_id="CBL27933.1"
FT                   /translation="MSTIQSRGRRGRGDRITSVSPSCGVPSRGLSPSFPKIVTGEPTRG
FT                   AKPPKGPVPAAASREKKAPAAAAGATVTAGTRLRMRPRPSSTSTSR"
FT   gap             590533..590766
FT                   /estimated_length=234
FT   CDS             593843..595612
FT                   /transl_table=11
FT                   /locus_tag="SY1_05240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27934"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7T9"
FT                   /protein_id="CBL27934.1"
FT                   /translation="MICKNLAYWVFTSGEEGVHGLDWGIKHASKSFADQRKLDSRYRLL
FT                   LKDFSLSPSLEREQEREQEREQERPKKAGLILLPWQGGGKDQDEGTLMGFIFPGSDHKG
FT                   RPNISTVACVVPADVVHALSLSEVTRALWSSNDLERIARKNSEKPGVSPEGKEGSDEGI
FT                   AKDDSVRPDTLYLDGEKASSATEVPFPLSSSLKWPKKDVGYLMVDGHVWDLRSLSSPLC
FT                   PPAEEAAKKRKLRMPQLAALLMALALTFGVACCWGSIRDFSQKYLIQPVYSWWGGGDPS
FT                   PSTNSPEDPEITERREKRREKREAIIDILSKNKGEDYLKGLAGLMWVPEPWKEKASLVD
FT                   FLIVEAISENFTVKLKNEKWLVEKGDQGGRGGQEKKLINVSVFKENFKITVLSPLGKDF
FT                   SSVVDETDRGEFFSISPKKAGIEAWGSLKNDLNDQLSQFIDTTKNPGVSLESATQPIAE
FT                   DRQALEERLDELLEKSDTQKDKGFGYLSFFYGDGKEGYQVLLLNMEDLSEGKKLDKYIF
FT                   VKKDNWRRIDVSDLGKRLDGTLQKKPYIKFDDERRDITFFLAPKSKRKKGGDFKEFLDV
FT                   FFDDLLKSVLVEE"
FT   CDS             596047..597747
FT                   /transl_table=11
FT                   /locus_tag="SY1_05260"
FT                   /product="Sel1 repeat."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27935"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7U0"
FT                   /protein_id="CBL27935.1"
FT                   /translation="MWKTMERVWKRSVAALLLAALLCEAMPVGPARAQEDYDRLNTMLT
FT                   LNMAIVSVHRILKTKDRIVLEQEYQNIINNLSLGEIAPDSNLIDLYEELMDFMTRKLLN
FT                   GKQMERFRKRYVRREKQQFVRSLSSVSAQGESLRSFLDSLAVSCVSAYFGYQAAINEIR
FT                   EELEDKLWEISDKEMEDCNELQKRLLKSSWTLLHLYGLPDEYRLTQDSLNDFYEAVRQS
FT                   DASQRLRMLRSLEREFGVYPPYWFYRGRAARDAMNTEEECRCFDQFDEVWRPVLKSDPY
FT                   KLEVAKYRIEKLMAPDRKGRWDTDAITKQLETLRKHAPRNDWGSRLFAGIAYFQLGRKT
FT                   EGENCIRDNIDYGCEKNVSGHILDLMKQGTLNPDEWKTILVEKIDLDGDGAEDRECPRK
FT                   ALSRFVELANDGNLSAQCLMGDNHCLLGEYGEAAEWYRKAADQGLAKAQKALGDLYARG
FT                   DGVGRNVPKALELYQEAAKQGMAEAKKAMGDLYARGDGIGKNVPKALELYQEAAKQGMA
FT                   EAQKALGDLYANGADGVGKNVPKAREWYQKAADQGNQEARDRLAELDKK"
FT   tRNA            597932..598018
FT                   /locus_tag="SY1_T_24550"
FT   CDS             598321..598620
FT                   /transl_table=11
FT                   /locus_tag="SY1_05270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27936"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7U1"
FT                   /protein_id="CBL27936.1"
FT                   /translation="MATKRFSRAQLEFLSRMSSYIWWKTRDEAMEYPERILAQMMNIGT
FT                   LEDTRELEKLFSQDELMEVLEKAEAGQFRPKSWSFWHCRITGKEAPAMPVRELP"
FT   CDS             598617..599309
FT                   /transl_table=11
FT                   /locus_tag="SY1_05280"
FT                   /product="Domain of unknown function (DUF1814)."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27937"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7U2"
FT                   /protein_id="CBL27937.1"
FT                   /translation="MKTFQAHLDILPEAQRELWNKLSPCGALGFVLYGGTAIALHLGHR
FT                   VSNDFDFFSRLPLSEAMEKKMLESMPFLKMAELLQNELDTRTYRTTEGVKLSFFGGIAF
FT                   GRIGEPLLTHDGILQVASLKDLLAMKAAVIMKRVEAKDYRDIAAILRSGTSLSEGLSGA
FT                   CAIYGDRFPVIESLRTMTYFQGGDLDQLSENDKKTLIEHTKSFKLDDVKQVKILSHDLS
FT                   EPGSATAC"
FT   CDS             599453..600469
FT                   /transl_table=11
FT                   /locus_tag="SY1_05290"
FT                   /product="conserved hypothetical protein (putative
FT                   transposase or invertase)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27938"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7U3"
FT                   /protein_id="CBL27938.1"
FT                   /translation="MDERTMQEKPERFDYDGFWKALIRRFWRELLRSAIPDLYRDADLE
FT                   QEATPLDKELQDTLPKPGDEEQVSAKFVDTLLKIPLKDGGEQWVLLHIEVQGRGGEDLS
FT                   RRMMRYYCLLFAHYDKNPIALAILTASRPKSETPGVYDFLQYGTRLHYSYNCVKLWNLD
FT                   DEGLLASDNPFDLALYAAKKALAYDNEEQQKLIYLLKLTRILVSKGWSREDRSDLLAFI
FT                   ARVINLKDRALWEQYRKGAREIKGESEMMSFWDEELEQTRAQGRAQGRAEGRVMGHEEG
FT                   REEGRQEGRQEGRLKGLMEVARRMLAVPLPVAQISELTGLTSHEIDALKKDAHAGLS"
FT   CDS             complement(600575..601087)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05300"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27939"
FT                   /db_xref="GOA:D4M7U4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7U4"
FT                   /protein_id="CBL27939.1"
FT                   /translation="MLEAMRRRRSIRKFEGRKVEDGDVTRLMDAGLVAPTGKNTLCTEF
FT                   FAVTDKAKIERLAQCRDGMAASSLRTAPLAILVAGRHKDSDVWREDASAAAAFVLLEAT
FT                   EMGLGACWVQVFQRPCGSGTSEEAVRRILGIDPEFSILCAIAVGYPAEEKEPRNLETLD
FT                   RSRAHRL"
FT   CDS             601198..601458
FT                   /transl_table=11
FT                   /locus_tag="SY1_05310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27940"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7U5"
FT                   /protein_id="CBL27940.1"
FT                   /translation="MNVNGYDRLGQAGLELMQKSMSAAAAAAEDIASGSLNPMDVAKSA
FT                   MDLGRAKVQMKLGAYLIRTQQELMESTLEVFGVGTKLDRRY"
FT   CDS             601732..603120
FT                   /transl_table=11
FT                   /locus_tag="SY1_05320"
FT                   /product="L-serine ammonia-lyase"
FT                   /function="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27941"
FT                   /db_xref="GOA:D4M7U6"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7U6"
FT                   /protein_id="CBL27941.1"
FT                   /translation="MQSVFDIFRVGIGPSSSHTMGPMRAALRFLEELRAMGLLERVGSV
FT                   RCDLHGSLALTGKGHMTDRAVLLGLWGVKPEEADPDVIQEFVDLVDRTRRLPLGAFPRL
FT                   EDGRSIPFDPERDIAFLPKQLPLHENSLVLHALGPDGTELHSNAYYSIGGGFVVEAARF
FT                   DAPDGVSGDVPYPYASADELIAVCAEHGLSVSTLVMKNERALHPGVDVQAHFERIWALM
FT                   SACMERGMRTEGILPGGLHVARRAAPLLRMLSSDRPLSSDPMQILDWVNVFALAVSEEN
FT                   AAGGRMVTAPTSGACGVVPAVLEYYNRYVRSTTPEDRTRYFLTCGAIGLLFKANASISG
FT                   AEVGCQGEVGVACSMAAAGLTELSGRSPRQVTTAAEIAMEHCLGMTCDPIAGLVQVPCI
FT                   ERNAVAAVKAINAAHMAMHRSTPPLISLDEVISTMYQTGKDLSAKYRETSQGGLAAQPR
FT                   RAVG"
FT   CDS             complement(603187..604758)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05330"
FT                   /product="Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27942"
FT                   /db_xref="GOA:D4M7U7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7U7"
FT                   /protein_id="CBL27942.1"
FT                   /translation="MRKVFLRLAALAAACAFAGPAAAARHVPGEVLAVFKGEEGTKVVA
FT                   SSLHLGREAFRAASLAAAVGARVEETYAELSEAGNGVFVLLKSDILSPEALTARLLKRE
FT                   DVLAASPNFIVRASVTEPNDPFYASGALWNLKAIRAPEAWDTTTGRGDVCVAVLDTGVD
FT                   YTALELAPNFRRDLSRNFYKDGGTSRADPEAYADRNGHGTHVAGTIGAAGNNGRGVTGV
FT                   NWSVGLISLRTLGPDGSGPVSGIVDALNFLTKRLEEDASLKVAAVNLSFNWFSSMPPTL
FT                   ANQRKDPVWRAFKALDSLNRTVIVTSAGNDGLEVGVLAPADGPKGADGTPTYERGDYVY
FT                   SSSYRGIHNLIVVGASSQNGSLANFSNWSRNFVDVAAPGVSILSTTIAAYEHSTRVGDG
FT                   TVMATMNGTSMAAPHVAGAVALLKAADPARTAYQVRTALLHGAAVKSVLVGKVAGGRFL
FT                   DLKGALDYQAAHPELASEAPRTEYDERIKDADGTSSSGGAGCDAAGLGALGWGLVALLA
FT                   VVGRRR"
FT   CDS             complement(604815..605009)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27943"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7U8"
FT                   /protein_id="CBL27943.1"
FT                   /translation="MQVIQQTRTSVNVSGYVDRLEHGIVRKHLEVQLEHVKEPVYVQRP
FT                   IIDDLNSQVIVHDQVEQYV"
FT   CDS             complement(605123..605827)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05350"
FT                   /product="aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27944"
FT                   /db_xref="GOA:D4M7U9"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7U9"
FT                   /protein_id="CBL27944.1"
FT                   /translation="MGPAAAAEFLRLLAEGAPAASDAEHPRTILLSDPDVPDRSDGIMG
FT                   LGPDPLPAIKKDLLQLVEWGAEVLAVPCNTAHFFIDRFREELSVPLVHIVEATVNAARR
FT                   ASPEGAWLVATSGTQKSLIYPACAEKAGYLFLRPSREQQECVQQSLRAVKAGDMGRAAE
FT                   LLKEVVEALWREKDLPITTACTELPLAYAAAGLPPDRQISSLQALADACLDLLYERGDG
FT                   AAGWGVGAFMPR"
FT   gap             606091..606518
FT                   /estimated_length=428
FT   CDS             609849..612878
FT                   /transl_table=11
FT                   /locus_tag="SY1_05370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27945"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7V0"
FT                   /protein_id="CBL27945.1"
FT                   /translation="MNAPSLKIRITGLPNFVQNCFGNNSDLANCMGIIAQNKVEDKELV
FT                   QAVLSEYCDSSETVISEDLINMKLDREWDIARSRKNKPKMKLAFDARRKVFDAFLERLT
FT                   LMMEWGNIEEVDDNRCNHLRSLRAKTLNDVNAIFMKSEELKAAPGNVFVLKMLKVIHDR
FT                   LSGHHVKPLFMDLLTTRFIPLDNEGNPILTTEQCAIPYYEPWRNVLRHIASPARSLNEA
FT                   RQGIFDNSAPDETTTFDNLNQLELIDRAEGKEIQVHDDITAVQNSAEKRLDSFKGQLEL
FT                   AYTYGRIREDDKENLTNIQMRYKPDFFDGRNFGCWRQFLNALEQKVTDLTAERKKQLKN
FT                   DIKIRRANLDEKQKTFSTLDKAEKLLDEDNFAVAEEYINRFDYGEYELTKELQTVMTSG
FT                   DSFRDFLSDESFDPLYDLCSRNSSRKLGDFSKDLDKARPKDWSSRLKTSSEKLVEAWPS
FT                   RRGKTTTDQIKTLFFCLGFNVIKAEKIDCDQKAPDQFKVFVQKSPRNASDYDHPIAAFG
FT                   TKMASPLSVVILYGNHMADGIVKTVTALNLNPNGIAVVLVDYYLDRGTRRQVAEIFHTQ
FT                   TSGQKPFLLIDRVLALHLALHLPTERLSILLKCTLPYTIYQPFVSGVGAVSDEMFFGRR
FT                   KEIHDITDPNGASIVYGGRQLGKTALLQRAENLRFAPENGAFAVLSTIKEFHKEEQVVE
FT                   HVIKDIVEKTNLPITPCASLEDMCRQISSLFRQEKIASFLLLLDETDNFLESIGSVDYN
FT                   PLLPLVNLKRETQNNFKFVLAGLHNVCRAKNTLSSNNVFGQLGTPLCIQPLSPVDAMDL
FT                   ISRPLHYLGFQVGDAHLQTILINTNYYPGILQFFGYTLVQTLTSKYAQYYHATNNPPFV
FT                   LNDMQLGNVMADESLNDSIRSRFHLSLNLDQRYFMLARCIALLYYTQEEYLVGDQHGFT
FT                   QKQISDCAKEYQIYCLEQLSSETTINLLDEMVEMGILGRPESGIYRLRRRSFLNIISHD
FT                   DSSLLDDIDKANNPEEAVQS"
FT   CDS             612875..614011
FT                   /transl_table=11
FT                   /locus_tag="SY1_05380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27946"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7V1"
FT                   /protein_id="CBL27946.1"
FT                   /translation="MTDFEEFWWNNITGPHSVVTKTSELLSTKFAVLLLVPGDLPWRHT
FT                   MRSAIDAEFKRRSSMMDILIRPIDVKDEYLQDIAPGQFILRNYASESVKNEYRVGSGMS
FT                   MQEYIKRNSVLKNTILWLKGFNNAEQVKDWVNFCSDYATGAVVDGLFILEVQDNMRLPA
FT                   HSSIPKINFSEYVDSYNLLLFCSFLLDEQKELTAQWKSYIAAMVSNLCETDAEVAERMI
FT                   LETNFMNEEPLDVLSRIAKEPDFVRRGEGAQHAFALLRNRNNLTLKKRLWSAQVQVLFP
FT                   VIELERVEIVRQWHAEIAAALAKHPEQRGYGNGSNEAIDDLCDIELGQLNHMIINHMLE
FT                   IPAPEIRSRIALLRTCRNLLAHGECCSAAQTGKLLNAS"
FT   CDS             614093..614170
FT                   /transl_table=11
FT                   /locus_tag="SY1_05390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27947"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7V2"
FT                   /protein_id="CBL27947.1"
FT                   /translation="MMTFRVEDATAVDITIIDEVENLLY"
FT   CDS             614188..614916
FT                   /transl_table=11
FT                   /locus_tag="SY1_05400"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27948"
FT                   /db_xref="GOA:D4M7V3"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7V3"
FT                   /protein_id="CBL27948.1"
FT                   /translation="MAKVPRVHCDSCGVCLVPVPWAREGSGFTLLFEALVLSLAPAMPI
FT                   KTLAKELNMHDTRLWRVIRHYTEQALERRDLSGVRNVGFDETASKRGHDYVSVFVDLDT
FT                   SKVIFATEGKDSSTLGRFKTFLEKHGGRGENIERMCCDMSQAFIKGAREHFPGAKLTFD
FT                   KFHVVKVVNDAVDSVRREERKEDPSLAHTRYLWLKNPQTLTEKQKAWLGELSLRKHNRK
FT                   TARACQMKLGFQDIFRRFRL"
FT   CDS             complement(615027..615134)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27949"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7V4"
FT                   /protein_id="CBL27949.1"
FT                   /translation="MRFSLLLQPLALALQAWIKLLIPSRMPLLIRDSNH"
FT   CDS             615139..615234
FT                   /transl_table=11
FT                   /locus_tag="SY1_05420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27950"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7V5"
FT                   /protein_id="CBL27950.1"
FT                   /translation="MIYLIAGKLQIGLSLKIARSYKMKEAPWGAS"
FT   CDS             complement(615265..615717)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05430"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27951"
FT                   /db_xref="GOA:D4M7V6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7V6"
FT                   /protein_id="CBL27951.1"
FT                   /translation="MKLTDRIAADLMAAMKAREERRLSSLRMLKTELQKLAADKGRGAE
FT                   IADEDVHTVIRRLIKQRKEAAEQYAAGGARDRAEAELAEAAVLEPYLPAQLEDAALDEM
FT                   VRQAAQDTGASGPRDMGRLMKAVLALAAGRADGARVKDRVTAYLNR"
FT   CDS             complement(615779..615976)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05440"
FT                   /product="SSU ribosomal protein S21P"
FT                   /function="SSU ribosomal protein S21P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27952"
FT                   /db_xref="GOA:D4M7V7"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7V7"
FT                   /protein_id="CBL27952.1"
FT                   /translation="MTTVTRKEGENIEDTLRRFKKEVAKVGTLREARKREHYEKPSDAK
FT                   KLKRAEAARKRKSMRRRNAG"
FT   CDS             complement(616005..616343)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05450"
FT                   /product="Diadenosine tetraphosphate (Ap4A) hydrolase and
FT                   other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27953"
FT                   /db_xref="GOA:D4M7V8"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7V8"
FT                   /protein_id="CBL27953.1"
FT                   /translation="MSDCIFCKIAGGEIPTDFVYRDEDVVVFRDVAPQAPTHLLVIPRC
FT                   HVASSAEVKDSAVWGALMGAAVKVALSLGLEKDGYRMVINTGEGSGQTVPHLHIHLLSG
FT                   RNFGWPPG"
FT   CDS             616548..617735
FT                   /transl_table=11
FT                   /locus_tag="SY1_05460"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /EC_number="3.5.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27954"
FT                   /db_xref="GOA:D4M7V9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7V9"
FT                   /protein_id="CBL27954.1"
FT                   /translation="MKGVSVRDEARELNGEMVGWRRHIHLHPEVGFDTGGTAAFVAERL
FT                   NEAGAVEVRTGVGRSGVTAVIRGARPGRTLALRADMDALPVSEETGLPFASAHPGRMHA
FT                   CGHDAHTAMLLGAAVLLGRHREDLQGAVKLIFQPAEEIGMGAMAMIQDGVLEGVDAIAG
FT                   LHTGSLWNGADAGEIGFRPGAVMAAADTFTIDVSGKGGHGAQPDRSVDPISIACQVYAT
FT                   LQTVISRETPPLAPAVLTVGSFQAGSAPNVIPDSCTMKGTIRSLSKETRSSLQDRIRTI
FT                   AEGVAAAMRGSARVAFTYGPPPVVCDPDMTEKLVRAAGAVVGPEHVRPIDEPAMVSEDM
FT                   AFYMERVPGVFFSHPSTLGGGLDFPHHHPKFTVNEDVLWTGAGTFAELALTWQEA"
FT   CDS             complement(621540..622811)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05510"
FT                   /product="glycerate 2-kinase"
FT                   /function="glycerate 2-kinase"
FT                   /EC_number="1.1.1.81"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27955"
FT                   /db_xref="GOA:D4M7W0"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7W0"
FT                   /protein_id="CBL27955.1"
FT                   /translation="MDKLREDALEIVRRAIDAVLPEAAVREALGRGELAARLRETGRGR
FT                   VILAAIGKAAWRMAQAASEALGDRLAGGVLITKYGHSLGEMRGIKAFEAGHPVPDENAV
FT                   RGTEALLRRVRGLSPEDTVLFLVSGGGSALFELPAEGVTLKDLADVTGQLLACGADIVE
FT                   VNAVRKHLSAVKGGRFAKLCAPARVLTVALSDVLGDRLDSIASGPACPDASTSEDALRV
FT                   VEKYGLALHPRLTEALKRETPKKLDNATAVAAGSVASLCAAAGRAAAALGYTPLLLTST
FT                   LSCTAREAGAFLAAIAREVRASGRPIASPCVVIAGGETVVHVTGKGRGGRNQELALSAC
FT                   RGIRGLRDVVVVSVGSDGTDGPTDAAGGIVDGTTAEALGARGMDVEAVLRDNDAWTALK
FT                   AVDSLVITGPTGTNVNDVSFALMG"
FT   CDS             complement(624171..625508)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05530"
FT                   /product="Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27956"
FT                   /db_xref="GOA:D4M7W1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7W1"
FT                   /protein_id="CBL27956.1"
FT                   /translation="MKGKTTIVHKMLIALVCGLAVGIGCLFLREYLLSNGGEGTWKLIN
FT                   GLLFQDITRPEGVRSLGLFYIIGQVFMNGLQLAIVPLVLVSISLAMCSISEAAKLGRIA
FT                   IRSLIGFLGFYAVGCLIAGAIAYGARGMGWFTVVLPGGEVTKTAQIAPYNPLGVIVDAI
FT                   PNNIINVMGVNTRILAVVVVAVILGICMNKLGEKAHVLKSVLEGLSDVINMWLTFLLNR
FT                   VGPFAIFCMISRTFAVYGVEYLKPAAAYMGTAIFTLFLVLLTVYPIGILLLTGLNPFKF
FT                   IKKMAKVGVFGFAMNSSAATLPINMRTNLDELGCSEEITSFVLPLGMTINMNGTSIMHM
FT                   VAVTFIATSAGIPITPATLVIMAVLTICAAAGTPAIPVAGTTMIFTVMAGLGFTTEACL
FT                   VGYALVVAINRPVEMSLLTLNVIGDAAVNVIVNAKEGELNRDVYNS"
FT   CDS             complement(626224..627624)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05540"
FT                   /product="Predicted transcriptional regulator containing an
FT                   HTH domain and an uncharacterized domain shared with the
FT                   mammalian protein Schlafen"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27957"
FT                   /db_xref="GOA:D4M7W2"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7W2"
FT                   /protein_id="CBL27957.1"
FT                   /translation="MKDYREIVRELTAHPSEEEWFEFKENWYDAHGIGEYISSLSNSAA
FT                   MNGKGNAYLIWGIDNVTHDVVGTRFAHRQDVKNEPLEHYLARQLTPDLNFSFHDVTLNR
FT                   RRVVVLEIPAAKQSPVAFDNVRYIRIGSSKVNLSKHPEREAALFSVLKNGLPTTENTEA
FT                   DIQELSFRKLFFYYEDRGIVLNRRNFKKNLGLLTKDGTYNLLAQLLSDDSKIPIRVSIF
FT                   MGRTKADPLYSVREFGNTCLLISLEKILEYGDVLNIMQADEKDRIVERREVPLFDQDAF
FT                   REAVINAFVHNLWVTGNAPMFTVFNDRIEILSRGTLAPAQTLEGFYTGDSVPVNKRLSD
FT                   IFLQLHISERSGRGVPKITQVYGREAFEFRENSIIVTIPLNRMLPAAGDRSGGKMGDNV
FT                   GDNTLNPTRQRILAEMRNNPNITHPQLMRITGLGKTAIQNNVSYLRKNGYVERVGSNRN
FT                   GYWKVCER"
FT   CDS             complement(627868..628791)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05550"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27958"
FT                   /db_xref="GOA:D4M7W3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7W3"
FT                   /protein_id="CBL27958.1"
FT                   /translation="MNLADIETFLTVVNTKSVTQTAKMLFLTQPTVTHRLNSLEAELGF
FT                   PLMIRKKGCKQVELTERGLDFIPVAERWVSLWKETQNLSGAEDRVPLSIGCTDSMNVVL
FT                   LAPLYEGFLKTKPQVNLTVHTHQSRELYGLLANHDIDLAFVYHNLPYKNIRSDKIFEER
FT                   LYLAQTDEPAVSKPVVRMNELDTSKEIFMSWDDNYQIWRGICAGGVYRPRVSVDTVAML
FT                   DRLWSQPDHWVIAPESVIAELSRRRRLYVSEIESAPPNRSVYKIKRQAPKLASHRVVAL
FT                   FESAVEEYLGDLKFPIKIGEVFGGRD"
FT   CDS             629634..630368
FT                   /transl_table=11
FT                   /locus_tag="SY1_05570"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27959"
FT                   /db_xref="GOA:D4M7W4"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7W4"
FT                   /protein_id="CBL27959.1"
FT                   /translation="MQDVAIKQAGDSAVLVEFENEIGIETNAKVRSLMFSLERRPFAGM
FT                   RELTPAYRSLLIQYDPCAVKSGAVREFVGQSLANLRSVTLPKPVITEIPVIYDPEFAPD
FT                   IEEIARIEDKTVEEVIRIHSGSDYFVYMLGFAPGHPYTARFENPFSFKRRESPRVRIDG
FT                   GSVVVQLALSNIIPFDQPCGWNIIGTTPVLVCDYRRENPFLLKAGQWIRHIPIDRDEYF
FT                   DIKRRVELSEYVCRTYEKEGTP"
FT   CDS             630365..631387
FT                   /transl_table=11
FT                   /locus_tag="SY1_05580"
FT                   /product="biotin-dependent carboxylase uncharacterized
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27960"
FT                   /db_xref="GOA:D4M7W5"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7W5"
FT                   /protein_id="CBL27960.1"
FT                   /translation="MIIENGGILTTVQDGGRFGYESFGVSSSGPMDRRSFEIANLLVGN
FT                   DRSEACLEATVIGPSISFAENAVMVIVGADMSPVLNGAPVPNCRAFAVRPGDRLRLGAA
FT                   RIGCRAYLAFAGGVDVPLLMNSRSTMVGKGFGGYRGRRLRQGDEVRLLKDVSGLPNLAG
FT                   RVAEPEPIPSGERALRVILGPQDDRFTEEGIATFLNSRYTIGADFDRQGYRLEGPKIRH
FT                   VTDGNIISDGIVFGSVQVPTSGDPIVMMAEHQTVGGYAKIATVITVDLPVLGQCKAGDA
FT                   VRFVRTSVEEAERLAEASRRELDALAARIGRGFERPARRSFKVTVDGRAYSVSIEREED
FT                   "
FT   CDS             631392..632153
FT                   /transl_table=11
FT                   /locus_tag="SY1_05590"
FT                   /product="Uncharacterized proteins, homologs of lactam
FT                   utilization protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27961"
FT                   /db_xref="GOA:D4M7W6"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7W6"
FT                   /protein_id="CBL27961.1"
FT                   /translation="MFRIDLNSDMGESFGAYTIGGDEEVIKFVTSANVACGFHAGDPMV
FT                   MDRTVKMARERGVAVGAHPGYPDLQGFGRRKMALTPLEIKNDVKYQIGALKAFVEAEGM
FT                   RLQHVAPHGALGNLCQYDRDASRAICEAVREVDDSLIVYYCAGAVLGEEAASAGLDAKA
FT                   EIFVDRAYQDDLSLVPRKTPGAMITDEDVAIARCVRMVKEGRVTALSGRELEIKGDTLC
FT                   VHGDGPKALDFVRKIRKAFEREGIAVCNFQC"
FT   CDS             632192..633166
FT                   /transl_table=11
FT                   /locus_tag="SY1_05600"
FT                   /product="Lactate dehydrogenase and related dehydrogenases"
FT                   /EC_number="1.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27962"
FT                   /db_xref="GOA:D4M7W7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7W7"
FT                   /protein_id="CBL27962.1"
FT                   /translation="MSPEIVVLDGYTENPGDLSWGELEKLGALKVYDRTSLTDEDEAIA
FT                   RIGGAEIVLTNKTPITKRVIDACPNVKFIAMLATGYNVVDAAYAKERGIPLSNVPAYGT
FT                   ASVSQFSIALLLELCHRIGLHDQTVHEGRWERCADFCYWETPQIELDGKTIGIIGFGRI
FT                   GQREGAIARAMGMNVLAYDLYPNDSGRQIAEYVDLDALLARSDAITLHCNLTSENAGLI
FT                   CKNTIAKMKDGVLIVNNARGQLVNERDLADALNSGKVGGAALDVVSSEPIRGDNPLLSA
FT                   KNCVITPHISWASLESRRRIMECTLSNVKAYLEGRPVNVVNGL"
FT   CDS             633464..634477
FT                   /transl_table=11
FT                   /locus_tag="SY1_05610"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27963"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7W8"
FT                   /protein_id="CBL27963.1"
FT                   /translation="MKRSFRFAFLILATLALAAGPAAGVDKAGWPDQLRFMAGPPGGNW
FT                   FALGTALADMWTGAGLPQTTSSSGGGVANIVNANNAKGDLGFSVTSMVGAATQEGGVDF
FT                   TKGQKMENAVIMANLYTQYTYFIMRRDFAEKNGVKSLGDVIDKKLKMRFATLKPGTSSE
FT                   FVVKALFDKGYGFDYKKTFEEWGGTVEYASYEGGADLLADNHLDCFAFSVGKVASIVMN
FT                   IESKLDVVLLPVGQEALDRLSAAYGTETFTIDPGIYKAVPEGAEPVKTVGDYTCIVIRR
FT                   DLPESLVFELNRALWEHRDSLVAAVKDMEELDPAATVPARVPSHAGSEAFWKTVAK"
FT   CDS             complement(636978..637961)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05630"
FT                   /product="Mg2+ and Co2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27964"
FT                   /db_xref="GOA:D4M7W9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7W9"
FT                   /protein_id="CBL27964.1"
FT                   /translation="MISVLRTNTNQKNPGHEDLSLDTLRHGSWINLVAPTRQELEDVAR
FT                   IAAVPLDFLTAAMDVEESSRIDVEEADEDSGCDTSLLMVLNIPKHPESFSFDTLPLGIV
FT                   ITESAFITVCLEENVILPGAAGGVRGFCTWKHTRFLLQILYRTAGAYLQYLSEINRMSN
FT                   SIEHTMRQSLQNEELFRLMDLEKGLTYFTGSIRSNRVAIDKLLRVLKNPQYQELVKMRE
FT                   EDEDLLEDVIVEHDQAYDMVRVYSDVLGDTMDAFASIISNNLNIVMKFLASVTIILAIP
FT                   AAVSSFWGMNVRLPLMDSPNGFFWVSLIALALSAVATLWLWMRRML"
FT   CDS             complement(638034..638591)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05640"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27965"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7X0"
FT                   /protein_id="CBL27965.1"
FT                   /translation="MAGAVSLGMTSREVRRFGDGPAFCRVTCAMRPMRCARRAFSLAEV
FT                   LIVLTILAALSGSVLSVGAIWGRPTAAQEADRAMRWLYGVVARADLSGRPFGLGVDEDA
FT                   QCLQVRWEKPRSVERLPARSGCTFQWLGVGSATVDSHYAPQWGTFSSAMTTLIRDAEGK
FT                   RHFLILSGQGQIRTADHPPVAR"
FT   CDS             complement(638752..639687)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05650"
FT                   /product="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27966"
FT                   /db_xref="GOA:D4M7X1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7X1"
FT                   /protein_id="CBL27966.1"
FT                   /translation="MSALLEVEDLRQHFRVSRHFVVRAVDGVSFHIDRGETFGLVGESG
FT                   SGKSTIGRTIIRLYAPTSGRVVLDGTDISGRLSAAALRRLRTQVQMIFQDPMACLNPRK
FT                   KVINIVAEGLDIHRLYGSSRERREKVYDALETVGLSAEHANRYPHQFSGGQRQRIGIAR
FT                   ALVMEPSLIIADEPITALDVSIQAQVVNLLKEVQQRTGVSYLFIAHDLSMVKYISNRIG
FT                   VMHQGRLLETGTPTEIFSRPIHPYTRSLLSAIPLPNPVKEKKRHAVDYDRRAEGIEYAQ
FT                   GTLHDAGGAHRVLATDAEFERWRALSPNAS"
FT   CDS             complement(640769..641779)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05670"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27967"
FT                   /db_xref="GOA:D4M7X2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7X2"
FT                   /protein_id="CBL27967.1"
FT                   /translation="MTEPIIEPGHEFERIDVTGAAHIDRDCASQPFWRDVLSRFARNRG
FT                   AVFGAVTILVIAVLAAFGPGMNEHAYNDVNILHQNLAPRIPVIERLGVFDGGERRVNRY
FT                   RQKGLDDVYYWFGTDTFGRDQWTRTWMGTRISLYIAFVAVLIDMLIGMSYGLTSGYFGG
FT                   ATDMIMQRVLEVVNGIPTLIIVTLLMLVMPPGLNSIILALLITGWVGMSRVARAQMLKL
FT                   REQEFVLASRTLGAGHFAIIFRDVLPNIFGQLVTMSMFSIPNAIFSEAFLSFVGLGVPA
FT                   PMASLGSLINDGYKSFLMHPHMLVFPAMVLALLMLSFNLLADGLRDAFDPRMQEV"
FT   CDS             complement(641772..642713)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05680"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27968"
FT                   /db_xref="GOA:D4M7X3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7X3"
FT                   /protein_id="CBL27968.1"
FT                   /translation="MKTYIVKRVLTAAATLFAIVLALFLMLELMPGSPFNDEKLSPEQV
FT                   AVLREKYGLDGPVLIRFARYVGRMMTGDLGVSYNIQKNVPVTEMIRARLPISIRIGLQA
FT                   VFVGAVLGLLLGVLAALRHNSIADTFSTVVSVLGVSVPSFVFAFVLLYYLGFKAGWFPT
FT                   LYKVNRPAASTVLPTLALSMFTLAQIARFARSEMLEALGSEYMLFAQSKGLSPFRTNFV
FT                   HALRNVLIPIITVLAPLIVNLMTGSMVVEKIFSIPGVGSLLVTAIQSNDYNVVISLTFV
FT                   YCVLYIGLMLVVDLLYGVIDPRIRLAGGKRHD"
FT   gap             645683..646422
FT                   /estimated_length=740
FT   CDS             complement(646785..647585)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05730"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27969"
FT                   /db_xref="GOA:D4M7X4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7X4"
FT                   /protein_id="CBL27969.1"
FT                   /translation="MSSANGVMEGLRDIPVGGVRKRYLMEVQDLRYAYPDGHEALNGVF
FT                   FVLRDGEKLALVGPNGSGKSTLMLHLSGCLAAQSGVVCLNGEPVGEDLKRLRSAVGLIF
FT                   QEPDNQLFMPEVVEDVAFGLVAHGTPVQEAQERALSVMETLGIAHLAERAPHRLSGGEK
FT                   RMAALAGILVMQPDIVVLDEPSAALDPRARRRVIERLNTLEKPMILATHDLDMALDVCD
FT                   RAIILYEGRIAADGALQDVLRNEALLQQNGLELPLRYTKSTEAL"
FT   gap             647702..648045
FT                   /estimated_length=344
FT   CDS             complement(648531..649034)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27970"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7X5"
FT                   /protein_id="CBL27970.1"
FT                   /translation="MNASFKKTALLGLAVIAGLSGLLAQQADAHGVGYSESTLKPVSLE
FT                   FFYSTGELMNYLEAKVFSPADEKIAYQSGRTDEGGRFAFTPNKPGTWRVIVSDEDGHRA
FT                   EATVNVTEDFLKAGATGGGSGIDIQEKKAAPEGLDLLLRAGLGVSLIFNIAAFVLLLRC
FT                   RKAV"
FT   CDS             complement(649050..649838)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05760"
FT                   /product="ABC-type Co2+ transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27971"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7X6"
FT                   /protein_id="CBL27971.1"
FT                   /translation="MKRGNKVVLAAGLLLGVASAAFAHELVMKPQKMNAAKGETLAVEI
FT                   HSGHKFIVPEEVESVERIKAGVFKDGKLQEAGLKPNEKNLCIDFSLPVEDASQSMVILA
FT                   NKDGGVWCVTNEGGKSGLRKDLEAQGLKVTKATKNDKFVKVIVNASRDDKNFAVQTGQA
FT                   LEIIPVTNPADAKVGEFFEVKILVDGKPYSGAVWASYDGFAPEYEDTYAYYTQAVQGVA
FT                   HIKITAPGLWGVRAMKTDLPGKEGEYDSVARRTFLLFEVK"
FT   gap             650696..651689
FT                   /estimated_length=994
FT   CDS             652714..654225
FT                   /transl_table=11
FT                   /locus_tag="SY1_05790"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27972"
FT                   /db_xref="GOA:D4M7X7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7X7"
FT                   /protein_id="CBL27972.1"
FT                   /translation="MKRFHSALLIAALVLSLSQPVALSAAENKDTLTWAQGADVTSLDP
FT                   HIGKETPAIMATNQIFDTLFTTDDEGKIVGQIAESWKYLSDTELEVHVRSGIKFHDGSP
FT                   LSASDVKFSLDRAIASTAVSYIVNFIKEVRVVDDHTVVIETAKPYAAALRNLAHPSSAI
FT                   VPEAYVKADEARFRLNPIGSGPYRFVSWKQGDSLKLEAFDEYYAGAPKTKNLVMKVVPE
FT                   AAQRTIALETGEVDIANDIQANDQQKVRDNPDLTLNEKAGLSCWYLSFNMKKKPFDNKL
FT                   VRQAIRHAIDVNTIIDSIMYGGGEPAGDLIAPGVFGYAGDKPYAYDVELARKLLAEAGY
FT                   PDGFSCKLWVNDSQTRIEVCQAVQAMLLEVGIKCEVEVMEFGSFIERTSKGEHDMAYFG
FT                   WTTSTADADYTYYSLVYSTQTGAPGNRSFIQDPRVDELVDLGRGNTDETIRRKAYADLE
FT                   QILQDLSNNAPLVYSTLNSGTSKKVHGFVLDPAGYHKLENVTVEK"
FT   gap             654814..655091
FT                   /estimated_length=278
FT   CDS             656164..656400
FT                   /transl_table=11
FT                   /locus_tag="SY1_05820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27973"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7X8"
FT                   /protein_id="CBL27973.1"
FT                   /translation="MWDNAFETRWSCVFLAAYVVVMLPVKCFYSTEYVPSWKGLPLFMV
FT                   GWFWLTVAVMVLILLFYWQAMGREEYRAFGTED"
FT   CDS             656440..657969
FT                   /transl_table=11
FT                   /locus_tag="SY1_05830"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27974"
FT                   /db_xref="GOA:D4M7X9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7X9"
FT                   /protein_id="CBL27974.1"
FT                   /translation="MDVSTMLVPATGTFFLVLGGYFLIMALIGFYSARETKSLKEFFVM
FT                   GGKAGAIVSGIAYFATQYSMSTFMGVPAACYRQGYPGLTVSVPGLVFSMIIPALVVGRK
FT                   LIKLGHEQGFMTMADYLGDRYESNLLRGLQAVLMVFFMVPMMGAQIIGAGIIFNTFTGY
FT                   PEWVGVVATGLIVIVYCMSGGIRGAMLTDVIQGLLMVVTAVVTFFVALDMGGGLEAINA
FT                   KLFELNPAYMAHPGATGAYPWPALVSMVVMWSFFNIGSPTLATKFFTMKNYKVMFKAVI
FT                   LGTLGMWVSATLIEWVGVLGIVSVPGLEGKQMDFIVPLILQKGVSPVFASLMIAGIMAA
FT                   GMSTIDSLLVVSSGGISRDIYQNLMNRNASDAEILRLSRVVTCVFGVVAILFGIWRPSA
FT                   IFDIIIFSFGGLTIWATPVLLGLYWKRTTSAGAVLGILTGVLLYIPLSASPQILEKIGL
FT                   GGLVEISSTLKGYTFGFNALIPTWVVAMIVTVLVSLVTKPVSEATLKRHFG"
FT   gap             658767..659147
FT                   /estimated_length=381
FT   CDS             659151..660263
FT                   /transl_table=11
FT                   /locus_tag="SY1_05850"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27975"
FT                   /db_xref="GOA:D4M7Y0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Y0"
FT                   /protein_id="CBL27975.1"
FT                   /translation="MDGKNLKKIVELRHELHAHPELSMHEGWTKRRLMDFIGANTTLAV
FT                   VDCGGWFYASRYREGTPAVAFRADMDALPIPETISLPHASQSPGVSHKCGHDGHSAALC
FT                   GLALELEAMECPRSVYLIFQQAEETGQGGAAAAALLPERHVSEVYAFHNLSGYPEGSVI
FT                   LRNGLCQCASRGLTVRMTGRRSHASEPEKGNNPAFALAALVTEVRTLLARPHRGMVLAT
FT                   VVNLSVGRRDFGISPGEGTASMTLRADDEAEMEAFEAEVRGRAIALAAAEGLEVGFDVS
FT                   DPFPATVSDAGCVARVEAAAGRLGCPVVWMEAPWRASEDFGHYTKRCPGAIFYVGNGAN
FT                   WPALHTPEYDFNDRILETAVDVFREVYRGA"
FT   CDS             complement(660392..660667)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27976"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Y1"
FT                   /protein_id="CBL27976.1"
FT                   /translation="MKNISSVIVEYLERTMLNKGLVLYVSDEGKYMAMDESFNIRFKFD
FT                   LEFSDRAFVCHTLIHNEGELQLCHSVNIAWTNGKAIRDFFQYLQEL"
FT   CDS             complement(660711..661124)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05870"
FT                   /product="FeS cluster assembly scaffold protein NifU,
FT                   Clostridium type"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27977"
FT                   /db_xref="GOA:D4M7Y2"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR017787"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Y2"
FT                   /protein_id="CBL27977.1"
FT                   /translation="MALDYSQKVMDHFTNPRNVGELKDADGVGEAGNPRCGDIMKIYLK
FT                   VNDRNVIEDVKFKTFGCASAIASSSMATELIKGKTIDEAWDMTNQAVAEALDGLPPVKM
FT                   HCSVLAEEAIHAALNDYRTKHGMAAIPMEKHDD"
FT   CDS             complement(661260..662453)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05880"
FT                   /product="cysteine desulfurase NifS"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27978"
FT                   /db_xref="GOA:D4M7Y3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Y3"
FT                   /protein_id="CBL27978.1"
FT                   /translation="MKSVYMDHAATTPTDPQVLEAMTPYFTEVYGNPSSVYSLSRGSRA
FT                   AIEKAREQVAAALSADPSEVYFTASGTEADNWALKGTMERMRAQGKDHLITTQIEHHAV
FT                   LHTAAYLEKVEGLTVTYLPVDPDGRVSASDLKDALTDRTGLVSVMFANNEVGTIQPIGE
FT                   IGALCRERGIPFHTDAVQAAAQLDIDVRALNIDMLSLSAHKMYGPKGTGAFYLRKGLRL
FT                   ENFMHGGAQEHGRRASTENTAGIVGLGAAILLMKSRLSQDRPRIVSLRDRLIDGVLTKV
FT                   PHAKLNGARGGLRLPNNANFSFIGVEGETLLLDLDAKGIYASTGSACSSESLDPSHVLL
FT                   ALGLSHEMAHGSLRLTLGRETTDEDIDYVLDVLPKIVARRREMSPLWEDYLKGVGEP"
FT   CDS             complement(662563..663048)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05890"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /function="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27979"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Y4"
FT                   /protein_id="CBL27979.1"
FT                   /translation="MKLSTTTRYGLRALTDLCVQQQDAPVSVSDIARRQSIPVNYLEQL
FT                   FAKLRRSNILKSVRGAQGGYLLARPAKEITLSEVIAALGEEILFGSCQSEKGCANAATC
FT                   STFDLWNRLRISIDGILDGTTLEDLAKKDRTLRARKTVDPLRRAAVARALKHQEIRP"
FT   CDS             663296..665302
FT                   /transl_table=11
FT                   /locus_tag="SY1_05900"
FT                   /product="urocanate hydratase"
FT                   /function="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27980"
FT                   /db_xref="GOA:D4M7Y5"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Y5"
FT                   /protein_id="CBL27980.1"
FT                   /translation="MAVDERVTLSLDFPDGLPALPKFDPQYRRAPDRGYTLNEKETVLA
FT                   LANALRYIPERFHRELAPEFLEELRTRGRIYGYRFRPEGKLWGKPIGEYRGRSAEGRAF
FT                   QVMIDNNLDFDVALYPYELVTYGETGQVCQNWMQYLLIKRYLENLTQDQTLVVESGHPL
FT                   GLFRSRPEAPRVVVTNALMVGLFDNQEEWHRAMQLGVANYGQMTAGGWMYIGPQGIVHG
FT                   TFNTVLNAGRKKFGNKPDVLKGRLFVTSGLGGMSGAQPKAADIAGCVSITAEVDESRIR
FT                   TRHDQGWVQEVCRTPKEAFDRAREQMKKDDVHSIAFHGNVVDLLQYAVDQGIGIDLLSD
FT                   QTSCHAAYDGGYCPAGITFEERTRLLKEDPARYRTLVDETLKRHFHLIKTLVDRGTYFF
FT                   DYGNAFLRTVFDAGVTEIAKNGKDTYDGFIFPSYVEDIMGPMLFDYGYGPFRWCCLSRD
FT                   PEDLRRTDRAAMDCIDPERRQQDKDNWVWIRDAEKNALVVGTQCRILYQDAEGRVRIAL
FT                   KFNEMVRNGEIGPVMLGRDHHDVSGTDSPFRETANIKDGSNVMADMAVQCFAGNAARGM
FT                   SLVALHNGGGVGIGRAINGGFGLVLDGSFRVDDVIRSAMSWDVMGGVARRAWARNEAAL
FT                   ETSAEFNKKRTGEHITLPYLADMDYLKDLVAKD"
FT   CDS             665466..666173
FT                   /transl_table=11
FT                   /locus_tag="SY1_05910"
FT                   /product="yjeF N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27981"
FT                   /db_xref="GOA:D4M7Y6"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR026600"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Y6"
FT                   /protein_id="CBL27981.1"
FT                   /translation="MIVEGFGVEELAGESLIREVVYRGVSSPETVGREKMRRMEERAVK
FT                   KFGIPSLLLMENAALAVVHEVEDYSAFAVVCAPGGNGGDGLAVARHLCLLGRDVRVYLV
FT                   GDPEGGSADFRTNLEIMRRMSPESIYALTDESFKDFEYALKGCETCIDAMFGIGLNRPV
FT                   EGLPRRAIEAMNRYALHIVSVDVPSGVDADTGEVLGAAVCAHKTVTFHRVKPCLDLAPQ
FT                   YAGDVVVAYVGIP"
FT   gap             669136..670101
FT                   /estimated_length=966
FT   CDS             671227..672657
FT                   /transl_table=11
FT                   /locus_tag="SY1_05970"
FT                   /product="FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27982"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Y7"
FT                   /protein_id="CBL27982.1"
FT                   /translation="MKLTEYLKQVVNDEQWVYKEDCDLYACGITPDIVDEELLLKVASK
FT                   LHKQKERESFWNDLLDYLPEKSLTQNVFAYLLENKIALVSLAHRRSDDERLKKLIPYAE
FT                   EALFTLAKRYYGQSEYYPSDFNGESKYSAEDFAGFLCEYYYDALLEQLGSLKPDDPEKE
FT                   IILFYFYSNKHRPDVEKLIELRCLEITNDPVMIQSAYERNDPLCFLALSRNMFATRDML
FT                   ESLGNASDIENASCIRSNARKTLSIKKYLDSHEGTPQITTNKAYQDPKMAVECMTLLMR
FT                   TVWQDTDFQLLNELLATGMDVNEKNVYGMTALMYAAWRDVPSIEVVSALLDAGADVNVK
FT                   DEGGMTALMYSVWGEAPNAEVIGSLLDAGADVNVRDEDGMTALMYSVWGEASNVGVIRT
FT                   LLDAGADVNAKDENGMTALMYSVWGDTPNVETIGTLLDAGAEVSMKDHEGKRVIDHARV
FT                   NERLKGTDTLKRLENASR"
FT   gap             673105..674920
FT                   /estimated_length=1816
FT   CDS             complement(675197..675799)
FT                   /transl_table=11
FT                   /locus_tag="SY1_05990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27983"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Y8"
FT                   /protein_id="CBL27983.1"
FT                   /translation="MLDLSRYRVFILCEDQEHNYFVRTFFKSLGIGDRKFDTYPLVDGA
FT                   RSAEGHVRERLPEALDKIRKNRENVFLVLVSDADKNDPNLSDRVKQWNEELHSRGLPKI
FT                   CKEDRVLCLVPKRNIETWFAWIDGEEAVDEIKDYKQRYKKAKAGHYGKRFFEKYTECRS
FT                   RDARCDDAPQSVRDACTEFGRFCDSLDKHERQRKSSA"
FT   CDS             complement(675792..676925)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27984"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Y9"
FT                   /protein_id="CBL27984.1"
FT                   /translation="MIRKLEIHNYKLFRNFALELDGGVNLLCGPNGSGKTSVIEIVYAL
FT                   TRFLAIPDHSDTIACSVEDAFPFRTFCRWCTEENGWGEMSVKLEIESDEQPLYIYDLTV
FT                   RYNFLEKISRVQHESLRLGEALLLRFQEGRIEMFTDDEKKLAFRSDWKRSGLVVGSSNN
FT                   SRIRRFGKQVASLYAFHLVPALMKQDVEKPMETLALYGENFAAWRFLRATQQLMRQARV
FT                   VEQSKYFIPGLVDIRYIKKGDWHALAVKVEFNGRENDIEFNELSDGQKTLLALYSILAN
FT                   IPNGSTVLIDEPENFLALSELQPWLEAMNDAWEERDIQFIIISHNPRTLNWHNKNAMIL
FT                   SLEGTPPKVVVERRTDDDDDPLVDKLRLMEWEECDNA"
FT   CDS             677163..677594
FT                   /transl_table=11
FT                   /locus_tag="SY1_06010"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27985"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Z0"
FT                   /protein_id="CBL27985.1"
FT                   /translation="MTRRYALRDDQWERIKDFLPGQPGYVGANGKDNRLFVETVLFRYR
FT                   AGIPWRDLPERFGDFRVVHTRFSRWCKSGVWKRIFETLAEDADNEYAMIDSTIVRAHQH
FT                   SAGAKKAARMRKPLVAAVEVSAPKFMRRLMRWETPQAFY"
FT   CDS             complement(678135..680111)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06030"
FT                   /product="Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27986"
FT                   /db_xref="GOA:D4M7Z1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Z1"
FT                   /protein_id="CBL27986.1"
FT                   /translation="MEKNELNRVQFHDLMKYRFISSPRISPNGAKAAFAVHQGDLEGNR
FT                   YLSCLWLCDLTSAQTSQLTFSGTERAFCWSQDGRDLIFVSGRSPQPGEPEPAPDAPRDS
FT                   RLYRMNVAGGEARFLAALPRTVTALWDLGDGRLLLKTTDPRKGERFEDADYMVFQQIPF
FT                   NSNGKGFTAQQRSRLSLLTLEGSKLEDLTPETMDVRQVRPSPDGTRVLLTGVDYEDVMP
FT                   LTTGVWEIDLSSKTLKERLPQGQYAWGCAAFFEGEVLLAGTDMKRHGLNENKRFFMARE
FT                   GAAPRCLTPDWDRSLHNSIICDCRYGIGPIGESFLVDGDKAWFISTEGWRSRLSTVDAQ
FT                   GAVVQVTRMLRSVDDFDVKDGRAVVVGLEGLSLQELYLIEDGAERRLTGLNTAALEGTD
FT                   LSVPEYVRLENGTPDGLDCWYMRPIGFEVGKKYPAILHIHGGPKATFSDVFVHEMQCWA
FT                   AEGFAVLFCNPRGSDGKGGGFDDIRGKYGTVDYEDLMAFVDWAVQTLPFVDGDRLGVTG
FT                   GSYGGFMTNWIIGHTNRFRAAATQRSICNWVSMTGMTDIGYYFDPDQHGADVGDSVETL
FT                   WDRSPLKYANQMRTPTLVIHSDEDHRCDLGQGLQLFTALKRGGVESRMCVFKGENHELS
FT                   RSGRPQPRLARLQEIARWLKERV"
FT   CDS             683713..684588
FT                   /transl_table=11
FT                   /locus_tag="SY1_06060"
FT                   /product="Virulence protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27987"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Z2"
FT                   /protein_id="CBL27987.1"
FT                   /translation="MKKDEREISIVRSSAAEYLTFITATGESDVNAVYFDENVWLTQKM
FT                   MGLLYHVETHTINYHLKKIFADGEIDESSVIRKFRVTAADGKSYNTNHYNLSAIIAVGN
FT                   KVDSPRAVQFRKWANRIIEEFTVKGFAMDDERLKNGGTVLTKDYFREQLERIREIRLSE
FT                   RRFYQKITDIYATSIDYDAKAETTRLFFARVQNQLHWAIHGETAAETIYRRADSSKEHM
FT                   GLTTWKDAPGGKIQKFDVVMAKNYLTQEELSAMARIVNAYLDLAELRAEEEVPMTMEDW
FT                   AEQFEGVPSG"
FT   CDS             684788..684967
FT                   /transl_table=11
FT                   /locus_tag="SY1_06070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27988"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Z3"
FT                   /protein_id="CBL27988.1"
FT                   /translation="MSRLDELIQEYCPEGVEFKPIQEVYQRLRGTPITAAKMEEIEKAD
FT                   GDVRIFADGKTVIV"
FT   CDS             complement(685130..686644)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06080"
FT                   /product="Aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27989"
FT                   /db_xref="GOA:D4M7Z4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Z4"
FT                   /protein_id="CBL27989.1"
FT                   /translation="MSRHSVAIAGSGLAALATAARLHELGVRDIALYANGFGGTPFIAA
FT                   INFVLPDNPYGDTPELYCTDMLHAGYDIADRETVRRMTSRTADGYELLCRWGVTFARNE
FT                   DGTLKRRHVSGHTHPRSLCQTTRLIGAEILEAMLTRLEAAGIEVHRRCPVAGLLTRGGR
FT                   IEGFTVLQDGEPHNVYAPATVAAWGGVGGLLGPTTYPGDVQGNTLGMAKEAGATMIDME
FT                   FLEFEPMVMMDPPGTVGEPAPTAMLGEGGHLLNSRGERFLLSVRPQGEGGAPKSLINRE
FT                   AWKQVQSGKGSPRGGVFLDLRHIDRAVLQSYPWFYDRLMKNGCDPNRQLLEVGPMAHSF
FT                   SGGIRVDADYRSDVQGLYAVGEACGGLHGACRCAGNAASQAVLSGLLCAEGIAKEGGLD
FT                   RAISPHPLRCTQDATLRGKVLPKLRGIAAHALGIYRNGPDLEAARSAVKAILDEPVTAR
FT                   DDLTRQSALAILTIAEAALNRKESRGTHSRLDFPETDPAFQREFTL"
FT   CDS             complement(688940..689686)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06100"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27990"
FT                   /db_xref="GOA:D4M7Z5"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Z5"
FT                   /protein_id="CBL27990.1"
FT                   /translation="MQSLLKGKAAIVTGSSRGIGRDIALAFAENGADVVIHGTREQPDL
FT                   RDRIRATGVRCECAAGDIGDYSTAERLTAACLDAFGRIDVLVNNAGVNSRTPFADLSLE
FT                   EWERVLRTNLTGAFCTCKCVVPHMLRQRSGCIINLSSSAGKTAHPNAALPYGVSKAGIN
FT                   SLTQKLAWDLAPFGIRVNAICPGPIETDMTRQWIPEYREEVLKSIPVRRLGCGADVANV
FT                   AVFLASDMSTFIVGESINVNGGKYMN"
FT   CDS             complement(689697..690701)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06110"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27991"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Z6"
FT                   /protein_id="CBL27991.1"
FT                   /translation="MKKILALSLILAFAAAASAELTQPVNLTFAAQEVGTGAYSVAAAI
FT                   QSVLVKGLPQGSTIDLTTNSPGGVGAPMLIQNEDCDLIVSNAGPSLWSYERTPDQYQFG
FT                   GCKDVRSIGGGLGHTFTNVMFTKKFVDETGITTLEELIAKKHPVKIVTKKNGSLGELTA
FT                   ERVIEACGISVEEFNSFAKWEKTGTDAIKSGLQDDLYEMTIDHIDAGQATTTEIALTHD
FT                   MFFVQLSDATLANMQKMGYAPIVMPAGTWNKQDKDIKTMGSQQNVLVPAAMDEELAYAL
FT                   TKAICENKDEMAKFVASLGWFDLKTAARKELNGAPLHPGAIRYYKEIGVQVDE"
FT   CDS             complement(690798..691748)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06120"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27992"
FT                   /db_xref="GOA:D4M7Z7"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Z7"
FT                   /protein_id="CBL27992.1"
FT                   /translation="MKKAFSALLTALLLTGMASASFAADWPTKPINVYVTHAPGGDTDY
FT                   MARQLSAQLEKVLGVSVVVSNVTGANGATCMQQYKDGSKDGYTFIATNTAALNGNEATQ
FT                   MVDFGYSAFEPVAVYGIQSGENIVVPADSPYKDLKELIDASIANPGQIRFGISTGGGVY
FT                   IMACVLTNLGHAQFNIIDAGDGANRLTALLGKAIDATSLPYSTAADYIEKGQLRSLCTV
FT                   LSKAPTLLPDQPSASAVIPELKLDTEYVILAPKGTPADLVKSMNDAILKVCGSEQWKKL
FT                   VNDYCYQDPFFFNVEDTVQNLKEQRDLFQSFLPFL"
FT   CDS             complement(691792..693291)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06130"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27993"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Z8"
FT                   /protein_id="CBL27993.1"
FT                   /translation="MIMEGLLAVCQPLTLLFIAIGVAVGIVFGAIPGLTATMAVVMFLP
FT                   LTYSMAASEGIAMLMALYIGGISGGLISAILLNIPGTPSSVATCLDGKPMANRGEAGKA
FT                   LGVGVVFSFIGTLIGIAILVVLAPVLCAFALKFQSYEYCALALFSLSMVVALTGTDMTK
FT                   GLISAILGALLATVGLAPIDSRPRFTFGLFQLNNGFALVVLLIGLFAISEVMAFAETVR
FT                   RRQDYTVEASVRIRGAGFSLAEFFGQIRNAIVSALIGVGIGILPGIGGGVSCMISYTVS
FT                   KNTSKHRELYGTGIIDGVVASETANNATIGGAMIPLLSLGIPGDAVTAMLLGGLQIHNV
FT                   APGPLIYEKNGVVVHAIFFAMLIAAVMMLFFMLWGMRFFISVLKVPKNYLLPLVLVLCG
FT                   IGAIGNANQIFDTYTMVAFGLMAYLMIKARIPTVPMILGFILGPTFEQNLRRASQLTSS
FT                   DPFWNHPIFCVLIVATLLVVVFSARANMRDAAREEAAQGDD"
FT   CDS             complement(695107..696396)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06160"
FT                   /product="TRAP transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27994"
FT                   /db_xref="GOA:D4M7Z9"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D4M7Z9"
FT                   /protein_id="CBL27994.1"
FT                   /translation="MTISMFFLALCFAVTLAIGVPVVWSLALSSMVACLSIPGISLSFL
FT                   AQKMELGSEKYALLAIFFFLLAGSIMQHGGIAKRLIAFAKSITSFIRGGMSIVAIITCM
FT                   FFAALSGSSVATTAAIGTIFYPELVKDGYKKGYAATLPVVGGTLGIVIPPSIVFVVYGT
FT                   TTNTSVARLLMSGVLPGLLGGLAMCLYAYFYALRHKMPKGAPFRFNAFLDATKDAMWAL
FT                   MMPIIVLGGIYAGIFTPTESAAIACIYGLFVSCGVYRELKLKRLIQIAIESVKSTANVM
FT                   LIIMAATLFSYVLTRNNIPVMLSNAITSAITTKTEFLLALNILLLILGMVMDAGPIILI
FT                   IAPIVYPIALKFGIDPVHLGCIIVFNLSVGQATPPFGLCLFAAQPVTGQSIATLSRNAM
FT                   PFVIILYLMVLATSFIPEIALTIPRLMMAR"
FT   CDS             complement(696393..696941)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06170"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   small permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27995"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D4M800"
FT                   /protein_id="CBL27995.1"
FT                   /translation="MLKLLVRLKKADNFLYSIQKILILFGVIAMVIINGAQVFCRYVLH
FT                   SSLAWSEQVSVLLFFILIMLGANLAVKTDSETKVDILKFKNKRTNSALHILTDALSIVA
FT                   LVVFIVSGFALLKHARKFPQFLSSIRLNYFYIYLWLPMGFGLVLFDKVINVLENTCVLM
FT                   GIDTSTSCNSEKEMEQAQS"
FT   CDS             complement(697040..698029)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06180"
FT                   /product="tripartite ATP-independent periplasmic
FT                   transporter solute receptor, DctP family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27996"
FT                   /db_xref="GOA:D4M801"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="UniProtKB/TrEMBL:D4M801"
FT                   /protein_id="CBL27996.1"
FT                   /translation="MIRWKFSTVILAIAFMTAVCPATEAADAIHLTLAHADTPEGSLFG
FT                   TCMTEFKNVLEQRSNGSIIVDIFPNGQLGTVSEYVVGVQSGTIDLAPAASTFIANFCHT
FT                   VSIFDLPFLFEDYEHVWQTLDGEVGTQLTSALADNGIEALAWWGLGFRNVTTSKKHPIN
FT                   SIGDLKGFRIRTMQSAIHQALFQALGADAVPMDWGELYTALQQGTVDGEENPFTQVLSS
FT                   NIWEVNPIIVKTEHAFTPAVFMMSPQVASKVSSEQLELIRNCAKECTPIFRKATVDINA
FT                   DALKTLIQEKECSFIETISKADLQAATASVYNSYPEYADLVQSIRNIR"
FT   CDS             complement(699430..700386)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06200"
FT                   /product="Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27997"
FT                   /db_xref="GOA:D4M802"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4M802"
FT                   /protein_id="CBL27997.1"
FT                   /translation="MELLKMGAIDVHVADDPDPNRYLDVLQDADALIVRIARCDANAIE
FT                   HSPRLKVIGRTGVGYDTVDVKKASERGIPVVLTPGANNRSVAEHAVAMMFALSKNLVEA
FT                   QNEMCAGNWEIRGAGKAFELEGKTVGIVGMGAIGREVATICRGCGMKLIGYDPFLSRDK
FT                   IEALGALYCADYEDLLKRADVVTIHVPLTNETRGMIGARQLASMKRTALIINCSRGGII
FT                   DEGDLVRALKDGVIAGAGTDVYCHEPPKPDDPLLHCPNLILSPHSAAQTREAVVKMAQM
FT                   CVRGCLAVCSGKKWPHVADRSVYDHPIWAGRDWAEAD"
FT   CDS             complement(700510..701808)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06210"
FT                   /product="TRAP transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27998"
FT                   /db_xref="GOA:D4M803"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D4M803"
FT                   /protein_id="CBL27998.1"
FT                   /translation="MSPIALSAAIMLVLLFANVPVFASVVGACIAYFVSAPDTGFTAMM
FT                   ATQRIISGMQSVTMLAIPFFVATGVLMNYCGITGRMLQFCKVLTQHMYGGLGQVNITLS
FT                   TLMGGMSGSSLADAAMEAQLLVPEMRKAGYSNGFASAITAASSMITPLIPPGIAAIIYG
FT                   SITGTSIGRLFVAGILPAAVLCAAMMIIVSRFSRKNGIPRLSERRATIYELWEAFKPAF
FT                   LPLCLPIIIIGGIRMGIFTPTEAGSIAIFYALLLGILYQEIRLDNILTCIKETVATTAS
FT                   IMLIVGAATCFSWILTWENIPQTMTAELIALCHNKYVFLLAVNVFLLAVGMFVEATAAQ
FT                   IVLAPMLAPVAVAFGIDPVHFGMIFIFNMAIGSITPPMGNLMFVTCGVTRCTTGDFIRE
FT                   CRVFYALLIIILMLMTYVPFLSTWLPNLLYGVR"
FT   CDS             complement(701808..702305)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06220"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   small permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL27999"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D4M804"
FT                   /protein_id="CBL27999.1"
FT                   /translation="MKKTLNALLNLDTLVAGVGLVLIVVMTVAGVFMRKVMGRPFAWME
FT                   EMQIFFFIWTIFFGGSVAFRTGSQVSIDLIAVRLSPRARCILDIVDYLITVLVLAYLTK
FT                   GGYQLMMSVTKKVTPYFKISYSLIDLAVPIGCVLMIIQYSLIAWDKFLRNREAAQEEGA
FT                   EA"
FT   CDS             complement(702363..703376)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06230"
FT                   /product="tripartite ATP-independent periplasmic
FT                   transporter solute receptor, DctP family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28000"
FT                   /db_xref="GOA:D4M805"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="UniProtKB/TrEMBL:D4M805"
FT                   /protein_id="CBL28000.1"
FT                   /translation="MKKTLALLLTLGLALSVISGSASMASATEAKFVLKLCTEQTDGDP
FT                   IDDGCDRWAELVSKATDGAVKIQVYPSSQLGAKADLIEMMLMGQNVCTIADGSYLMDYV
FT                   PDFGVVMGPFLFSEWSAMYQITDSDWWGEVAAQLEEQGLKIISTNWVYGERQLMTRSPV
FT                   KSLADMKGLKIRVPNNDISVTMFNDLGAASTPMALSEVYTALSQGVVDGVENPLTTLYN
FT                   NKFQEVCKNVTMTNHQMTFSNFIVGKTFWDKLPPKYQEAIVSCGKEAALYNNDLYQQVS
FT                   QKMQQALTDEGCTIITLDEAAQAEFKDACVKLYKEYEEKGTWSKGLYDKIQAIINH"
FT   CDS             complement(703423..704496)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06240"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /function="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28001"
FT                   /db_xref="GOA:D4M806"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D4M806"
FT                   /protein_id="CBL28001.1"
FT                   /translation="MDKPILGITMGDPFGNGPEITVKALADAAVYDRCRPLVVGDASSI
FT                   RYAAAAARTLSGADLEVRPVKAVSEAAFTPGVIDVLDLGLVKASDIPGDPAAPKPFGLG
FT                   VTKLGGEAAFQYVVRVIQMAMAGTVDATVTNALSKEAINLAGHHYSGHTEIYADYTHTQ
FT                   KYTMMLAHENLRVVHVSTHVSLREACDRVKKERVLDCIRIANDACLALGIRDPKVGVAG
FT                   LNPHCGENGMFGTEDIQEIQPAIDTALAQGINVPDRKPTPPDTIFSKAIGGWYDIVVAM
FT                   YHDQGHIPLKVKGFVYNKAEKRWEAVAGVNVTLGLPIIRASVDHGTGYGHAGSGGANAL
FT                   SLVNAMDYGIRLAEHRG"
FT   CDS             complement(705484..706638)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06260"
FT                   /product="Alcohol dehydrogenase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28002"
FT                   /db_xref="GOA:D4M807"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D4M807"
FT                   /protein_id="CBL28002.1"
FT                   /translation="MLTKYDLKMPSAVYSGEDALTNVGNVLAENGVKKLAVFTDKGIEG
FT                   AGLLEPPMAEVRRTGVEFTVLDDLPAEPSYAQAQKLVDQCRESGADFIMAVGGGSVMDT
FT                   AKLSSVLMTDEYGIKELLEDPGRARKHVKTLMIPTTAGTGAEATPNAIVAVPEKELKVG
FT                   IVNPRMIADYVVLDAVMVKKLPRKIAAATGLDALAHAIECYTSNKANPFSDIFALQALD
FT                   MILNNIERACDDPKAMEAKRMMQIASFYGGIAITASGTTAVHALSYPLGGRYHIAHGVS
FT                   NAILLAPVMRFNEPACRELLAHAYDRCIHGDASSTEAKSAAVITRIEEIVRHLDIPVSL
FT                   QEFNVPKEDLESLVQSGMQVTRLLVNNRRPVTEEDARRIYQEIL"
FT   CDS             complement(706638..707189)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06270"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28003"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="UniProtKB/TrEMBL:D4M808"
FT                   /protein_id="CBL28003.1"
FT                   /translation="MACGSVNPVTRRQTAAAEGCGFQHVHLSVRQKLDEAWPSENESSA
FT                   LIEDCLARARRYGRVILDTNDPEGSAETQERAAAMGLSLPQTRVRVSKALAELTKGLLD
FT                   RGLEATLLCVGGDTLLALMQAVGTHELTPVCEMAPGVVLTSFVYGGRARYILAKSGGFG
FT                   KPDLLCCLADRIGAGREEKA"
FT   CDS             complement(707162..707890)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28004"
FT                   /db_xref="UniProtKB/TrEMBL:D4M809"
FT                   /protein_id="CBL28004.1"
FT                   /translation="MVSLLIVADDFTGALDTGVQFVARGASTRVVTDLDRDFSRDEAQV
FT                   LVLDTETRHLAPEAAYAAVHRAVSAALRAGVPYIYKKTDSGLRGNVGSELAAAMDAAGV
FT                   QSLPFVPAFPSMGRITRDGVQYVDGLPLDQSVFGRDPFEPVRFSRIGDVIAQQTSKAVF
FT                   VRRPGEPGMGQGIQVYDATTDEDLKLTARALGPEGLRLSAGCAGFASVLADLLMPAARP
FT                   AAVPSLAPGTSSWPAAASTP"
FT   gap             711656..711870
FT                   /estimated_length=215
FT   CDS             712841..713320
FT                   /transl_table=11
FT                   /locus_tag="SY1_06320"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28005"
FT                   /db_xref="GOA:D4M810"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4M810"
FT                   /protein_id="CBL28005.1"
FT                   /translation="MKIINEANESKVSYRLLNVMLKLQEAQERLHRYGTDTPLFAAEIH
FT                   LIKCVKENPNRHMTALAEVLGVTRGAVSQIAMKLEEKGMLVKEKDEGSSLRRILRVTPD
FT                   GERAYRFHERLHADFDRLVEGLLSGAAEGERLFLLDFLGALDAALEGKFQSCAHR"
FT   CDS             713409..714062
FT                   /transl_table=11
FT                   /locus_tag="SY1_06330"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /EC_number="2.1.1.-"
FT                   /EC_number="2.1.1.103"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28006"
FT                   /db_xref="GOA:D4M811"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniProtKB/TrEMBL:D4M811"
FT                   /protein_id="CBL28006.1"
FT                   /translation="MTEEARDFRGKGRAFKGAFGGENYRRFAALFGFQERFYRQAVGDL
FT                   RLGEGGRALDLGCGPGGLSYALAETSPASASIVGADISDDQLECARRGAGAFACKVEFL
FT                   KASMDELPFPDGHFDLVMTSMALHETPPAVRRAAIAETARLLRPGGTFLLVDWSRPRFG
FT                   LWGIVWYPFCRWGERNRDNWNNAYPAICRERGLSLTEDRYINSISRRQVFVKER"
FT   CDS             complement(714126..714512)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06340"
FT                   /product="Essential protein Yae1, N terminal."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28007"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="UniProtKB/TrEMBL:D4M812"
FT                   /protein_id="CBL28007.1"
FT                   /translation="MTNDETGVSIVQTTADTVFQRVNDTEKEYWSSFAVRYRQLQEQIA
FT                   EWDRRAFLKDARNQGLAEGHKQGLEEGRKEGLEQGLERGRALGEAKGRADVVRQLAASG
FT                   LLTLEQVAQATGMSTEEVKAITSE"
FT   CDS             714805..717450
FT                   /transl_table=11
FT                   /locus_tag="SY1_06350"
FT                   /product="pyruvate phosphate dikinase"
FT                   /function="pyruvate phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28008"
FT                   /db_xref="GOA:D4M813"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="UniProtKB/TrEMBL:D4M813"
FT                   /protein_id="CBL28008.1"
FT                   /translation="MAEKFIYSLKEGKGDQKLLLGGKGANLCQMVQSGLPVPPGFILTT
FT                   EVCRRYMQDPKIMDAIWDEVKRYVKELEKEAGKGFNDGKNPLLVSVRSGAPISMPGMME
FT                   TILNLGLNDETVEGLASVSGNRRFAFDSYRRFIQMFGSVVDEVSSDRFEQALSACKKAL
FT                   GVAQDFEIPAEALEKLVAEFKAIYKAATGRDFPTDPWDQLRRAIEAVFRSWNIPRAVTY
FT                   RKINKIADDLGTAVNVISMVFGNLGDDCGTGVCFTRNPSTGENKLYGEFLINAQGEDVV
FT                   AGIRTPMPIGQLEGAMPDIYRELCRLTGQLEKSYRDMQDIEFTIERGKLFLLQTRTGKR
FT                   TAAAAVKVAMDMVGEGLIDTKTAVARVSPEQVEQLLHRQVDKSAPQEVLAVGLPASPGA
FT                   GVGILVFSADEAEAWAHQDKSVVLARPETCPDDIHGLFASAAVVTSRGGMTSHAAVVAR
FT                   GMGKPAVCGCEEVEIDLAAETLTSRGRTLKKGDTVTVDGSSGRVLLGEAPLIEATFSED
FT                   FKKLLGWADEAAEQEVWANADTPEDARRAREFGARGIGLCRTEHMFMATDRLPVMQRLV
FT                   VADSLEERVEALNKLKVMQKDDFVGIFKAMEGYPVIVRLLDPPLHEFLPKEPALLEELG
FT                   ELEKKGRGTSPEAEKLRRTLNKAHQLHEANPMLGFRGCRLGMVYPEIYEMQINAIFEAV
FT                   AELTKAGVKVRPEVMIPLVGTRAEMKFFREMADRIAGEVMKASGTDFTYLVGTMIEVPR
FT                   AALVADQLAEYAQFFSFGTNDLTQTTFGYSRDDAEGKFLFQYIDKGVFKENPFSELDRD
FT                   GVGALMRIAVEKGRSVAPKLSVGICGEHGGNPSSIAFCHSIHMSYVSCSPFRVPVARVA
FT                   AAHAAMGTLK"
FT   CDS             717642..719222
FT                   /transl_table=11
FT                   /locus_tag="SY1_06360"
FT                   /product="nickel ABC transporter, periplasmic
FT                   nickel-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28009"
FT                   /db_xref="GOA:D4M814"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR011980"
FT                   /db_xref="UniProtKB/TrEMBL:D4M814"
FT                   /protein_id="CBL28009.1"
FT                   /translation="MRRFARWLCALWLLSLCGASGAAETSRLVYSCGSNAGGDLSPHQY
FT                   SSNQMYAQDMIYEPLVRYAVSGEIEPCLAESWEVSPDGKVYTFHLRRGVTFSDGTPWNA
FT                   RAAKANFDAVMANAGRHEWLGLIGELEGTEAADEHTLRLILKDAYGPTLADLSLIRPLR
FT                   FLSPAQFGADGGTAKGIKAPVGTGPWVHAEARKGEYDLFKRNESYWGKKPELEEVLVKV
FT                   VPEGDSRVAALETGDLDLIFGTSGHGAAQISLEAFKRLEATGRFETGVSNPRATRALAI
FT                   NSARGAGRDLAVRRAVQHAIDRDAIIRGVFLEVEPPAPFLFSTAMPYCDAGLAPYEHDL
FT                   EKAKALLEEAGWKQEGDYRSKDGQELAFDLCFVGNDAEQKTIAEVVQSDLRKAGIRVNL
FT                   IGEESDAYFKRQRDGEFGMIFNDTWGAPYDPHAMCASMRVPSHADYQAQSGLPMKKELD
FT                   EKIGLVLRATTDAERSALYRDILTTLHDQAVYFPISYKTLVKVHRKGLVGVGFPAFVDS
FT                   VPFDTMSWE"
FT   CDS             719233..720174
FT                   /transl_table=11
FT                   /locus_tag="SY1_06370"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28010"
FT                   /db_xref="GOA:D4M815"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4M815"
FT                   /protein_id="CBL28010.1"
FT                   /translation="MVRFIVRRFLVLIPILICVSILVFLVLRLAKGDPAMAYLRMANIP
FT                   PTEQALAEARRELGLDRPIAEQYAAWAAKAVRLDFGRSYVTGKPVLQEVLYYLPATLTL
FT                   AGWGLLFTLLVSVPLGVAAALYKDRLADHFTRALAFVGVSMPSFWLGYLLLYLFSVKLG
FT                   WLPPMGRGGAAHLVMPVVTLSAMSIAVNIRFLRANLLEHMRSRSVFYARARGLTERRVV
FT                   WAHVMKNSMIPIVTATGMHLGEMLGGAVIAENIFAWPGLGRYAVQSVLNRDYPVLQCFI
FT                   LLMTVIFVACNLCVDILYALVDPRVRLEGEAR"
FT   CDS             720998..721819
FT                   /transl_table=11
FT                   /locus_tag="SY1_06390"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28011"
FT                   /db_xref="GOA:D4M816"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M816"
FT                   /protein_id="CBL28011.1"
FT                   /translation="MSAPLLEVRGLRIETSERAARPLVRDVSFAVRRGRVTCLVGASGS
FT                   GKSLSCTAVPGLLPQGVRRTGGAIRFEGRPIDALPARELRELRGTRIAMVLQDPISCFD
FT                   PLFSIGSHFRETLAAHGGDFGWRGRAEAALREVGLEDAGKICRAYPFQLSGGMLQRVML
FT                   ALALLNDPSLLIADEPTTDLDTVAQRRVLDLIDAARRRRDMGVLLVTHDFGVVARVADD
FT                   VVVLEEGAVVEDRPVGEIFSSPRHPVTVALVEAHRALCARLGLLQEGGDER"
FT   CDS             721816..722601
FT                   /transl_table=11
FT                   /locus_tag="SY1_06400"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28012"
FT                   /db_xref="GOA:D4M817"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M817"
FT                   /protein_id="CBL28012.1"
FT                   /translation="MSALLSLEGVCRTYRRGGLFTRAEALHVLRGVDLDLSEGASLGLV
FT                   GRSGCGKSTLGRVILGLERPNAGTVRFLGEDVASPARRAEFRRSVQAVFQNVRDSVNPR
FT                   MTAGEIVAEPLRNFFSLTKGEAVERSCPLLEQVGLKAVDADKYPSQFSGGELQRVCIAR
FT                   ALAPNPRVVVFDEAVSSLDMLVQARVLKLIERIRDEQGLAFLFISHDLRVVAGLCREVA
FT                   LMADGVIAARGRSVEELAAMGHPIIEELLASLPPAFPRR"
FT   CDS             722756..723640
FT                   /transl_table=11
FT                   /locus_tag="SY1_06410"
FT                   /product="Predicted permease, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28013"
FT                   /db_xref="GOA:D4M818"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4M818"
FT                   /protein_id="CBL28013.1"
FT                   /translation="MKRSAIAGYAAALTSILIWGTTFIVSKVILEDFRPVEVILIRMVL
FT                   GLVALFLVSPRLPRVRTVPEELSYAVAGFCGIVLYFLLENTALTHGLASNVGVIISAAP
FT                   FFTATLNRLFYRSDRLQVRFFVGFALAMTGIGLISFNGVRMQISPLGDLLALGAAASWG
FT                   LYSVLVRRAGGFGLSTLQATQRIFLYGVLFLAILSPFLGLRPNLAHLVQPKFFLPFLYL
FT                   GLGASALCFFAWNFAVEALGPVRTSVSAYLIPVVAVAAGALALGEPVTPLSLLGTGLIL
FT                   GGLAVSEWRAGRG"
FT   CDS             complement(726912..727577)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06440"
FT                   /product="Nitroreductase family."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28014"
FT                   /db_xref="GOA:D4M819"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:D4M819"
FT                   /protein_id="CBL28014.1"
FT                   /translation="MFAAFRKFCAFLLAVAVLLPTGAASADVPLPAPQRTGGPGVFDAI
FT                   GSRASALGADFASMGEVSSEKLSTILWAATGLNRGEKGWTVPMAMGMEPYVKVYVARAD
FT                   GVFLYDWKAHALKEVSGEDVRGRIGKQDFVAKAPCTLILVSDSEALSRKFKDEDAEEQF
FT                   AAVAAGAMAQDVYLAAGAVGVGTRYIRSVQKDAVEDVLGLRDDDDVLCIMPMGTKPGA"
FT   CDS             complement(727676..728251)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06450"
FT                   /product="Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28015"
FT                   /db_xref="GOA:D4M820"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D4M820"
FT                   /protein_id="CBL28015.1"
FT                   /translation="MTDMLRSRAEELKGKKTRENLCTAFAGESQARNKYTFFAAKARAE
FT                   GYNQIADLFEETAHNERAHAKMWFQILGGISDSTAENLKAAAAGEHDEWTDMYPTFAKV
FT                   AREEGFNDIARLFEGVAAIEKAHEERYKKLLNDVEKGLVFSSDGDAIWQCANCGHIVVG
FT                   RRAPEMCPICGHPKAYFMKKGEGGQAGD"
FT   CDS             complement(728999..731359)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28016"
FT                   /db_xref="UniProtKB/TrEMBL:D4M821"
FT                   /protein_id="CBL28016.1"
FT                   /translation="MSKTVRLVSGALVLLAALAAGGAAWGAVADPIHDYPSFNDYDDAD
FT                   RYYTFGDHTTEYGYHYQLRDVSGARDGHTVAGAQWFATSYENYLWRYVNEDLNGRLLYR
FT                   RTLGGETPEVPLTTSADLLYDFEAVYIDEPQPYPAYPDTRYRDACMDPIESIALVLPEG
FT                   RGQFKVSLANHYARHFPYWWRESGSGRTPINPSPVLSGDIVSHDVISRDVMEDVLLSAE
FT                   GYAVSVQPNRPQRVMPGESMTANVSLTAENPEAYGSRLGYIAFRQSASFDTGYVGWRES
FT                   LHVPVVVANVHDGPASDPGNELYFDMMIFNRTLSGDTVVGMGDIEKRIQFRWGVDREMT
FT                   QDLGALYMMRHSLNSGLPSYHLETRITNRTGTRYRLQRYDMIGGPRDNTGSGDVGGGSW
FT                   DMTARYTFRDIRPDHWKYDLTPDLYGSLPDHFQLDAHSQIAPGLVTVYKNRVGTGYNTL
FT                   NTSYGTSESFRLYPFSEARHHDLRLSYRRVGGMALTGGASEATGRWRVQGFRWDQFADV
FT                   VQNDEQTTYELEKLMGKPASLGSSAVGASDAYVRSSALNAFEIKTDVPAGLVSMDVSMD
FT                   VVVSKDVSGDVVQMVSRDVPATIAVQPMRVRLRIPRREQILVGRWEQLSEAADGKALLK
FT                   QFMRFGTVWLRSGRADERDTNLFTAISQRGVDPAECVSAFLYNDELYLDFILLLADAKS
FT                   PREGYTAYLRTFRDDGIPYILIGDGAADGVWNLGLYVDAAGANPESGRSSDDVNPRPQE
FT                   KEKEEGGGCNAASGLGLILSAFVGALFLERRIR"
FT   CDS             complement(731484..731924)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06480"
FT                   /product="conserved hypothetical protein TIGR00250"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28017"
FT                   /db_xref="GOA:D4M822"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D4M822"
FT                   /protein_id="CBL28017.1"
FT                   /translation="MTEAQPGRVLALDVGSARVGAAISDPMRLIAQGLAVWPVVDRDGG
FT                   WRRKFEACLVQYAPTLVLVGMPTRTDGTRGPEAERVAKLVDLLRAGHPDLAFDTWDERF
FT                   TTVMAHRAMIEGGVSRSGRRQRVDKIAAVLILESWLARQGAP"
FT   CDS             complement(731921..734560)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06490"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28018"
FT                   /db_xref="GOA:D4M823"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:D4M823"
FT                   /protein_id="CBL28018.1"
FT                   /translation="MQHRTGRELREMFLKFWEEKGSHRCPSFSLIPDDPSLLFTIAGMV
FT                   PLKPYYLGIRQPPYPRIVTSQKCVRTNDIENVGRTARHHTFFEMLGNFSWGSYFKKEAI
FT                   TWAWEFLTDRIGLDPNRLYATIYQDDEESREVWHRQAGLPEDRILRFGQDNNYWFMGDT
FT                   GPCGPCSEIYYDRGPDYGCGKPSCGVGCDCDRYLEIWNLVFTQFDRQKDGSLPNLPHKN
FT                   IDTGMGLERLASVVQGVDTDYETDLFTPLIRHTCARAGIQYGQGGRNDMAVRVIADHVR
FT                   SVAFMLADGVLPANDGPGYVLRRLLRRAVRFGRLLGFEGAFLCEYMPILIDLMGDPYRE
FT                   LIDQRPTIEQIITVEEERFQRTLQQGTDLFEAETARLAAAGRREVPGEVVFTLYDTYGF
FT                   PPELTREMADEQGFAVDEAGFKAAMQQQRDRARASSKQKKSALAGDVYTELENEGGATR
FT                   FTGYASAMGAGKVTAILTKEGRRDHVEGNGEFELVLDETPFYAERGGEVGDTGTIRDGE
FT                   TTLEVLNTVPHGGVIVHRVRMTEGSVRVGDSMTAEADDARRQAIRRNHTGTHLLHEALG
FT                   RVLGRHVRQAGSLVTDRFLRFDFTHHTPLTDGQIEEVERIVNGEILRNVPVSTAEHTLE
FT                   EARELGAKALFDEKYGDVVRVVTVPDFSMELCGGLHVRATGDIGSFKVLREESIGSGTR
FT                   RILAMTGMEVVELMQVLFGLRRRLMGILSADEEGLEAKAKDLAEELRALQKRAQERARH
FT                   ELTDNVDRFVERRRVGGAVLHIGRFPDVKSDVLRDVGDRVKAGPDPSVALLASVDENGA
FT                   CTLIVMADDRAVKLGANAGAIVREASAVLGGKGGGRPSTAQGGGRDGEKLDEALERAAE
FT                   VLKGQLGA"
FT   CDS             734905..735627
FT                   /transl_table=11
FT                   /locus_tag="SY1_06500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28019"
FT                   /db_xref="UniProtKB/TrEMBL:D4M824"
FT                   /protein_id="CBL28019.1"
FT                   /translation="MLTKAKCPACGGALELNPGLERGICVYCGSEFLVREAIQKFKAEV
FT                   DGLPTLQNMLIRAEQKLFDGDQEGAEALYEKILEGAPTCHEAWWGMFKVKFLRNDFTFY
FT                   EGTIGRTRAMIENLGSSREALRAIEYAPDDVKVFYSGEIERIKRKWEADLAPHEAREAA
FT                   LARRRAEQRKEDEEKEKEKENTMKGIGRIMVVGIVLSLLVVASTDSSVGTGIDSPACWG
FT                   AFSFWGCLLGWGLTVMMR"
FT   CDS             735870..736769
FT                   /transl_table=11
FT                   /locus_tag="SY1_06510"
FT                   /product="conserved hypothetical protein TIGR00268"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28020"
FT                   /db_xref="GOA:D4M825"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4M825"
FT                   /protein_id="CBL28020.1"
FT                   /translation="MEGADLESEVEERLRGVRRLLEAMGDVAVMLSGGVDSALLAALAH
FT                   EALGRHAVAVTIESPLLSADERADAGRLAAQVGIRHKVLPMDELEDAGFVANPRDRCHL
FT                   CKRMRLEAVVRWAAERGIPWVLDGANADDRGDYRPGMKALMEFGSVRSPLLEAGMTKAE
FT                   VRAAARAMGLFTWNKPARACLASRIPYGEPVTAEALRRVEAAERFLAGILPPAAQFRVR
FT                   AHGDLARVEAECRDLPRVLARREAVAEGLRAVGFRYVTLDLVGYRVGSLNEALDQGAAK
FT                   DVQAPAGTAGAVGTKGVF"
FT   CDS             738397..739188
FT                   /transl_table=11
FT                   /locus_tag="SY1_06530"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28021"
FT                   /db_xref="GOA:D4M826"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:D4M826"
FT                   /protein_id="CBL28021.1"
FT                   /translation="MNAFLEFIKDLLTLRTTWIDKGQGRWVARRRMHPLMRLIVFCGAA
FT                   AAVTVLGVELLRSGPVPAPEAEVPLSGPLDSPDVPALLADEALDAASSEPGAVLPEVEE
FT                   PEDETPQMTEPTPTPSALRPPRDAGKYWILINKGQYRLSLYRGRDLVKTYNVAIGKNPG
FT                   NKRRVGDNRTPEGQFRVLSIENASGWKHDFGDGKGEIAGAYGPWFIRLDTGGWKGIGIH
FT                   GTHAPDSLGTMASEGCIRMNNDEIRDLKNYAYRNMIVRIEK"
FT   CDS             739185..740117
FT                   /transl_table=11
FT                   /locus_tag="SY1_06540"
FT                   /product="Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28022"
FT                   /db_xref="GOA:D4M827"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4M827"
FT                   /protein_id="CBL28022.1"
FT                   /translation="MTAAAGSPHDFGEGLFLIDLPQRMPGFRRFIASWFFVDALGRRVV
FT                   VDPGPANTIPLLNGALERLTEDVDLVLLTHIHLDHAGGVGAFCRRWPRAAVLAHPRAFS
FT                   HLRRPERLWSASVRTLGNVALAYGEPEPLTAPLLSEDPDGLIEVFPTPGHAPHHVALRT
FT                   RPREGGPLLFIGEAAGLTLPSLDGALWLRPTTPPRFDAAAALSSLDHAAVALRGDERLC
FT                   YAHWGLSEDPAGRLSLAREQTERWLELIGTMLDRRPEEVVECLLRRDPLLQARLDEDLM
FT                   VRERHFMANSVQGFMGFLNEAGRGPAPRP"
FT   CDS             complement(740201..741214)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06550"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28023"
FT                   /db_xref="GOA:D4M828"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M828"
FT                   /protein_id="CBL28023.1"
FT                   /translation="MEKLIEIKDLAIHYETDDGVVKALNSVSLSLVKGRTLGVVGETGA
FT                   GKTTLGKGVLRLIPSPPGRIVSGSVLFEGQDLLKLSEAEMRKIRGRSISMIFQDPMTSL
FT                   NPVMTVGDQIMEVIQAHKNLRRQEAWQEACRILEMVGIPGQRGREYPHQFSGGMRQRVG
FT                   IAIALACAPTLLIADEPTTALDVTIQAQVLEMIRDLKKALGTSVILITHDLGVVAHNCD
FT                   YVAIIYAGTLMEYGALREIFKSPQHPYTIGLFGSIPSLERKADRLRPIPGLMPDPTNLP
FT                   PGCPFSERCPHSAEVCSREVASRNPPERSACVRPVVWLNPSAALGGTSPFRGGNPH"
FT   CDS             complement(741225..742127)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06560"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28024"
FT                   /db_xref="GOA:D4M829"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D4M829"
FT                   /protein_id="CBL28024.1"
FT                   /translation="MNDRISQDNEQREQRSLWEEAWRRFRKNRLAILSLVFLLLLAAVA
FT                   AATILWDFADGRAFYNAHVIKQNLRLRLKGPSAEHIFGLDEFGRDMFLRMLWGIRYSLF
FT                   MGMAGIAFSTLLGGLIGAVAGYYKRLDNVLMRAMDVLLAIPSMLLATAIVAALGPGLVN
FT                   VLIAISIAYVPTFARTLRASVLTVKEQEFIEAARSVGADNGRIIMRYIVPNSLAPLIVQ
FT                   STLGVAGAILSIAGLSFLGLGIQPPTPEWGSMLSNARTYIRDAWHITMIPGAGIMLTIL
FT                   ALNLVGDGLRDALDPKLKS"
FT   CDS             complement(742137..742412)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06570"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28025"
FT                   /db_xref="GOA:D4M830"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4M830"
FT                   /protein_id="CBL28025.1"
FT                   /translation="MRHMMRNALIPIVTAVGLQFGHLLGGAMLTETIFSWPGLGRLMVD
FT                   SIKSKDMPLVLGSVIFLAVMFSVVNLVVDIIYAFVDPRIKSQYQKA"
FT   CDS             743778..745658
FT                   /transl_table=11
FT                   /locus_tag="SY1_06600"
FT                   /product="KWG Leptospira."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28026"
FT                   /db_xref="UniProtKB/TrEMBL:D4M831"
FT                   /protein_id="CBL28026.1"
FT                   /translation="MRRTRRLHAAFALLAALLTFCGEAGAARIDWFLQPVWDRASRFSE
FT                   GLAAVCSGGRWGFIDPAGRWAVEPRYEDAQPFRGGLAAVLLDGRWGFLDLKGRLAVKPA
FT                   FAAASSFSEGLAAVRAGDKWGYVDRRGTMAIAASFDLAGDFYQGRAAVTSGGRCFFLDP
FT                   KGVRVGSLDFDAAWPFVEDRAAVVVDGRMGFIDREGRMAVPPRYDPPVGGRVFSSGLAG
FT                   VEIQGLWGYIDLNGSWFVEPFCEGVGDFSDGLGPVRRGGRWGFVSLSGELAIPYAFEDV
FT                   MPFSEGVASAAVGGRWGYIDRLGSWMADPVFLEAWPFSEGLAPVRSALNGRWGYVGRNV
FT                   APLFGGRAFDGAEPFSEGFALVALAGRRFFIDEEGRDAFDAAFADARSFSDGLAAVVAG
FT                   GWWGYIDRQGRTAIPPQFEAAGAFHDGLAPVRAKGKWGYIDRRGRWVVKAAYDAAWPFS
FT                   EGLAAVRKGRSLGYIDAAGRTTIPFKLTPPGDGAEAGPFSEGLAAVLSGGRTAFMDRGG
FT                   RVVIKGAFKAWRGAAPRFRSGIAAVEDGNGREFFINREGDDVGARGFAAAEKGAATLVR
FT                   PYRAPSGLFGYRRSDGVILVPPFLERAGEFQDGRAPVSLGGRWWYIPQPR"
FT   CDS             complement(745999..747339)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06610"
FT                   /product="Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28027"
FT                   /db_xref="GOA:D4M832"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D4M832"
FT                   /protein_id="CBL28027.1"
FT                   /translation="MKVVVLGCTHAGTAAVLNTVALHKDAQVTVYERNDNISFLSCGIA
FT                   LHVQGLVKDPAGLFYCSPEKLAELGVTTRMEHEVTEVDLAGKKLKVRDLRSGREFEDTY
FT                   DKLIVTAGSWPVEPPIENAKLENVMLCKNYTHAMEIVKRCASARKVAIIGAGYIGTELV
FT                   EAFETQGKSVTFIDQMSQVLPRYLDPDVIDVIEKLYVEKGVTLAFGRTVKKFVDDGHGK
FT                   VAKVVTTDGEFDADLAILCVGFRPLTALFKGKLEMLPNGAIRVDEYMRTSHPDIFAAGD
FT                   CCAVYNNASRQYGYIPLATNAVRMGTLAARNLKAPTTRHRGTQGTSGIKIYEWNIASTG
FT                   LTELVARELGIDYAVSVLKDNYRPEFMPTTEPFYLKLVYDRKTMRILGAQVRSKEDLTQ
FT                   SINTLSVCIQNEMTVEDLAFTDFFFQPHYNKPWNYLNSVALQALPPV"
FT   CDS             747872..748870
FT                   /transl_table=11
FT                   /locus_tag="SY1_06620"
FT                   /product="conserved hypothetical protein (putative
FT                   transposase or invertase)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28028"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D4M833"
FT                   /protein_id="CBL28028.1"
FT                   /translation="MEDAERERNGELIGPALGPVTAGQIEADLERGKIYRLNDRFFKFL
FT                   FGREERKPLFLDLVNALVFPDGSAGFTDFEYANRELSAARVEGKDCYLDIVANMADGTQ
FT                   VEVEVQVRNWNDYLQRSAYYLSTLHASQMGLGGSYLDLKRTVSIHILAFSLFSGERFRR
FT                   EFCLCDVESGEKLSDDLKLIYLEVPKYASYGTPRNRLEYWLMYLAGMEAKKMPEAMVKD
FT                   PMIGEALNLEKLFLQSREERQRYIVSYKAMRDAMTRDETIRRVARAEGEARGEARGEAR
FT                   GLAKGLNEGEAKGIAATARRMLARGVSSEQVADFTGLSPDEVEALRVGIGN"
FT   gap             748994..749512
FT                   /estimated_length=519
FT   CDS             complement(751143..751736)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06640"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28029"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:D4M834"
FT                   /protein_id="CBL28029.1"
FT                   /translation="MTDREEALPAGRRLLLHICCAPDATVPARDLTAEGWQVTGFFYGS
FT                   NIHPREEYVRRLTTLHRLMAHEGLPLEEGPYAPEDWIVHMERSGLMEEPEGGRRCTECF
FT                   LMQLASAAEAAVRLGCTHLCTSLTTSPHKDVERIARLGTACAASRGLTWEPRVWRKRNG
FT                   FLRSLEISRELGLYRQNYCGCVASLQGLPVECAL"
FT   CDS             complement(753199..753672)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06660"
FT                   /product="Transketolase, N-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28030"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="UniProtKB/TrEMBL:D4M835"
FT                   /protein_id="CBL28030.1"
FT                   /translation="MSLPKLNGFPVPSLSEEDRAALEAAARRARVSALTMVTAASSGHP
FT                   GGAFSGIEMFLTVYGTANLTPENCNALDRDYVVVSHGHTSAGVYAALAEWGFFDAGEAM
FT                   AHFRQCGSVFQGHVEREVPAWTGGRATWGRGSPPAWASPWRSAPAGTRGASTC"
FT   tRNA            complement(753828..753905)
FT                   /locus_tag="SY1_T_24870"
FT   CDS             complement(757088..757612)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06700"
FT                   /product="O-6-methylguanine DNA methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28031"
FT                   /db_xref="GOA:D4M836"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniProtKB/TrEMBL:D4M836"
FT                   /protein_id="CBL28031.1"
FT                   /translation="MLYRMEYESPLGTLTAMSDGESLVGLFMDPVEARPGDAADEGLPV
FT                   LAALRGWLDAYFDGRRPTPADLPLAPAGTEFQRAVWRILLDVPYGRTTTYGAIAAILAE
FT                   RNERGRMAPRAVGGAVGHNPISIVIPCHRVVGVGGNLVGYGGGMDRKVRLLTLEGVDMS
FT                   RFFVPGEGRRV"
FT   CDS             complement(757763..758629)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28032"
FT                   /db_xref="UniProtKB/TrEMBL:D4M837"
FT                   /protein_id="CBL28032.1"
FT                   /translation="MRGRPLVLAAALFLLSLPARAALADELPIAVTQPWIALIVSFLGG
FT                   PNVAVKPLLIWNDAGDSIRAEGGRALRNLPTDARIVALDSADLTGAGLKVGAYGNLRTL
FT                   YNPFPIPPERWDASLPDPSVMPFVAQRVLTVLADWDPQNYLYYQRRLAEFQARLSSSVL
FT                   AGRQVLRDVRVCDLSGASSALLRAAGCRMERPDLHLLDSWSRASPKQLQEFLEERIAQG
FT                   VVLVMDGGTPRNLRSFLGGRTEVFSFARPPLNQDYPAFLNEQYISLWQKITAKPPAGRR
FT                   PDAPRSR"
FT   CDS             complement(758626..759381)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06720"
FT                   /product="ribonuclease III, bacterial"
FT                   /EC_number="3.1.26.3"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28033"
FT                   /db_xref="GOA:D4M838"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:D4M838"
FT                   /protein_id="CBL28033.1"
FT                   /translation="MPGSALLRDILDAALSEQERARIEGRDLAALQAALGYSFRDEGLL
FT                   EEALCHASFANEHGLAVSNERLEFLGDSVLGFVVARALYRLYPEAREGDLTQKRAELVC
FT                   GRSLRDRARELNLPPLILHGHSVRDEALPTSMCEDAVEALLGAVCLDGGVQAAEGVIGR
FT                   LFLQEAEVRAETDVSPKSRLQTWLQARRIPLPTYELVSVTGPSHAPSFRVRLRVNGVEH
FT                   TACGSTRKGAESDAAERVLEDLMSLEVGE"
FT   CDS             complement(759381..760625)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06730"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.179"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28034"
FT                   /db_xref="GOA:D4M839"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniProtKB/TrEMBL:D4M839"
FT                   /protein_id="CBL28034.1"
FT                   /translation="MSATRRVVVTGLGPVSPIALGKDAYWKALREGKNGIGPITTFDLG
FT                   DCPVTFGAEIKDFDPTLWMPGKEAKRSDRVIQFAVAAARMAVEDAKLDTSAMDPYRLGV
FT                   YIGTGQGGIETSFNNFNTMLTKGSRRVSPYFIPMMISNMSTAYVAIVLGAKGPNLCVVT
FT                   ACATSLHSMGEAYHTIVRDDADVIVAGGTEAALRTISIAGFAAMKALSTRMDSPETASR
FT                   PFDRDRDGFVMGEGAGVVVLEELEHAKARGAHIYGELVGYGTSCDAGHITAPDPEAEGA
FT                   AYATRHAMKMAGWRPEQVDYVNAHGTSTGLNDKMESFMIHKVFGERAKDVTVTSTKSMI
FT                   GHCLGAAGGLEVIASLQAIEENYIHPTLNYTTPDPECDITLSTGRGVERKVDRLLVNSF
FT                   GFGGHNGVLAFQRCE"
FT   CDS             complement(760780..761031)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06740"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28035"
FT                   /db_xref="GOA:D4M840"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D4M840"
FT                   /protein_id="CBL28035.1"
FT                   /translation="MKKEEVLARLKEIITDRLDVEEDQIVPEATFVEDLGADSLDIVEL
FT                   IMGIEEEFDIEIPDEDAEKLTSVGEAMNYTLGKIGVEE"
FT   CDS             complement(761070..761810)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06750"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28036"
FT                   /db_xref="GOA:D4M841"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4M841"
FT                   /protein_id="CBL28036.1"
FT                   /translation="MARRVALVTGGGRGIGRAIVLELARNGCDVAVNYAKSADAADETA
FT                   RAASALGVRAETFGADVSDRAQAEALFKAVREAMGPVEVLVNNAGITRDGLLVRMKPDD
FT                   WDAVIAANLSSVFYCTKEAVRDMARARWGRIINLASVVGLIGNAGQANYSASKAGLIGF
FT                   TKSVAREYAVRGITVNAIAPGFIDTSMTAVLKEDVKAAITTQIPMGAIGTPDDVARAAA
FT                   FFASEGSSYITGQVLAVDGGMTMC"
FT   CDS             complement(761810..762757)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06760"
FT                   /product="[Acyl-carrier-protein] S-malonyltransferase"
FT                   /function="[Acyl-carrier-protein] S-malonyltransferase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28037"
FT                   /db_xref="GOA:D4M842"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:D4M842"
FT                   /protein_id="CBL28037.1"
FT                   /translation="MKYALCFPGQGAQQVGMGQELYRAFPSAKAVFDEADDALSAHLTK
FT                   LIFEGPEGELTLTANAQPAIMTVSVAALSVLEKEMGVALKPACGAGHSLGEYTALVAAG
FT                   VLSFSDAVRLVNKRGRWMQEAAPEGVGAMAAILGLGSDEVKALCAEAAPGGECQAANFN
FT                   SPGQVVISGVKEFVEKAAAAAKAKGARKTVMLNVSAPFHSRLMLPAAEKLKEEFERCSW
FT                   AEPKWPIVANVSASAVVSAEEIRDALYEQTFSPVLWESSVLYMVDYGVDTFLELGPGEV
FT                   LCGLIKRCRKGLKQMAAGEPEALEAMATALREGA"
FT   CDS             complement(762837..763790)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06770"
FT                   /product="Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /EC_number="1.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28038"
FT                   /db_xref="GOA:D4M843"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4M843"
FT                   /protein_id="CBL28038.1"
FT                   /translation="MIRNNRVCELLGTEYPLIQGGMAWVANASLAAAVSNAGGVGLIAA
FT                   GASPAEVLEQEILKARSLTDKPFGLNIMLMSPTAPDALELAAKHRLRIVATGAGSPGKV
FT                   LERLKPLGTIVIPVIASVAQAKRAEKQGADAVVAEGTEAGGHIGELTTMVLTPQIASAV
FT                   KIPVIAAGGIADGRGVAAAFALGAEGVQLGTRFICCSECTVHPNYKQAVIDARDRSTAV
FT                   TGQSLGHPVRCLRNRLTAEFERLEAEGAPAEEIEKLGMGKLRAAVVDGDTEWGSLMSGQ
FT                   SAAMVNDVLPAREIVRGLFDEARRVLHGIRDAAGAE"
FT   CDS             complement(763801..764853)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06780"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28039"
FT                   /db_xref="GOA:D4M844"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D4M844"
FT                   /protein_id="CBL28039.1"
FT                   /translation="MKKMTIAVDAMGGDNAPQAICEGAAQACAAFEDLEVVLTGDRERL
FT                   LPLVEASPAAVRSRISIRHADEVIGMDEHPSAAIRRKRNSSLRVAMEMVRSGEAQSCVS
FT                   AGNTGAIVAGGVLVVGRLPGIDRPALGAPLPTIERWTFLLDVGATVRCKPVNLYQFALM
FT                   GSVYAERIMKVEAPEVRLLSNGTEEIKGDESVSGARELLSKSRLNFMGYTEGDDIAWGR
FT                   SDVVVCDGFMGNVVLKFGEGLMYGAKSIISQEMGRRILPKVGMLFMIPMVKSLWSRFNY
FT                   EKYGGTPLLGVKGVVIKAHGRSRAPAIKGAISAARRFIEEDGVGQIRAELDTGAGPQGE
FT                   SRGAQGQAEY"
FT   CDS             766569..767135
FT                   /transl_table=11
FT                   /locus_tag="SY1_06800"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28040"
FT                   /db_xref="GOA:D4M845"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:D4M845"
FT                   /protein_id="CBL28040.1"
FT                   /translation="MDFLKLARERYSVRKFTSEAVESEKLDAVLEAGRLAPTACNNQPQ
FT                   RILVLDTAEALDKLKDCTPCHFSAPLALIVCYDDTVSWKRPYDDKDMGEVDASIVTTHM
FT                   MLEAAALGLGTTWVGHFDPQKVRSAFALPENVIPVAILPMGYPHETSVPKAWRAPSAFG
FT                   DDAPRHLLNSPLLHGGVLHSQRPPP"
FT   CDS             complement(767164..768333)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28041"
FT                   /db_xref="UniProtKB/TrEMBL:D4M846"
FT                   /protein_id="CBL28041.1"
FT                   /translation="MDDKGEIVSSHDVDDNLSLQIWTKGHTPRLVIFNKAKNSKKLIRL
FT                   GWVEKRDRKLAVSGKKRGESVNYTIQDFEPTLQRILTEYAVYANFRIKLWRFAVELEKI
FT                   VNAPEIVTDSGEMNLLTEDKRSSFWIADCTGPDRKAGFFRPFFPVSGAEADAVAGDRLR
FT                   IAEGNRGVEALLKTGVLRDLAKANPKRWHNPVRVVAAAMLLGFSYCEEDGSDFSDELWG
FT                   AGAEGGGEDAAAAALTGTVKFTLRDPRLLGLGRKLVAFVRHFDAVPQVEVSNSVDSDKE
FT                   LQEQGFGRTRRLEFGAGTIGDVPYKVTFFEHEDGRIALGCKPEAATQRHKGELVLTLPG
FT                   DVYRTALKQDTMGGPEDDFYTTTQLAWACQFKEWLDNITPYISNFAGLM"
FT   CDS             complement(768567..768776)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28042"
FT                   /db_xref="UniProtKB/TrEMBL:D4M847"
FT                   /protein_id="CBL28042.1"
FT                   /translation="MEQVGQVRVESIFKVGVPAAEAGTAARTAARTAINSAFIIDTSFR
FT                   SFGPAAVGFCAPGREVRFVKAILQ"
FT   CDS             769005..769721
FT                   /transl_table=11
FT                   /locus_tag="SY1_06840"
FT                   /product="Thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28043"
FT                   /db_xref="GOA:D4M848"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:D4M848"
FT                   /protein_id="CBL28043.1"
FT                   /translation="MLDAIFSAMLSSGALQWLGAFLWGMASVILSPCGIAAIPLVVGYI
FT                   ANAEEPGRWEAFRISCVFCVGIVLNLLLVALITSGVGVLLGGHERLLTFVTAAVFILMG
FT                   LHLIGIVHIRLFSFNGGADKAGGTDRRGLRGALTLGVVSGLAIGPCSIGYISPLLSVAL
FT                   SQASTKPVAAAGLIVAYALGYSAVLVLSGTFAQLASRWLQSERGTVILRALNVTCGLAL
FT                   IAAGLYLSREMLLLIS"
FT   CDS             complement(769802..771337)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06850"
FT                   /product="Lysyl-tRNA synthetase (class II)"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28044"
FT                   /db_xref="GOA:D4M849"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/TrEMBL:D4M849"
FT                   /protein_id="CBL28044.1"
FT                   /translation="MENAVKGPGQGGLEQEGADNEVVRQMKEKLLRLRREEGFDPYVAE
FT                   TWDCRDHLADVRCRFEHLAPEESDETVTLSTAGRLMTLRRQGRTTFADLADETGRIQLY
FT                   FQVNALGEKPYEFLKKWVDTGDWLGVVGHPCRTKRGELTIQVTDYKLLSKSIRPLPEKW
FT                   HGLTDTETRYRRRYMDLIANPEVREVFRKRSKIISSFRETLEAHGSLEVETPILSVLAG
FT                   GANARPFKTFHNALGLDMYLRIAVELYLKRLVVGMMGRVYEIGRNFRNEGIDTMHNPEF
FT                   TMMEVYWPYANYEDMMNLAEELIRNAAKAIGTLEIEWNGVKADLSRPFRRITMLDAVKE
FT                   YAGVDLSAVTDDEAARKIAREKGLGGDLKGTESRFAVLNLLYEAFCEEKMVQPTFVMGH
FT                   PTEISPLSKRDPENPDYTHRFELFMFGKEVANAFSELNDPLDQRARFEDQMRKKEAGDD
FT                   EAHAFDEDFINAIEVGLPPTGGMGIGMDRLVMFLTGARSIRDVILFPAMKPNE"
FT   CDS             complement(771551..772657)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06860"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /EC_number="3.4.13.9"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28045"
FT                   /db_xref="GOA:D4M850"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="UniProtKB/TrEMBL:D4M850"
FT                   /protein_id="CBL28045.1"
FT                   /translation="MAFEAVNKRLVRFRALLKEKGLDAFVLLVLERHNTENCHYLSGFR
FT                   GSSAALVVDRENALLVTDGRYRIQAAAETPFEVVIQSELPLPAWLAKAVKDARWRRVGF
FT                   EAEKVSHRIFSLSLEPVGIEWVDASELIPSLRRAKDAEEVEAIRRAALIGRQAYGNVLR
FT                   TVRPGMTEAEFEGALLLEIKRLGAEKGWAHDDFIVASGARGAICHAHATSRAFEAGDVV
FT                   TVDYGAMVGGYMSDITRNFAVGRPDDKALEVNDVLLRAHRAAAAALRPGLAGREADAIA
FT                   RRIIAEAGYGRNFVHSLGHGLGLEVHEAPRLSATSRDVLQAGDVVTVEPGIYIEGWGGL
FT                   RIEDDYLITQDGAECLTATDNQSLEVVA"
FT   CDS             complement(772935..773228)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28046"
FT                   /db_xref="UniProtKB/TrEMBL:D4M851"
FT                   /protein_id="CBL28046.1"
FT                   /translation="MLELHVSGEAVKMAFPLHSSLEGYSSSRGVFAPPSSTVIPWRLSG
FT                   FRSRAVCLNLNRMSPLRWLSDSKAASSLLLSVRTGMSTDLGQVAGSRVLKLV"
FT   CDS             774073..775185
FT                   /transl_table=11
FT                   /locus_tag="SY1_06900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28047"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M852"
FT                   /protein_id="CBL28047.1"
FT                   /translation="MAAHPQRFFAANQFIDSDGHLLKPDDDQANRHNIELALMAATATC
FT                   GFTILGGTNGGGKTHMAISFAKKITGLDAEVSADLLPVRSDWRNVGDLLNRQQTLGANG
FT                   TFSGTAFYDALSACEITPQKRAFIILEAMDLARSEDYLTEVLSAMDMRNLALIPCPDGN
FT                   FYRMPKFLFIIGTANADATTFPFSPRVLDRAFYIRFRVNDVMFTDDQSDDTALQSAKAA
FT                   ATFLAIIDGEMEEKLKAFRKKIRTDFQIEELLSAVNTIPGNHTVSLGYRTRDAIYNFMA
FT                   NFMCLSGQDAYNVDAAMRAFDWAVTTKILPKFQGSRDDLQAPLIALERELQSRGLLPYG
FT                   PSGMWPWRTKDELTFLRYQMEKNAASAIYR"
FT   CDS             complement(775285..776172)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06910"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28048"
FT                   /db_xref="GOA:D4M853"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:D4M853"
FT                   /protein_id="CBL28048.1"
FT                   /translation="MTVNKDKYTIGQMAKLCNVSTKQLRFYDERGLVTPAYRDEINGYR
FT                   YYERRQIEEILLLSELKQYNFSLEKIGRLLRNRELNPLQKELEQQLYELRRERKDIMAK
FT                   YDSIIDRILNILHSSVYLIANQKTFAQDIISVQTFPETVVAYTRYVSYWHVDQLFTSRR
FT                   AELFKFLSEHRLEEMGANMAFFYNGYKKQFSENPDDREGDLEVCIRIKNPDLSLPCVRV
FT                   VEEFQAVSCIYVGPYRDMLPAYLDLESYARQHQIPLSGESLEEYLIGASMTANPNDYVT
FT                   RLYLPFAREKRVRP"
FT   CDS             complement(776254..777375)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06920"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28049"
FT                   /db_xref="GOA:D4M854"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR011386"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="UniProtKB/TrEMBL:D4M854"
FT                   /protein_id="CBL28049.1"
FT                   /translation="MKRLGLIVNPIAGIGGKVGLKGSDGVDTLQRALLLGGEFESGKKA
FT                   SVALTQLGTLNKGFELYTCSGAMGAEACQRVGLPCTVVGEPCVTHTGPEDTMRAARALQ
FT                   RLDLDLLLFAGGDGTARDILKAVGQEVTVLGIPTGCKIHSGVYALTPQAAGLLARQCVQ
FT                   GRIHRAKEAEVMDIDEDLFRHGVVQARLYGYLKIPDDEALVQRTKIGGSGSSSVEALAR
FT                   FVAGQWQNDTLYIVGTGSTTAAVMRELGLPNTLLGVDLVYDKRVVALDCTEKRILEAVQ
FT                   EYDRVKIIVTIIGGQGCLFGRGNQQISAEVLRRVGRNNIIVAAGRDKVLSLKGRPLYVD
FT                   TGDEEVDRSLAGYMKVVIGCEEFTVLKVAGVAL"
FT   CDS             complement(777461..778660)
FT                   /transl_table=11
FT                   /locus_tag="SY1_06930"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28050"
FT                   /db_xref="InterPro:IPR008537"
FT                   /db_xref="UniProtKB/TrEMBL:D4M855"
FT                   /protein_id="CBL28050.1"
FT                   /translation="MTSFIGADQTWVLFAILTAIAALSIQLEHNYRWASRVTGCVLALI
FT                   GAMILSNLNVIPLDAPAYDFVWSYVVPLSIPLLLFNANIRRIWKDSGRLLVIYLISGIG
FT                   TILGAFIGYFLLKDLVKDLGIAVTMMIGTYTGGSVNLVAMADAYKAPADLVSSSVVADN
FT                   LLMALYFFALIAASGSKFFLKNYKHPLIDAVAARSDGDRGAASYWVAKPVALKDIASSV
FT                   ALSFVIVALSTVIADCFSAAIAKDSFAKALINGLLGNKYLVMTTVTVLIATAFPGFVGG
FT                   IAGAQEIGTFLIHIFFTVIGVPASIRLIVTQAPLLLLFCTIIVATNMIVSFSVGKLFGF
FT                   TLEEIVIASNANVGGPTTSAAMAISKGWTELVVPAILVGTLGYVLGNYYGVFAGTCLGL
FT                   "
FT   gap             780076..780731
FT                   /estimated_length=656
FT   gap             782664..782884
FT                   /estimated_length=221
FT   CDS             784753..784908
FT                   /transl_table=11
FT                   /locus_tag="SY1_06980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28051"
FT                   /db_xref="UniProtKB/TrEMBL:D4M856"
FT                   /protein_id="CBL28051.1"
FT                   /translation="MAEMIFCIWAGVWLIATGVMYRIAVKREYDTYGVKGWNSPGTGLN
FT                   SPTEDG"
FT   CDS             785222..786811
FT                   /transl_table=11
FT                   /locus_tag="SY1_06990"
FT                   /product="Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_06990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28052"
FT                   /db_xref="GOA:D4M857"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="UniProtKB/TrEMBL:D4M857"
FT                   /protein_id="CBL28052.1"
FT                   /translation="MHSIFITGIAVAMVLYITVGVIVGRKVKDINDYYVAGRNAPVLLI
FT                   VGSLVASFLSTGAFLGDTGEAASGGFIAICIVGLIQACGYIYGANFFGRYIRRSKTLTL
FT                   PEFYGRRFHSKRMRKLAGITCIIAVSAYMLSATRGITSLMMNITGLPEWASILIAWLSF
FT                   TIFTIVSGSPGVLVTDTMMFLVFLSAAIITVPSIVMAAGGWYTAIGNLANFQAIPGIIS
FT                   AAGNPDFVAQTGETTLWAITYGIVWMLVVMVSPWQTSRYMMAKNEHTVLRSAIWASMGV
FT                   ITTTIFLYFAAVFVASVKPGLGSDTMIWGAMNLVPTTIGVILLTGILSAGISSASNFLA
FT                   LVGFSFINDILTLDDKPEKEKLKISRIGMFLVSLVVLAMAFFANRIFWIMYFGGTVIAG
FT                   SWGLVSFAAIWSKRLSEKGAFLSMLLGFIGCFGVRLATSVWGVTVPFFLDSFFVGIYLS
FT                   IIGMVVGNALAKPTPEEIAERERLFIVPESEKDVVEMRKTMGAYKFHIAFSIFMFALFT
FT                   FGYLVPYLQAVK"
FT   CDS             787126..788379
FT                   /transl_table=11
FT                   /locus_tag="SY1_07010"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28053"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="UniProtKB/TrEMBL:D4M858"
FT                   /protein_id="CBL28053.1"
FT                   /translation="MAYFQEIVFSSCRSMMFIIFCITFIGYLLGDIKVKGVELGTAGVF
FT                   LSALFFGHFAYSDASLLRQMGIITVSSGFMQHSMSLIQEMGLLCFVTSVGFIAGPNFFH
FT                   NLKKNVKSYAFLGLIIIGSGALTCAAVILLTSVDSAMGVGILSGALTTTPGFAAAQDIV
FT                   RSNEFLLNEVTVGHAIGYPFGVVGVVLFVQIVPKLVKANILEEQKKINAASGQPLEFTP
FT                   DRRQEGNAQKNLLDIDPIGLGPLSLAVVLGILLGKVRLPLPLGTHFSLGNTGGALIVGL
FT                   ILGHFGRIGRINMRISAGFLKAFREFGLVMFLIGAGVPGGSGFVDIVREYGLILFLYGA
FT                   LMTTVPLLVGYFIAKHVVKLCLLNNLGAITGGMTSTPALGALINVAKTDDVAASYAATY
FT                   PVALVLVVLASQFLMTFL"
FT   CDS             complement(788698..789258)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07020"
FT                   /product="Amidases related to nicotinamidase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28054"
FT                   /db_xref="GOA:D4M859"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:D4M859"
FT                   /protein_id="CBL28054.1"
FT                   /translation="MSKETLLVVDCQYDFIDGSLACCGAEDAVKNAVDYINAHPAVRVL
FT                   YSADWHGKGHCSFKENGGQWPEHCVAGERGSAIHEAFTRDVARAGQRPGEENVYHKGTD
FT                   DGREEYSAFEARNAAGRTVGQDAGECVVVCGIASEFCVRESALDLLRTGRRVTLLVDAV
FT                   GYVNAEKHRENLADLEAQGATIA"
FT   CDS             complement(793727..794269)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07050"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /function="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28055"
FT                   /db_xref="GOA:D4M860"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="UniProtKB/TrEMBL:D4M860"
FT                   /protein_id="CBL28055.1"
FT                   /translation="MAKEYRLGEVLLSRERIAERVAELAREIASDNGGRRELLVVGILT
FT                   GAVFFLTDLVREMPDDLDVHIDFMSVSSYADATKSSGVVRILHDLKNSVEGIDVLIVED
FT                   IVDTGLTLSYLQDLLRARRPASLRTCVLLDKSARRETAVKVDYCGFEIPDAFVVGYGLD
FT                   CAGRWRHLKDIRSVEAL"
FT   gap             794498..794681
FT                   /estimated_length=184
FT   CDS             complement(795417..797429)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07080"
FT                   /product="Soluble lytic murein transglycosylase and related
FT                   regulatory proteins (some contain LysM/invasin domains)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28056"
FT                   /db_xref="GOA:D4M861"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4M861"
FT                   /protein_id="CBL28056.1"
FT                   /translation="MLKKRFVVERCAVLALLMGLAAALLSALPAGAATMQDLFWKRAWK
FT                   EMEVLYASMDERSPQDAALMANAYRIQDRWPDAVAILEEYAGKFPASIRPYADMTLLLG
FT                   YERGKRDQEALALAERLWKSAPQELKYYVAYAQYRLLSKGGDERRIGEALSHMLAAAET
FT                   KERRIYALSKRIELSGNRAESALKLLELQPSNKDAAKVLLQQPQPWSNAVRVALGVYAH
FT                   LAGESAAAEERLRPVPMTAAGGRKAAYYRAWSLYRLKRSGEALDLWSRLALSGNAYAEP
FT                   SVRRIATLAGKAGKAEKKAAMNVLERVIKERRGKPQARALLVLRDLLDKSQAKYRDALE
FT                   AKVLSAYPDTPYAFDVLWGRGWKNVAAGNLTEAVRLWRQADAPNIGPMRRARLLYWIAD
FT                   AERRSGNKAEADRTQALLERRYPLSIYALLNGGEKLKVVNGEDPALATKPSELEQWGFV
FT                   LYAKLRLSRPKAGVRELYRALRLSRWLGLEESYNEARRLETLLTSGRTLYRANLEALYP
FT                   RPFRAQVKAACEAYSVEDALVWAVMRQESSFRPDARSHAGATGLMQLMPGTAKGEAKRA
FT                   GLEKYDLLDVNDNIRLGTSHLAWLGRSFPRVEWVMAAYNAGSGNARKWLKNGGEDLPLD
FT                   RWIEAVKFDETCGYVQRVSANLRVYRMLYGTAEAR"
FT   gap             801263..801672
FT                   /estimated_length=410
FT   CDS             complement(801680..802927)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07140"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28057"
FT                   /db_xref="GOA:D4M862"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:D4M862"
FT                   /protein_id="CBL28057.1"
FT                   /translation="MVRERTRRAELTVDELNAYIQGLFNSDLLLKALVISGEIAEFKRH
FT                   TSGHCYFTLLGTDTRISCAMFRRDADLLPEWPRNGDQVLIEGSVGVYPQRGVYQLYARR
FT                   LIPVGAGAIERARQELKRRLELEGLFHPSHKRPISPYPSRVAVITSATGAALRDVLRIS
FT                   GRRYPLSDIVVVPTLVQGPDAPEDIVRAFARAGAMSGVDCVLLVRGGGSREDLVPFDDE
FT                   RVVRAVRNCPFPVVSGIGHEVDSTLSDLAADLTASTPSAAAEVVFPDRAALLAWLAQVR
FT                   QRVGGSARRRIGVERARCRLALEGMERALKLRTGTERSRLHEGLRALSRSMTLRLRDAR
FT                   SELSTRAASLSGLSPLAALARGYVIAEREGRRLFSVREALSGAALSLCFRDGRADCLVR
FT                   AIAPFDPPNEGALEER"
FT   CDS             complement(802899..803441)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07150"
FT                   /product="transcription antitermination factor NusB"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28058"
FT                   /db_xref="GOA:D4M863"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="UniProtKB/TrEMBL:D4M863"
FT                   /protein_id="CBL28058.1"
FT                   /translation="METDVSEPARRAQSHHRSRQERGYAARRRARELAVQFLYSMECGP
FT                   GQDLEEALELFLGAESCAEAEPPAVKEYCRALVRGTWSRRTEVDEVLLSVVTNWRPERM
FT                   VAVDRAVLRLAVFEGFLDCALPFKSAISEAVNLARSFGTEDSARFVNGVLARVVRRLIP
FT                   EERKEGGADGQGEDPQG"
FT   CDS             complement(803422..803883)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28059"
FT                   /db_xref="UniProtKB/TrEMBL:D4M864"
FT                   /protein_id="CBL28059.1"
FT                   /translation="MIRVSYDGLFDFVQGFLSARFRLYGLALAAGDNALLTLLMSSGDV
FT                   SREPELARSLSALMEPLGMLTSVVWFSRGTPGSDWMETRFSLIRSPWAWMALASSVALI
FT                   VIAGWVGFFWTAFWGTAAWFVVRGLTFLFFRRKNFLLPQAGIRNGDGRV"
FT   CDS             complement(805008..805580)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07190"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /function="translation elongation factor P (EF-P)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28060"
FT                   /db_xref="GOA:D4M865"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:D4M865"
FT                   /protein_id="CBL28060.1"
FT                   /translation="MAQVVDTTDFYVGLKFRWQDGIWEIVDYDHHKMGRGGAVVRTKLR
FT                   NVETGSTVENSFKPGEKFERIIYEEKPAQYSYRDGEDYVFMDLATYDQMTLSPKVLGEA
FT                   AKYLVDDLEIQLEFFEGKVMGIELPKSVTLKVTDTPPSFKGDTVTGGGKPATLETGLVV
FT                   TVPVFIEPGEEIVVDTRTGLYLERAKK"
FT   CDS             complement(805746..806327)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07200"
FT                   /product="Type II secretory pathway, component PulD"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28061"
FT                   /db_xref="GOA:D4M866"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="UniProtKB/TrEMBL:D4M866"
FT                   /protein_id="CBL28061.1"
FT                   /translation="MHGIWREFDGAFRALEERGKGKALASPSVITIDGMEARVELTQDY
FT                   PYISERDDAGNPTWSTQTVGPQMTMTPRVGRDGVINLALDLETGEVIQMITGSTGEQMP
FT                   RTSKRHVTTNVRVRDGEPFVIGGLFSDNKSRTRNRIPILGQLPLLGELFTYRQDEHRKT
FT                   QVVMLVVPYVLDTPDAAIEQEPLFPRTAAR"
FT   CDS             complement(806336..807379)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07210"
FT                   /product="Type II secretory pathway, component PulD"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28062"
FT                   /db_xref="GOA:D4M867"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="UniProtKB/TrEMBL:D4M867"
FT                   /protein_id="CBL28062.1"
FT                   /translation="MLLNYELYQLGASEVVFGLSGKALPDPEVSCESTRVRFLIRNTHV
FT                   DRAEMSNHALVTPMISDMQINQVLDDVEIVMQTKAPLSVRSKRGSAPSNEFSYRMIAGV
FT                   EEERIRREPLETRPKLEAPKPAGPFANKTKITLDLRDAELRDVFRMLGTHLKKNVIIDP
FT                   SLPPALVTMTLKNVPLSEAFDYLMRTYDIAYHMVGKDTIVVGTQDGLSRLSGNEETRTF
FT                   NIAYGDPSVIQGLLVNLTKLPADRVLVDPRLRALYVTSTPQKLMEVNNILQKMDRPGKQ
FT                   VMIYAKIFEFSDNATDEVETALNAVYNHWWLSYSGGAECAAATRTTIAWGAILRPIITR
FT                   SSPFRRT"
FT   CDS             complement(807586..808206)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28063"
FT                   /db_xref="UniProtKB/TrEMBL:D4M868"
FT                   /protein_id="CBL28063.1"
FT                   /translation="MQSTWREAIAYAWGNFTGVMSEGSARALRLLLFLIFIGGTAWAVY
FT                   SYLELQQLREEKTFTASSTTTSVNEDRIRLEAMVTEVRDASARRSGSAMTAQTMKDMGK
FT                   YLFDDPSRRMAAVVPEIPLPGGGVVAPQVEEVVEPPPEITLRAIMVIDKTKTALIDIAG
FT                   VGTGLLVKQGDTFLNREGRIVRITNDKVVVRWKKKTWNVTPGF"
FT   CDS             complement(808211..808762)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28064"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:D4M869"
FT                   /protein_id="CBL28064.1"
FT                   /translation="MKDNKVTVLTLLFFLLCASLIGGVWFLDKRVRDLQEQYDEVEQRR
FT                   VDLNGATGALMEQKKVFTEAFNELDNYHVNVASDDMNFYANVQQAVQDKGVEILSTRQQ
FT                   GVNAEGVGAISMTLRGDYYDMVQVLAAWRSLPMTVRVVNLTVRQNEPSRDSGNGKNAPL
FT                   GRVEADVTVEAIVAANNSRR"
FT   CDS             complement(808762..809394)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28065"
FT                   /db_xref="UniProtKB/TrEMBL:D4M870"
FT                   /protein_id="CBL28065.1"
FT                   /translation="MRVQFDLCPAEYLARRKKRHSFNATRILAVLLLLFFLVAGIGYIV
FT                   MAFMETRALASDIEMVEDAVAKLEADQSELTAEIVRLKNKEQQYAKTLQIMRNEPPTIE
FT                   ALSALETNMDQGMGITSIRFAPGGTNEGGLVVYTADVDATALVEDQITALTTGLSGSGV
FT                   FSGVTMPSSQKDEKTGRVDFKLHLELRPFGQIDMTGAADSTGKEPNP"
FT   CDS             814152..814295
FT                   /transl_table=11
FT                   /locus_tag="SY1_07300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28066"
FT                   /db_xref="UniProtKB/TrEMBL:D4M871"
FT                   /protein_id="CBL28066.1"
FT                   /translation="MLAVRKRIPAPRRRASMRAGTNTAKVFPTPVGASRARTAASASLR
FT                   NP"
FT   CDS             814627..814902
FT                   /transl_table=11
FT                   /locus_tag="SY1_07310"
FT                   /product="ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28067"
FT                   /db_xref="GOA:D4M872"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="UniProtKB/TrEMBL:D4M872"
FT                   /protein_id="CBL28067.1"
FT                   /translation="MPNKQSAKRRVRIEERNRLYNRYWTTRCKTAVKKLLESVEAGDGE
FT                   AAARNFNLAQSVLDKAVVKGVMHRNTASRRKKLMARAVKGLSRPEA"
FT   CDS             815195..815524
FT                   /transl_table=11
FT                   /locus_tag="SY1_07320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28068"
FT                   /db_xref="UniProtKB/TrEMBL:D4M873"
FT                   /protein_id="CBL28068.1"
FT                   /translation="MADNPTIAEIKAAEERAAAGVQDAKSAAARRLNQARTDAESTLKE
FT                   TRQSAARQFREKLHRAEEAAEIKAKDILSKREADAKAFYAKHKDKVAGAASWITEEVMG
FT                   RYGRG"
FT   gap             815765..816859
FT                   /estimated_length=1095
FT   CDS             818342..818824
FT                   /transl_table=11
FT                   /locus_tag="SY1_07350"
FT                   /product="ATP synthase subunit C."
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28069"
FT                   /db_xref="GOA:D4M874"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="UniProtKB/TrEMBL:D4M874"
FT                   /protein_id="CBL28069.1"
FT                   /translation="MEYLGLSLALLGAALAAALSGIGSAIGIGIAGESAAGVMTEDPNK
FT                   FSKCLILQALPGTQGIYGLLIMFFVLIKLGLLGDAGAVTLNWNQGLQVFASCMPIAIVG
FT                   WISAIYQGKTSAASIQMISKKPEAMGKAIILPAMVETYAVLALLTSIMMLNFGIKL"
FT   CDS             818838..819416
FT                   /transl_table=11
FT                   /locus_tag="SY1_07360"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit E"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28070"
FT                   /db_xref="GOA:D4M875"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="UniProtKB/TrEMBL:D4M875"
FT                   /protein_id="CBL28070.1"
FT                   /translation="MSLADIKAKISTESQAEIQAIESEADEKVRQINQELNAEVKSVKD
FT                   TYASRFAKEEPEVLRRREIVAGIDANKLDLGVRRRLVDDAFAASLRKLADLPADACLKF
FT                   ASRLLKEAVSSGHEAVVVGKDEKHLNQGWLDGYNAEHGTSLTLSQERLPISGGFVLRDE
FT                   KIDTNCSWEMLLEDVRPEIESEVVKKLFS"
FT   CDS             819432..820436
FT                   /transl_table=11
FT                   /locus_tag="SY1_07370"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28071"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="UniProtKB/TrEMBL:D4M876"
FT                   /protein_id="CBL28071.1"
FT                   /translation="MSYVYTVARLRGMETHLLDAAFFSRLIDSSTLEDALKALSETSYA
FT                   QWLTQAGGEDFDKAIDEELLATCRELGQFVPDEGLLTLFRMPYDYHNVKVALKSLFRVR
FT                   GGDAEGRRHDLLSPLGAFPSEGLVEAIETEEYGRLPYGLGDVVPHCWTLWDQTKNPQAV
FT                   ELLLDHHLFAAMLRIAGGLEMPDVVRWVRHRIDAENLKSAVRLARMRYDAAKGLPFFHE
FT                   GGFIRAADVARLLGEPQETWGKILSYTDIGAVLDALQESSDVQAALSDVSKALDEYLIR
FT                   VLERVRYSTSAPANVLLYLLTKEAEARNLRIALVCVAGGLSREFSRRLLSHAR"
FT   CDS             820426..820764
FT                   /transl_table=11
FT                   /locus_tag="SY1_07380"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit F"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28072"
FT                   /db_xref="GOA:D4M877"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="UniProtKB/TrEMBL:D4M877"
FT                   /protein_id="CBL28072.1"
FT                   /translation="MPDNRSLPMAAIGSYEMVLPFQAVGVKTVVLDGEKRGSFEEILEK
FT                   LARESYAVVFIQEDLFVDFGGKVQEVNDRYPTSVLPIPGPSGTSGAGLESIRSSVEKAV
FT                   GMDIFAER"
FT   CDS             820869..822593
FT                   /transl_table=11
FT                   /locus_tag="SY1_07390"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit A"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28073"
FT                   /db_xref="GOA:D4M878"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M878"
FT                   /protein_id="CBL28073.1"
FT                   /translation="MLGASMSDVVHVGTAGLVGEIMDMDGDKASIQVYEETSGLKPGEP
FT                   VVCLGEPLSVELGPGIIEQFYDGIQRPLELIEKAAKSPYISRGISVPAIDHAKKWKFEP
FT                   RVKVGDTVEAGDVLGVVQETVVVEHRILVPVGMKGTVKSVNGGDHTVLDVVAVLDDDGV
FT                   KHEVTMLQRWPVRKPRPVSKRLAPNVPMTTGQRVVDTFFPVALGGTACVPGPFGSGKTV
FT                   IQHQFAKWAQAQIVVYVGCGERGNEMTDVLLEFPELDDPQTGQPLMKRTTLIANTSNMP
FT                   VAAREASVYTAITIAEYYRDMGYSVALMADSTSRWAEALREMSGRLEEMPGEEGYPAYL
FT                   GTRLASFYERAGRCVVLGREGREGSITVIGAVSPPGGDLSEPVTQNTLRVTKVFWGLDA
FT                   NLAYQRHFPAINWLNSYSLYTDRLDVYWNEKFDDEWSGLRVEAMSLLEKEAQLNEIVRL
FT                   VGIDALSRDERMVMETAKSLREDFLHQNAFHEIDTYASMEKQFKMLRMIVRFHHLGLDA
FT                   LHRGAPMNELFNLPVREQIARMRYLEESQISQIDKLEDTMKQQINGIVPVGGEGNVA"
FT   CDS             822583..823992
FT                   /transl_table=11
FT                   /locus_tag="SY1_07400"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit B"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28074"
FT                   /db_xref="GOA:D4M879"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M879"
FT                   /protein_id="CBL28074.1"
FT                   /translation="MLPKEYRTISNISGPLMMVESTRDVRYDELAEIELASGERRRGRV
FT                   LEIESDRALVQVFEGTSGIDTNETKVRFLGKVQTLPVSRDMLGRVFNGRGEPIDGGAPL
FT                   IAEQTLDINGMPMNPYSRDFPSEFIQTGISTIDGLNPMVRGQKLPIFSASGLPHNRMAA
FT                   QIARQATVISGHEDFAVVFAAMGITFEEASFFMEDFRKTGALERTVLYINLADDPAIER
FT                   ISTPRIALTAAEYLAFECGMHVVVILTDLTNYCEALREISAARKEVPGRRGYPGYLYTD
FT                   LATMYERAGRLKGKVGSITQIPILTMPEDDKTHPIPDLTGYITEGQIILSRSLHRQGIY
FT                   PPVDVMPSLSRLKDKGIGKDKTREDHADLMNQLFAAYSRGKDAKELAVILGEGALSDED
FT                   KAFAKFSDVFEDTYIRQGEYENRTIQETLDLGWNLLTMVPTKELKRVRDAYIDKYLKPL
FT                   LEKKAAQGAKA"
FT   CDS             824007..824627
FT                   /transl_table=11
FT                   /locus_tag="SY1_07410"
FT                   /product="H(+)-transporting ATP synthase, vacuolar type,
FT                   subunit D"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28075"
FT                   /db_xref="GOA:D4M880"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:D4M880"
FT                   /protein_id="CBL28075.1"
FT                   /translation="MARINVNPNRMELSKLKKRLTTAVRGHKLLKDKQDALIKAFLEKA
FT                   RAGKELREKVEKELAECYGTFVLSRAQTTPEVLEQALMFPGASCSLSVKWRNVMSVMVP
FT                   EYDVEQEGNPVNYGFVSVPVLLDTALEQFSKLILRLLEMAAEEKAIRMMAGEIERTRRR
FT                   VNALEYVMIPNYKETIRYISMKLDEQERSTLSRLMKIKEIVSA"
FT   CDS             824768..825706
FT                   /transl_table=11
FT                   /locus_tag="SY1_07420"
FT                   /product="conserved hypothetical protein (putative
FT                   transposase or invertase)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28076"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D4M881"
FT                   /protein_id="CBL28076.1"
FT                   /translation="MTCGREGLTTELSPEELERCVRSANLLNDVVFKYLFATKGNEENL
FT                   LRLLNDVLAPGPGIVSLQYLDRENDPRRDEGRTSCVDVLARAEDGRVCHVEVQLGREGY
FT                   FFERALYYASCSYSDQLSVSDSYDKLRPVIFVSILNFCLFPDRAEDWRSLHRLLDVKEQ
FT                   RSYCDGMEFHFIEMPKLKRLTAAGRVEDVGLSRVMKYLGRIGGEVEMERLVKCDRGIER
FT                   LEDGVRTFFRKRGNLALYRMRERAETDYRSNLKFAVQEAMTEGENRGRDLGRVETARRM
FT                   LDMSLSPSQISQATGLSLDEVEALKDNAAGA"
FT   CDS             828041..828883
FT                   /transl_table=11
FT                   /locus_tag="SY1_07450"
FT                   /product="Methyltransferase domain."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28077"
FT                   /db_xref="GOA:D4M882"
FT                   /db_xref="UniProtKB/TrEMBL:D4M882"
FT                   /protein_id="CBL28077.1"
FT                   /translation="MDVDFFNAILDRQSQDASEAEAFWDARAESFLASKRTYGADLTER
FT                   VVRCLTGGGMLGPETSVLDVGCAYGSYALPFAAVAKDVVAADVSSRMLELCAERAKAAG
FT                   ASNLRILKHDWELDEIGDLKGCFDLVFACMCRPARTSSGLAKMAAASRGVCVVAQYVAM
FT                   EDSLAESMAGELGLDRGDDPHNDRSIAWAIFNRLWLDGFLPRMDFAERIEDRTLTLEEA
FT                   LDRYGMGLGRAASERGTDLRSLLSAREEKGGVRTRARAVLALISWRPSERGHFTAPTQ"
FT   tRNA            complement(831432..831505)
FT                   /locus_tag="SY1_T_24860"
FT   CDS             complement(831612..832418)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07470"
FT                   /product="Methylase of chemotaxis methyl-accepting
FT                   proteins"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28078"
FT                   /db_xref="GOA:D4M883"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="UniProtKB/TrEMBL:D4M883"
FT                   /protein_id="CBL28078.1"
FT                   /translation="MPEATQYDSPAYSAFKQKMQKIIGLDLNSYKEQIHRRIHMQMDRW
FT                   GVKGNYDEYFNMIKNDSKRLREFLDYLTINVSEFFRNDSQWWKLRDKIIPELTQKRGNR
FT                   RLKLWSAGCATGEEPYSLAILSAVCGLEASAPVLAMDIDQGALDIAQKGHYVKAQLVNA
FT                   PKEYLAKYFTTKDGGESYDVNQEIKRRVAFKRFNMIDDSFGTGFDLILCRNVVIYFTNE
FT                   TKAALYQKFFNALAPGGYFLVGSTEQIFDYRKLGFEMAGPFLYTKK"
FT   CDS             complement(832541..833098)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07480"
FT                   /product="ribosome recycling factor"
FT                   /function="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28079"
FT                   /db_xref="GOA:D4M884"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="UniProtKB/TrEMBL:D4M884"
FT                   /protein_id="CBL28079.1"
FT                   /translation="MPKDELKELQESMDKAIDFLQNEYLSIRTGRAHPGLVSDIKLDYY
FT                   GTPTPLKQIANITIPESRTIQIAPFDRTSLKAIEKAILAANIGMTPQNDGASIRLTLPE
FT                   LTRERRVELTKLLAKKAEDARVVVRNYRRDAIESLKKQEKASEITEDDLKTLTKGVQDK
FT                   TDAYVKKVDEIYKAKEKEVLED"
FT   CDS             complement(833155..833871)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07490"
FT                   /product="uridylate kinase"
FT                   /function="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28080"
FT                   /db_xref="GOA:D4M885"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="UniProtKB/TrEMBL:D4M885"
FT                   /protein_id="CBL28080.1"
FT                   /translation="MPRYNRVLLKLSGEVLAGDERFGLDFDAVRRVGAEMVELHGAGIQ
FT                   LSLVVGGGNMLRGRDVQKLGIERSQADYMGMLGTVINALALQDVLEKMGVPTRVQTAIE
FT                   MREVAEPYIRRRALRHMEKGRIVIFAAGTGHPFFSTDTTAALRAAEMGVDCMVKGTKVD
FT                   GIYEADPKSHPEARFFPHLSYSEALQRNIEVMDASAFSLCRENRIPILVLNVQKKGCLV
FT                   SALVNGERIGTIVEDA"
FT   CDS             complement(834023..834619)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07500"
FT                   /product="translation elongation factor Ts (EF-Ts)"
FT                   /function="translation elongation factor Ts (EF-Ts)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28081"
FT                   /db_xref="GOA:D4M886"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="UniProtKB/TrEMBL:D4M886"
FT                   /protein_id="CBL28081.1"
FT                   /translation="MAEITAAIVKELRERTGSGMMDCKKALAESGGDMEKAIDYLREKG
FT                   LAKAAKKADRAASDGRVFQYIHTNFKVGALLELNSETDFVAKTDEFNHLGHEICMQIAA
FT                   ANPQYVRPEDVPEDVLQREREIYRQQLIEEGKPAQAIDKILEGKVRKFYETSCLLEQEY
FT                   IRDSNKKIKDLVTDMIAKLGENIVVKRFARFSIGE"
FT   CDS             complement(835575..837098)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07520"
FT                   /product="Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28082"
FT                   /db_xref="GOA:D4M887"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="UniProtKB/TrEMBL:D4M887"
FT                   /protein_id="CBL28082.1"
FT                   /translation="MVMTEALSLLSNGYVLFILGYAVLLILIGALVGRRVTSAEGFFVA
FT                   ERRLGPALLFTTLTAANLGAGSTVGVSALAWRHGLSAWWWIGSAGIGSMILAFWVGPRI
FT                   WRLAVRHNLYTLSDWLDLRYGKAFRGLLSAMMAVGTLALFAGQLLGIAWILQVAAGVPT
FT                   TVGVVAGAVVTTLYFAAGGLFSAAVVNLVEVAVILAGFAAALPFIWSFVGGWEGLTAKV
FT                   GQNLAEAERTDAYFSMGGMGTTAIVGYLVMLVPSFFISPGLIGKVFGARDERTIRWGTA
FT                   LGGVVQLVFAVIPVFIGVAAFACFPDLSRADLALPTAIKEMLPFSIATLSLAAIFAAEV
FT                   STADAVLYMLAGSITNDLYKRFLHPSLSDRGLLWGSRLVSLASGVAGVFLALRLESIIS
FT                   ALTIFYSLMSVSLAAPLVLGLLTSRASTTGAILSAVLGVLLTLFCTFYSGTATVNLGFG
FT                   VLDTATHLVDVGFARLNATTCGILLSFVAMGAATLLMPARRSAGERGLH"
FT   tRNA            complement(837219..837292)
FT                   /locus_tag="SY1_T_24850"
FT   CDS             complement(837491..838207)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28083"
FT                   /db_xref="UniProtKB/TrEMBL:D4M888"
FT                   /protein_id="CBL28083.1"
FT                   /translation="MWKKLSTVLALSALLLAVGGEAWAALPRDYQEFKARYQKEGKTPE
FT                   GAVKLYFEAVFCYINEATRAEGSKMVRYALHYDRPIEQSNNLSTFAERLRDPEMHHIFR
FT                   GFAEGTSPENDYRMSPDNFNLVVGKKVQEQGYLRVFLRNSGADSPRVVWMKEFDGLWYM
FT                   INNASTYVEVRPPKAFIDRTKNAHDADYDASPAPDPRKRDNDNTPSPSEGNASPEPTAP
FT                   SDEGESTEDDEEVVFK"
FT   CDS             complement(838230..838829)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28084"
FT                   /db_xref="UniProtKB/TrEMBL:D4M889"
FT                   /protein_id="CBL28084.1"
FT                   /translation="MRRTVRFFLWAILLFCLLFPAGMALAATKVQIVEYQCRVCDKIFY
FT                   GFKGDKLDDDIFMKQDVQLARMSKLSDRGKPLDPCKGGMKSHILDKKREGEATMEFISQ
FT                   NLDKFVVLKGSGSVHGTLKEWECFMCKKPFYSLNKEDLNIKEWDEQQNYLFSLKGKKPI
FT                   SRCKEGYQGHVFMPKKEGSFSSSELAIVVYDLFWSK"
FT   CDS             complement(839326..840030)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28085"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:D4M890"
FT                   /protein_id="CBL28085.1"
FT                   /translation="MADIKRDKLKIRNSTVDFLVFTKDAHEDGIEVRVQDHDVWLTQKA
FT                   IAQLFDVDRSVVTKHLKNVYESGELSEDSTCANFAQVADNGKTYHYKFYSLSAIIAVGY
FT                   RINSGRATQFRQWATKVLDTFTKQGYVLDKSRLINGQIFDEDYFDHLISEIQEIRASER
FT                   RFYAANAARRFDPVFKEFYDRMIARGKHPKQALAAVGTKLLRVIHAVMTSQKPYNPQKL
FT                   LPPSTRISQLNP"
FT   CDS             840574..840972
FT                   /transl_table=11
FT                   /locus_tag="SY1_07570"
FT                   /product="Transposase DDE domain."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28086"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:D4M891"
FT                   /protein_id="CBL28086.1"
FT                   /translation="MHTLKVQIVADASTRDILCISVGKGKQHDFKMLEESKVHFSPRIQ
FT                   VIADKGFQGLKKLHTNSVMPIKAKRGKQLSALEKIYNAVVSKCGIYIEHINRYIKRVRI
FT                   FSSRYRNRRKKFALRFSLICGIYNFQHG"
FT   gap             843445..845031
FT                   /estimated_length=1587
FT   CDS             complement(845226..846053)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07590"
FT                   /product="phosphonate ABC transporter, permease protein
FT                   PhnE"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28087"
FT                   /db_xref="GOA:D4M892"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="UniProtKB/TrEMBL:D4M892"
FT                   /protein_id="CBL28087.1"
FT                   /translation="MKNSRIVSTKYRLVVNASSDGWLLLKRMLQVVAVVAVIIWSFYSI
FT                   GFSLKELIQGLDGIVDIAGRMFPPKVSKWRGIVKPIVETINISVSGTFIAVLLSIPLGI
FT                   LAAKNISPNGFFYNLSRLLLNTIRTIPDMVFALIFVAAVGLGPLPGVLAIGVSSSGMLG
FT                   KFLADSIEGTNQGKIDAIRATGANYMQVLVYGVIPQITAEFISLVLFRWEMNFRSSTVL
FT                   GIVGAGGIGFDLITSIRLFQYKETTTILLGILLVVILVDFISNSIRNSLNADD"
FT   CDS             complement(846043..846783)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07600"
FT                   /product="phosphonate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28088"
FT                   /db_xref="GOA:D4M893"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M893"
FT                   /protein_id="CBL28088.1"
FT                   /translation="MLEIRNLSKSFKNAPWALNNVSLSVQEGDFIMLLGLSGSGKTTLL
FT                   RCINFLQRPTSGYVSFNGREIRDKKSIISARKKMGMVFQNFNLIEQLTVLQNVLCGRLS
FT                   YANKLLSCLKMFSEEDIDIALDCIKQVGLEDKAYTKTMHLSGGQRQRVGIARALAQRPV
FT                   LLLADEPVASLDPRTSRQVLEILKEINKSYRITTVVSNHNLSLALEYGTRIVGLKNGEL
FT                   VLDKKRDQITNSEISALYGSNHEE"
FT   gap             847417..848230
FT                   /estimated_length=814
FT   gap             851141..852256
FT                   /estimated_length=1116
FT   CDS             complement(854560..855747)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28089"
FT                   /db_xref="GOA:D4M894"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:D4M894"
FT                   /protein_id="CBL28089.1"
FT                   /translation="MKRSLSDFVPLLLKDEGLPEIIDEIRAELSFGVAWRELDTGNVLC
FT                   RGNPAFEERMLSFPLREIVRIYVSHEVEVSGNAIGLLVLDLPKGLPGPLPERLEDCLSV
FT                   LRLFYGQRLAESRLKTRYRNEFVQDLIYGRIYHEEEIRNRARTFHWKLDGGIVCLVISP
FT                   ELTETTGAVLDEALLSGFNLIQSRVLAFFPKSVYARLPDSLVVVLTLALPEERGRETRL
FT                   RDFRAALREVMENALHDARDRCRIRFFASVGSWREKPILAYQSYQEARQALMILRGGMS
FT                   RQDFVFWEQLGGTRMIAMLADMEPAREFCRQTLAPLLRESRGGEELIHTLLRVEECGGD
FT                   LRQAAKSLSLHYNTLRYRLRRIQEILDLSPHDGERRFNLSLALRLHRVLSKNRTA"
FT   CDS             856412..857335
FT                   /transl_table=11
FT                   /locus_tag="SY1_07680"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28090"
FT                   /db_xref="GOA:D4M895"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="UniProtKB/TrEMBL:D4M895"
FT                   /protein_id="CBL28090.1"
FT                   /translation="MTASGETVMKGTRGADAQDERAVVRRLSLTGITGNAALSAFKLFA
FT                   GVAGRSSAMVSDAAHSLSDVLATLIALVGVLLSKRAADDDHPYGHERFESVAALLLGLI
FT                   LLATGGLIGKAGLEALLSGNDAQRGGPGSIALVAAVVSIAVKEAMYWYTRRCALHLNSA
FT                   AFMADAWHHRSDALSSIGSLIGIAGAMMGYPALDPAAGVVICLVILTVALRTTRDALGQ
FT                   LLDTSCGRSYDRELADFIAAQEGVVRVDLLRTRRFGNRVYVDLEISVDGDESLRKAHSV
FT                   AERVHLSVEQRFPGVKHIMIHVNPAA"
FT   CDS             complement(857356..858243)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07690"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28091"
FT                   /db_xref="GOA:D4M896"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4M896"
FT                   /protein_id="CBL28091.1"
FT                   /translation="MESTFNRYEVFLKVAELGNITRAAEALNYTQSGVSHSIAALEREA
FT                   GFPLFLRGSGGVALTERGRRLLAPVQELVNRQRNLAQAIHEINDVVCGTLRLGTFTSVS
FT                   AQWLPWIIRDFQRSCPRVEFDLRAGDYDEIGEWIRREKIDCGFLSAPVPEGLSFRPLKE
FT                   DPMKVILPVGHPLAERGSLTLPEIAQEPFIIPMKGSDNDIQALLRRSGVSVRVRYALND
FT                   EFSVMSMVEHGFGVSIMPDLILRNFRFSLLSRDLSPEAHRTLGIASLPPERVSVVGRTF
FT                   IRYLSGPAVDLWRL"
FT   CDS             858432..859373
FT                   /transl_table=11
FT                   /locus_tag="SY1_07700"
FT                   /product="Predicted permease, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28092"
FT                   /db_xref="GOA:D4M897"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4M897"
FT                   /protein_id="CBL28092.1"
FT                   /translation="MRTLTSFVAGPRGIRWTQQRADAALGLVAMAWGSSYLLMKMGLEG
FT                   IPPLSMIALRFGIAFLTVALIFARQLRRTTSRTLRHGAILGLFLFGLFAFLMYGLRTTS
FT                   ASAAGFLTSATVVFVPLLQAIFRRKAPDAATVVGTAAVMSGIGLLTLRDAMTLQWGELL
FT                   CLGGALLYACQILLTDIFTHQEDGLLLGVWQLAFAALLGFVASLLLEVPAWPANAAQWA
FT                   AVLGLALLCSAFGFVLQPVAQRYTTPEHAGLLFAMEPVFSALLAFLFLRETLDARGYAG
FT                   AALILLSVLFVARGKPAPKGAAAGQGEDVRYA"
FT   CDS             complement(859434..860855)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07710"
FT                   /product="Mg2+ transporter (mgtE)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28093"
FT                   /db_xref="GOA:D4M898"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="UniProtKB/TrEMBL:D4M898"
FT                   /protein_id="CBL28093.1"
FT                   /translation="MDHTRTIPAEESASTAQHPNYEEKIAQVVRGNLTPKIMREQLLTY
FT                   HENDVAAALDLLKKEDRYRLYSVLNPETLADVLEYSEKINEYVGELNLRKRAEVLAHLE
FT                   PSVAVDYLQEVEKGERAAIIDLMPDDAKQEISLLSSFDEDEIGSRMTTNFVMIHMGISV
FT                   RQAMRELVEQAADNDNISTIYVADDDGIFAGAIDLKSLIIAREGTELDSIIMTSYPYVY
FT                   ANELIEDCIERIKDYSEDSIPVLDQENRLKGVLTAQDVAELIDDEMGEDYARLAGLTAE
FT                   EDLQEPLSMSIVKRLPWLLVLLGLGLVVSSVVGLFEAVAAGLTIIVAFQSLILDMAGNV
FT                   GTQSLAVTIRVLMDDQCTGRQKLYLVAKEAKIGLCNGLILGSLSILFIGLYLLLVKGEA
FT                   AHFAFSISLCAGAALALSMSLSSISGTTIPILFKGLGVDPAVASGPLITTVNDLIAVVT
FT                   YYGLAEGLLRGVLGG"
FT   CDS             complement(862963..864513)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07730"
FT                   /product="Ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28094"
FT                   /db_xref="GOA:D4M899"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D4M899"
FT                   /protein_id="CBL28094.1"
FT                   /translation="MEQEMNRDMELEQAAQSDGQEMDQGKLMEEYDVATRLHPGEIIKD
FT                   GTVVAETENGWLVDVGYKCEGLLPEKEWTHRILIEDVEKPKTGDKIEVQVVKIRDGEEA
FT                   QLLLSRWRSEFDRRWAELEALLEGNETVQVKGLRKVKGGLMVECCGLEGFIPMSHIAEN
FT                   GRGSNLSSFIDETFEVKPLERDKRKHRLVFSRKDLVAKENAEKRAKFYDEVHEGDVLEG
FT                   EVSSITDFGIFVNLKGAMDGLVHVSEITWKRNVRIRDLYKKGDKVTVKVIGLDKEKDRI
FT                   SLSIKQVQGDPWLTAGERIHKGDVMKGVVTNVTDFGAFVELEPGIEGLIHIGDISWARI
FT                   KHPRDTFRKGQEVEVLVMDIALSEDPKKCRISLGYKQLNDPWKDIDKRYAVGQDLKVKV
FT                   VRLAEFGAFVEAEEGVEALIHISQLSNRRVEKPGDVLHEGQEVVARMIEVNPEQRRMRL
FT                   SLSALEEPTEPQQPKRDERQQHRKESREDRRSNAGDAGLDEGGLYQNPFAEAFKDKNF"
FT   CDS             866698..867708
FT                   /transl_table=11
FT                   /locus_tag="SY1_07760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28095"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8A0"
FT                   /protein_id="CBL28095.1"
FT                   /translation="MRMQSKRSPIEVQNAIDRRKLWLAYLVFPLISLLPVLIPLVMPGM
FT                   KEQLTSQLVLQLILDMCLYVLFRGVLFPTVIRFLLLRRGTRYGVETYAFTVLSIVISIL
FT                   ACWLVYEEPYFPLVFDFFSAYNILTYRSSGKNAISTGRLLALTGLTIALLAGWCVVLDD
FT                   EDETLNRKVVQAVASIGALCYTFSSYRNVKGATRGATRGAAPSPSPSPSPSGPAAAPIR
FT                   GQALLPPWETGAAEPQVQAQPQAQVQPQPTNVFSASSGLETLQDLTDEEAFSCLGIARS
FT                   ATMDEVQRAYERRKELLNPASFVMGSVEYQDAVRTLQLLDRAYHKASMACMARRA"
FT   CDS             867907..868800
FT                   /transl_table=11
FT                   /locus_tag="SY1_07770"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28096"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8A1"
FT                   /protein_id="CBL28096.1"
FT                   /translation="MGERTQRSRAADFLHRLMTEELDTLISTTIGTVLTCFAIIALMMP
FT                   YKFASGGVTGVALITNYLWGLSPVWVITVGNALLLLWGWHYLSMRFALWTLYVTILTSL
FT                   VLPVVEMFQYPVIQEPLLAAILGGIIGGIGYGMLFRVDASSGGMDVVSAAARKRWGADI
FT                   GTMSLYINLVILLASFVAVSLEEVLFGALMLYVETLTIDNVVHSFHRRTQALIISGRVL
FT                   EIKNYIMTDLERTATLIPAKGAYRDTPLELLLVILPRRQAASLKRYIASLDPTAFVIFS
FT                   EVSEVVGEGFKSWLRA"
FT   CDS             868829..869713
FT                   /transl_table=11
FT                   /locus_tag="SY1_07780"
FT                   /product="Triphosphoribosyl-dephospho-CoA synthetase"
FT                   /EC_number="2.7.8.25"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28097"
FT                   /db_xref="GOA:D4M8A2"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8A2"
FT                   /protein_id="CBL28097.1"
FT                   /translation="MNDILVFNIARLAVKSMLNAGAAWPKPGLVTPLADAAGTAFQTIV
FT                   EGALGLLPCFINCASIGLETEAMNPEDVMTLLRPAGMQGEREVQGVVRGRTSFKGSIFF
FT                   LGLFSAAAGRLFAQERNLTPLALALTASSCVRGLVERELRGLDEGSAELTPGERAWTLY
FT                   GVDGARGEAERGFPVVVQAVDLLRQLEEGDDSPSGRESAAQALLGILAGNSDSALAERA
FT                   GLDGMLRVQAEAKAALLAGGVLTSEGRKAVDALDRRLREADVSPRGAEVALAAALFVRD
FT                   LEALRPTRSGREE"
FT   CDS             870068..871240
FT                   /transl_table=11
FT                   /locus_tag="SY1_07790"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28098"
FT                   /db_xref="GOA:D4M8A3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8A3"
FT                   /protein_id="CBL28098.1"
FT                   /translation="MDIKALAERYEPYIVERRRYYHSCPELSNEEKETSAQIRRDLEAM
FT                   GIAVREVSGCYGLVADIRGGSQGATVALRADMDALPIEEDTGLPFASKNEGRMHACGHD
FT                   NHVAMLLGAAQILNEVKAELHGTVRLLVQPAEEVASGALDMLKGGALDGVSAIYGAHVW
FT                   GNFDAPLIDVTPGSRMACCDKFTIEVEGVAAHASAPHLGVDAITVSAAIINNLQQCVSR
FT                   MNDPLNPLVLTIGFIEGGPRWNVISNRVRMEGTVRTFDEDLSKSEIMRRIIADTAAAFG
FT                   AKGTLEYKRLTPPLINGSDKLNAIAREAVVKLYGEQAVGHMPTMMGSEDFPWLSDGGRI
FT                   PYIFAFIGSRNREKGITYTNHHEKYTVDEGILTRGAAVMAQFAADFLASA"
FT   CDS             871268..872017
FT                   /transl_table=11
FT                   /locus_tag="SY1_07800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28099"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8A4"
FT                   /protein_id="CBL28099.1"
FT                   /translation="MSDKDRDLSVAGELLEVLRRSGRDFMTLSAMRKAMSSQLRKRLGL
FT                   TGRNLTNPNVIKILTPHLEDKLAICSKGNAVYLLRGTNLAEVVLCFIRGKAGKSGPQLL
FT                   NGMPFIKKDELIRILNNLLESGQVTLKLAAEFAPRFFASGAMGPVKKDAAGTACETLAD
FT                   TFDKRREQLHAAFRELDRGSTFVRICDLRGRLGWPREVFDDMLRRLRDDEAVQLHAGDV
FT                   TLMTPDQVQDGFVDENGFRMGTMTWIA"
FT   CDS             872005..875304
FT                   /transl_table=11
FT                   /locus_tag="SY1_07810"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28100"
FT                   /db_xref="GOA:D4M8A5"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8A5"
FT                   /protein_id="CBL28100.1"
FT                   /translation="MDSLNDSVIRSQLVAKNPFASSAAPNPWDNANPDLDSLNRTVVDH
FT                   IDLLLKMTRENPAETFAGLILGEAGAGKTHMLKRVLRRIRESGEIAIFVTVRAFMDPES
FT                   VLQDLLREVFISMGREHGDGKLQIDLLLEALDKAYRRDFREDALGGMARLEPLQMKLDR
FT                   VNNDFLRCLLLYASTEDASLKNDILRWMRGESDESFSEKLDVIACNWDEMTPAAQEKKA
FT                   RDRLLSLGHVLRYVRVPMLVCFDQLDGMTSEDLLNAWGTAASLLINDVYGVLPLAFLRA
FT                   DTWEQRFSPRLDDAVRQKFLNHRLPMANCNLEQAKQLIKERIKAFFDDDDEVEQKYQWL
FT                   MARLNTTLKPGYSPRMVITLANQAIQEAGAGADAAHEVEHALAEAYREECDKVASDPNS
FT                   WPPNANHLLSALEMWLGAHPEFKVSRSADKYLRLSGKRSAEGPEAPCAFIIMATRHHRS
FT                   AAAAIDRGIKFLEENPNGFCCYVTDERALKGPENWKQVHELLGQFRALKGRTVVLQPDG
FT                   RAAWYGLVAFQNKVCNGDVTLYPPSGGPRLATPEDLSGYMKEGFRWNLLGLDGESGKPG
FT                   DGDRSKDTGSGKDPTPSTSGPKDTSGSASEEKRLPLPVAVNSELCQQRPQNGDCSNDLG
FT                   VAPAPQTVPEKSGSESGDKARDDFGEVHQEIFCHNDLGAAPTPQTVPEKSGSESGDKAR
FT                   DDFGEVPQEIFCRNDLGAAPTPQTVPEKSGSESGDKARDDFGEVPQEIFCHAEGLDRMV
FT                   QLLKALKDLGLSVADAGVVCGPRFIRLKVLPDAARGTTVKKIDNRADDLQVQMALPVPP
FT                   VIQAYGGYVGVDVPRSSPQALSLKTLLRQGEESRPRSEAVFPLGMRVDGSVFWADLAEP
FT                   SMTSILIGGTSGSGKSVLLRSVVVGLLLCAPKDSVNFTLIDPKRLTFVDLAGLRALEEG
FT                   RILCDVEETMEALKEAVEEMERRYELMEGAKVSHLTDYNAVAEERLRRRVLIIDEYADL
FT                   MMHKETAKDLEHFIQRLCQKGRAAGFHLLLATQRPDAKVVTGVIKANLQLRVALKVASK
FT                   SNSQIILGEGFTQAQHLLGHGDMLVGNGSAVERLQGPIADISLLGPEFLRG"
FT   tRNA            875353..875439
FT                   /locus_tag="SY1_T_24560"
FT   tRNA            875453..875529
FT                   /locus_tag="SY1_T_24570"
FT   tRNA            875538..875614
FT                   /locus_tag="SY1_T_24580"
FT   gap             875835..876654
FT                   /estimated_length=820
FT   CDS             complement(876822..877691)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28101"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8A6"
FT                   /protein_id="CBL28101.1"
FT                   /translation="MKKLQTGNVVIVVLVLGILAAGAYFLMGSGLFISTPAVASMTPEE
FT                   LAAENEALMKQFQEAGRSIGGMAVLGRSKAALEWLEKYAPDGHPTPLPDDPKAANEGLK
FT                   KRVADAKVIFEAMQAAEKRENPWLRQYYGEENEQTLKKLGIKSLKVKEAQDDEIKKFLK
FT                   PARTTAKALKGFLLKHGREIAQDKNYNLASVLDTPEHILGVVKPYLEEDVDYNDSRFSF
FT                   HGDNKEWWVGYKLDGLSDELRQKIVEGNIGLYRDLYKAPDKGKYLMDINALYDGGDIVF
FT                   LNVNSILL"
FT   gap             878462..878958
FT                   /estimated_length=497
FT   CDS             complement(879458..880873)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07840"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28102"
FT                   /db_xref="GOA:D4M8A7"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8A7"
FT                   /protein_id="CBL28102.1"
FT                   /translation="MSGEMKSIGNEAIYDARSLGVGRMLILGVQHLFAMFGATVLVPLL
FT                   TGLSVSSTLLFAGVGTLLFHMIAKWKVPAFLGSSFAFLAGYAAIAPKGDPALLPYACFG
FT                   VACAGLVYLLLAAAFRAFGASRVMRYFPPIVTGPIIIAIGLTLSQSAIENCSKDWFIAL
FT                   VAIVVVIACNIWGHGMVKIIPILLGVAGSYLAAVAIGAVDFSTIAAKPWFGFPVEYGQT
FT                   VFAIFTNGRVNFDLLISSVITIVPIAFAAMMEHIGDISAISSTVGINFIRDPGLHRTLT
FT                   GDGLATTAASLFGAPANTTYGENTGVLTLTKVYDPKIIRLTAVFAVLLSFCPKFAAAIE
FT                   SMPTATIGGISLILYGMIASVGVRNIVETNVDFSQSRNVIVAALILVLSIGINYSSAGA
FT                   LNFTLGGIGIKFSGIATGSLVGILLNAVLPGKDYKFDDDVPNRTGVNLEIAQGKSLDWR
FT                   ASDGVEGQDTVIS"
FT   CDS             881482..883122
FT                   /transl_table=11
FT                   /locus_tag="SY1_07850"
FT                   /product="hydroxylamine reductase"
FT                   /EC_number="1.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28103"
FT                   /db_xref="GOA:D4M8A8"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8A8"
FT                   /protein_id="CBL28103.1"
FT                   /translation="MKMDCSMFCFQCQETAGGKGCTKSGVCGKKPDVAAMQDLLIYVTK
FT                   GLSCVTERLRSEGQEVDKKVNHSVTVNLFTTITNANFDRDAIVSRIEETLRLKEELLAR
FT                   VKDASGLPEAASWKGTRDEFEAKAAKVGVLATSDEDIRSLRELVTYGLKGLAAYSKHAN
FT                   ALLQDDEAVDAFIQRALASTLNDALTVDDLVALTLETGKYGVEGMALLDRANTGAYGNP
FT                   EITKVEIGVRKNPGILISGHDLRDLEMLLEQTAGTGVDVYTHSEMLPAHYYPAFKKYPH
FT                   FAGNYGNAWWKQKEEFASFHGPILMTTNCVVPPAESYKDRLWTTGAAGFPGCRHIDGAY
FT                   GEVKDFSAIIAQAKTCPAPEEIERGSIVGGFAHEQVFALADKVVDAVKSGAIRKFVVMA
FT                   GCDGRMKSREYYTEFADKLPKDVVILTAGCAKYRYNKLDLGDIGGIPRVLDAGQCNDSY
FT                   SLALIALKLKEVFGLKDVNELPLAFNIAWYEQKAVIVLLALLYLGVKNIHLGPTLPAFL
FT                   SPNVAGVLVKNFGIAGIGTVDEDLKLLIA"
FT   CDS             883229..884524
FT                   /transl_table=11
FT                   /locus_tag="SY1_07860"
FT                   /product="enolase"
FT                   /function="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28104"
FT                   /db_xref="GOA:D4M8A9"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8A9"
FT                   /protein_id="CBL28104.1"
FT                   /translation="MWKHAAIEKVTGREILDSRGNPTVEAEVVLSDGTVGRGIAPSGAS
FT                   TGEFEAVELRDGDEKRFGGKGVARAVANVNTVINDVLRGLNPQSVHTVDFAMLKADGTP
FT                   NKSRLGANAILAASIASARAAAESMGVPLFRFLGGVNASLLPVPMMNILNGGAHAANSL
FT                   DIQEFMVMPVGAPSFREAYRWCSEVFHSLRGILKGRGRATGVGDEGGFAPDLKDDEDAI
FT                   QSILEAIQKAGYEPGRDFVLAMDAASSEWKSEKGVGFYHQPKSGLDLTSDELIAHWEAL
FT                   VDRYPIWSIEDGLDEEDWDGWKKMTRQLGGKVQLVGDDLFVTNTERLSRGIEMGCGNSI
FT                   LIKLNQIGSVSETLDAVRMAHRAGYTAVVSHRSGETADTTIADLAVALNTGQIKSGAPS
FT                   RGERTAKYNQLLRIEEALGNAAAYPGVHAFNR"
FT   gap             884608..884954
FT                   /estimated_length=347
FT   CDS             complement(885065..886522)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07870"
FT                   /product="Na+/panthothenate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28105"
FT                   /db_xref="GOA:D4M8B0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8B0"
FT                   /protein_id="CBL28105.1"
FT                   /translation="MNTGVLSLGVIVLYLVAMLVITVVHGRRKKKASALDFFLANRGVN
FT                   SILLPLTMIAAMQSTFAFLGSPGMYYTHGISFIVLVLSQVWVALMVVYFGNKIRLLANE
FT                   RGYMSLGDYLEDRFQSRYLKVMAACVSVLMTMIFLAMQYVGNARAMSVVSSGAISYNAA
FT                   ILVSVAFSLLYVLIGGAGGVVLLDAVQAVILLIGIVLAAWVALVPSGGIVNLFTQVRQT
FT                   APELLSRPGLKGLYTDKYWVMQFIVLPFGIWLCPHVWNKSLMARDEEALARSAISIPIS
FT                   QILIYGFSTLFIGLAGHILVSASEVRAADNILPILMLKYSNWFVAALIMAAAIAAGIST
FT                   INAMLLVSSQLVSQDLILLTRRGRISNEQNMRISRIIVFAVAAICGLIALKPPATFVQV
FT                   IQDVAYTGLAQLAPPFLLGMYWKRCSRLGASVGLTAGIAILFGTRILGVSPLGWPGFMW
FT                   GFFINIILTVVISLLGKEGEAPTAEVH"
FT   CDS             complement(886526..886735)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28106"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8B1"
FT                   /protein_id="CBL28106.1"
FT                   /translation="MKQKLFGCVFLVLLLLGALPLSMTWGEQGYLFGWLPVALAYWWTL
FT                   MVVNLAFVLLVCRDFVRSSKKGEK"
FT   CDS             complement(886738..888021)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07890"
FT                   /product="dihydroorotase"
FT                   /function="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28107"
FT                   /db_xref="GOA:D4M8B2"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8B2"
FT                   /protein_id="CBL28107.1"
FT                   /translation="MILIQNGRVIDPKSGLDEVLDVIVQDGRIAGMGKYARGGEFTEVI
FT                   DAEGCTVAPGLVDTHVHFRDPGLTYKEDVATGAASAAAGGYTTVICMANTKPPLDDAEA
FT                   LKDLRRRESDLPIHVLNTACVTRGMKGQELTDMDALKAAGAIGFTDDGLPIKDVKLMMR
FT                   AMERARELGVPISLHEEDPDLIGSPGINQGRISKEVGVPGAPAVAEETLMARDCLLALH
FT                   TGARVNIQHLSSGVSVEVLRLMKRLGADVWAEVTPQHFSLNEEIVLEKGTLAKVNPPIR
FT                   TEEDRYQLIRGLKEGVIDIIATDHAPHASEEKAQDLLHAPSGMIGLETALALGITNLVR
FT                   KGHLTLLELLEKMTARPAELYGLSCGSLREGGDADLVVFDERESWTVGSRFFSKSSNSP
FT                   FTGMTLYGRVKHTLCGGRVVYTDGKDVR"
FT   CDS             complement(888018..889238)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07900"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28108"
FT                   /db_xref="GOA:D4M8B3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8B3"
FT                   /protein_id="CBL28108.1"
FT                   /translation="MQHSVSEIRYCGELFEAFYDVGSTREGGVTRLGYSAVEDEMHRRF
FT                   EALARELGCGVFTDEVGNTFASNGEEGDYYLLGSHLDSVVDGGRYDGVAGVIAGLMVVR
FT                   RLQEEEEVRLPLRVAAFRCEESSNFGLCTIGSGLIAGQEKYSSDIGSLRSRDGERLDEI
FT                   FQKRGLSFSPKNISGIKEYLELHIEQGKVLEETGTEIGIVSTIAGPRRFRFILRGMAEH
FT                   SGATPMGLRNDALCAAAEVILAVERIGREEAVHQSVATVGVVENRPNVLNVIPGEVALG
FT                   IDLRGIEEESLDRMEQALRSRAQDIAKSRGATCLEMKIGSVPPVAMSRRVQRGLERAAS
FT                   RLKISSRNMPSGAGHDAMSFAALCDTGMVFIPCRHGVSHNRKEFASLSSICDGAAVICE
FT                   YLKGEAV"
FT   CDS             complement(889258..890199)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07910"
FT                   /product="dihydroorotate dehydrogenase (subfamily 1) family
FT                   protein"
FT                   /EC_number="1.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28109"
FT                   /db_xref="GOA:D4M8B4"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8B4"
FT                   /protein_id="CBL28109.1"
FT                   /translation="MSELKYRTDLSVKVGGITFKNPVMPASGTWDCFENNAGLFPMSEL
FT                   GAVLVKSVHRLVRQGNPPPRIAEVTGGMINAVGIPSVGIEAFMTQELPRYDGIGAPVVL
FT                   SLSGNRKEHYREALEIVANDPRIAAVELNLSCPNIGTGLAFSSTPDVLRETLKAAREAT
FT                   RLPIFVKLAPNVTDIRVSARVSEEEGADAVTIANTWRAMLIDVETRSPVLSNVSGGMSG
FT                   PAVKPQTLFLVWQARAATAIPIIASGGIARWQDAVEYFLAGASMVQVGSANFQNPAAMV
FT                   QIVDGIDRYLAEHGHRALSEIRGLAHQRRGNS"
FT   CDS             complement(890214..890978)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07920"
FT                   /product="2-polyprenylphenol hydroxylase and related
FT                   flavodoxin oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28110"
FT                   /db_xref="GOA:D4M8B5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8B5"
FT                   /protein_id="CBL28110.1"
FT                   /translation="MYLKCRVLQQAKVGAEAFALDLDVQDMAGLSRPGQFVMVRCWEGD
FT                   DPFLMRPFSINSVDRKNGVMTLLYQVRGRGTALMAALRPADSVAVLGPLGRGFPVREGA
FT                   SRVALIGRGMGIAPLLLLAQDYAAHGTELHVYLSARSEEGLFNRSQFERLGARVTTTTA
FT                   PSLNVTDRMAEDCRSLNFDAAYSCGSRRLGLGMKELHLKYGFPAYVSLEEHMACGLGAC
FT                   KGCACRTRRSEAGGEYALVCRDGPVFDVDEVL"
FT   CDS             891439..892563
FT                   /transl_table=11
FT                   /locus_tag="SY1_07930"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28111"
FT                   /db_xref="GOA:D4M8B6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8B6"
FT                   /protein_id="CBL28111.1"
FT                   /translation="MFAQRLWALTKKEALQIVRDPSSIVIAFVLPLTLLFLFGYGLSLD
FT                   AREIRIGIALEDGGQPARDLARRFAANPYFSPSLAASRQELLPALVTGELKSVLIVPQG
FT                   TSAALYFNQNLNQNSGRKASLQLLTDGSYPNSGALAENYALAAILQWGGELSRTSLPIV
FT                   VEPHFRYNDGLESRYSLIPGIMAVIMALIGTMLTALVVAREWERGTMEALFSTPVSALE
FT                   LLLGKLIPYYLLAIFSTFFSLALSVSLFGVPFRGSLPALFAVASLFMMSALGQGLIIST
FT                   LSKNQYVASFAALLSAFLPVVLLSGFIFELNSMPLVQRAIAAVLPARYLVTCLQTLFLA
FT                   GDVWPLLLPNMIRLGLLGLFFLAVTLRYTKKVLA"
FT   CDS             892566..893675
FT                   /transl_table=11
FT                   /locus_tag="SY1_07940"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28112"
FT                   /db_xref="GOA:D4M8B7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8B7"
FT                   /protein_id="CBL28112.1"
FT                   /translation="MFARIRSLIVKELYAVLLDPKTRFQVFVGPFVMLFLFSFAITMEV
FT                   RNASLAVLNQDDGDLGRRLEAAFTAGPAFTRSFALSSVREIEPAIAEQRALMVLRIPEG
FT                   FSASLMRGEPTSVQVVLDGRKANAVQIAYGYATSIANGFARGLRKTLTGTDALLSVEPR
FT                   QLFNPNHDYLWFTLPVLLVVLTQMLSLVVSGMSVARERELGTFEQLLVSPLSPLEIVVG
FT                   KTLPAVAIAFGIGVAIHVLARTVFGVPCLGSLGLLAFGFLIFILACTGVGLFVSSLCNT
FT                   QQQAFLGVFTCMVPFVLLSGFATPIENMPHALQTLTLFNPSRHIIVIALGVYLKGIPLR
FT                   EVAVQLLWLGGIATVTLGAAGWFFKRRVQ"
FT   CDS             893783..894814
FT                   /transl_table=11
FT                   /locus_tag="SY1_07950"
FT                   /product="Multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28113"
FT                   /db_xref="GOA:D4M8B8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8B8"
FT                   /protein_id="CBL28113.1"
FT                   /translation="MKKRFALLLLVLAAVLGALYANGELDGLIDRFREKDPHRIRLYGN
FT                   VEIRQVLLGFRVSGRVEAVYREEGERVASGDLLSILDPVPYRIKRSEARGAMLQAKAAL
FT                   DKLHRGFRTEEVREAAAQRDRVQASLDLAEKDYSRISNLFAQKAVAKSELDRASSQRNA
FT                   LRAELAAAENALALMREGYRREDIEAAEAAYEAASARFAAAENALSDTELRSPADGTIL
FT                   TRVTEPGTVVGAGQVVYALALERPIQVRAYIPEPQLGRVRVGMPAQIVTDSSPAPIEGT
FT                   LTFISPTAEFTPKQVQTEDLRTDLVYRARILVEDDRDGRLKNGMPVTVLMESIEASEGA
FT                   ASR"
FT   CDS             894811..896595
FT                   /transl_table=11
FT                   /locus_tag="SY1_07960"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28114"
FT                   /db_xref="GOA:D4M8B9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8B9"
FT                   /protein_id="CBL28114.1"
FT                   /translation="MSEVEKRLPIDSQKTSEIVVEGLVRTFGKRTALDGITARIGGGRI
FT                   TGLVGPDGAGKTTLLRLFCGLLAPTAGRVSVCGCDTAEDADAIHERVGYMPQRFGLYED
FT                   LTVMENLNLYAELRSVPRRERTDRYAELLAFTGLEPFTGRLAGRLSGGMKQKLGLACTL
FT                   LSRPPVLLLDEPGVGVDPLARRELWRMVRGLLVRDRIVVWSTAYLDEAEACDAVLLLNE
FT                   GKLLYDGTPEDLAKRVEGRVFLLGGAGGRRRKLIAPLMERKCTLDAVIQGSSVRVLTSD
FT                   DGAELRENLDAIACEAEVLADPSSRLTLRPAPPRFEDSFMQLLGGARRGSDAVAAFFEE
FT                   KGTGRVSVEARHLTKRFGNFTAVDDVSFSIERGEIFGLLGPNGAGKSTTFKMMCGLLTP
FT                   TEGECAVSGLDLRTAPGAARARLGYMAQKFSLYGDLTVLQNLRFFSGIYGLRGDAALER
FT                   VVETFGLAPYLSSRAGSLPLGFKQRLAMGCAVMHGPDVLFLDEPTSGVDPVTRREFWTC
FT                   INSFALKGVTVMVTTHFMDEAEYCDRIALVYRGGTIASGPPDALKASVRTEACPDPTLE
FT                   EAFIALIERQDAAPASLL"
FT   CDS             complement(896850..897404)
FT                   /transl_table=11
FT                   /locus_tag="SY1_07970"
FT                   /product="Uncharacterised protein family (UPF0227)."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28115"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8C0"
FT                   /protein_id="CBL28115.1"
FT                   /translation="MFINIHGFGGQGENTKYLWLRKTYPEEEIFCPTFDYTTAHPEEVL
FT                   SRYEAEVRAQVKAGRSVRVVGTSWGGFFAYCLNALFPSLPTVLVNPSLNPHLSRRCIVL
FT                   NHDLLLEYMEVLSRHMLRHSDASCAVIIGSRDEVIPHEVVTVPIFAPESVHRFDVQHSF
FT                   DMDAEPELPRLMMEHFGRTFA"
FT   CDS             897706..898239
FT                   /transl_table=11
FT                   /locus_tag="SY1_07980"
FT                   /product="O-6-methylguanine DNA methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28116"
FT                   /db_xref="GOA:D4M8C1"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8C1"
FT                   /protein_id="CBL28116.1"
FT                   /translation="MQYLGRYTSPLGAITLGSDGESLIGLWFDGEKFFCDKITEDTEEG
FT                   NLPVFDTTRRWLDVYFSGRAPDFTPPLKEIGSDFQLAVWQILRAIPFGHTVTYGDIAGR
FT                   LARQRGLARMSAQAVGGAVGHNSISIIVPCHRVVGANGSLTGYAGGVDKKQKLLTLEGV
FT                   DMSRLFVPRRGTAL"
FT   CDS             898536..899651
FT                   /transl_table=11
FT                   /locus_tag="SY1_07990"
FT                   /product="Predicted oxidoreductases of the aldo/keto
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_07990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28117"
FT                   /db_xref="GOA:D4M8C2"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8C2"
FT                   /protein_id="CBL28117.1"
FT                   /translation="MTCLEEGIKKLGFGLMRLPRDGDAIDVGQTKRMVDRFLAEGFTYF
FT                   DTAWAYPGSEDAIREALVERYPREKFQLATKNAAWLECKTREDAVAQFETSLRQTGAGY
FT                   IDFYLLHNLGEGRTHFFNDFDMWSFVQEKKKEGLIRHAGFSFHSTPEELEDILKAHPEM
FT                   EFVQLQINYGDWENPAIQSRACYEMARKYGKPVIVMEPVKGGMLATPPESVANILRRAD
FT                   ADASMASWAIRFAADLDGVLTVLSGMSDLAQMEDNLSFMKDFTGLSDAERRTLEEAREE
FT                   LAHIPLIPCTTCNYCSKVCPVEVGISGTFTAMNALTLYSDLAAAKHQESWLVGGHGRKR
FT                   AAECVRCGHCEQVCPQHIAIRDELARAAAFA"
FT   tRNA            899792..899866
FT                   /locus_tag="SY1_T_24590"
FT   CDS             complement(910078..910179)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28118"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8C3"
FT                   /protein_id="CBL28118.1"
FT                   /translation="MADDVKTILDEAGVSREAFDTDTNGVRGRRGRK"
FT   CDS             910833..912959
FT                   /transl_table=11
FT                   /locus_tag="SY1_08020"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28119"
FT                   /db_xref="GOA:D4M8C4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8C4"
FT                   /protein_id="CBL28119.1"
FT                   /translation="MFRNMRISLKLSLGFGLVLLVFVVAVAFSRAKISGVQEDNRLMAK
FT                   ISEVLALITDLNDGISGLRFSARGYLYAEDADDMKTGRDSLKALEEGIARGERMYREDP
FT                   RLVALSRISDLKGPLEAYSKNMEEVVSLAEAKRNTVQGLAKDSQEFLDKLNEALVPIYR
FT                   KLQNDISAGNATEAQRRLERVREGEALTTEIGEVRRSYSWVMANRDVSGIDAILSRVDA
FT                   MGKRGQKLLDDTRSEEIRRDLADALTHLHAFSTGVRELADQLVRISELTKIVKQQGDDL
FT                   DELSDAIFDVSQKRTRGIITQTDDNLSLSVLMLIALTVVSVVVGLLIAFLISRMITKPL
FT                   SLLVSVAERAGGGDLTLTRADLGEERNDELGKLSDALIEMVGAQRRTITEAMEIAERSA
FT                   ESADTMRTSSSQSSESIANAKQAIESVVSLCESNSSSLQESNAGTEEMSAASMTAAQAA
FT                   TDCAEFISQTTVVSGQAVEMVQETIEDMGLLFKKSEESGERLRELVESVGQISGFVGVI
FT                   TSIADQTNLLALNAAIEAARAGEAGRGFAVVAEEVRKLAEDSGQAANNIKGLITTLQAG
FT                   ARDTMNSSTESSELLTRTTEKADKAKESLNEAMGQIDKANDRIQNIAAVAEEQAASSRE
FT                   IASGIDAATKSTVDMLQNMERIQSSSDETARVAEEVAKQADGLAVLADRLKGALSRFKV
FT                   SAGASGAGRAALKG"
FT   gap             913095..913760
FT                   /estimated_length=666
FT   CDS             complement(915561..916796)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08040"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28120"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8C5"
FT                   /protein_id="CBL28120.1"
FT                   /translation="MEEKHGVERGGPEGHRRRVGVEAHGIRLPVIQRGDDLVRIVAESL
FT                   IEAARSPYAPFALRDRDVVAVTESLLARAQGNVVSLDDIALDVAGKLDSDEVAVAFPIL
FT                   SRNRFFPLFKALTKAIRGRVHLFLSCPADEVGNHLVDPMEYLKRASGLPECFGLDEFRR
FT                   RFGEYRHPFTGVDYVELYRGVAPDRIEVHFTNNPLNVLKATKCVIMANIHQRGTYAALL
FT                   REQGASVLTLDQICNAPLRDGGGYNAEFGLLGSNFSREGSVKLFPRDAERFALDLQQEV
FT                   LRRSGRRVEAMVYGDGAFKDPACGIWELADPVVSPGFTEGLRGTPSEIKFKMVADNASG
FT                   DAEAAVREAIRSKPASDGKESGLAESRNALGTTPRRYTDLLGSLCDLVSGSGDRGTPVV
FT                   HVSGYFDSWNDE"
FT   gap             918008..918390
FT                   /estimated_length=383
FT   CDS             918879..920732
FT                   /transl_table=11
FT                   /locus_tag="SY1_08070"
FT                   /product="PAS domain S-box/diguanylate cyclase (GGDEF)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28121"
FT                   /db_xref="GOA:D4M8C6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8C6"
FT                   /protein_id="CBL28121.1"
FT                   /translation="MKPFRPAAPSFGLLDEALSALLPADDGDSALSGRQAASLSTEQLL
FT                   ASRDAILDQLPVPLVISDEQDRILYANRALLSLINGPEDFLKGKKLPSILVPRAKLDPH
FT                   SEDAQDPAERERQDLPDGQALILLGAEGVALPVKQLTGSVTWNAYKLTLSALFDLSEQQ
FT                   AANERLLRIAYYDSLTGLPNRDCFMDSLNQELRKLNSADGYTFSVILLNMDRFKLLNEQ
FT                   YGSDTADKVLIEVIERTKTILHGFATIFRTGGDEVMAILKGVSSQSYLESTLDRLLKLI
FT                   SLPIWIDGDSVFPSACLTAMLDIPKDFSALQVLGGLSSSMKAAKKRGLGCVLFVSPATE
FT                   HRDKEAKHKDILKVTAEIQTSLLNDQFIPYFQPIYNTATMQLLGFETLARWRHPTGDIL
FT                   PPGAFIPEAEESGLLTAIDRSIVSQALAVMESFTRKYPNLNFHLNANASGLSLKDASFF
FT                   DFIEGKLKNVTFPTDRFTLEITEDVLMENLGEARGRLEKLKKLNISVALDDFGTGYSSL
FT                   QYISQLPVDSLKIDRSFIDQMLKSRKTASLVKSVIEMARSLNLGIVAEGIETKDQNQWL
FT                   AEYNVAGQGFFFSVPLPVEKADEFLKDVSVFAELIKEMPQL"
FT   CDS             complement(920751..920963)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28122"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8C7"
FT                   /protein_id="CBL28122.1"
FT                   /translation="MSIAVSEVSANLKKPLAPVGAKGIDVAKGGRGAAKLSTPCQDRVD
FT                   VAKSLFGVLAADVTLEEAMEERRSR"
FT   CDS             complement(921119..922048)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08090"
FT                   /product="phosphate butyryltransferase"
FT                   /function="phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28123"
FT                   /db_xref="GOA:D4M8C8"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8C8"
FT                   /protein_id="CBL28123.1"
FT                   /translation="MEQIRSLSQLIEGAKKLCAEKGKKRLSVAMAEDAGLIAAIEEARK
FT                   AGMVEATLVGNPDRVRACIQEAGASEKDYNVIEERNEAKCGIVAVTEVSAKRADIYMKG
FT                   QLHTDHFLRGMLNKEVGLRSGKTISHCYFHHIPGYDRVLFIADAAFNMYPDVKQKADIL
FT                   QNTVNFARALGVECPKVACLAAVEVVNPDMPCTLDACALVQMNQRGQIRNCIVDGPLAL
FT                   DNAINEEAAKIKKINSPVAGHADILFVPQIEVGNVLAKSITYFSRDSETAGLIIGAAAP
FT                   VILTSRADPMRAKLLSIAGAVMMAHHKG"
FT   CDS             complement(922104..922925)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08100"
FT                   /product="Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28124"
FT                   /db_xref="GOA:D4M8C9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8C9"
FT                   /protein_id="CBL28124.1"
FT                   /translation="MKLCYVNGRFTPPEEAALPLSDLLVQRGVGVFEVIGTYGGRPLLL
FT                   TPHLERLLNGAERERIRPTLSMEDMKRLVREGLARAGGDVQVKVYLSGGDVFDDVEGFT
FT                   APRFFMIFEELSPPPRKAYEEGVALAPLPFGRKDPAVKSVDYRTTYALSRSGAFEVLYC
FT                   PDGEITEAGHSTFFLVLEGRLVTAPLSRVLKGTTRSVILELARAEGIETQERCPRVDEL
FT                   PRASEAFITGSVKKVLPVVRVGEQRIGTGRPGPVAARLLKLYLDRIQNWLE"
FT   gap             923126..923258
FT                   /estimated_length=133
FT   CDS             complement(924818..925369)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28125"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8D0"
FT                   /protein_id="CBL28125.1"
FT                   /translation="MKVSRVKVGMGVLVVGIVALVRYAMRDMRLDVDLLREGLMNIPGL
FT                   VMENMQLAREVSGDVWHVRVPYLERRGELVAVRSVDVRRQIREGGEWYLFGAEGVYSND
FT                   ERTACVNGLLGTLEAPARIWNLESPRLLWSEASGDFVFPRGLTLYDDEFLLSAPEASMD
FT                   RTGVVLLEKGGQLQWTKPLG"
FT   CDS             complement(927846..929456)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08170"
FT                   /product="CTP synthase"
FT                   /function="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28126"
FT                   /db_xref="GOA:D4M8D1"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8D1"
FT                   /protein_id="CBL28126.1"
FT                   /translation="MVKYVFITGGVVSSLGKGITAGSVGTLLKKRGLKVSILKVDPYLN
FT                   VDAGTMNPFQHGEVFVTDDGAETDLDLGHYERFIDETLSEQNTITTGKIYSSVIARERR
FT                   GDYLGGTVQVIPHITNDIQERLVRAGEGLDVLIVEIGGTVGDIESQPFLEAIRQMANRV
FT                   GRENVVYCHVTLIPWLEAAQELKTKPTQHSVQELRRIGILPNLLVCRTSHPMDQGMKNK
FT                   IALFCTVPSEAVIEVMDEPTIYNVPMALHRQRLDDLILRYLELPCDAEPDLSDWSRVVD
FT                   RFMNPQESVDIALVGKYVQHKDAYLSVVEALHHAGIHHDVRVKVHSVEAEDLDSCDLAG
FT                   VLGSMDGILIPGGFGPRGVEGMIRAIQYARENRVPLLGICLGMQMMVVEYARNVCHLHG
FT                   AHSKEMDPSTLHPVIHLMEEQRNIDRLGGTMRLGAYPCDLTEGTLAARAYGTLHISERH
FT                   RHRYEFNNAYRERLEGAGLKVAGVCPKQDLVELVELPGHPWFVGGQFHGELKSRPIRPH
FT                   PLFAGFVGMALERQRADRG"
FT   gap             929528..929814
FT                   /estimated_length=287
FT   CDS             complement(931662..933413)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08190"
FT                   /product="transcription termination factor Rho"
FT                   /function="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28127"
FT                   /db_xref="GOA:D4M8D2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8D2"
FT                   /protein_id="CBL28127.1"
FT                   /translation="MVKVLDEKAATPRRRGRPPRVKEPAEALEEVKATQPEEAEGSSPA
FT                   EESAVVKVRRPRGRPPKNAAKKIEEAETSQQLLLLPDARRVEAVEPSEASKPEVPAPDE
FT                   PVDEMEETTAYGAEPDSASEAQVVQPVEDGESPAPLEPAPDEPAEARAPYARASVHEVT
FT                   PHPKPKHTYSYLAAQTLTDLRKIGREFNVAGPTTMHKDDLIISILKAQAESMNYRFGGG
FT                   TLEILPEGFGFLRPKGMLPTDNDVYLSLSQIRRFGLRNGDVIWGLIRPPRDQEHYEALL
FT                   RVETVNFSDPESSRHRPMFAHLTPIFPNVRINLDSGPGDWATRLVDMFAPIGLGQRALI
FT                   VSPPKAGKTTLLKRIAKAISANSPDIILMALLIDERPEEVTDISRSIDGEVIASTFDRP
FT                   ADEHIRVANLAIEKAKRLVEAKRDVVILLDSITRLARASNLTVPPSGRTLSGGLDPSGL
FT                   YFPKRFFGAARNFEEGGSLTIIGTALTDTGSRMDDVIYEEFKGTGNMELHLSRKLAEQR
FT                   IFPAIDITRSGTRREELLIPEDELARLWALRKRIVGVDEAGALNLILDKLKQTKDNHEF
FT                   LMSIKLA"
FT   gap             933489..934075
FT                   /estimated_length=587
FT   CDS             complement(934216..935172)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08210"
FT                   /product="6-phosphofructokinase"
FT                   /function="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28128"
FT                   /db_xref="GOA:D4M8D3"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8D3"
FT                   /protein_id="CBL28128.1"
FT                   /translation="MDRIAVLTSGGDSPGMNAAIRAVARTCHYNDKECIGVMRGYEGLI
FT                   EGDFKVLDRASVGGIIHRGGTILKTARSDRFKTQEGREAALLKMKEAGIEGLVVIGGDG
FT                   SFHGAKALHEMGMPVIGIPGTIDNDVAGTDETIGFDTAVNTALEAIMRLRDTASSHDRL
FT                   FIVEVMGRNAGFLALETAVASGAEYAVVPEIPLSIGNLCKLLRESHAEHKSHTLIILAE
FT                   GVMSATEMRDKLQDTGGYDARVTVLGYIQRGGSPTSFDVVLATRMGAFATDNLLIGKSG
FT                   FMVGNVNHKLVLSDLERSWTEHKNLSPELLNLIHKMN"
FT   CDS             complement(935196..935945)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28129"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8D4"
FT                   /protein_id="CBL28129.1"
FT                   /translation="MKKTVWLVLALAICLVPHAAFAADLPELARWTRTSDFADRDEAQR
FT                   VKVSVVYYSNEYVEALVKAEAEKNLWTRDETENYKYTLLKTLNFHDAIAFQLTLYVEGL
FT                   PMYAQPFDRHISLWIGNKRYNPTDYDKRFNVKILGERDGMIWFPRYDPKTGAELLKGAK
FT                   DIRLVLDGAISQAISPRGDAMWVWDITKDVEGALGNGRAMDRLELDRLIKRLEKLNQER
FT                   GALQLQVDSIDQELNKVNSRIDELQGR"
FT   CDS             complement(937176..937970)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08240"
FT                   /product="Flagellar biosynthesis pathway, component FliR"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28130"
FT                   /db_xref="GOA:D4M8D5"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8D5"
FT                   /protein_id="CBL28130.1"
FT                   /translation="MRGIELPAQLLIVCLLLHLRFVGLVFSAPVFTSVMAPTPVRYLFA
FT                   ALLTFSAAGGLGGAEVPLFYFDSVFSIALLGVREVLIGVALGFLSALPLVALRVAGEQV
FT                   GTVIGFSMAQVLDPTTQTESSIIGQLEFLVGLWFYYHWNGHLLMIQAVMESVRLAPVGR
FT                   LLPFPPDLIEVGTWLQDLFILAMRITLPFFCSLVLADVGLGFLARTVPQMNIFVLGLPI
FT                   KVALGFMVLAAVLPLTVDLIYTQFERWIEFALEGVLPWSAAP"
FT   CDS             complement(937990..938265)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08250"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28131"
FT                   /db_xref="GOA:D4M8D6"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8D6"
FT                   /protein_id="CBL28131.1"
FT                   /translation="MAETALSLFDLLSQSIWTMLVVSLPVLLVAMSVGLLIGILQTATS
FT                   IQEQTLIFIPKILAVFICIILLSPWMGQRMLVMTREILGQLERFIQ"
FT   CDS             complement(939562..939924)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08280"
FT                   /product="response regulator receiver protein"
FT                   /function="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28132"
FT                   /db_xref="GOA:D4M8D7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8D7"
FT                   /protein_id="CBL28132.1"
FT                   /translation="MGKKVLIVDDAAFMRMMLKDILQKNNFEVVAEAENGKAGVAAYQK
FT                   YKPDIVTMDITMPEMNGIDAVKAIKALDPDVKIVMVSAMGQQPMVIEAIQAGANDFIVK
FT                   PFQPERVIEAITKVLS"
FT   gap             940283..940501
FT                   /estimated_length=219
FT   CDS             complement(942646..943101)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08320"
FT                   /product="Flagellar basal body-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28133"
FT                   /db_xref="GOA:D4M8D8"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8D8"
FT                   /protein_id="CBL28133.1"
FT                   /translation="MKRMIVFVVIGLVMFGVGFGGGLMLGRTMASGEGGAAKAREVAEP
FT                   GPIVTIGEFTSNLAGAGRHVVSFTVSLELVNKKEEIAAAVQNMGWLVRIKNEILLIAKD
FT                   KTYDDLNSAEGTVQFQGDIKRVLNSILPNVGGEAPIAQVLFESFVLQ"
FT   CDS             complement(943850..944569)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08340"
FT                   /product="Flagellar motor component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28134"
FT                   /db_xref="GOA:D4M8D9"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8D9"
FT                   /protein_id="CBL28134.1"
FT                   /translation="MAGGGNFGAYIDVPSMMITIGGAVGATILSNPSDRLKAIGGGLKS
FT                   AFVSHEPNLVGMVQMIVSFAEKTRREGLLALESDVAELDNEFLKKSIQLVVDGTDPELV
FT                   RAILDTEIGVLEDRHSANKSVFDTLAEFAPSYGMIGTLVGLIAMLGNLADVSSLGPNMA
FT                   VALITTMYGSMMANMFGIPIGKKLAARSAQEVVAMELMVEGILAIQAGENPRIVEEKLK
FT                   VYLPPRLRSSFDKKEGE"
FT   CDS             complement(944661..944900)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08350"
FT                   /product="Uncharacterized protein, possibly involved in
FT                   motility"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28135"
FT                   /db_xref="InterPro:IPR009384"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8E0"
FT                   /protein_id="CBL28135.1"
FT                   /translation="MIEVHRLNGERFLLNSDMIETINVTPDTVVRLLNGHRYIVREGID
FT                   EVCEKIIAFRKLAGYTCIVANSADEVEDSEGAGS"
FT   tRNA            complement(945172..945246)
FT                   /locus_tag="SY1_T_24840"
FT   tRNA            complement(945260..945335)
FT                   /locus_tag="SY1_T_24830"
FT   tRNA            complement(945351..945427)
FT                   /locus_tag="SY1_T_24820"
FT   tRNA            complement(945438..945512)
FT                   /locus_tag="SY1_T_24810"
FT   gap             945815..947518
FT                   /estimated_length=1704
FT   CDS             947824..949548
FT                   /transl_table=11
FT                   /locus_tag="SY1_08370"
FT                   /product="Adenine specific DNA methylase Mod"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28136"
FT                   /db_xref="GOA:D4M8E1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8E1"
FT                   /protein_id="CBL28136.1"
FT                   /translation="MPTLEWIGKDKVINHHQEVPFRVLEKKYTVGADESDNLIIRGDNL
FT                   EALKALLPRYEGRVKCVYIDPPYNTGNEGWVYNDNVNDPRIRRWLGAVVGKEGEDLSRH
FT                   DKWLCMMYPRLRLLHRLLSPAGAIFISIDDAEYSNLKAVCDEIFGPDCFVSNISWQRTY
FT                   STRNDSKGIVNEVEHILTYSRRPGWNPNKLPRTEEMDAKYRNPDNDVALWRSDNPFAPG
FT                   AATHQGMVYAIQHPFTGEMIYPTNGRCWTFGQDQMLEIMSGWTAYKLQDLHDEEARAIV
FT                   CGVAAEEVRPGVQAIVLAVPPEKAAADARKVYKRGQWPRFYFTKGGKGGITRKTYLDSV
FT                   GGRLPTNLWTYAETGHTDEAKKEMLAIFDGRATFDTPKPRRLVEFVLKIAGDPDSIILD
FT                   SFAGSGTTAHAVLNMNKADGGRRRFILVEMMDYAESITAERVRRVINGYGGTEGTGGDF
FT                   TFCELGPTVMTAEGLINPRTPTERLMEYVWYTETRQPWAGAPTDASPWRLGEWNGTEYY
FT                   FYYEPDRPTALDEAFLRTLPAGPAARVIYADICTLSAAKLKKYGVLFKKIPRDITKI"
FT   CDS             949561..952281
FT                   /transl_table=11
FT                   /locus_tag="SY1_08380"
FT                   /product="DNA or RNA helicases of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28137"
FT                   /db_xref="GOA:D4M8E2"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8E2"
FT                   /protein_id="CBL28137.1"
FT                   /translation="MELKSYQQDVLADLSRFLDLLNETQNSREAYRRLWEERGVPVTDG
FT                   GKSGMATYRVGLEGVPEVCLKVPTGGGKTFIAANAVRRVFNAMPARRVRAVAWLVPSDA
FT                   ILTQTHQALSTASHPYRQQLNLDFSGRVEVYTKQELLNGQNFNPVAVTEQLSVFVLSYD
FT                   SFRTKNKEGRKAYQENGNLAPFARFYREQEAESGGASAEADDTALIQVIRRMNPMVIVD
FT                   ESHHAQSELSREMLANFNPCFVLELTATPKERSNVISFVDAVQLKREHMVKLPVIVYNR
FT                   RTQGDVYADAISIREKLERAAASEKSGAYIRPIALFQAQPKNSTDNATYQKIRDTLVDA
FT                   GIPEAQIAIKTADRDELRGVDLLSQDCPVRFIITVNALKEGWDCPFAYVLATVANRSSP
FT                   VDVEQILGRVLRLPHARKNKSEVLNLSYVITSSADFYDTLERVVAGLNNAGFSSRDYRA
FT                   EDSAPAAEADTQPSALQLHISPEADSMNPSGAHETPEANEDQDVDVVALKTRVAEAMKP
FT                   DEDRSSEPEISDEIPGHDLLARALEQNAKYEAEMEKEEGGDGKNGGGLSRVPVEVREKM
FT                   EYFAMREEYRETAQKLILPQFMIQKEMLLLSLDEGDYANYEIVEPEDLTVDFTLRNKDT
FT                   MIDFSTMNTQIGGVDVGAKGEAPRAWKLSEADSLQFKKWFSSQPSTVRIAVCRQTIFEQ
FT                   LSSKINCISDVDLRKYVERVVENMDSDQLGDMEQSPFPYFRKIQEKINALLTEHRRKRF
FT                   ELLLNQGKIICRPSFRLREVISPVRHTAAIAKSLYTAEEDMNGYERDMVMELSGMDNLL
FT                   WWHRNIAKREFQINGPLHAYPDFIAMTKSGKVLMIEAKGDHLENADSREKAWTGDKWAS
FT                   AAGKDFRYYMVFQQRQPGWPGTCNIEAFKAIARGL"
FT   CDS             complement(952340..953467)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08390"
FT                   /product="Membrane protease subunits, stomatin/prohibitin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28138"
FT                   /db_xref="GOA:D4M8E3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8E3"
FT                   /protein_id="CBL28138.1"
FT                   /translation="MNFKEEKMKITVGENERAFLFRNGRFVRMLGTGKHRLFRFLGEEV
FT                   RRLDVNDEPLNADIPLPVYLRDENFAREVETVRVSDGHVALHYVDGRFAGVLEPGEHTY
FT                   WKVFRSHDFKLVDTEDDTATLPPLVQEAIPNSLCERVEVDAHEVALLYVDGRFERLLEP
FT                   GRYFFWRNGRNIDWTPCDLRIRQVDVAGQEILTLDKVALRLNFVCTYRVLDPVRLYREQ
FT                   EDPERQLYAALQLALREVVGHLRFDELLERRNDLGSLVLEALPHDGIVEFVSAGLRDIV
FT                   LPGEIREIMNTVLVAEKKAQASVITRREEVASTRSLLNTAKLMEENATLFKLKELEYLE
FT                   RICEKVGSISLDNASGILEQLRTMTALSGTKSDER"
FT   CDS             954020..956374
FT                   /transl_table=11
FT                   /locus_tag="SY1_08400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28139"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8E4"
FT                   /protein_id="CBL28139.1"
FT                   /translation="MLNERGREAPFQDEGGKEMRFSELVKSLDRARRYLRDFYLFGYRT
FT                   REEYEARRSYDNERRRIESWLGDSMRRTPAPGGRAVSLCLDAADEPRNPLYALWATKSF
FT                   TRNDILLHFLLLDLLSDGASLAADEATDALAERWGEVFGTATVRLKLKEYAELGLVEEV
FT                   DSGRRQRFRLAPLCAEDLGGDLLEAVDLFTEAAPFGQIGARIQDELGRVNVLFRFKHDF
FT                   LVHTLDDAVLLTLLTATAEGREVVLKLRDRTVSGTPVKALFGLQSGRRYGVLHRGGRFT
FT                   LIRLDRVDSARLGEPVPDFEAKRQAFDALLPRLWGASLPYPLREERVRMVLTTEGRRER
FT                   YVAERLKREGRGGSVTERPDGTIVYERRASDSMEMLPFLRTFTGRILSLKGDNRRMLRR
FT                   FHDDLRRMEALYSGDGGSVPCGPMPKEGSVPRTARSGSKGNAASDGGRCRAADALFHEA
FT                   FGRYYVIAARLLERADREGPLTLEAIRRRVARWGFAETPALMLPPLTEGEWPLFQRGAD
FT                   RAFVPRLRSVRRPLSTLERRWLAALLEDERMGLFLEPEALRRAKARLSGAAPLFRASDL
FT                   CAFDRSHDPDPFRDEEYRSVFRTVLTSLREGRLLWARFTSGHGREVRGNFLPRRLQYSL
FT                   KDDRFRLLARRADPGLPAWEETINLARIQCAVLGTRYAAAEGAALPSARTEPVVLLLTE
FT                   ERQAMERALLHFASFPCRPQTGPSGERLLHILYDTQDEKELLIRVLAFGPLVRVLGPER
FT                   FVEMVRRRVREQARLLGHAAPQGEGDTKGAV"
FT   CDS             complement(956450..956818)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08410"
FT                   /product="Uncharacterized protein with conserved CXXC
FT                   pairs"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28140"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8E5"
FT                   /protein_id="CBL28140.1"
FT                   /translation="MTRERKFICVSCPLGCGLTVALDGDAIVSVSGNSCPRGKTYAESE
FT                   VKNPCRVFASTVRVKGGRLPVCPVRSRTPAPKGKLLDIARAVGELEVPAPIAIGQTILK
FT                   GACGTDVDIVASRDLSAL"
FT   gap             956875..957052
FT                   /estimated_length=178
FT   CDS             complement(958293..959786)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08430"
FT                   /product="Predicted dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28141"
FT                   /db_xref="GOA:D4M8E6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8E6"
FT                   /protein_id="CBL28141.1"
FT                   /translation="MSREEFDVAIIGGGVVGASLARELTRWRVRVVVLDRAAELPSGAS
FT                   RANSSMIHGGFDDSPNTLKARFCPEGNRMYHALKDELDFHLDECGSYVCAFDDKDMAHL
FT                   EKLLVQGRANGVPGLEIVTRERLRGNEPNVSPDVKAALWSPTAAIVNNFEAVVAFMESA
FT                   KINGAVLRLETRVTGLMLDDRGEVRGVETDRGPVYVPIVVNAAGVHSEEVASWAGEPDF
FT                   HITPTRGEYFLLDRTAGDFVTSFLFACPSERGKGVTVARTAEGNLLAGPTATVQKDRDD
FT                   TATTPEGLAQVLEGARRLVPNFPVNLNITTFAGVRANTDTGDFVIEALKAPRGFVNVAG
FT                   IKSPGFTSAPAIAVHVAEMIRAELGDRASFEPNPHFVPERRGIPRFAELPMEERARLAR
FT                   EDPAWGQIVCRCETVTEAQVLEAIRRGARTVAAVKIWTRAGAGRCQGGFCCPRVAEILA
FT                   RELQIPLTEVTRHGGNSRLLLGGAKEFLLDEGRGEEARS"
FT   CDS             complement(959916..961448)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08440"
FT                   /product="glycerol kinase"
FT                   /function="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28142"
FT                   /db_xref="GOA:D4M8E7"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8E7"
FT                   /protein_id="CBL28142.1"
FT                   /translation="MSEKKYVAAIDQGTTSTRCMIFNKKGLPVCSDQMEHAQIYPHPGW
FT                   VEHDPMEIWSRTQDVIRNALERGGISPAEIAAIGITNQRETTVVWDKATGRPIYNAIVW
FT                   QCVRTQDFCAQWQKMPGWEQTVTGEGKVKDHTGLLINPYFSGTKIKWILDNVPGARERA
FT                   ERGELLFGNTDCWLIWNLTGGPNGGVHVTDVSNASRTLLMNIETLQWDKAMLDFLDVPE
FT                   AMLPKIMPSSGVFGMTAKNGPFGAEIPVSGDLGDQQAALFGQACLKKGEAKNTYGTGCF
FT                   MLMNIGEKPIQSMNGLLTTAFYSREQGKCVYALEGSIAIAGAAVQWLRDNLKLVDAAPD
FT                   TEFFASKVEDSGGVYFVPAFSGLFAPHWDMTARGAIVGLTRYVQKSHIIRATLESICYQ
FT                   TRDVIDAMQKDSGVNLTSLKVDGGAVKNDLLMQMQADILGVEVVRPVVNETTALGAAYA
FT                   AGLAVGFWKDENEIRANWAVDRKFASLSLPEKREKMYAGWKKAVEKSRGWTE"
FT   CDS             complement(961561..962295)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08450"
FT                   /product="Glycerol uptake facilitator and related permeases
FT                   (Major Intrinsic Protein Family)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28143"
FT                   /db_xref="GOA:D4M8E8"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8E8"
FT                   /protein_id="CBL28143.1"
FT                   /translation="MQSWLGPVFGEFFGTLVLIVFGDGDVAATALKGSKGEGAGWVHVN
FT                   WGWAWAVVMGIFAAQATGSPQADINPAVTLAKFMAGTYAANEALVVMAAQFVGAFLGAV
FT                   IVYFAYLNHWEGTAPDAQLAVFCTGPARRNYPCNFLTEVIATFFLVTGIMCIFSKGVGG
FT                   QGGWMGAFMVGGLIYVLGAALGGPTGYSMNPARDFGPRVAHFVLPMAGKRDSDWGYAWV
FT                   GTIGPWAGAAVAFFFCRAFGLM"
FT   CDS             complement(962929..963330)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28144"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8E9"
FT                   /protein_id="CBL28144.1"
FT                   /translation="MTIDALRESASRAGRARRTEVDPEVHRSKEAGRLRESCQQFESIL
FT                   WAKLWKEMRNTARSFTTSKDRPWKQMEDLSLEMACDELVERSGGAGLWKMLYDSMIERV
FT                   AAEQERERADGEGQDAGDAEAPVSFDARA"
FT   CDS             complement(963345..964487)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08480"
FT                   /product="Flagellar basal-body P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28145"
FT                   /db_xref="GOA:D4M8F0"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8F0"
FT                   /protein_id="CBL28145.1"
FT                   /translation="MKCFRALGFVLACLLVGLQTAGATASVNLQDMDFTKLHPRVRIKD
FT                   IADIEGARDNQLTGVGLVTGLRGTGDNSAMTTHMMRNMMRNFGVTLAPNEVKTRNVAVV
FT                   SLTATLPPYARPGQRIDVSVNAIGNAQSLQGGTLIQAPLHAADGNVYAVAQGSVLVGGW
FT                   AADGSSASTTKNVPTVGRVPSGAIVERDVPSDFTLGGQMALLLRDPDFTTAQRVADAIN
FT                   QKFGAIASPVDAGRVAVNLPGQYLAAPTAFLANVERLEITPDMVARVAVNERTGTVVMG
FT                   GNVRISSVAVAHGNLTVSVKDDPNVVQPEAFSGGETRVEIRTDITVNEDGASMIAMPAT
FT                   TTVRDMVRVLNAIGATPRDIITILQAIDKAGALHGQLVNM"
FT   CDS             complement(964501..965103)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08490"
FT                   /product="Flagellar basal body L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28146"
FT                   /db_xref="GOA:D4M8F1"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8F1"
FT                   /protein_id="CBL28146.1"
FT                   /translation="MKICFRQGRGAALTALALCALLGTFLAGAADAASLWDDRTNWIVD
FT                   VRPGRVGDVVTVLVNERTNAKDEATMDLKKSSSNSVSDGTGILKFIRALSLTSKNSSAG
FT                   DGSFERKHHATATVACLVTEVLPNGNLVIEGTRDVRTSEETLQIQLVGVIRPQDVNSDN
FT                   QINSSLVANAELAVKGRGAIARTQKPGIISQILQAVF"
FT   CDS             complement(966105..966911)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08510"
FT                   /product="flagellar basal-body rod protein FlgG,
FT                   Gram-negative bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28147"
FT                   /db_xref="GOA:D4M8F2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8F2"
FT                   /protein_id="CBL28147.1"
FT                   /translation="MLRALWSSASGMIAQQTNLDVVSHNLANVNTQGYKKRRADFEDLL
FT                   YQVWREPGTPVEPNSTVPTGVQVGLGTRVTATPSFMTQGHFQITDNKMDWAIAGQTMAG
FT                   ENAFFQVTQQDGTIAYTRAGAWEIDGDGQIVSEDGLLLEPAMVVPENATSVQLTRTGRV
FT                   MVTIPGQTEPQEIGQLELARFINPAGLRALGDRLFLETSASGAPIVGQPGQNGMPTVRQ
FT                   GVLEMSNVQVVEEMVGMIIAQRAYEANSKGIQTADELLRIANGLKR"
FT   CDS             complement(967995..969041)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08530"
FT                   /product="rod shape-determining protein MreB"
FT                   /function="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28148"
FT                   /db_xref="GOA:D4M8F3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8F3"
FT                   /protein_id="CBL28148.1"
FT                   /translation="MFGTDIGIDLGTATVLIYERKHGVVLREPSVVAVDQDTGNILAVG
FT                   YEAKNMVGRTPGSIVSVRPLRDGVIANYSMTEAMLQHFMRRVTKGWQRFFRNRVMICVP
FT                   SGATDVERRAVLEAALEVGASEAYLIEEPMAAAIGASLNVEEARGKMLVDIGGGTTDIA
FT                   VISLGGVVVSKSLRLGGDKFDEGIMRYLRRQYNLAIGEQTAENLKIMIGTCVPLEEDQR
FT                   MVIKGRDLVQGLPRQVEVTSSAVNMAIGEMVQTLVDGVRNVLELTPPELSADIIDRGIV
FT                   LTGGGSLLRGLPELVAQQTGINCFTAENPMESVALGTGRALAEIDSLRSSGRSGILVNL
FT                   KKGRRRRY"
FT   gap             969429..969773
FT                   /estimated_length=345
FT   CDS             complement(971879..972181)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08580"
FT                   /product="LSU ribosomal protein L17P"
FT                   /function="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28149"
FT                   /db_xref="GOA:D4M8F4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8F4"
FT                   /protein_id="CBL28149.1"
FT                   /translation="MLGNMAASLFLSGQVRTTVTRAKELRRVAEKLITRARGGSVHDIR
FT                   VVFSRMPHKEAATKLFKEVAPRYMSFDKGGYTRIVKLGVRAGDGSEMAVVQLIEK"
FT   CDS             complement(972242..973243)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08590"
FT                   /product="DNA-directed RNA polymerase, alpha subunit,
FT                   bacterial and chloroplast-type"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28150"
FT                   /db_xref="GOA:D4M8F5"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8F5"
FT                   /protein_id="CBL28150.1"
FT                   /translation="MLETLEILRPVLKLEENTPTYGRLYLEPLERGYGMTLGNALRRVL
FT                   LSSIRGAAITSVRIDGVLHEFSTVPGVREDVMEILMNLKHIPVRSKSKEVRVVSLDVER
FT                   AGLVTAGDIPENGEIEFIDPNAKICTMEEGAHLSMELYIEQGTGYLSAERPRPAYLPVD
FT                   ALLTDAIFSPVLRVNYGVEAARVGQRTDFERLAMDVWTNGIIAPDAAVGEAAQIIEKCF
FT                   SYIVASVGQAGPDGVGGGAYDIDLGADRRIGPAGNEELLARPVRELELSIRSENCLLRG
FT                   GVQTIGDLLQKSREDLLKIRNLGKISLTEIEEKLESAGLKLREKKEKAGKED"
FT   CDS             complement(973764..974141)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08610"
FT                   /product="SSU ribosomal protein S13P"
FT                   /function="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28151"
FT                   /db_xref="GOA:D4M8F6"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8F6"
FT                   /protein_id="CBL28151.1"
FT                   /translation="MARISGVDLPREKRIEIALTYIFGIGVPSARKILAATGVNPDVRV
FT                   KDLSEDDAQKLRREIEEHYVVEGDLRREVSMSIKRLMDIGCYRGLRHRLGLPVRGQKTK
FT                   TNARTRKGKRRTVANKKVATK"
FT   CDS             complement(974315..974545)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08620"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /function="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28152"
FT                   /db_xref="GOA:D4M8F7"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8F7"
FT                   /protein_id="CBL28152.1"
FT                   /translation="MANAGGKEEVIEAKGVISEPLPNAMFRVELENGHKLLAHVSGKMR
FT                   MHFIRILPGDRVLVEVSPYDLSRGRIIYRYK"
FT   CDS             complement(974575..974883)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28153"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8F8"
FT                   /protein_id="CBL28153.1"
FT                   /translation="MDKPDGPLGPDPVSCRLGQVVRSTKGKDRGRLYVVVGFLDGNRLA
FT                   LADAERFNVLQPKKKNPRHVQVTPQCAAELVALIEAGKNIDRGRFCQILAGLGMRLD"
FT   CDS             complement(974859..975644)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08640"
FT                   /product="methionine aminopeptidase, type I"
FT                   /function="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28154"
FT                   /db_xref="GOA:D4M8F9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8F9"
FT                   /protein_id="CBL28154.1"
FT                   /translation="MLHLKTPEEIDLLRKAGRVVADILDHIGTVVRPGVSTGELDRIAD
FT                   EHISACGGTAAFKGYRMTSRTPPFPGIVCASINDEIVHGIPSDERKLEEGDILSIDVGV
FT                   CLNGYFGDAACTYPVGAISPERQRLLEVTETSLNRAIEAARVGKTVGDIGYAVESYAVP
FT                   LKYGIVRDYTGHGVGRKLHEAPQVPNFGRPGRGVMLQRGLTLAIEPMIMSGREAVRVGE
FT                   NGWTVLTADGSDAAHFERSIVVLDDGPEILTPWTSRMGR"
FT   CDS             complement(975631..976287)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08650"
FT                   /product="Adenylate kinase"
FT                   /function="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28155"
FT                   /db_xref="GOA:D4M8G0"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8G0"
FT                   /protein_id="CBL28155.1"
FT                   /translation="MRLVLLGAPGAGKGTQAALLKEREACVHVSTGDILRKNLGERTPL
FT                   GLEAKKFMDQGVLVPDDLVLKMVSSRLLEPDAAEGFLLDGFPRTVPQAEFLESFLTEHH
FT                   AKLDAVLLFSIADEALVRRLSNRRTCRSCGGIFNLLTMGGAAGAKCPSCGGELHQRDDD
FT                   QEAVIRNRLKVFHEQTEPLIAWYRDRGLLSEIDAASAPETIYAGVKAALNRHAAP"
FT   CDS             complement(977613..978059)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08670"
FT                   /product="LSU ribosomal protein L15P"
FT                   /function="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28156"
FT                   /db_xref="GOA:D4M8G1"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8G1"
FT                   /protein_id="CBL28156.1"
FT                   /translation="MNLHDLRPAPNSRTKAKRLGQGIGSGTGKTSGKGNKGHKARTGGG
FT                   VRPGFEGGQMPLVRRTPKRGFNNARFARTYQIVNVGSIEDKFEAGQEVTPDTLMRAGLI
FT                   SGASLPVKVLAKGDLLKALTVRANAFSKGAEEKIKAVGGKAEVI"
FT   CDS             complement(978074..978256)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08680"
FT                   /product="LSU ribosomal protein L30P"
FT                   /function="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28157"
FT                   /db_xref="GOA:D4M8G2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8G2"
FT                   /protein_id="CBL28157.1"
FT                   /translation="MAKIKVKWVKSAIGFAERQKRTIKALGFKKLQSTVEHEDTPQIRG
FT                   MIEHVRHLVVWTVED"
FT   CDS             complement(978268..978789)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08690"
FT                   /product="SSU ribosomal protein S5P"
FT                   /function="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28158"
FT                   /db_xref="GOA:D4M8G3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8G3"
FT                   /protein_id="CBL28158.1"
FT                   /translation="MIKKRIDAKSLDLKERVVAINRVSKVVKGGKRFKFAVLVVVGDGD
FT                   RYVGAGIGKAKEIAEAVRKGIEKASKELVAIRRNGDTMPHPVTGCFGAAKVLLKPAPAG
FT                   TGVIAGGVVRAIMELGGVKDVVTKVVGRTSNSINVAWATLEAIKETRTADEIYKLRGRK
FT                   PAEPASASAD"
FT   CDS             complement(979745..980149)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08720"
FT                   /product="SSU ribosomal protein S8P"
FT                   /function="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28159"
FT                   /db_xref="GOA:D4M8G4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8G4"
FT                   /protein_id="CBL28159.1"
FT                   /translation="MYVNDPIADMLTRVRNANMIYSESVDVPASKMKLAIARILKDEGY
FT                   IKNVKTITDPKKPYASIRIFLSYGPERERVIQGLRRISKPGRRLYVGRDKLPVVMGGLG
FT                   LAILSTSKGLKTGAEAMKLGLGGEVLCYVW"
FT   CDS             complement(980167..980352)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08730"
FT                   /product="SSU ribosomal protein S14P"
FT                   /function="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28160"
FT                   /db_xref="GOA:D4M8G5"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8G5"
FT                   /protein_id="CBL28160.1"
FT                   /translation="MARKALKYKAKLPPKFEVRQHNRCPLCGRIHGYMRMFDMCRCCFR
FT                   KLAREGRIPGVVKSSW"
FT   CDS             complement(980372..980917)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08740"
FT                   /product="LSU ribosomal protein L5P"
FT                   /function="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28161"
FT                   /db_xref="GOA:D4M8G6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8G6"
FT                   /protein_id="CBL28161.1"
FT                   /translation="MVPRMLEKYKKEISPALLKEFGYKNVMQLPRVEKVVVNIGVGDAK
FT                   LDIKFMDAAIAELRAITGQQPLLKRAKKSVAGFKVREGMPVACSVTLRGTRMWEFLDRL
FT                   ISLALPSIKDFQGVSRRGFDGRGNYNLGLREQLIFPEISYDKVIRSRGMNVSIVTSAST
FT                   DEEAHALLKGMGMPFNNR"
FT   CDS             complement(980935..981258)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08750"
FT                   /product="LSU ribosomal protein L24P"
FT                   /function="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28162"
FT                   /db_xref="GOA:D4M8G7"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8G7"
FT                   /protein_id="CBL28162.1"
FT                   /translation="MSVRLKKNDRVRVISGKDKGKEGKILRRIPDRDLVVVEGVNLVSR
FT                   HMRPTQKNPQSGIHKQEAPIYASKVMLVCPHCGAAVRVGSSFLESGKKVRVCKKCSEII
FT                   DKA"
FT   CDS             complement(981273..981641)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08760"
FT                   /product="LSU ribosomal protein L14P"
FT                   /function="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28163"
FT                   /db_xref="GOA:D4M8G8"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR023571"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8G8"
FT                   /protein_id="CBL28163.1"
FT                   /translation="MIQLTTVLNVADNSGARKLFCIQVMGGSKRKWGTIGDVIVASVRE
FT                   AIPNSNIAKGSVVKAVIVRTRKEVRRRDGSYVRFDDNAAVIIDANGEPKGTRIFGPVGR
FT                   ELRAKKYMRILSLAPEVV"
FT   CDS             complement(981645..981947)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08770"
FT                   /product="SSU ribosomal protein S17P"
FT                   /function="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28164"
FT                   /db_xref="GOA:D4M8G9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8G9"
FT                   /protein_id="CBL28164.1"
FT                   /translation="MEPYKETAPAHRKVRVGIVVSNKMDKTVVVKVSRLAEHPLYGKRI
FT                   RRAKKYVAHDAENTCRVGDEVRIRETRPLSKTKRWELVEVMRRAPVFDSDTPGEE"
FT   CDS             complement(981954..982169)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08780"
FT                   /product="LSU ribosomal protein L29P"
FT                   /function="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28165"
FT                   /db_xref="GOA:D4M8H0"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8H0"
FT                   /protein_id="CBL28165.1"
FT                   /translation="MDATKLRELTLDELQEKYSQYKEELFNLRFQNAVGQLKNTSRIRD
FT                   VRKTIARVLTIAGEKRQAMASDAARR"
FT   CDS             complement(982169..982594)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08790"
FT                   /product="LSU ribosomal protein L16P"
FT                   /function="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28166"
FT                   /db_xref="GOA:D4M8H1"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8H1"
FT                   /protein_id="CBL28166.1"
FT                   /translation="MLMPSRVKYRKSHRSPLRGVSKGGTTVAFGDWGIQALENVWLTAR
FT                   QIEATRVAISRKMKKGGKIWIRVFPDRPYTKKPLETRMGKGKGAPEFWVAAVKRGRVLF
FT                   EFSGISPELAAEAFRTASHKLPVKVRIVSREGMGGEN"
FT   CDS             complement(983294..983638)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08810"
FT                   /product="LSU ribosomal protein L22P"
FT                   /function="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28167"
FT                   /db_xref="GOA:D4M8H2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8H2"
FT                   /protein_id="CBL28167.1"
FT                   /translation="MEAKTMARAMARQARIAPTKVRQVLTLIRGKGAEEALTILRFSPQ
FT                   KAARIVYKVLQSAVANAEHNYGMDMDKLYVLTAFADQGPVMKRFRPVSMGRAHPYVHRT
FT                   SHVTVTVAER"
FT   CDS             complement(983652..983873)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08820"
FT                   /product="SSU ribosomal protein S19P"
FT                   /function="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28168"
FT                   /db_xref="GOA:D4M8H3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8H3"
FT                   /protein_id="CBL28168.1"
FT                   /translation="MNISGNKKVIKTWSRRSTVVPQMIGHTIAVHNGRMHLPVYISENM
FT                   VGHKLGEFAPTRKSARHAGQERAAKGVK"
FT   CDS             complement(983959..984786)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08830"
FT                   /product="LSU ribosomal protein L2P"
FT                   /function="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28169"
FT                   /db_xref="GOA:D4M8H4"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8H4"
FT                   /protein_id="CBL28169.1"
FT                   /translation="MSIKQFKPYTPGRRQMTIQGREDITADKPERSLTRELRKHGGRNN
FT                   TGRITMRHIGGGHRRAYRIIDFRRDKIGVPGKVATIEYDPNRNARIALIHYLDGEKRYI
FT                   LLPKGLKVGDTILAGPEADITPGNALKLKDIPVGAVVHNLELQPGHGAKLVRSAGTSAQ
FT                   LMAKEGKYAYLRMPSGELRLFLLECMATVGQVGNEEYENISLGKAGKTRWSGRRSSVRG
FT                   MVMNPVDHPLGGGEGKSKSNKHPVSPWGTPAKGYRTRRHKASDRLIVRRRYDK"
FT   CDS             complement(984803..985099)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08840"
FT                   /product="LSU ribosomal protein L23P"
FT                   /function="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28170"
FT                   /db_xref="GOA:D4M8H5"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8H5"
FT                   /protein_id="CBL28170.1"
FT                   /translation="MSLSAHDIIIRPVVTEKSSALMELNKYTFEVRRDVNKIQIRKAVE
FT                   EAFKVKVLSVNTINVKSKPKRMGASVGRTRSWKKAIVSLPQGQRIEFFEGASI"
FT   CDS             complement(985096..985719)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08850"
FT                   /product="LSU ribosomal protein L4P"
FT                   /function="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28171"
FT                   /db_xref="GOA:D4M8H6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8H6"
FT                   /protein_id="CBL28171.1"
FT                   /translation="MPTIKVVDFSGQSAGEMELSEVVFGAPIHVAAMHQVVVAHLANCR
FT                   QGTHAVKTRGDVSGGGKKPWRQKHTGRARQGSTRSPLWVHGGVAHGPKMRDYSQKVNKK
FT                   VRRLALLSALSVKVRDAQMLVVRGMEMEAPSTKTMKGFMDAIGAEKALVIYSGNGENVA
FT                   RSVRNIPGARYLNVASINVYDLLNSRTLVVTPEVVARLEEVYAR"
FT   CDS             complement(985746..986369)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08860"
FT                   /product="LSU ribosomal protein L3P"
FT                   /function="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28172"
FT                   /db_xref="GOA:D4M8H7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8H7"
FT                   /protein_id="CBL28172.1"
FT                   /translation="MGIGILGKKMGMTQIFDAEGQAVAVTVIAAGPCPVVAVRTPEQNG
FT                   YSAVLLGFGAVKPHKLSKPVKGLFDKNKVEPKRTLREFRLDKAEGYEVGQEIRVDLFEA
FT                   GERIDVSGVSKGKGFAGVMKRYHFGGQQFSHGTSVEHRHGGSSGAISYPGRVFPGKRMP
FT                   GHMGSDKVTVKNLTVMAVDLENNLLLVKGAVPGAKDGLVALYKK"
FT   gap             987142..987642
FT                   /estimated_length=501
FT   CDS             complement(990226..990474)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28173"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8H8"
FT                   /protein_id="CBL28173.1"
FT                   /translation="MPLNELAAGTRVVGEKEVLRALGRDGLRKLFVAKDVESERLRPLL
FT                   EGARALGVEVEWADSRLVLGRACAIDRSASAAGLLKP"
FT   gap             990663..992422
FT                   /estimated_length=1760
FT   CDS             992807..993235
FT                   /transl_table=11
FT                   /locus_tag="SY1_08930"
FT                   /product="Fe2+/Zn2+ uptake regulation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28174"
FT                   /db_xref="GOA:D4M8H9"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8H9"
FT                   /protein_id="CBL28174.1"
FT                   /translation="MTKYASGILDIVSRPGGHLTAEQIFWEMKRRHPAIVMATVYNNLN
FT                   ALCAQGAIRRLRLEGQPDRYDRTIRHDHMICRRCGELTDVFIGDLTDRLRAETGLEVDF
FT                   YELKISWICKKCREKEASAEREERSDSTGRERGAGSAS"
FT   CDS             993300..993863
FT                   /transl_table=11
FT                   /locus_tag="SY1_08940"
FT                   /product="peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28175"
FT                   /db_xref="GOA:D4M8I0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8I0"
FT                   /protein_id="CBL28175.1"
FT                   /translation="MSMINKEVSDFKVQAYHKGEFKTVTKADILGKWSVFFFYPADFTF
FT                   VCPTELEDLQNKYADFQKAGCEIYSVSTDTHFVHKAWHDESERIGKITYPMLADPTHAL
FT                   SRDFEVLIEDAGLAERGSFIVNPQGRIVVYEVNAGNVGRNADELFRRLQASQFVAEHGD
FT                   QVCPAKWQPGAETLKPSLDLVGKL"
FT   CDS             993863..995488
FT                   /transl_table=11
FT                   /locus_tag="SY1_08950"
FT                   /product="putative alkyl hydroperoxide reductase F subunit"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28176"
FT                   /db_xref="GOA:D4M8I1"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR017561"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8I1"
FT                   /protein_id="CBL28176.1"
FT                   /translation="MDDRNFYDVVVVGGGPAGLTAGLYLARACYRVLVVEKETFGGQIT
FT                   ITSEVVNYPGAGRTDGRALTDTMRAQAESFGAEFLMADVTNLELDGDVKKVHTDRGVFS
FT                   CFGVLIATGAHPRVLGFPGETEFRGRGVAYCATCDGEFFTGKEVFVIGGGFAAAEESVF
FT                   LTRYARHVTVLVREDAFTCAEATARGALEHPKVTVLTNTQVVEVSGDTALRRIRYKNSK
FT                   TGTETVFSAEDGDTFGVFVFAGYVPATDLVKGKVELNPQGYVVTDRSQKTSLDGVYAAG
FT                   DVCVKNLRQVVTAVGDGATAATELERYAAAMQAKTGIHPKKPVRTAAAPTREAKREAPA
FT                   EGGLFSEDMRQQMEAVFARMEQNLILELFLDDRPVSRELQGYMTELAGMTDKLTVRTGT
FT                   GLPEAELPCVRVLKADGTDTGLAFHGVPGGHEFTSFMLGLYNAAGPGQSLDDTTRARIR
FT                   AIDRKVGMKVLVSLSCTMCPELVAAAQQIAALNPSVTADVYDINHFGALKERYNVMSVP
FT                   CLVIDDDRVTFGKKGVQQLLDEIG"
FT   CDS             995533..995964
FT                   /transl_table=11
FT                   /locus_tag="SY1_08960"
FT                   /product="DNA-binding ferritin-like protein (oxidative
FT                   damage protectant)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28177"
FT                   /db_xref="GOA:D4M8I2"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8I2"
FT                   /protein_id="CBL28177.1"
FT                   /translation="MEAKMNALLSDLVFFYHKLQSYHWYISGPTFFQTHAKLEEYYDDI
FT                   RPQIDEVAETMLMVGYRPVSTMAAFARHAKVKDASEGFVGDVKAVYASILGDFKHLLES
FT                   VKAIKKDADASDNHLVSTKMDDFIESYSKAIWMISQASM"
FT   CDS             996304..998193
FT                   /transl_table=11
FT                   /locus_tag="SY1_08970"
FT                   /product="GTP-binding protein TypA/BipA"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28178"
FT                   /db_xref="GOA:D4M8I3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8I3"
FT                   /protein_id="CBL28178.1"
FT                   /translation="MQAEKIRNLAIVAHIDHGKTTLIDSIFRAAQTFSAHTQVAERVMD
FT                   SGAIERERGITIRSKPCTVEWGGYLINIIDTPGHADFSGEVERILSTVDSVILIVDANE
FT                   GPMPQTRYVLQHALSIGMKPLVFINKVDREGADPNGALNKTFDLFFELGATDEQADFPV
FT                   LYGSGLAGWAVKDLSDPRRDNMDDLFQAIIDYVPAPNVDPDKPFLMQVSTLAWNEYVGR
FT                   IGCGKILQGHIRKGDPFVRVSTKWNTTDHTGTDWTTTGQENARVVQLWVTRGLERVEVD
FT                   EVGAGDIVWLTGPTEIDIGDTFAAEAIADRPLKPLSIEEPTVSMFFLVNTGPFAGREGQ
FT                   AVTLRQLKARLQREMHVNVSLRMEDLGRPDGVKVSGRGELQLSILIEEMRREGMEFCVS
FT                   KPEVIMETRDGVKMEPYELVTVDVPDEYQGIVFEKMSQRKGKVKNVVNQDRGLLRIEIE
FT                   IPTRGLIGYRGEFLTDTRGLGIMSSCFSGYAPWAGDLVTRSRGSLVSLDTGEATAYQLE
FT                   NLQERGTLFISPLEPVYNGMIVGENSRPGDMPCNPTKRKQQTNHRSATKELTTKLDVPR
FT                   RMSLEKAMEWIEVDELVEVTPQSIRLRKAILDELERRKATRRAGGESDPSNRK"
FT   CDS             complement(998337..999938)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08980"
FT                   /product="ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28179"
FT                   /db_xref="GOA:D4M8I4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8I4"
FT                   /protein_id="CBL28179.1"
FT                   /translation="MKGKKWLLALVAVLCLMGTAWAGEREIVYNLGIEPRTIDPVLNSA
FT                   VDGSTVLYNISEGLVRIGLDDAPEPGCAESWEVSEDGLSWTFHLREGLKWSDGKPLTAE
FT                   DFRCGFQRVFNPENACPFAYVGYFIKNGEECFKGTAKLEELGVTAVDERTLRLDLKHPS
FT                   PLMLDYLSYHIFFPARADVVEQDPRGWSASGSFPCNGPFMITEWKHNSELTVVKNPHYW
FT                   DADKVKLDKVRMVMINDVNTALAAFKGGKVDYNTLVPAPMLPQLLESGEAKARNTLGTY
FT                   FYVFNTARRPFDDARVRRAFALAVDRTAIVEKVTRGGQKPANGFIPYGIPGVDPNDPAA
FT                   DFRAEDKAEYLPPRADVEQAKKLLAEAGYPDGKDFPKVQCKYNSNLGNKAIAEALQAMW
FT                   RQNLGVEVELYNEEWKVFINTRNKKDFDIARHGYLVDFFDAGSLLEMWQTGVWENSASF
FT                   SDAEYDALIRDSLEQMDRAKRIEDMHKAEQILMREMPVCPLYFYTTPSMQSARVKGIYH
FT                   SPRNWVFFRGAEVVEP"
FT   CDS             complement(1000044..1001636)
FT                   /transl_table=11
FT                   /locus_tag="SY1_08990"
FT                   /product="ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_08990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28180"
FT                   /db_xref="GOA:D4M8I5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8I5"
FT                   /protein_id="CBL28180.1"
FT                   /translation="MKGKKWFLALAAVLCLMGTAWAGEKEIVYNLSIEPRTIDPVLNNA
FT                   VDGSNVIFNLFEGLVRIGFDDAPEAGCAEKWEVSEDGMSWTFHLRKGLKWSDGKPMTAE
FT                   DFRYGFLRAITPENASPYAHLGFFIKNGEAFFNGKAKAEEVGLVAVDDVTFRIDLEYQT
FT                   PLMLDYLSYHIFYPARADVIEADPRGWTSKPETALGNGPFMLADWQHNSEMTLVKNPHY
FT                   WDADNVKVDKLRLVMITDSNTALAAFKGGKVDLIDSIPPQMTPQLIKSGEAKVAPTLGT
FT                   SFSVFNVTRAPFDNPLVRRAFTLAVDRTVMAEKVAMGGQKPAVAFIPYGIPGVEPEKDF
FT                   RAEGGAFLPDRADVEQAKKLLAEAGYPDGKGFPKVVYKYNLNPINKAIAEALQAMWKQN
FT                   LGVEVELSNEEWKVFINTRMKHDFDIARHAYLVDFFDAGSLLELWQAGVPENVAGYAND
FT                   EYDALIKDSLKQMDRAKRVEAMHKAEQILMQDLPVLPLYFYSTPYMQSARVKGIYMSPR
FT                   KWVFFRGAEVVEP"
FT   CDS             complement(1001775..1002917)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09000"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /EC_number="3.4.17.11"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28181"
FT                   /db_xref="GOA:D4M8I6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8I6"
FT                   /protein_id="CBL28181.1"
FT                   /translation="MKDQEKRIFDWLSAHKEDIVADLLALVRSESPTGDKAAVDACGRV
FT                   LASLYRDRLGAVSRTVPQTEAGDHLVTEVGEGERTLLIVGHIDTVHSVGSVPVRREGDV
FT                   LYGPGVIDMKGGDIAVVWALKALKDLGLPLGKRVRIVNNSDEETGSESSRGLLLDSARG
FT                   ACACIVPEPATCPDGKVKPSRKGGGEIVVRCRGKAAHAGNNPQEGVDANVELAHQIIYL
FT                   KGLSDYEGKGSTYSPGVISGGKAVNVVSDYAEATVDWRMCVPEEIPRTRSLLAERKAVL
FT                   PGAQVEFEVRVGHPPLAENARNLALLELLKQCGADLDMRIEAAPMVGGCSDGNDISDAG
FT                   VPTIDGMGMVGNFIHNPQEQLFLEHLVPRVALLASLILRV"
FT   gap             1003533..1003837
FT                   /estimated_length=305
FT   CDS             complement(1004209..1005240)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09030"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28182"
FT                   /db_xref="GOA:D4M8I7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8I7"
FT                   /protein_id="CBL28182.1"
FT                   /translation="MNDRMNAMNSSDFLLRVSDLRTSFFTPAGEVKAVGGVSFNVKRGE
FT                   VLGIVGESGSGKSVTMLSVLGLLGTSGRVVGGSIDFDGQELTRMRLRDLEELRGKRISM
FT                   IFQDPMTSLNPVLTVRWQMEESLRRHRIPCDRHDRAVDMLKRVGIVPAERRLTQYPFQF
FT                   SGGQRQRIMIAMAMICNPDLLIADEPTTALDVTVQAQILELMKELQGQFGTSIILITHD
FT                   LGVIAGMADRVLVMYGGRIMERGTRREIFYEPAHPYTRGLLRSVPNPEELVRQRLIPIE
FT                   GQPPDLLNPPAGCPYAPRCPEAMRVCMEYSPDRTELTGSHNAACWLLNRPAGSAADRKE
FT                   GAR"
FT   CDS             complement(1005254..1006195)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09040"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28183"
FT                   /db_xref="GOA:D4M8I8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8I8"
FT                   /protein_id="CBL28183.1"
FT                   /translation="MSSMERAVPDISDPRLFEPVSPEERTRAEFVRPSLSYWQDAWRRL
FT                   CRDRVAILGLVVILIILAMAVVGPWLSPYTYDGQDFMVSNEPPSLKFWFGTDMFGRDIF
FT                   VRVLFGARISLAVGFVASFINLFIGVIYGGIAGFVGGRTDNVMMRIVDVIYSVPTMIYV
FT                   ILLMVVVGPGLKSIFITLGISYWASMARIVRAEVMRIKNEEFVLAARVLGASSTRMLLR
FT                   HLIPNAMGPILVTLTFSIPRAIFTEAFLSFVGLGVSAPMASWGVLSNDAIGSLAIYPWQ
FT                   LFFPAAAISVTILAFNFLGDGLRDALDPRLRK"
FT   CDS             complement(1006210..1007127)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09050"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28184"
FT                   /db_xref="GOA:D4M8I9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8I9"
FT                   /protein_id="CBL28184.1"
FT                   /translation="MRRYIFQRVWASFLTLFVVVTLTFFMMRAIPGGPFTDEKAIPPFI
FT                   LEKIMARYHLNDPLYVQYGHYLWDVLHFDLGPSYRYEGMTVNQLIASGFPASLMVGSIA
FT                   ILLSLVVGIPAGIVSALRRGRWQDRTAMVLATLGITIPNFVIATILVYFFAYRWGWVTV
FT                   GFWEGLPTALLPAITLAGYPTAFISRLTRSSMLEVLQQDYIRTAYSKGLRERAVVYIHA
FT                   LRNAIIPVVTYLGPLIAGILTGSFVVEQVFGVPGLGTFFVTSISNRDYTTIMGVTIFYS
FT                   ALLVSLNLVVDICLGFIDPRIKLN"
FT   gap             1008530..1008707
FT                   /estimated_length=178
FT   CDS             complement(1010406..1012088)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09100"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase and
FT                   related glycosyltransferases of PMT family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28185"
FT                   /db_xref="GOA:D4M8J0"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8J0"
FT                   /protein_id="CBL28185.1"
FT                   /translation="MRPGGREGPRFLRWLAAARPLIPWAVLALLAVAVYFWGLGRYGLI
FT                   DPDEGRYAEIPREMIESGDFVTPRLNYVKYFEKPALHYWLTAASFAAFGQNEAAARLFP
FT                   VLFGLGGCLLTFVAARRMTGSARAGAAAAAVLVSSVLWYALSRLNVIDMTLTFFFTLAM
FT                   LGYWLWFRGGEGAGRRPLLLFYAAMALATLSKGLIGVVLPGGIAVLHLASLRRWRAIPR
FT                   LFSPWGIALYFAVVLPWFRAVCAANPDFFDFFFVHEHFTRYLTTEHGRYEPFWFFVPIL
FT                   LGGLVPWTGMLWDAFRAARGRGGLLRREDGLFLSLWFAVPLAFFSLSGSKLVPYVLPCL
FT                   PPLAVLIGAAVEGILRGGAPAMRAGRRFACLNALILLPIVLAGAVYPALRPEDAYLRAA
FT                   TNPFCFVLTAFCLASFVLLRARTRGFLLLCLLALTALFVAGTGFDLMAARDSRRPIAAM
FT                   LRERLRADDTVVAYGDLMQGLSFYLGRRIAIAGGRGELDFGAAQEEDPRWFLNAEQLRR
FT                   LWNGPDRVLLAASRRRLEELTRDLGREPVRLGETEKEILFTNF"
FT   CDS             1013422..1013883
FT                   /transl_table=11
FT                   /locus_tag="SY1_09120"
FT                   /product="Molecular chaperone (small heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28186"
FT                   /db_xref="GOA:D4M8J1"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8J1"
FT                   /protein_id="CBL28186.1"
FT                   /translation="MRNGYAPVVYGRFGGPAASIFDSMDRLAEQMGLFPFEGSGGLSAK
FT                   TDLYRKDGKLCVEAELPGIKPEDVELHVYGDRLTLSAEKRSERTEGTEGKSYFRSERSW
FT                   GKVERVISFPVEADPDSAKATFKDGVLTIEVDEKQEDRAHKKVAITSGD"
FT   CDS             complement(1013978..1014577)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09130"
FT                   /product="Cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28187"
FT                   /db_xref="GOA:D4M8J2"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8J2"
FT                   /protein_id="CBL28187.1"
FT                   /translation="MNRIITIGREFGSGGRELGRRLADALQFAYYDREIITELARRTSL
FT                   SEEYVQRIVEHRPTAAFPIHVGRSFYPMVNPMWEQGQAVYQEQHRLIKEMAAASNCVIV
FT                   GRCADYILRDMRPFRIFVYAEMASKMRRCREKGEDAKAMSDKELTQHINDINRGRAKYY
FT                   EFYSGQEWGGRLNYDLCVNTTQLDLAEVVAAIAKLF"
FT   gap             1016972..1017734
FT                   /estimated_length=763
FT   CDS             1018292..1018510
FT                   /transl_table=11
FT                   /locus_tag="SY1_09170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28188"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8J3"
FT                   /protein_id="CBL28188.1"
FT                   /translation="MGREMGIRAGANVVMPNLSPASVRKKYAIYDGKLCTGEESAQGLA
FT                   RLARRMAGIGRRLSMDRGDVKREAWPA"
FT   CDS             1018829..1020277
FT                   /transl_table=11
FT                   /locus_tag="SY1_09180"
FT                   /product="iron-only hydrogenase maturation protein HydG"
FT                   /function="iron-only hydrogenase maturation protein HydG"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28189"
FT                   /db_xref="GOA:D4M8J4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024007"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8J4"
FT                   /protein_id="CBL28189.1"
FT                   /translation="MAVYDPKSLRATEFINDEEILETLDYADRNKENVRLIDELLEKAR
FT                   PRRTAGGCQCSGLTHREASVLLACEMPDKVARMYEVAEEIKLAFYGNRIVIFAPLYLSN
FT                   YCVNGCLYCPYHTANKTIPRKKLTQEEVRREVVALQDMGHKRLAIESGEDPVNNPIEYI
FT                   LDCIRTIYGVHHKNGDIRRVNVNIAATTVENFSKLKDAGIGTYILFQETYHKKGYLELH
FT                   PTGPKHDYDYHTEAMDRAMDGGIDDVGLGVLFGLDKYRYEFAGLLMHAEHLEAVHGVGP
FT                   HTISVPRVKRADGIDPDVFDNSISDDTFTKIAACIRLAVPYTGMIVSTRESEAVRARLL
FT                   QVGISQVSGASRTSVGGYTEEERPHDTEQFDVSDQRTLDEVVRWLMDSGHIPSFCTACY
FT                   RAGRTGDRFMSLCKSGQILNCCHPNALMTLTEYLEDYASPETKRIGYEMVARELNRIPR
FT                   ERVRATARENIEAIRNSNRRDFRF"
FT   CDS             1020286..1021509
FT                   /transl_table=11
FT                   /locus_tag="SY1_09190"
FT                   /product="iron-only hydrogenase maturation protein HydF"
FT                   /function="iron-only hydrogenase maturation protein HydF"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28190"
FT                   /db_xref="GOA:D4M8J5"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8J5"
FT                   /protein_id="CBL28190.1"
FT                   /translation="MGLNDTPSGERVHVAFFGVRNAGKSSLVNAVTGQDLSIVSDVGGT
FT                   TTDPVRKAMELLPLGPVLIIDTPGLDDEGALGALRVERTLRILAETDAAVLAADARRPL
FT                   TEHDHRLLALLKERAIPFLIARTKADLLRPEERPAPGRDELCVSAVTGENVEELKERIA
FT                   ALARSVEDKKRLIADLLSPGDTVLLIMPQDGSAPKGRLILPQQQTVREVLDAHAIVVAC
FT                   QETEVAEALSGLTRPPRLAVTDSKVFARAAQDVPPCVPLTSFSILFARYKGNLAALARG
FT                   AGRLSRLRTGDRVLIAEGCTHHRQCGDIGVVLMPGWIERYAGARPCFDFASGGDFPRDL
FT                   SGVSLVLHCGGCMLNEREMQRRIGEAEAAGAPIVNYGMAIAQMHGVLRRSLELFPDVLK
FT                   LMEEERAG"
FT   gap             1023560..1023941
FT                   /estimated_length=382
FT   CDS             1024176..1024415
FT                   /transl_table=11
FT                   /locus_tag="SY1_09240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28191"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8J6"
FT                   /protein_id="CBL28191.1"
FT                   /translation="MKGKGLRDVALFGRVLSTGLVVAGYAFLGVWLSRWLDAEGYPGWL
FT                   SVAAIPAALLFGLWQGWLFLTKIARRGPQDGKPL"
FT   CDS             complement(1024469..1024852)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28192"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8J7"
FT                   /protein_id="CBL28192.1"
FT                   /translation="MTFVWLGAGIVFFGLGLWQWARGGSGLWQILNLRRREKTLTAEER
FT                   LEAEGTVHRLERATDRALLLSFRILGYLAIVLWLVLGVSLLMDFLGVDWTSRFRARQYW
FT                   NADTEALPDRNTVLRSIGSKLRK"
FT   CDS             1025281..1025541
FT                   /transl_table=11
FT                   /locus_tag="SY1_09260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28193"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8J8"
FT                   /protein_id="CBL28193.1"
FT                   /translation="MEWIKAPADTPVCPEKNILLKDIVQLILDGAETPEAVMAELELTG
FT                   TEEGTDQIPAILDVFVPVVNAWQTGICSGGCSGCSGGCCGE"
FT   CDS             1025573..1026088
FT                   /transl_table=11
FT                   /locus_tag="SY1_09270"
FT                   /product="thiol peroxidase (atypical 2-Cys peroxiredoxin)"
FT                   /function="thiol peroxidase (atypical 2-Cys peroxiredoxin)"
FT                   /EC_number="1.11.1.15"
FT                   /EC_number="1.11.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28194"
FT                   /db_xref="GOA:D4M8J9"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8J9"
FT                   /protein_id="CBL28194.1"
FT                   /translation="MQERTGIITMKGKPLTLLGTTPRVGDKAPDFVVLDSGLAEKSLKD
FT                   YAGKVKVLSVAPSLDTPVCSLQLRWFNEDAAQEPGDVVVLNLTMDLPFAIKRFCAVEGI
FT                   ENAIALSDHRTASFGTAYGVLIKELRLLTRSVFIVDKDDVVRYVQVVPEVTDEPNYEDA
FT                   VEALKKLL"
FT   gap             1026473..1026492
FT                   /estimated_length=20
FT   gap             1028351..1028853
FT                   /estimated_length=503
FT   gap             1030686..1031448
FT                   /estimated_length=763
FT   gap             1034760..1035986
FT                   /estimated_length=1227
FT   CDS             1036708..1037175
FT                   /transl_table=11
FT                   /locus_tag="SY1_09350"
FT                   /product="Flavodoxins"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28195"
FT                   /db_xref="GOA:D4M8K0"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8K0"
FT                   /protein_id="CBL28195.1"
FT                   /translation="MKTLIVYFSKSGRTRKAAEEIASLLEGADLFEIKVDKTYPPSYFK
FT                   TLFEGRREFKSGERPRLAVMPPDPAPYDRVLLGWPVWFGTCPMAVISFLEACDLSGKEV
FT                   YPFCTSSMTGPERGVRDIAAACRGHVHKGLRVRRADAERIAAWLDAPAEAS"
FT   gap             1037841..1038651
FT                   /estimated_length=811
FT   CDS             complement(1039600..1040139)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28196"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8K1"
FT                   /protein_id="CBL28196.1"
FT                   /translation="MKKLLLCALLMGLLAVTVSPALAWEKQKDLGQDHVKMKWYLLDYG
FT                   VKDNVPFAIARKYYTNTSIKSQTVDLLMSKYNISPEVAGSLYFTEYGYEYTPDGKQFAV
FT                   TYLRHYDMLGNEIYATVYDGSSDALKKVFANVDPKSTPGKGAAYALGKKPAAEKQPAAA
FT                   KKAPAKRPAKKVKVKK"
FT   CDS             complement(1040285..1041778)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09390"
FT                   /product="Predicted periplasmic protein (DUF2233)."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28197"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8K2"
FT                   /protein_id="CBL28197.1"
FT                   /translation="MRFHFSGLRARSRALCLAAILFLAIPCRAEAVTRGAFLAALLDAR
FT                   GLSSNVPVGKNAVAFVQETGIVTDGIGGPNAQVTRREALRWCIQSLGLAFEAGALSDVS
FT                   AGFSDEKALTPFERGCLAVAVNMTPALLSRDRSFRGAQRLTEKEMRFLLDRVSQASEGL
FT                   SLEVTLTPVEGLTLLLHRDGVPTGVPRWRVYADGFEDKAAAESAQAFFKSKGFEMSMLQ
FT                   PQYEWFLRSPVLEDYGAARRLASLIRQRKLAVCLLPSVSNSNTDILPRYWALLTIDPGL
FT                   WRMVPAASSEGPAALTPLSRIVKDNGLSAAINAGFFAVTGRRQGYPIGLLRRDGAEVHK
FT                   LYNGRGCLGWNDENEAAFGLPSLVNGELVGAGGESWSDMPFAIQAGPLLLSDGVVQGND
FT                   EGFSNSLLSARHPRSVVGLTADGEWFFLAVDGRNGLHAAGATMSELTDILRSYEVPYAL
FT                   NLDGGGSTELIVKGRLFTFPSEGRERPISYALGVVPAPR"
FT   CDS             complement(1041816..1043060)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09400"
FT                   /product="imidazolonepropionase"
FT                   /function="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28198"
FT                   /db_xref="GOA:D4M8K3"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8K3"
FT                   /protein_id="CBL28198.1"
FT                   /translation="MTLKLFRRARIYTPTLGAAPAAGAEQGRIRSVEDGAFLVEDGRFA
FT                   AVGSASEVEGSLSGRTPDQEFDLGGAAVVPGLVDPHTHACFAARREAEFSMRLAGRPYL
FT                   DILKAGGGILSSVRAVRAASEEELFSFSRDLLRRTLHYGTTTIEIKSGYGLDLDSELRM
FT                   LRVIGRLGRETVQTVVPTFMGAHAVPEPFKSDPDGYVRLLTEEMLPAVAEQGIARFCDV
FT                   FCEEGVFSIEQSRRILLRARELGLGLKIHADEVNDLGGASLAGELRTASAEHLLAASDE
FT                   GIRAMARGGVVADLLPATAYSLRKPFARARKMIEEGVPVALATDLNPGSCYCESMAFVI
FT                   SLAVMEMGLTPEEALTGATLNAAWSLGMQQEVGCIERGRMADFLVLDGETPATFAYLSG
FT                   ARPIRSVWKLGERVA"
FT   CDS             complement(1043685..1044521)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09410"
FT                   /product="Formate/nitrite family of transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28199"
FT                   /db_xref="GOA:D4M8K4"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8K4"
FT                   /protein_id="CBL28199.1"
FT                   /translation="MQSNFLSPAEVAELVVGVGQRKAEMSVTNQLILGVMAGAFIAFGA
FT                   AGSCVAVHTVESAGVAKALAGALFAAGLIMVVVAGGELFTGNSLMLMALAEGRISPWQL
FT                   LRSWLVVYAGNFAGALLTAGLVCLSGQWGMSGGLLGASVIKTAAGKTALSFQNAFFLGI
FT                   LCNWLVCLAVWMSFAARDIAGKVLVIFFPIWIFVTSGFEHSVANMYYIPAGILAAADPA
FT                   LAERAASVGLSPEALANLNWGAMLQANLLPVTLGNVVGGGVLVALACWFVYRRDKR"
FT   CDS             complement(1044739..1046589)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09420"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28200"
FT                   /db_xref="GOA:D4M8K5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8K5"
FT                   /protein_id="CBL28200.1"
FT                   /translation="MRQSYIDAENPDAGARNVEAICEKILKNAEDKNILNLYLALESTG
FT                   LLAIASSEGKWVAPAGYDARTRGWYQQAVADRGATKFSAPYVEAASGKLVIAATKAVYD
FT                   DSGKLVGVASIEVDLDKLSAFVVSQKVFGQGSGALVQKDGTFIAHSNKDYVLKANLLNG
FT                   QEFDASVHQFAVKVVGGGTGFADYLNNGERRRVFYAPAGHDFFFIVFFPISVIHSMVHG
FT                   LTVFLVLIAAAALLVIGFLIFAIMRSLSRSLKGMSAATVELGRGDLTVRFDETGRDELS
FT                   GMSRELNAMIASVSETLRNIRIEADETSRQADTLAALSEETLASMKEVSASIERVNGVV
FT                   SSASSATEETRASVSEIADSAQSSAQSATESAEQASRVADVSKNAVDEVGAVVTGMREA
FT                   KDKSSHSIAQIQELGESVNAISSFVTTITSIADQTNLLALNAAIEAARAGEAGRGFAVV
FT                   AEEVRKLAEESAHAAQEIEKLIAGLQKHSESSVEATKETEKLLIETSATAEVTQQKLNG
FT                   AMDAIARLNDAIQNIAAISEEQAASSEEMTSAIQHVADANHGVVEAADSIQTATRETTR
FT                   AAESIAGAAQGLASTAEKLQGFIGSFFLEKQGDIVPKKNR"
FT   CDS             complement(1048513..1049268)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09440"
FT                   /product="NCAIR mutase (PurE)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28201"
FT                   /db_xref="GOA:D4M8K6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8K6"
FT                   /protein_id="CBL28201.1"
FT                   /translation="MSLSVRQVLQRVSEGTMSVEDALLHVKEKPFEDLGFAKVDLHRRV
FT                   RQGAAEVIYGAGKTPEQIVGILEAMRRNGQGPVLITRLSPEAAEAVGRSCALDYHEEPR
FT                   VGIVGDLPQPDGIGRIIVATGGTSDIPVAEEAALTAEVLGSEVQRLYDVGVAGLHRTLS
FT                   HLEDIMSASVLIAVAGMEGALASVLGGLAECPVIAVPTSVGYGVSFGGLAALLAMLNSC
FT                   SSGVTVVNIDNGFGAGYCANRINHMGVKR"
FT   CDS             complement(1049274..1050128)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09450"
FT                   /product="methenyltetrahydrofolate cyclohydrolase
FT                   /5,10-methylenetetrahydrofolate dehydrogenase (NADP+)"
FT                   /function="methenyltetrahydrofolate cyclohydrolase"
FT                   /function="5,10-methylenetetrahydrofolate dehydrogenase
FT                   (NADP+)"
FT                   /EC_number="3.5.4.9"
FT                   /EC_number="1.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28202"
FT                   /db_xref="GOA:D4M8K7"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8K7"
FT                   /protein_id="CBL28202.1"
FT                   /translation="MTVVMKGAEVAVGMKEALLAEHAELKGMGVDPKLAIVRVGARGDD
FT                   LAYERGALKRFAGLGITTQVYELPEDIEQADFDAEFGKVNADPKVHGILLFRPLPGGLS
FT                   DEAARRTIDPRKDVDGMSPISSAMVFAGARDGFAPCTPGAVMEMLAHYEVDLKGKNVTL
FT                   VGRSMVVGRPLAMLMLAANATVTICHTKTVDMPAVCRRADIVVAAAGKAGMIGADCVTD
FT                   RSIVVDVGINVGPDGKLCGDVDFEAVSSIVSMVSPVPGGVGAVTTSVLARNTLRAARLL
FT                   TKR"
FT   CDS             1050327..1050947
FT                   /transl_table=11
FT                   /locus_tag="SY1_09460"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28203"
FT                   /db_xref="GOA:D4M8K8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8K8"
FT                   /protein_id="CBL28203.1"
FT                   /translation="MSTAAIDTVIFDIGGVLANFDWNGYVHRWVRDERAIQEINEALWG
FT                   TGLWDELDRGVLSTESIVEGFIAGAPRREGEIRTLMEHVGGCVSRLDYAVPWIQSVKST
FT                   GRRVLFLSNYSRLIMDANPGVLDFLPALDGGVFSCDVKLLKPDRAIYAALCERYALTPG
FT                   RCVFIDDLEPNVQGARDFGMQAIRFQSYEQAQEALSAMLGGDA"
FT   CDS             complement(1052331..1052543)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28204"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8K9"
FT                   /protein_id="CBL28204.1"
FT                   /translation="MIQAVAAKRKSLYRQLQNLTEEDLDRVSHYAAFLQYLEAQEDEED
FT                   IVWIEAHKDDPTVPLADALKALGLD"
FT   tRNA            complement(1053077..1053152)
FT                   /locus_tag="SY1_T_24800"
FT   CDS             1053227..1054051
FT                   /transl_table=11
FT                   /locus_tag="SY1_09500"
FT                   /product="Lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28205"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8L0"
FT                   /protein_id="CBL28205.1"
FT                   /translation="MHEALIRSFDGTELYRCTDEAPGAALGSVLLLHGLGGHCRRFDAA
FT                   SAAMATAGWRVTRFDLRGHGRSGGARADVRDYRLLVKDVRLMADAALAERPGPLFTVGY
FT                   SMGGLLSLLLGVQRPEGISGQVLIGAPTLETGRYRNFRRPQVQRLLMRCSPSVGEDLLT
FT                   PDEAARHEYERDPWVLHAFVNRLLVEVFVKGMDDLTAALPAHRLPFLALHGSEDRIVPP
FT                   ASAENLRVRSASPDGTLTILEGAWHDLLHGPERDRAMELILGWLKAHAAAEA"
FT   CDS             complement(1057089..1060292)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09530"
FT                   /product="ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28206"
FT                   /db_xref="GOA:D4M8L1"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027050"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8L1"
FT                   /protein_id="CBL28206.1"
FT                   /translation="MRPLTLTMRAFGSYNKETTVDFTRPNQKLFLITGDTGAGKTTIFD
FT                   AIVFALYGETSASGRSGGRRQGEDLQSQFADLDTEPFVKLTFSEVHGGEKRHYTVTRTP
FT                   RCHQSLKQKAGSRPKGETVSLSMPDGLVYTGNLRETNQKIGEIVGLTKEQFMQVAMIAQ
FT                   GEFMELLCAGADKKKDIFRKLFRTRLYQDVVDELKRRLDDAAKRVTEIRSAFQAEAGHV
FT                   VIPEELDGMERLKEIRSRLLTSEGGTVMDMEALLAELSALCSRLKEGAALAASERYEAG
FT                   RRRDEARDAYTGAQDLARAFEELERSERALAECEAEEGRIQEAGRLMIQINAACEIQPL
FT                   HQRMGDAEKAAAETERKLADLKGSLPDLNLDRQRAEASEAEARSVQAAGIEEFTRVSER
FT                   VSRALQVLERIRATTERFEEWRAALSAAEMTSLQAKDALMNFEAREAAWRAREKELEGA
FT                   DLRLAHWEVRRREAEDLMVEVSLAEDAGRDAQRQRAETERLQGEYASVREEYNRKRDEY
FT                   VRRQEEFLDAQAGFIAWEKLRPGEPCPVCGSLDHPRPCLLPEGSRDLTREVVDALAEEV
FT                   ASLQQDLTKRSTASGSALSLLEEKERTLKGALARLQERLARSVPEASEAPSLDQVRALL
FT                   ESWRAGIRAEGVALQEGAQALSRIKESLKSVDEQRQALTIAVDQAVRTAHQAESALAAA
FT                   EAELRGLEGQRDYATVADAQSALDEARVAKRKADSTFEAAREAAQAARSSLENAEAAIA
FT                   RFAEELPLQREEAERRRQAYEALMDEKKLSEADWMETVRRYGREDVGELLDEVEAHRKK
FT                   KAAAEGARDAALKAVNGREKPVMEDLERARDKAEEELEKARAAWARLDRAFEADDAALC
FT                   ALSPRMEERKQVAREHARLNGLHRGLGGRESGARMDIETFVQRHYLQRILHAANTRFQD
FT                   MTAGQFELRLVQEDQAGEGRNQGLDLVVYSSVTGRERRVWTLSGGESFVAALSLALGMA
FT                   DLIQESASSISLDMIFIDEGFGSLDDRTRNQAVRVLQRIAGSRLIGIISHVTELKQEIE
FT                   DQLIVSKDSEGSRVRWQIS"
FT   CDS             complement(1060294..1061499)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09540"
FT                   /product="exonuclease SbcD"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28207"
FT                   /db_xref="GOA:D4M8L2"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8L2"
FT                   /protein_id="CBL28207.1"
FT                   /translation="MKFFHLSDLHIGLKLINRDLREDQEYVLDQIVRAAGEVSPDAVVV
FT                   AGDIYDKAIPSVESVELFDRFVSKLAGAVPTAEIMMISGNHDSGPRVNLFRSVLQRRGI
FT                   HMVGLPPRTPEDFIEKVVLWDEFGPVNFYLLPFVKPSMVRLVLDAGADASGGGDEAADA
FT                   TPRGLSYDEALHRLIDRETIDPEQRNVLVSHQFYLPSGAVPSGVERMDSEVRTVGDIDG
FT                   VRSDVLERFDYAALGHMHKPMEVGNERCRYCGTPLACSVSEAGQQKGIIVVELGEKGSV
FT                   KTSVLPLTPLREVRVITGAFSEVLGQGCEDYVTVVLTDKEDLDVLDMQDRLRACFPNLL
FT                   EIRRELPQRAGDRAGRGAAEAEMSPFELCGSFLKEQWGGRELDEEERSLLQDVINSVQE
FT                   AH"
FT   CDS             1061779..1062372
FT                   /transl_table=11
FT                   /locus_tag="SY1_09550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28208"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8L3"
FT                   /protein_id="CBL28208.1"
FT                   /translation="MRSSLLQKCLLSMAALSCLVLSASRGVAAEHWTEVFFNRCLALEK
FT                   QAISLAERTIRDDKPSAEPSRYCPLEEKDIDDLWFLEWKKNGTTVSGASQQKGGKYHPY
FT                   GIEIRDPDIVFPGGIRVGAGTEVLESYFKGCLNRSDYPEDFDSEYLEYENELPPSGTAS
FT                   IGYLEQNSAFLIECKGGRITSIAYGVPVDMMRLY"
FT   CDS             1062691..1063320
FT                   /transl_table=11
FT                   /locus_tag="SY1_09560"
FT                   /product="Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28209"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8L4"
FT                   /protein_id="CBL28209.1"
FT                   /translation="MKTGPFSLAAENPAVPGCTLSGKVIQDTFVFSMAEGTDISPESYP
FT                   DHKLWLVVHGSMCVVAGREIPLGAGQGYVTPVGMPVGIKAEADSVYVEVSLRKETVMNP
FT                   VLKDKEVFELKDLIPYQDGKIVNLDLLSSPKMKFVVMSFDEGTGLSEHSAPGEALVFAL
FT                   DGKAIIGYEGKEYPLRAGENFRFQKNGRHYVKADGRFKMALLLVLE"
FT   CDS             1063368..1064105
FT                   /transl_table=11
FT                   /locus_tag="SY1_09570"
FT                   /product="ABC-type transport system involved in Fe-S
FT                   cluster assembly, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28210"
FT                   /db_xref="GOA:D4M8L5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8L5"
FT                   /protein_id="CBL28210.1"
FT                   /translation="MLELRNLSFSVDNDGVRKEIVHDLNLIVDDNKFVAITGPNGSGKS
FT                   TLAKLIVGIEKPTEGQILLDGLDITNMGITERARKGMGFAFQQPVRFKGITVHALLRLA
FT                   SGKDLSVSDACDYLSEVGLCAHDYIHREVNASLSGGELKRIEIATVLAKHSRLTVFDEP
FT                   EAGIDLWSFQNLIRIFESMRRGIRDSSIIIISHQERILNIADEIAVLTDGTIERHGTKA
FT                   EVFPDLVGTEAAQGPCSRLRRGV"
FT   CDS             1064105..1065031
FT                   /transl_table=11
FT                   /locus_tag="SY1_09580"
FT                   /product="ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28211"
FT                   /db_xref="GOA:D4M8L6"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8L6"
FT                   /protein_id="CBL28211.1"
FT                   /translation="MEKLTEVQKRLLREVADLHDVPMGAYNVRANGGLAGRNNTANIDI
FT                   VSKEDGSGIDIHIKPGTRRESVHIPVVLSQSGLKETVYNDFFVGEGSDVTIVAGCGIDN
FT                   CGVQDSEHDGVHRFYVGKNAKVKYVEKHYGSGDGTGKRILNPVTEVYMEEGSSVEMEMA
FT                   QIKGVDSTNRTTLAELKKDARLVVRERLMTHGEQHAVSTYKVTLQEEGGSADVVSRSIA
FT                   RDRSYQRFDACIVGNAPCKGHTECDSIIMDEGTILAVPSLEAHHVDASLVHEAAIGKIA
FT                   GEQLIKLMTLGLTEQQAEEEIINGFLA"
FT   CDS             complement(1065121..1066077)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09590"
FT                   /product="Lactate dehydrogenase and related dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28212"
FT                   /db_xref="GOA:D4M8L7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8L7"
FT                   /protein_id="CBL28212.1"
FT                   /translation="MSKVYVTRMLPRPVMEELGRVCEYAANEEDRPASREELLSGVKGC
FT                   DGVISMLNDAIDAEVMQAAGPQCRILANYAVGYNNIDLAEARRLGIAVTNTPGVLTDAT
FT                   ADLAWALLFAAARRVPEGDRLVRHGSFNWAPEFMLGADITGRTLGVIGAGRIGLNFARK
FT                   ARGFDMKVIYAGRHRSSEFEAETGGTFVTKEELLRTADFVSLHVTLTPETRHLIGEPEL
FT                   GMMKPTAILINASRGPVVDEKALVRALRERRILAAGLDVYENEPEVEPGLKELDNVVLT
FT                   PHVGTATVGTRTEMGFMVVRNVAAALAGQEPPNLVRA"
FT   CDS             complement(1066109..1066687)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09600"
FT                   /product="Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28213"
FT                   /db_xref="GOA:D4M8L8"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8L8"
FT                   /protein_id="CBL28213.1"
FT                   /translation="MKTMKIFLELLCAAAAVCCPLLLPRAACAAEEEAPRRPVAVFSTN
FT                   MGQFKAELYTDLAPVTAGNFIDLARRGFYNGVIFHRVIDRFMIQGGDPTGTGTGGPGYK
FT                   IEDEFGPGLAHDAPGVLSMANAGPNTGGSQFFITLVPTPWLDGKHAIFGRIVEGMEVVE
FT                   AIGHVETARGDRPVKDVVMQSVVVEEPKE"
FT   CDS             complement(1066759..1067625)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09610"
FT                   /product="protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28214"
FT                   /db_xref="GOA:D4M8L9"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8L9"
FT                   /protein_id="CBL28214.1"
FT                   /translation="MNRNYNFMALRRPALSLSAVLVLASLAFLFTRGLNLGIDFTGGNV
FT                   IQLEFDNLPEVAEVRKVVSGVVAQEAMIQKFGEKGVIIRTNEDTEESREQVISVLQKAF
FT                   PDMKVSGYEKVGPVVGGELRRQAVIGVSIALVAILIYITVRFRFRFAVVSVVPLVHDVL
FT                   IALGFFSLTQMEVSSSFIAAILTIVGYSLNNTIIILDRIRENWRDLGRDGIEKLVNDSV
FT                   NQTLARTINTTLTTLFPVIALCVWGGPVLQAFSYAMLVGIIAGTYSSMLVATGALIEWY
FT                   KARPESR"
FT   CDS             complement(1067639..1069042)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09620"
FT                   /product="protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28215"
FT                   /db_xref="GOA:D4M8M0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8M0"
FT                   /protein_id="CBL28215.1"
FT                   /translation="MNRRDRLRLWVVLIVIVAALAYSWPIKGRINQGLDLRGGAHIVLQ
FT                   AKDTPENPVGPDSIDRLLAVLRNRVDQYGVAEPIIQKSGEDRIIIDLPGIQDPKAALEL
FT                   IGKTAQMDFREVMDVTASTLSAPERKNYDSDLQFSQAQERWRAAVEAQSNSSADLAARA
FT                   RGIEGAIVAPSEEEEGEAARFYLLGKSLLSGKDLETASVNPDRLGRMGVSLSFSPEGAK
FT                   LFEEATARLVGKQIAIVLDNVVISAPVVQDRISGGEAQITGRFTAEEASRLAIMLKAGA
FT                   LPVAVEIAENRSVGPSLGADSVRQGMQAGLFGAAMVLVFMLIYYRFRGLAADVALVVTI
FT                   LLIFTGLIAFHATLTLPGIAGIILTLGMAVDGNVLIYERIREEVRSGKTPIAALDAGFR
FT                   KALVTILDSNITTLIAALVLFHFGSGSVRGFGVTLSIGLVASVFANVVVTRALLQLFVS
FT                   RRQNALKRS"
FT   CDS             complement(1069136..1069558)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09630"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28216"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8M1"
FT                   /protein_id="CBL28216.1"
FT                   /translation="MADTAAAPEAAQQTTAVSPCGSLFGGGASAPSGEGGAAPQQQASL
FT                   MGMLFPLVIFVVIFYFFIIRPQRKRQKEHESLLSGIGRGDQIVTIGGFLGTVKEVRDDT
FT                   FLIEMGEGVRVRILRSAVQTKRTPAQGQPAAEEKKD"
FT   CDS             complement(1069695..1070072)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09640"
FT                   /product="endoribonuclease L-PSP"
FT                   /function="endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28217"
FT                   /db_xref="GOA:D4M8M2"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8M2"
FT                   /protein_id="CBL28217.1"
FT                   /translation="MKKIISCDKAPAAIGPYSQAIQAGEFLYVSGQIPANAKGEVVQGG
FT                   VEEQAKQSLENVKAILESAGYGLKDVVKTTVFATDMANFAAVNGVYAKYFDAEAPARSF
FT                   VAVKALPKEVLVEIEVVAWKR"
FT   CDS             complement(1070193..1070474)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09650"
FT                   /product="Ribosome-associated heat shock protein implicated
FT                   in the recycling of the 50S subunit (S4 paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28218"
FT                   /db_xref="GOA:D4M8M3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8M3"
FT                   /protein_id="CBL28218.1"
FT                   /translation="MRVDKFLKMARLVKRRSAAQEMAELGAVRIDGRPCKPASEVREGS
FT                   VLEVAYMNRVLKARVLCAEEALLKRPGTVSWEQVEERPVSPDENPWGE"
FT   gap             1071084..1071276
FT                   /estimated_length=193
FT   CDS             1071740..1072063
FT                   /transl_table=11
FT                   /locus_tag="SY1_09680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28219"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8M4"
FT                   /protein_id="CBL28219.1"
FT                   /translation="MERTPPRINSLARRWIRDVISGDAGPPLGGSYLMPPSSGGLWDGV
FT                   ITRPSATAAPTSRLCARMAREMTGVGVGANPSCSTTSTPFAARTSTQVRSAGSDRAWVS
FT                   APM"
FT   CDS             1072076..1072228
FT                   /transl_table=11
FT                   /locus_tag="SY1_09690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28220"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8M5"
FT                   /protein_id="CBL28220.1"
FT                   /translation="MPASLRCSATARAMARMWASLKLRSLEEPRWPDVPNATCWDRASG
FT                   SGSRV"
FT   gap             1073826..1075727
FT                   /estimated_length=1902
FT   gap             1077804..1080263
FT                   /estimated_length=2460
FT   CDS             1080952..1081197
FT                   /transl_table=11
FT                   /locus_tag="SY1_09770"
FT                   /product="GTPase of unknown function."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28221"
FT                   /db_xref="GOA:D4M8M6"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8M6"
FT                   /protein_id="CBL28221.1"
FT                   /translation="MAIAAIIGRPNVGKSSLFNRLIGRRESIVDDAPGVTRDRIYGEAE
FT                   WRGRSFYVIDTGGNPGGGVRLQRRHPRPCGGGHRGM"
FT   CDS             complement(1082284..1082625)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09790"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28222"
FT                   /db_xref="GOA:D4M8M7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8M7"
FT                   /protein_id="CBL28222.1"
FT                   /translation="MTTDPEILSLSVEVLRVELLAEPLYGAHIVAAGVFRGAGDTLFSS
FT                   LMTLASMWGVRLPLAAFLAPRRGLRGVWLAMCVELCGRGAIFLARLAGPRWQRRGLAAA
FT                   TERSGGTRD"
FT   gap             1083161..1084035
FT                   /estimated_length=875
FT   CDS             1084104..1084883
FT                   /transl_table=11
FT                   /locus_tag="SY1_09810"
FT                   /product="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28223"
FT                   /db_xref="GOA:D4M8M8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8M8"
FT                   /protein_id="CBL28223.1"
FT                   /translation="MGPNLYQALPFWQQAAIVCPLIFLGGFVDAITGGGGLITLPAYLF
FT                   AGLPVHFALGTNKLSSCIGTALTTARYARAGFIPWKLACLCVAASLMGSNLGAHLALFL
FT                   NDRIFKFVMLFLLPVTALYVLKGRALVHQRPPLPQARTVLTSAAIAFALGAYDGFYGPG
FT                   AGTFMLLLLAAAAHLSLNTANGVAKSINMASNLAALTVFLINGRVLFPLGLLAACFGLA
FT                   GNYLGARSFEHGGARAVKPIMLTVLAIFFVSLLRDLF"
FT   CDS             1085127..1086386
FT                   /transl_table=11
FT                   /locus_tag="SY1_09820"
FT                   /product="Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28224"
FT                   /db_xref="GOA:D4M8M9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8M9"
FT                   /protein_id="CBL28224.1"
FT                   /translation="MPKRESVFQNYALLIAMLGAIAAGCAVGWAWPGAAALEPLGTVFI
FT                   NLLFCIVVPLVFCSVAGAIANMKSRARAGKIMGVTIATFVVTGAIASVITIALMKLYPP
FT                   VPVPWTELKAAEVGDQASLATLVVNFFTVPDFSALLSRRAMLPLIVFSILFGFGVSMAG
FT                   GPATLTARALADMTECMLKVIKLLTYYAPIAFFGFFASLVATYGPQLIGDYSRALVVYY
FT                   PLCFVYILTAFPLMAWFGGGAAGPRVMFRHILKPAVTSLGTCSSIATIPANMEAADDSG
FT                   ISRDITEMVLPLGATMHMDGSCFSCTLKIAFLFGVFGMEFSGVDTFLRVILVSVVSSVA
FT                   MSGIPGGGYIGEFVLCSLFFPDHLPLAYPIAITIGNLVDPPATMINASGDYVASFIVSR
FT                   FVDGRDWLKNALARKASEGA"
FT   CDS             complement(1086449..1086679)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28225"
FT                   /db_xref="InterPro:IPR023883"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8N0"
FT                   /protein_id="CBL28225.1"
FT                   /translation="MAEAVKAAEPFEVTKATTMGEMLAHDMGIAQVLMRSGMHCVGCPS
FT                   SIGESLEDACAVHGLDADQVLAAIKEYLAGR"
FT   CDS             1086934..1088316
FT                   /transl_table=11
FT                   /locus_tag="SY1_09840"
FT                   /product="Na+-dependent transporters of the SNF family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28226"
FT                   /db_xref="GOA:D4M8N1"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8N1"
FT                   /protein_id="CBL28226.1"
FT                   /translation="MENGKKRETLGSRLGFIFLSAGCAIGLGNVWRFPFITGQYGGAAF
FT                   VLMYVAFLLLLGIPVMVMEFAVGRASQKSSTRSFKVLCPERRVWGLWGYGAWIGSVMLM
FT                   TFYTVVTGWMLAYVWYSASGRFAGATPEAVNDAFGTLLSAPKELLGWTALTSLIGAAVC
FT                   WTGLRQSVERVTKVMMCGLLAIMIALALRSVTLPGAECGLEFYLKPNFANLTANGLWSS
FT                   VYAALGQAFFTLSLGIGCMAIFGSYIGKDRSLTGEALLVTALDTAVALCAGLIIFPACF
FT                   AYGVNPGAGPGLIFVTLPNMFNQMPSGQLWSTLFFLFMSFAALSTVIAVFENIIAGLMD
FT                   RLGWNRQAAALFTGVAILLLSIPCALGFNRWSGFQPLGAGSGVLDLEDFIVSNNLLPLG
FT                   SLVYLLFCVSRWGWGWDGFIQEADAGRGIKFPAFLRPYFTWVVPLLVLSIFAAGYWEKF
FT                   VK"
FT   CDS             1088351..1089739
FT                   /transl_table=11
FT                   /locus_tag="SY1_09850"
FT                   /product="Na+-dependent transporters of the SNF family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28227"
FT                   /db_xref="GOA:D4M8N2"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8N2"
FT                   /protein_id="CBL28227.1"
FT                   /translation="MMEMTEKKRETLGSRLGFIFLSAGCAIGLGNVWRFPFITGRYGGA
FT                   AFVLIYIVCLLALALPLLVMEFAVGRASQRSVVTSFAALCPRHRAWSVWGYAGWIGCTL
FT                   LMMFYTVVTGWMLAYTCYSARGDLAGLTPDQVGGAFASLLADPAAMVRWLALAVGVSAA
FT                   VCCSGLRRGVERAAKAIMASLLVIMVALAIRSVTLPGAERGLEFYLKPNFANLTANGLW
FT                   TTVYAALGQAFFTLGLGVGSMAIFGSYIGKDRSLMGEALLISTLDTSVALCAGLIIFPA
FT                   CFAYGIEPGAGPGLIFVTLPNMFNQMPSGQLWSTLFFLFMSFAALSTVIAVFENILACF
FT                   MDKLGWSRPLAALVTGCGLFVLALPCALGFNRWSGFQPLGAGSGVLDLEDFLLSYNLLP
FT                   IGAIVYVTFCVSRYGWGWDAFIREVNTGQGVKFPTFLRGYLTYVAPVIVLLVFLAGYWE
FT                   KFFK"
FT   gap             1089876..1090112
FT                   /estimated_length=237
FT   CDS             1091145..1093622
FT                   /transl_table=11
FT                   /locus_tag="SY1_09870"
FT                   /product="Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28228"
FT                   /db_xref="GOA:D4M8N3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8N3"
FT                   /protein_id="CBL28228.1"
FT                   /translation="MAKKEVRTDLWVAKQLDECGINFDAQGSNIKEINEALKTASKRGT
FT                   GNVGYPEYVAVIGDFVLVIEDKADTDKQLKLTDKKIIDTDTKSITEYAVNGAYFYGKHI
FT                   AQNSSFKKVFALGVSGDEKHHVITPLYVDDREGYKQLPDIESFVWFSPSNIGEYYTRYV
FT                   LEEATDVEKTTEQILKDAAELHEYLRTYGTLKDQDKPLVVAGILLALDEVKHEEFKIDN
FT                   LTGSQVDKNHDGDKLMKAINTRLTRSNVGPDAKKDKLLSEFSILNTSFRLNEVNDVLGK
FT                   TPLKFYTKFLYDRVFRNIKYQKTSEDFIGRFYGEFMSYSGGDGQTLGIILTPRHITDLM
FT                   CDLVDVQVNDVVLDPTCGTAGFLISAMHKMLSMSDSDAQRKDIKKKQLHGFELQSNMFA
FT                   VAAANMILRHDGNSNLECTDFLKKNPAQVQMKGATIGLMNPPYSQGTKADPSQYELSFV
FT                   EHLLDSLTEGGRAAVIVPQSSMTGKSAEEKVFKESILKNHTLEGVITCNTETFYGVGTN
FT                   PVIALFTAHEPHPEDKVCKFIDFRNDGFETRAHVGLVEGDSAKDKKQHLLDVWNGRIEA
FT                   PSKFCVKTTVEASDEWLHSFYYFNDEIPTDADFEKTIGDYLTFEFSMVMQNREYLFEDT
FT                   KGRDDDELGDYVEIPSLEEKEWEAFSVDSLFPTIEPTKGKTTSGLVDGEGLPYIAAAKS
FT                   IIGCQICSKVANNEWASKGNGMVFVQLGDGAAGLAHYVPMPFVGMSGKTSVGYSKHQNL
FT                   YNGLFIARCLSSNKAIFSHGHSWTGRRLTKTKVMLPVNNDGEPDYDYMEQYSKNMMLHK
FT                   YKQYLRFIDGKGQ"
FT   CDS             1094101..1094829
FT                   /transl_table=11
FT                   /locus_tag="SY1_09880"
FT                   /product="GIY-YIG catalytic domain."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28229"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR025579"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8N4"
FT                   /protein_id="CBL28229.1"
FT                   /translation="MRKDIQEPGVYFLFCKDDENNKDSVYIGEAENVKERLLQHLRDAT
FT                   TEQEKYYWNTALIFVGRDLNKALIRYLENRLVELALASNRYDILTKNTYKNTVLKESQI
FT                   AAMEEFLENIKVLINTLGYKVLEPLRQGHSGDGEEEKFLYLKTGKTDAVGAVTAEGFVV
FT                   LAGAKINAKSSDKSLSKGMAKLRQKHFDAGHVSSDLVTTEDILFSSSSSAAIFVTGYSM
FT                   SGPAHWKDKNGKTLKEIESE"
FT   CDS             1095006..1095152
FT                   /transl_table=11
FT                   /locus_tag="SY1_09890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28230"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8N5"
FT                   /protein_id="CBL28230.1"
FT                   /translation="MGYLSGNNAVLEEPNRGTGYRNNQTFIDMIYPVARQLNLTESFFT
FT                   HTE"
FT   CDS             1096820..1097263
FT                   /transl_table=11
FT                   /locus_tag="SY1_09910"
FT                   /product="Predicted P-loop ATPase fused to an
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28231"
FT                   /db_xref="GOA:D4M8N6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8N6"
FT                   /protein_id="CBL28231.1"
FT                   /translation="MVSVKIIDGDKTKYMDLLLIADESVSMIEKYLYRGDMFALYDDDI
FT                   KAICIVTQEQLGVYEIKNLVTVPQYQRNGYGQKLISVVADYYRKLNGELYVGTGNCPTI
FT                   LRFYERCGFKKSHIVKNFFIDNYDHPIYEDGQPLIDMIYLKLH"
FT   CDS             1097458..1098003
FT                   /transl_table=11
FT                   /locus_tag="SY1_09920"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28232"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8N7"
FT                   /protein_id="CBL28232.1"
FT                   /translation="MSLKELWQLFPIFLVRHHEEWDDWYAEEKSTLTALLPRETVKRLS
FT                   HVGSTAVPDIWAKNIVDILLEVGSEEDLNNVEKRLLQKDWLCMSRSAHRVSMNKGYTPS
FT                   GFAQKVFHLHVRLWGDNDELYFRDYLREFPAVAKAYEALKLSLWRRFEHDRDGYTEAKG
FT                   DFIKKHTSLARQRYGARY"
FT   CDS             complement(1100572..1102500)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09940"
FT                   /product="Adenine specific DNA methylase Mod"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28233"
FT                   /db_xref="GOA:D4M8N8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8N8"
FT                   /protein_id="CBL28233.1"
FT                   /translation="MAGRMKMEWADGVARNIERIGALFPGCVTEARGADGRLRAAIDFE
FT                   RLRQELSDEAIARDEAYAFTWVGKRAAIAEANRPIRKTLRPCPEDSVDWDATENLYIEG
FT                   DNLDVLKLLQESYFGKVKVIYIDPPYNTGSDRFVYSDTFAVSEEEYLERSGAKGEDGTV
FT                   LFRENNFANPRFHSDWLSMMYPRLLLARNLLSDDGVIFISIDENEVSNLQKLCNEAFGE
FT                   RNYAATFLWTRTNTPPALSCKCRKTVEYVLAYEKRRSALKYFGAPLDGGDAPLLNAGNP
FT                   EKALRFPSGSIHFPFLRDGVIPAGEKGRVWLLDELRVEDGVNANAVRLAGEFKWEQRTL
FT                   EAEVRRGTCFVVKSDRFAIRFQRRNLEDAYKTPTNLLNVELNREAAVGTNETALRELEE
FT                   LGLGKCFDYAKPLSLVQAVARMVCAQDKEALVLDFFSGSGTTADAIMRMNAEDGGRRRF
FT                   IMVQIPERTAPDTVAFKMGFKDIAELGRERIRRSGARIGAKEPDGARRTDVGFRVLRLD
FT                   ESNMRDVYYAAGEYRQSLLPALASNVKPDRTDMDLLFGCLLEWGLPLSMPHHSEEVEGC
FT                   RVHTWNEGDLIACFAEDVPDSVVREIARRRPLRAVFRDAGFRDSPSRINAVELFKALAP
FT                   NTRLKVL"
FT   CDS             complement(1102609..1105101)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09950"
FT                   /product="Excinuclease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28234"
FT                   /db_xref="GOA:D4M8N9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8N9"
FT                   /protein_id="CBL28234.1"
FT                   /translation="MNETDAPKAIQVRGARVHNLKNIDVNIPLNRIVGIAGVSGSGKSS
FT                   LALGVLYAEGSRRYLEALSAYTRRRMTQAAKADVDEVLYVPASLALHQRLGVPGIRSTF
FT                   GTGTELLNSVRLMYSRLANHVCPNGHPQEPTLAVAAEQELVCPVCGARFHAPSAEELSF
FT                   NGQGACERCGGTGMVRTVDEATLVPDESLTIDEGAVAPWNSLMWSLMTDVCRAMGVRTN
FT                   VPFKDLSGREKDLVYHGPAEKRHILYKAKNSNVAGEMDFTYYNATYTVENALAKVKDEK
FT                   GMRRVERFLKEEICPECGGSRLSERARQPKLRGVSLDVVCRMPLSELLQWVEAVPGSLP
FT                   REMQPMANSICESFRTAARRLMDLGLAYLSLDRAASTLSTGERQRMQLARAVRNRTTGV
FT                   LYVLDEPSIGLHPANIAGLNAVMHDLVADGNSVLLVDHDMQVLKEADWLIEMGPQAGAE
FT                   GGRVIAEGTIADIEKDAASQIGAFLAGGRRVERERPLRPNGTFAEGTIRLVTSAIHTVK
FT                   PLRVAIPRGRLTVVTGVSGSGKTTMVLESLVPALEAVRQGKRAPEHVVEVAAECIEHVK
FT                   LIDATPIGVNVRSTVATYANVHDELRKAYARTQDAKRHGYKSGDFSYNTGSLRCPVCDG
FT                   TGSISLDVQFLPDVEVPCPDCHGSRYAKAACQVRHTNGAGVSRSLPELMDMDVSAALEF
FT                   CREMKTIRSKLRVLQSLGLGYLRLGEDTPGLSGGEAQRLKLASEMGREQADSVFVFDEP
FT                   TIGLHPLDVQTLLNVFQTLIRNGATVVVIEHDLDVIRNADHVIDMGPGGGEAGGTIVAT
FT                   GTPHEIREDARSVTGRYL"
FT   CDS             complement(1105375..1106013)
FT                   /transl_table=11
FT                   /locus_tag="SY1_09960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28235"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8P0"
FT                   /protein_id="CBL28235.1"
FT                   /translation="MEKIRLGELNKALRQCGIGLDLDEIDNTPCFGVYHVHDWNHGYDG
FT                   FYGITVYEDGSYTKGTAGFHGTRRQFYRDMQETINFLLEYFRFKKIQELIIAPCFQYTQ
FT                   FSFNAERNDIYEEIYAFLRKNNVRKNERSGVKINLKDDIGPLEMTVEGAFRGVSELCLF
FT                   APTHKMLIAPNHHFGFTFFTQQKSLEMEVITELLGGYLNLLYLEDQESQ"
FT   gap             1106924..1107478
FT                   /estimated_length=555
FT   CDS             1107668..1107862
FT                   /transl_table=11
FT                   /locus_tag="SY1_09980"
FT                   /product="toxin-antitoxin system, toxin component, Txe/YoeB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28236"
FT                   /db_xref="GOA:D4M8P1"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8P1"
FT                   /protein_id="CBL28236.1"
FT                   /translation="MKKQWDERAWEDYLYWLEQDKKTLRRINKLITDIERNGYDGIGNP
FT                   EPLIGNYSGYWTPNHRQSF"
FT   CDS             1109954..1110145
FT                   /transl_table=11
FT                   /locus_tag="SY1_09990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_09990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28237"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8P2"
FT                   /protein_id="CBL28237.1"
FT                   /translation="MAIFKCKDCGKEVSDKAVACPGCGRIFTHEEKKAGVKKQRMVLWL
FT                   IAVLALISVLWGLLSELR"
FT   CDS             1110278..1111009
FT                   /transl_table=11
FT                   /locus_tag="SY1_10000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28238"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8P3"
FT                   /protein_id="CBL28238.1"
FT                   /translation="MRRIFPVPFRFLGEEKRFKKWQWIMIEAEAAVGDNRKESRRGNFD
FT                   TIQLQELMKSGTGWRARMEWLKRVPRIRGFLPPDQGKRCTPAVPEEVSLALYVPDSPVS
FT                   LEIKKGAEDWTPKEKEALLQSDNPLFSRKALDLPPALKKVPYNFYYFFEAPVAEGGVKE
FT                   VRLKITDWEIGALYWRCVREHGDDWERFLRNKYEAEANKLGPMILMGNMHRHPDQWLAI
FT                   SVFLPPRQYRELFFQKGLFDE"
FT   gap             1111489..1112911
FT                   /estimated_length=1423
FT   CDS             complement(1113553..1113783)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28239"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8P4"
FT                   /protein_id="CBL28239.1"
FT                   /translation="MAQFVLELPQELRERIETRSGAANQKPEKFMLMAIEQYLEDLEDY
FT                   EDAVRISEEVRSGRMKTYSLEEVRAHLGLDD"
FT   CDS             complement(1113947..1114162)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10040"
FT                   /product="Predicted periplasmic or secreted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28240"
FT                   /db_xref="GOA:D4M8P5"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR015146"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8P5"
FT                   /protein_id="CBL28240.1"
FT                   /translation="MPELRGFSGQAVVGILQRMGFDLRRSRGSHVVLRRDGAVCVVPMH
FT                   NELAVGTLRSVLRQAGVSSEEFLKNS"
FT   CDS             complement(1114155..1114367)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10050"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28241"
FT                   /db_xref="InterPro:IPR005357"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8P6"
FT                   /protein_id="CBL28241.1"
FT                   /translation="MATHTFTAVIHREDDWYVAECPEVGTASQGATLEEAIANLREATE
FT                   LYLEEEAYTPRGRPLVTTFEAVAHA"
FT   CDS             complement(1114569..1114805)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10070"
FT                   /product="Uncharacterised protein family (UPF0150)."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28242"
FT                   /db_xref="InterPro:IPR005357"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8P7"
FT                   /protein_id="CBL28242.1"
FT                   /translation="MATYTACYTKIEAGYMGQLLEWPEVITEGSTLEECRAMLLDAAQE
FT                   MTRAYLETGQVPPQAQVLFEPLPVAMEKVSHVG"
FT   CDS             complement(1114809..1115078)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28243"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8P8"
FT                   /protein_id="CBL28243.1"
FT                   /translation="MLREEYLTTAEAATLTGKGANMIAKLCQAGRLPGAEKMGNSWVIP
FT                   RESVLKYQPSKRGVKPRSERVKAERAALREEVEAAISAARGEEG"
FT   gap             1115446..1116304
FT                   /estimated_length=859
FT   tRNA            complement(1116398..1116473)
FT                   /locus_tag="SY1_T_24790"
FT   tRNA            complement(1116486..1116562)
FT                   /locus_tag="SY1_T_24780"
FT   tRNA            complement(1116575..1116651)
FT                   /locus_tag="SY1_T_24770"
FT   tRNA            complement(1116660..1116736)
FT                   /locus_tag="SY1_T_24760"
FT   tRNA            complement(1116750..1116826)
FT                   /locus_tag="SY1_T_24750"
FT   tRNA            complement(1116848..1116925)
FT                   /locus_tag="SY1_T_24740"
FT   tRNA            complement(1116934..1117009)
FT                   /locus_tag="SY1_T_24730"
FT   CDS             complement(1117110..1118078)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10090"
FT                   /product="Transcriptional regulator/sugar kinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28244"
FT                   /db_xref="GOA:D4M8P9"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8P9"
FT                   /protein_id="CBL28244.1"
FT                   /translation="MTYYVGVDVGGTSVKIGVVSSAGSIVSEVAIATGAERPQEVVLQD
FT                   ILEGVRQAVAASDLGWGKVRAVGVGCPGMVRAEEGTVLYNNNLGWRDFLLGPMLTEALD
FT                   LPARVENDANAAALGEVVGGCARGATSAMIITLGTGVGSGFVIDGRIWAGYNSAACEFG
FT                   HMVIVRGGRPCTCGRRGCFEAYASATGLIAMTNEAIATDPEGAMAEMARREGRVGGHTS
FT                   FVAAEAGDPAAMRLVDEYTDYLACGVANLVNGLQPEVVGVGGGVGKQGERLLVPLRRKV
FT                   SAELYGRDYEDDRATRLVSCTLGYKAGLVGAAMAAKVAYGE"
FT   CDS             1122529..1122825
FT                   /transl_table=11
FT                   /locus_tag="SY1_10120"
FT                   /product="Uncharacterized virulence-associated protein D"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28245"
FT                   /db_xref="InterPro:IPR016368"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Q0"
FT                   /protein_id="CBL28245.1"
FT                   /translation="MSVYAIAFDLKVAELKKNYGDPYNGAYQEINEELKKAGFEWTQGS
FT                   VYLSMKDGDNLTAVYKAINALSRIEWFKNSVRDIRAFKVEDWSDFTDVVKGLA"
FT   CDS             complement(1122906..1123325)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10130"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28246"
FT                   /db_xref="GOA:D4M8Q1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Q1"
FT                   /protein_id="CBL28246.1"
FT                   /translation="MKVFDSMEVAGSALTAHRLWMDTISSNLANINTTRTLSGGPYKRR
FT                   VPVFAEMLDRTIGGYRDIGGVRVTAITEDRTAPRMTYQPDHPDADKDGYVAYPNVNLVR
FT                   EMTDMLVASRAYEANLSVVTTAREMWNGALEVMRA"
FT   CDS             complement(1123799..1124725)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10150"
FT                   /product="Pleiotropic transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28247"
FT                   /db_xref="GOA:D4M8Q2"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR010312"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013198"
FT                   /db_xref="InterPro:IPR014154"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Q2"
FT                   /protein_id="CBL28247.1"
FT                   /translation="MAKRTEKRRGTRKVEAEGTVDILNGTSVTESGWEAGPCSEAVTKA
FT                   MEDILEKTRQVGRALQNRREGDLLDYDRLARLLSEFSTANVYIVDKIGNLLGHNWLPDY
FT                   ESKALSASMKNGVMPEEFVVRMNRCRDSEVHDEDAFLFDDDYAGERPEKHLMYVPIIGA
FT                   AAERLGTVLLVRFRAPFLLRDLLLAEYLGTLVGIEILNERNRTIEERSRDRIAVQMAMR
FT                   ALSYSEVASMKHILAEIDGLEGVAIASKVADRVGVTRSVIVNALRKLESAGLIESRSLG
FT                   MKGTYIKVLSPLFVEELGVATSPRVLY"
FT   CDS             complement(1124936..1126342)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10160"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28248"
FT                   /db_xref="GOA:D4M8Q3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Q3"
FT                   /protein_id="CBL28248.1"
FT                   /translation="MSGLNSALTPSRIIEYLNRYIVGQDKAKRAVAIALRNRLRRRALP
FT                   PEMAHEIMPKNILMVGPTGVGKTEIARRLATLSDAPFIKVEATKFTEVGYVGRDVETII
FT                   RDLMEFGVAMVRRRMLETMQAPALERAEQRLLDAMLPKKERRFSVPDLMKAFGASQEEA
FT                   AEEDREEEGQAEENTRTRARLLEMLRAGRLDDREVDVEVTDAVTAIPVMGASGMDSMGV
FT                   NISEMLSGILPKRSRKRHMKVKEALRILQSEEAEKLIDKETLAREALEIVQEGGIVFLD
FT                   ELDKVVVRGGSTGPDVSREGVQRDLLPIVEGSVVQTRYGPVKTDHILFIAAGAFSGVKP
FT                   SDLIPELQGRFPIRVELEPLSWENLQQILTEPENSLIRQYTALISTEGTELVFTEEATA
FT                   EIAKLSSKMNAEMEDIGARRLHTMMEQLLEEISFSVCDRSPERIEITADLVRERLAPLV
FT                   ENRDIRRYLL"
FT   CDS             complement(1126339..1126881)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10170"
FT                   /product="ATP-dependent protease HslVU (ClpYQ), peptidase
FT                   subunit"
FT                   /EC_number="3.4.25.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28249"
FT                   /db_xref="GOA:D4M8Q4"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Q4"
FT                   /protein_id="CBL28249.1"
FT                   /translation="MITLFTGTTIVCVRDGARVAMAGDGQVTLGSQIIKSGARKVRPLL
FT                   GGKILTGFAGSTADAMTLLERFENCLEQEKGDLMKGAVKLVREWRMDKALRRLEAMMLA
FT                   ADRSMTLLLSGAGDILEPEGDVASIGSGSGYALAAGRALREATDWSPDRIARRAIELAS
FT                   EICIYTDSVVTLEVLGE"
FT   CDS             complement(1126947..1127873)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10180"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28250"
FT                   /db_xref="GOA:D4M8Q5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Q5"
FT                   /protein_id="CBL28250.1"
FT                   /translation="MMDHLIDAFMASVQNRSQSEHTLVNYASDLRQFAEYLEGCGASEV
FT                   RSVEAPILRAYLRALFGWGYAKATVARKLSSLRSFFAFLKERGVLERDPARNLRGPGAP
FT                   RRIPRALSEEVVERLFAAAGESEEALRDTAILEVLYGCGLRVSELTGLRWEDVDLDERW
FT                   LIILGKGSKERRVPFGRCAQRALTALRGEQALGPFVFVGHEGAGSPGREGRRGRTGQKP
FT                   VTVRTVHRVVTALAARAGLEGVTPHVLRHSCATHLLEHGASLKFVQEFLGHESLATTQI
FT                   YLTVSASWMKESYAAAHPRAHVGTDEG"
FT   CDS             complement(1128103..1128267)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28251"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Q6"
FT                   /protein_id="CBL28251.1"
FT                   /translation="MGCETTKLVYSDERPLWLTSDGSLVPAVRGEDGALKGIALYLKDR
FT                   SGAMRRLYA"
FT   CDS             complement(1128588..1129718)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10200"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase./Histidine kinase."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28252"
FT                   /db_xref="GOA:D4M8Q7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Q7"
FT                   /protein_id="CBL28252.1"
FT                   /translation="MSDKVAVLEDRILQFIQQSLDELNSIRKEEASRLEKARSRITAMS
FT                   IELKELASGIDSASREYSSLREKLVLYSKQGLIAEEKEAYDRASESMKLHALLEERYRN
FT                   LTQRRDELQKEERALSRVVSKSESMGTRLRMVMNLVALPEAMPAAQAAEIVNDGALVTA
FT                   FQIAEREARSFAQELHDGPTQSFSALGLTLEMAQELMSRGEYTEAAGELKLALSQLRGG
FT                   LSEVRSLLFGLSPTGIDMGFEVPLKRLADQVKRSWGTELTWKLTGKLEEVPLLQRGNVF
FT                   KTVHQAVVNAAKSGAPHVKVTIGNSRRTVRGLIIDDGKGFDVEKEKAAARERGSYGLQN
FT                   MEERVTVQGGEFTVSSVIGKGTTIAFKVPLRTGEGE"
FT   gap             1130332..1130719
FT                   /estimated_length=388
FT   gap             1132706..1133496
FT                   /estimated_length=791
FT   gap             1135371..1136389
FT                   /estimated_length=1019
FT   gap             1138966..1139625
FT                   /estimated_length=660
FT   gap             1142811..1143266
FT                   /estimated_length=456
FT   gap             1146017..1146535
FT                   /estimated_length=519
FT   CDS             complement(1147381..1148343)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10350"
FT                   /product="Entner-Doudoroff aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28253"
FT                   /db_xref="GOA:D4M8Q8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Q8"
FT                   /protein_id="CBL28253.1"
FT                   /translation="MIDVIKKIRDIGIVPVVKLDSSEQAVPLGKALIAGGIPIVEVTFR
FT                   TDAAEESIKKLVAELPEIMVGAGTVTTIDQAKRAWAAGAKFMVSPGFNPNVVRWCIENN
FT                   IPITPGVNSPSQIEQGIESGLSVLKFFPAEQSGGVNTLKAFAGPYGSVMYIPTGGVNLK
FT                   NMCSYLAFKNVLAVGGSWMVKPDTIAAGKYDEITKLCREAVITGLGFELRHVGINDPDE
FT                   DAARRDAARMEELFSFTSKPGNSSIFAGVGFEFMKSPYLGKNGHIAIATYSVDRAVAWL
FT                   ANLGVKTRPDTEKRDSMGSLTVAYLDEEIGGFAVHLVRR"
FT   CDS             complement(1148577..1149287)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10360"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28254"
FT                   /db_xref="GOA:D4M8Q9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Q9"
FT                   /protein_id="CBL28254.1"
FT                   /translation="MPMLEVRDLQVSYGAIQAVQGVSFEMDKGEIVALIGSNGAGKSTI
FT                   LRTISGLEHAKNGSIVFQGAELTKMKPHKIVELGISHVPEGRRVFPRMTVTENLLMGAT
FT                   LATDKQAVRDDLERVFCIFPRLKERAGQEAGTLSGGEQQMLALGRALMTNGTLLMLDEP
FT                   SMGLAPIVVEDIFRVIKQINENGASILLIEQNAFLALTTASRAYVLETGTITMQGAAKD
FT                   LLTDERVRAAYLGV"
FT   CDS             complement(1149274..1150053)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10370"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28255"
FT                   /db_xref="GOA:D4M8R0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8R0"
FT                   /protein_id="CBL28255.1"
FT                   /translation="MSLLEVKNLSIMFGGLCAVDDFNLEVEKGELIAVIGPNGAGKTTV
FT                   FNMLTGIYKPTSGVITLEGENMVGLKPYQFAQSGIARTFQNIRLFSNATVADNVKMAHT
FT                   MRNKQNIFKCLLRTPGMIRSERALDEKVMELLSRLGLADKADIPAKNLPYGDQRRLEIA
FT                   RALMTAPKILLLDEPVAGMITAELEDMAQLVSKIRRDFGLTIILIEHHMNFVMPIADRI
FT                   KVLDFGKTIAEGLPSEVQTNPLVIEAYLGGGYQDANA"
FT   CDS             complement(1150050..1151066)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10380"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter membrane
FT                   protein 2, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28256"
FT                   /db_xref="GOA:D4M8R1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8R1"
FT                   /protein_id="CBL28256.1"
FT                   /translation="MKKLFKSVYPAALVFLFYVLVTLLRSMRVLNAYYIQVMMFAGINI
FT                   MMTASLNLVNGFTGQFCIGHAGFMSLGAYGAAVVTTIVFHGKSIPAAAHVPVFLLSLLT
FT                   GGCVAALVGALIGLPSLKLKGDYLAIVTLAFGEIVRAILRLIQPIGGARGMIGIPNYSN
FT                   LAWILFFVTVTLYLLRNLIYSPYGRAFLAIRDDEIAADAMGINTTRYKIISFCIAAFIA
FT                   GVAGGLYAHVLAFIQPDSFSFTKSSDFLVYLYAGGSGSLTGSVLGATLLTVLPEILRFL
FT                   ADWRLAVYAVILVVVMLYRSEGLCGGKELPFMRVSRASLYETPLFAAKRIREKRAES"
FT   CDS             complement(1152101..1153252)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10400"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28257"
FT                   /db_xref="GOA:D4M8R2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8R2"
FT                   /protein_id="CBL28257.1"
FT                   /translation="MKKFLVLIMTLAALLQMTGALSAAEDLEKIKIGFAFPMSGSAAMA
FT                   GRYSSHGAQVIEKELNGKITVQGKEYDIEFVYMDTEGAEEKTVNVYQRLIEGEEVIAIV
FT                   GPDSSKCALAAGPVAQNAGCSNIPTFATNTAVTEVGDYIFRACFIDPFQGKIAATYCWN
FT                   AGYKTACIMFNNADAYPVGLKDAFIENFEALGGRVLAIEEYSGSDVKDYNVQLTKLAAQ
FT                   NADCLLLPNLNVELGLEIRQARTAGITCPIVCGDSADTPEVAQVAGSASEGVAYVSAFS
FT                   AESTAPAAAEFVKKYTAMFPQELPNSNAELTYEATQMVLYALENVREISREGVRDALAS
FT                   LKGLEQPSGIMNMGEDRNPVKGAVIMQYDSKGVSHFVSAVNPD"
FT   CDS             complement(1153400..1154428)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10410"
FT                   /product="Sugar kinases, ribokinase family"
FT                   /EC_number="2.7.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28258"
FT                   /db_xref="GOA:D4M8R3"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8R3"
FT                   /protein_id="CBL28258.1"
FT                   /translation="MAKYVTFGEIMLRLTPPGHDVLFQTPRLEATFGGAEANVAVSLAN
FT                   YGEDVAFVTAAPANPIGDAMLRELRGFGVDTRFIRRCGDRLGVYYTETGSNMRPSKVIY
FT                   DRAHSSVSEVEPGDFDWNIVFDGAKWFHTTGITPAIAEGTAKTALGAMKRAKEKGLTVS
FT                   CDLNYRKKLWKWGKTPKEVMSEMAQYIDVMIANEEDCQKCLGIELDVDVTSGKLDASKY
FT                   EALARKIMATYKNVQYLAVSLRESMSADWNNWSVVLASKDRFYVSKKYEIRDIVDRIGG
FT                   GDSFGSGLIWGLNNLDGLQAALEFAAAASALKHTIYGDFNRVSRDDVLTLMGGDASGRV
FT                   QR"
FT   CDS             complement(1154446..1155603)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10420"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28259"
FT                   /db_xref="GOA:D4M8R4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8R4"
FT                   /protein_id="CBL28259.1"
FT                   /translation="MNFLNKKAKGLEQGAIRAMFDKAIGMSDVISMGIGEPDMPTPSLI
FT                   CEAATEALNKGITHYTPNAGAFELREAIAQKSTVKEIGYDPWTEIIITNGGMGALSLLF
FT                   LVILDEGDEVLIQDPQWLNYVAQVQYCGGKAVRVPTKSQDNFQMSAEVIESLITPRTKA
FT                   LMINSPNNPTGEVMPWSNVEKIAEVVQRHDILVITDEVYNTLTYGDSLPYRSIASLPGM
FT                   KERTVVVNSFSKAYAMTGWRIGYAAGPSDVIDRMVKCQENFNACVNAPGQYAAVVALNH
FT                   PELTKELRDVFAGRRKAFLEGLSNIEGIRCNEPEGAFYAFPDISAFRMTSQRFCERLLL
FT                   EQRVVCIPGSAFGECGEGFIRVAYTCGEEKLLEALERLRTFCAKI"
FT   CDS             complement(1157427..1158101)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10450"
FT                   /product="Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28260"
FT                   /db_xref="GOA:D4M8R5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8R5"
FT                   /protein_id="CBL28260.1"
FT                   /translation="MKALFVNGSPRKNWNTHKMLESAMEGAREAGAEAELVHLYDAAFK
FT                   GCVSCFACKVKGSRTNGLCAFRDPLTPTLEKARGADVIVIGSPVYLGCPTASARAFLER
FT                   LMFPLLIYGIKERRVLKKTVPTAMIYTMNCPEGSAERFHYSTLLGANADALERTFGYSE
FT                   ALCAYDTYQFSDYSRYEVTLFNEKDKARQRAEQFPKDLQNARELGKRLVEKVASPAESD
FT                   VT"
FT   CDS             1158368..1158730
FT                   /transl_table=11
FT                   /locus_tag="SY1_10460"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28261"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8R6"
FT                   /protein_id="CBL28261.1"
FT                   /translation="MKGSKDSKTEDYAARCPLLYVMELIGSKWKLPILWCLNDEDGLHY
FT                   NELKRRVHGVTNTMLTKCLRELEEKGLIFRHSLGSVPPSVTYHLKEDGKSLMPALEGLC
FT                   SWGMAYLEKRRERPAC"
FT   gap             1158936..1160092
FT                   /estimated_length=1157
FT   CDS             1161423..1161920
FT                   /transl_table=11
FT                   /locus_tag="SY1_10490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28262"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8R7"
FT                   /protein_id="CBL28262.1"
FT                   /translation="MSKNRIVLFGVLGVVMGLVLGVFGRDFIVASEKQKLEAQKAEEAV
FT                   ATSIIVRLKQASTDLSMFRMKNGKEIGENYDLGAALNTPERIREKLGDIYADGRWVFQS
FT                   NAAGWWIGYKLDGVSNAVRQKIASQARFSNLFKATDKSDANVYDGGDIVFLYDYVPETF
FT                   KW"
FT   CDS             1162025..1162570
FT                   /transl_table=11
FT                   /locus_tag="SY1_10500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28263"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8R8"
FT                   /protein_id="CBL28263.1"
FT                   /translation="MSKNRIVLFGVLGVVVGLALGVFGRDFIVASEKQKLEAQKAEEEA
FT                   KIKAMMTGIPVDASQEFIAAKTLVDDMKSLKAMLLIFYMEHIEQEVDLTKTLDTPEHIR
FT                   EVLKKKVRNVEKYLDGNWIFQGNTSDWWIGYNLDDGFKKQASEIGKELVKRAERNGLYK
FT                   DMNGNLYDGGGKVYMKVH"
FT   gap             1163427..1164223
FT                   /estimated_length=797
FT   CDS             complement(1165777..1166160)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10530"
FT                   /product="Predicted endonuclease distantly related to
FT                   archaeal Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28264"
FT                   /db_xref="GOA:D4M8R9"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8R9"
FT                   /protein_id="CBL28264.1"
FT                   /translation="MSSAGDLGRLAEGWATDYVRSLGWRVLGRNVKNRCGELDVVALDE
FT                   VERELVIVEVRCRTLGRVQAPLDSVGPHKLRALIRAGRTLADEMGWDGPWRIDLIGVTV
FT                   GRGSEGWRLEHVRDVTRGMEFPL"
FT   CDS             complement(1166153..1166440)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10540"
FT                   /product="Flagellar biosynthesis pathway, component FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28265"
FT                   /db_xref="GOA:D4M8S0"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8S0"
FT                   /protein_id="CBL28265.1"
FT                   /translation="MAEAKRDQAVALKYDRETMNAPTVTARGEGFIARKIVERALEADV
FT                   PVLEDAALVSALLSLELGEEIPAELYTVVARVLTWVYRVDREAAGGGRDE"
FT   CDS             complement(1166440..1167534)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28266"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8S1"
FT                   /protein_id="CBL28266.1"
FT                   /translation="MPPVNNLINQNLTDPSRTSAGQIAVGQQAEALQATPSRAPGLRTG
FT                   TVVTGRVLAGNPDGTYAVRIDGQDANPPLELRARATLTLVPGERFTALWDASGGGVPVL
FT                   RLSKEELSFLAQIPQRDRGLATALLSREMPLSGEVLAVIRDAWRRMGSDEGQIAPLVEL
FT                   WARGVSLSAENVSLLAGYTALDAAAASEMWNRIRRELRERTRKGQDPLEALREMKEGNG
FT                   EKARFLQAHSLLMRAPRKDVNPMLLAAPFWPLPEAAGGMTARVFVGRSAEEEGQRYWQA
FT                   GFGLTGSALGAVAGVVETDGRGCNVLLTAESAAACGLLEARRGELRQELAGAALLVRFI
FT                   GISRGAPQEMRERLLAGRGLDVTV"
FT   gap             1168242..1168428
FT                   /estimated_length=187
FT   CDS             complement(1168582..1169388)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10580"
FT                   /product="Predicted GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28267"
FT                   /db_xref="GOA:D4M8S2"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8S2"
FT                   /protein_id="CBL28267.1"
FT                   /translation="MARGGRKLAELVEKLDLILEVRDARAPFSTSAPLVSAFSRLRPVL
FT                   LVLAKRDLADPERTGVWLEALGSDARALDLRRKEGLASLRKALSARRPPHRELRVAVMG
FT                   IPNVGKSMLLNALVGKAQAHVGGIPGVTRSVSWYRNGDLLVVDSPGILDPHAEPGVHQV
FT                   LSWLGCARAEVLGGFEAAALQFIRFLRSRGLFGAVLGKWEVRELDETPEETLVRIGRRL
FT                   GCLAPGGAVNMELAARRLMEAFASGRLGPATLELPGDPIGRAGADD"
FT   CDS             complement(1169420..1169968)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10590"
FT                   /product="signal peptidase I . Serine peptidase. MEROPS
FT                   family S26A"
FT                   /function="signal peptidase I . Serine peptidase. MEROPS
FT                   family S26A"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28268"
FT                   /db_xref="GOA:D4M8S3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8S3"
FT                   /protein_id="CBL28268.1"
FT                   /translation="MELAAEAAKPWWRETIETIVWAFVLAMIIRTFVVQAFWIPSGSMI
FT                   PTLEIGDRVLVAKFWNWFFEPSRGSIYVFTYPKDRDRDFVKRIIGLPGDTVDIRDGVVF
FT                   VNGRPTEEPYVVNHDAYSIRPGEFFQRPFTVPQDSYFVMGDNRPNSQDSRFWGFVRRSD
FT                   LHGPAFFRYWPLTRLGIPR"
FT   CDS             complement(1170087..1170671)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10600"
FT                   /product="orotate phosphoribosyltransferase, Thermus
FT                   family"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28269"
FT                   /db_xref="GOA:D4M8S4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8S4"
FT                   /protein_id="CBL28269.1"
FT                   /translation="MEKTQELAVEVLTRLGALKRGHFRLTSGLHSDCYMQCAVLFEHPK
FT                   ESERLCRALAEGFAGQRIDLVASPAVGGVIMGYEMARALSVRNVFAEREDGRMTFRRGF
FT                   HVEPGERALVVEDVVTTGGSVREVVELLRGAGAEVVGVGSVVDRSGGRVDFGVPFHALM
FT                   TMEASAWREEECPLCRKGEPIVKPGSRQLKK"
FT   CDS             complement(1172459..1172662)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28270"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8S5"
FT                   /protein_id="CBL28270.1"
FT                   /translation="MVVVFDEDTPRELLSRLRPDVLAKGGDYRAEELPGREFVDEVVIL
FT                   PLLEGHSTTRILNHGREGGGQA"
FT   gap             1173038..1173220
FT                   /estimated_length=183
FT   CDS             complement(1174147..1175499)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10660"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28271"
FT                   /db_xref="GOA:D4M8S6"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8S6"
FT                   /protein_id="CBL28271.1"
FT                   /translation="MKLAVIGTGYVGLVTGTCLARYGSTVACVDTNGERVAALRSGRVP
FT                   FYEPGLDEMMARNAAEGRLSFTTEAAEALEGADVCFITVGTPSAPDGSADLSFVEGAAR
FT                   SVGRGMSGGLLTVVKSTVPVGTNARVRDWIREELEARGARHALNMASNPEFLREGAALR
FT                   DFVEPDRVVLGADSPEAAETLRRIYSFLEPSKLLFMDIASAEMAKYAANAMLATRISFM
FT                   NEMACICSRVGADVESVRQAMGRDDRIGSKFLRAGCGYGGSCFPKDVRALRDFARATGY
FT                   EPNLLTAVDEVNTRAKGLLLEKLRGRLGDLSGRVIALWGLAFKPKTSDTREAPAQVLIH
FT                   GLLAAGASVRASDPRAIEETRAALGDLPNVTYVPDPYEAARGADALAVVTEWDLYRQPD
FT                   FVRLRSLLRTPIVVDGRNVYSREEMERAGFDYLSVGRPPVLAASGPAGRAL"
FT   CDS             complement(1175514..1176872)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10670"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28272"
FT                   /db_xref="GOA:D4M8S7"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8S7"
FT                   /protein_id="CBL28272.1"
FT                   /translation="MPWIWSVLMPHPPILVPEVGRGRESEAAETLAGLGRVAEAVRGRA
FT                   PEVLLVLSPHQPCAPCALGLNAAPEPEGSFAAFGAPQVRMGFRSPAEDREVLGGFLTPR
FT                   GIPISYRSLPDLSSDQGTMVPLHFLRRAWGGLPATLTASPTGLSPRGAFDMGRALADFD
FT                   DGRSWALLASGDLSHRLIPSAPSGYAPEAGRAFDDAVLEALRRGSAAPIFALKLKTINE
FT                   AGQCGLWSVLAMLGLMEALGGTARVLSYEGPFGVGYCTAAWDAPVPAPVRLARETVTRL
FT                   LSGRPLPERGSDVCASPLWGRTAACFVSIKTSRGALRGCIGTLAPSQATLDREIIENAV
FT                   AAATRDPRFPPMTAEELEGVRLSVDAVGSGARRGRGAAGPQALGRHRVEGLAARRAAAG
FT                   PGGRGHRGAAGGDRGPKGRPRQPGGRRAPALRRDAVSRAGCGDGPPSDFVITT"
FT   CDS             1177973..1178158
FT                   /transl_table=11
FT                   /locus_tag="SY1_10690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28273"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8S8"
FT                   /protein_id="CBL28273.1"
FT                   /translation="MGLRQPPEGGQPPGPRRGLSGAILDRSRSMADRLIEGKLPDGTEG
FT                   WDGLASEDLLPGAWTS"
FT   gap             1178761..1180929
FT                   /estimated_length=2169
FT   CDS             complement(1182595..1182798)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28274"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8S9"
FT                   /protein_id="CBL28274.1"
FT                   /translation="MSDNYPSDYPRSRAKAIAALRTVRDEDIDFSEIPETTNFSNWTPV
FT                   GEKFKKAAEHNLTVLNEKIRAG"
FT   gap             1184197..1185441
FT                   /estimated_length=1245
FT   gap             1186939..1188663
FT                   /estimated_length=1725
FT   CDS             complement(1188840..1189295)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28275"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8T0"
FT                   /protein_id="CBL28275.1"
FT                   /translation="MQKFRGKDIAVFVLVLGILAAGVYSLIGSGGSSINTPAIASMTPE
FT                   ELAAENEMLTKQAHDASMELQMIAAGGSKSANMWVEKYCKDRKDAPLPEDPAAANIELK
FT                   ARVREARTVFEELQAEQRKEMHWLTQYYAEENEQTLEKLGIQSHKLL"
FT   CDS             complement(1189316..1191358)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10780"
FT                   /product="DNA topoisomerase III, bacteria and conjugative
FT                   plasmid"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28276"
FT                   /db_xref="GOA:D4M8T1"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8T1"
FT                   /protein_id="CBL28276.1"
FT                   /translation="MRLFIAEKPSLARAIAAVLPQPQRASRLYIEAGNDVVAWAAGHLL
FT                   EQAMPEQYDEKYKRWNLADLPIIPEEWKMLVKKESRDLFDNLKTLLKKADSVVNAGDCD
FT                   REGQLLIDEILEHCKYKGPVQRILISDTNPDAVKKALAELKPNEDFRGDRDAARARSQA
FT                   DWLHGMNMTRLYTKLAEKNGYDGGPLRIGRVKTPVTALVVRRDLEIESFVPKPYWTLQA
FT                   QIQVKEGAFWAGWRPKEEQTGLDEEGRLVDKATGEELASRLKGKPAVITKYESKKQSVK
FT                   PPLGYSLPKLQMAASRKHDLSPSRVLEVCQKLYEQGVLTYPRSDCEYLPEGHQDEAEKV
FT                   LAVIDALSSLKRPDELNTARKTPVFNGKKVEEHHAIIPSASCRASKPLEGDEPLIFELV
FT                   ARRYLVFFMPDHEYMQTSITAEVEGETFVASGRRVLAEGWKAVERNDEPEKNDDKEDRE
FT                   EEQAALPVVSEGEKGECRDTKLQEKQTKAPARFTEASLLRAMNEVHKFVADPKVKKILR
FT                   ETDGIGTAATQAGILKDLITFGQLQKQKKQLISTPAARSLIQALPEAITLPDLTALWET
FT                   KFRAIKEGTLSIEDMMEQMATTIRESIAQAGSVSVQGSGEKKPVKATKKTAPKAGKGDV
FT                   KCPKCGAKMVLRNGKNGPFWGCGNYPTCRATADDDGGKPVFKKQH"
FT   CDS             complement(1191376..1192203)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28277"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8T2"
FT                   /protein_id="CBL28277.1"
FT                   /translation="MGELNKLYQAISNFSEAKERLDRTPRKKFTIAALQNTTTTLRDVA
FT                   GFGNVSDMLDAEQLCINLEKALYANTPDDEARYDKQIVENMAIRGSLDDILDVKGYQAH
FT                   FERLKVLGVNPDNLPKGEPFETNCNRQIKYLGSAKNGFSEPEEKDFFAARQENLRAVIL
FT                   ICRERQREALMPEAVSSELAGMITEDTGVQEPTINLHPYTKGQWFTGKIIHTDAAHGRC
FT                   IQQTASRLFTVHRLEKLETVPEQGQDLKITYSKDGAKAKLDPIVQKQSRSLHR"
FT   CDS             complement(1192196..1192444)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28278"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8T3"
FT                   /protein_id="CBL28278.1"
FT                   /translation="MLLPKDFVSTMSDEDKDKIMDEADALDERGEKEAANCLRNTIPMN
FT                   PILADGMKKVGGIQKLKDLGFNLNDAVKLFGEGWLNG"
FT   gap             1193024..1193989
FT                   /estimated_length=966
FT   CDS             1195003..1195254
FT                   /transl_table=11
FT                   /locus_tag="SY1_10830"
FT                   /product="Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28279"
FT                   /db_xref="GOA:D4M8T4"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8T4"
FT                   /protein_id="CBL28279.1"
FT                   /translation="MSEVTLAELAPGESGMVVGIKGRGMLAQRLVDMGLYPGVAARVVR
FT                   RAPLGDPIEVDAEGALVNLRYEEAHFVKMKKLNNGQDE"
FT   CDS             1195238..1197769
FT                   /transl_table=11
FT                   /locus_tag="SY1_10840"
FT                   /product="small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28280"
FT                   /db_xref="GOA:D4M8T5"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011619"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8T5"
FT                   /protein_id="CBL28280.1"
FT                   /translation="MGKMNKMGKKIVALAGQPNCGKSTVFNSLTGARQFVANYPGVTVD
FT                   KMMGWYRRDGESVEVVDLPGTYSLTSYSPEERVSRGVLLGEPLSAVVNVMDAANLKRSL
FT                   YLTIQLLEMEIPLVLDLNMMDVAENLGITVDAAGLSKELGVPVIGTAITQGRGREDLLR
FT                   AIADMSRSSARTSLATAELYPDLKDALRELEALLAGASLGETFPLPWIAVKLMEADPEV
FT                   AALVREKAEGRAQEVLLKAEALREHFEREKGMSADLYVSGQRSRRAAAIAGRHVVKKDA
FT                   EKVHISERIDRAVCNKFFGPVFLLVVIYGFYYLSFIQGYNLTHYTWPVLAGFRSLAESV
FT                   LPQPGLIELPLLREFVLWIVDNLNALFNYIPIFFILFALIAVLEDSGYMPRIAFVLDRI
FT                   LSRFGLHGQSTLPMILGGVVLGGCAVPAVMATKGIPDEKSKLATILTLPMLNCQAKLPL
FT                   YFLLIGIYFNETVRLPLFGEVNQQNIVIVFIQTISLLFVLPIAKILSMTALKHKETAPF
FT                   IMEMPPYHIPSLRGVLGRAIERIWLYIRKITTVVAAVAVVLFVLLQFPGLTPERKAHYE
FT                   AEKDRAVQAFLDRAKDKKLGSGLRSEDDVLRLILYQQGYKELLKSGASAEKKKAYGLKN
FT                   PDFFEIIQNKKDPEAKALEKELKKLVLFRTNTLTAIRRERIDNSLLGKIGRALEPASRY
FT                   AGFNWRVNVAVLSTLAAKENSVSTLGALYIKEPGEAGGAGKNTDTLEQRMKQQEGDLTP
FT                   LHAMALMLFMVLCPPCLPTIMAIRVQTGSTRWMLFAFFMPLLLGLLTAVLVFTGGSALG
FT                   LSGFQAMWMFYLIPLTLTVLLGLIKTKRTYS"
FT   CDS             1198281..1199075
FT                   /transl_table=11
FT                   /locus_tag="SY1_10860"
FT                   /product="ABC-type Co2+ transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28281"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8T6"
FT                   /protein_id="CBL28281.1"
FT                   /translation="MKKIVVLSLFALFAAALPASAHFQMLYTPETILDKGGEVPLKLVF
FT                   THPFEAGHTMDMGKPQEFFVVNKEKKTDLLDTLKPITWTSLENKGRAFETSFKLKGMGD
FT                   YVFCLVPAPYYEQSEETYIQQITKVIVNNGSLPTDWDAEIGLKAEIVPLDKPYALWAGG
FT                   VFRGVVKGDGKPVPFAEIEVEYMNHKPDMKKNSFEKKATVEAPHDAFVTLTIKADANGT
FT                   FTFAMPKAGWWGFAALGAGPDKEFEGRELSQDAVIWVQATKM"
FT   CDS             1199386..1200201
FT                   /transl_table=11
FT                   /locus_tag="SY1_10870"
FT                   /product="ABC-type Co2+ transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28282"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8T7"
FT                   /protein_id="CBL28282.1"
FT                   /translation="MRKFFSVMVAGALFAAFLGATAEAHEFWVNADYKDGLLKADLGYG
FT                   HEFPDPEVIPDERTHLFEPLKLITPEGATEMALAGDKNYHYEVKADLKKGDYLVIGNYK
FT                   PTFWAKGSEGWKQADKAKYKEMTKADATYAEEAAMYAKLVMNLDGADGTDLITKPVGQR
FT                   LELVPQVNPATVKPGQRFPVLVLLDGKPAKTAEVKAVYAGFTGGAKDGDPANEYKCFWG
FT                   RTGLDGIINIIPVKAGYWNAFVQVKIPYADTAVADETVLVSRLTFTIAE"
FT   CDS             complement(1200828..1201409)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10890"
FT                   /product="Chromate transport protein ChrA"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28283"
FT                   /db_xref="GOA:D4M8T8"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8T8"
FT                   /protein_id="CBL28283.1"
FT                   /translation="MGGAAEAWKLFVQFFRFGCFTFGGGWSIVAQMRERYVEKEGTLTN
FT                   EDLLDLTSIGRSLPGTMIGNIAMFYGYRRAGLPGGAACVLGMVLPPTLILMGVTCAYAA
FT                   LQGNVWVLAAMRGVRAAVVPIILSALAAMVRGAFRFPPCAAVAPVTFALYAFPGVSSVW
FT                   LVLLGAVCGLLICEGYERKGVDRRGTGRPA"
FT   CDS             complement(1201424..1202986)
FT                   /transl_table=11
FT                   /locus_tag="SY1_10900"
FT                   /product="Protein of unknown function (DUF1703)./Predicted
FT                   AAA-ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28284"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8T9"
FT                   /protein_id="CBL28284.1"
FT                   /translation="MKRNLKTLPIGTYNFEKLRRMNCVYVDKTARLVKLVEAGAWYFLS
FT                   RPRRFGKSLTLSTLDALFGGKAELFRGLAAEAWAIEQAKHPAPVLRLDMSMMNVSDVAQ
FT                   FEGSLNSALTWRAEDAGVTLSSQQPSDKFQELIRALHRQGGPVVVLIDEYDKPILDKIG
FT                   NLEAAEAMRDSLRTLYTVLKGCDEYLRFVMLTGISRFTKTGVFSAMNNLMDISMTESFG
FT                   DVVGYTQEELERDFADWIDDTAGKMRLSRQELLMRMKDYYDGFCFDGTTRLYNPFSILN
FT                   FFFNGRFSNYWYESGSPSFIVAYMKRHEILDPEAYRHLVVKESFASSQEIERARPESFL
FT                   YQAGYLTIEKWEEQSLTLDYPNREVLDSIAGMYLEHVYNVEGYSSIGAQLWKALSNGEV
FT                   TEAIRLYNTALASIPYQDLARRDESLYRSLFLMLLRGAGITAHGEVPTNRGRSDVLVLF
FT                   PHRVVVLEFKLARSAGEIARLRDEGRKQIEEKGYAKPFDADRRAVTSAVVVIDLQKHEA
FT                   AAC"
FT   CDS             1203266..1203736
FT                   /transl_table=11
FT                   /locus_tag="SY1_10910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28285"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8U0"
FT                   /protein_id="CBL28285.1"
FT                   /translation="MKKVGFPLRVAAVVVLAASLAAEGTAAPQDAETALPASGDEAVME
FT                   VAEPAPVGVPEPKPSAVGFEIMGPNGERTVVPLDRLEVREATGSLEGLDGGQLTLAVGG
FT                   RRYVCPLLAECAFADEKGQPMNRAAFAQRFLRRYVRVEMERTTGTVLSCRAM"
FT   CDS             1207238..1208197
FT                   /transl_table=11
FT                   /locus_tag="SY1_10940"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28286"
FT                   /db_xref="GOA:D4M8U1"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8U1"
FT                   /protein_id="CBL28286.1"
FT                   /translation="MTERDLKLVVASSPHVHSPLSTQKIMGLVIAALLPAGAAGVHFMG
FT                   WRALVVIAVCVAASVAAEYLWQRATGQRVTVSDLSAVVTGLLLAYNLPPSVPLWMAACG
FT                   AVFAIIVVKQFFGGIGGNVMNPALAARAMMLISWPVAMTDWSLDGVSTATPLAAMKALS
FT                   GAGASAAPGPSCSTADLLLGNVGGCIGETSAALLLLGGAFLVWQEVISWRIPVIYTLTA
FT                   ALLAALFRHGGGMMPLQEALTGGLLLGAIFMATDYTTSPMTARGQVVFAVGCGVLTALI
FT                   RRFGGYPEGVSYSILIMNATVPLIDRVTKPRILGEVRR"
FT   CDS             1208194..1208796
FT                   /transl_table=11
FT                   /locus_tag="SY1_10950"
FT                   /product="electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28287"
FT                   /db_xref="GOA:D4M8U2"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8U2"
FT                   /protein_id="CBL28287.1"
FT                   /translation="MNAAAEETSLHKALRLGGTLFLVTAVTGLVLGGVERGTRTAILKA
FT                   RMADQADALRNVMPDAETFKAVDVAPEDGTVVVTGAQEALKGDARVGYCLTVSTKGYGG
FT                   PISMVVGLKEDGSVSAIRILTHAETPGLGARSAEPAFYRQFDGRTALPLKVVKGAAGAG
FT                   DEISAISGATITSTAVTAGVNAAEDYWSRNLKGGESR"
FT   CDS             1208793..1209494
FT                   /transl_table=11
FT                   /locus_tag="SY1_10960"
FT                   /product="electron transport complex, RnfABCDGE type, E
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28288"
FT                   /db_xref="GOA:D4M8U3"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8U3"
FT                   /protein_id="CBL28288.1"
FT                   /translation="MSRNPISIIKNGILTENPTFVQCIGLCPTIAVTSSVENGIGMGLA
FT                   ATFVLIASNAVISMLRKLVPDEIRIPIFIVVIAAFVTVIQFLMEGYAPALNRALGIFIP
FT                   LIVVNCIILARAEAFASRNGVIASIFDGLGMGLGFTAALTVLGAVREVLGAGTILGLPV
FT                   VPAGYQPALLVILAPGGFLMLGIFMALFRAVQARLAARRGEPAPEAPAGCAACAMSGSC
FT                   PGARIEKEDQR"
FT   CDS             1209491..1210072
FT                   /transl_table=11
FT                   /locus_tag="SY1_10970"
FT                   /product="electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28289"
FT                   /db_xref="GOA:D4M8U4"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8U4"
FT                   /protein_id="CBL28289.1"
FT                   /translation="MTELFLLFVSSIFVNNILLTRFLGCCPFMGVSSRLKTAVGMGAAV
FT                   VFVIVLASLMTWLTYNFLLAPLGLEYLYTLAFILVIAALVQFVELVLKKLNPTLYKALG
FT                   IFLPLITTNCAVLGVAVLNMSERYTLTQSLVNALGSSLGFLLAIALMAGIRERVETNEG
FT                   IPACLQGLPLTLITAGLMSIAFMGFTGMGK"
FT   CDS             1210086..1210919
FT                   /transl_table=11
FT                   /locus_tag="SY1_10980"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28290"
FT                   /db_xref="GOA:D4M8U5"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8U5"
FT                   /protein_id="CBL28290.1"
FT                   /translation="MNFMHDLIVPLVLMGVMGAVFGALLAIASVVFRVRQDERVGKIRA
FT                   VLPGANCGGCGYPGCDSYADGVVNEGAGTNLCVVGGSAVSARVAEIMGVKAEETVPMRA
FT                   FVRCLGSAARSPRKVLYSGIADCRSAVMVPGGSPNECPFGCIGFGTCTKVCNFDAIFMG
FT                   PDGLPVVDREQCVGCGACVSACPKDVLTLIPQTSDVVVACGSHWKGPAVRRVCSIGCIG
FT                   CGLCARVCPAGAITMDRDLAVIDPAKCTNCGLCAQKCPAKCIETGQSLAACAKTA"
FT   gap             1211111..1211902
FT                   /estimated_length=792
FT   CDS             1211949..1212269
FT                   /transl_table=11
FT                   /locus_tag="SY1_10990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_10990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28291"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8U6"
FT                   /protein_id="CBL28291.1"
FT                   /translation="MHEREETDYHNTFRLAERKAEAKGMTKGMAKGRVKGLAEGLAEGL
FT                   AEGEALGEARGLAKGLNEGRADGIAATARRMLSMSFTSEQISQATGLSPDEVEALRSGT
FT                   GN"
FT   CDS             1212660..1212818
FT                   /transl_table=11
FT                   /locus_tag="SY1_11000"
FT                   /product="Protein of unknown function (DUF1021)."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28292"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8U7"
FT                   /protein_id="CBL28292.1"
FT                   /translation="MSKGRNRVEETEGILTDVYPKLFTLYNNSTASTISFSYAEVLTHE
FT                   VELEVVG"
FT   CDS             1213035..1213460
FT                   /transl_table=11
FT                   /locus_tag="SY1_11010"
FT                   /product="Flavodoxins"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28293"
FT                   /db_xref="GOA:D4M8U8"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8U8"
FT                   /protein_id="CBL28293.1"
FT                   /translation="MNTIGLAYFSNTGNTKALAEAFKSAVEAKGGSLYFSEAAGVDKAA
FT                   FAAADVWAFGSPASGTEEINDTEVLPLIEALKDHLKGKKVFLFGSYGWGGGAFMDAWKQ
FT                   DMEGRGAVIAAEPVTCLEAPDGAAESAMRQAAEALLG"
FT   CDS             1213998..1214303
FT                   /transl_table=11
FT                   /locus_tag="SY1_11030"
FT                   /product="Peptidase S24-like."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28294"
FT                   /db_xref="GOA:D4M8U9"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8U9"
FT                   /protein_id="CBL28294.1"
FT                   /translation="MYPTLRDGEAVVVDRNAYRQEIPDVGDVVLASHPFMRGVWMIKRV
FT                   VGFAGEDRCVLQGDNAMESSDSRSFGPIPLRSIRGRATRKADGSPLSPPPTRGDAL"
FT   CDS             1214384..1215349
FT                   /transl_table=11
FT                   /locus_tag="SY1_11040"
FT                   /product="agmatinase"
FT                   /function="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28295"
FT                   /db_xref="GOA:D4M8V0"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8V0"
FT                   /protein_id="CBL28295.1"
FT                   /translation="MSARELKQPATAFASPRFCNVGNFMRMERVADPDGLDFAVYGIPF
FT                   DTACSYRSGARFGPQGIRNISVMMKTNHPVHEVNIFDYLKGADMGDVNVVPGYIHPTYA
FT                   AIEAFASGILDAGALPIALGGDHSITLAELRAVAGKHGPVSLIHFDSHADINDEVFGEK
FT                   YNHGTPFRRAIEEGLIDPHTSIQVGMRGSLYDAGEFKLAADLGLKLIPTHRVREMGIPA
FT                   VLDEIRRRVGENKAFLTFDIDFIDPAYAPATGTPEVGGYSTFEAISFIRGLTDVNFAGF
FT                   DVVEVAPPYDVAEITSLAACNIVFEFLSVLALQKKEGRRT"
FT   CDS             1215625..1216731
FT                   /transl_table=11
FT                   /locus_tag="SY1_11050"
FT                   /product="SurA N-terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28296"
FT                   /db_xref="GOA:D4M8V1"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8V1"
FT                   /protein_id="CBL28296.1"
FT                   /translation="MLKNLRTHMKWIMITIVVAFLLSTFLMYEGRSGRRGPSRSADGTM
FT                   TDYEVAAVDGRPLMRSELENRLRAYLENSGLRNAASLDLPAVYQAVLDQYVLERQLESE
FT                   VKKADIAISDADAEQAMKAYADSAFPTREAFYAALERQGISSAEYKKSLARQLAVQQLL
FT                   HMAVGDVTVSEDEAVKFYDSIKDQLFRTPAGVNLQVARFGASADAEALRAKLQAGTDWV
FT                   QATSGDALASMDVLSVTREPLFLPESAFESGVLAELASLDVGAVSPVFSPASGDFSVAV
FT                   KTERVSESVRPYEDVSSDVRAFLRSQEERRKLNDYEAALMAKAEVVIYDASLFPASADT
FT                   TASAEPQAVSTDASASADVEPASDDAAK"
FT   CDS             1221300..1222406
FT                   /transl_table=11
FT                   /locus_tag="SY1_11090"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28297"
FT                   /db_xref="GOA:D4M8V2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8V2"
FT                   /protein_id="CBL28297.1"
FT                   /translation="MIRRFIENVGWPRFIIGLFLLSLFIAAPFVGVRVDTSLSDVLVRF
FT                   GMNGVMVLAMIPMVQSGCGLNFGLPLGIIAGLLGATLSIEFNQGVLAFAADLAAGRPWL
FT                   AFLASEAARAPLSFASAIVIAVPIAAVLGFFYGKLLNRVKGDEMMIATYVGFSSVAFMC
FT                   IAWLLMPYRSPTMIWGYGGSGLRTTISVNGYWLHVLNDLLSFQQGHLFVPTGTFLFFAV
FT                   LALLMWVFMRSKTGTAMTAVGSNPDFARASGVNVDRMRTISVVLSTILGAVGILVYEQS
FT                   FGFIQLYMGPFYMALPAVASVLLGGASVNKAGIVNVIVGTFLFQGILTMTPSVINSVLQ
FT                   TDMSEVIRIIVSNGMILYALTRKVRVKR"
FT   CDS             1222403..1223533
FT                   /transl_table=11
FT                   /locus_tag="SY1_11100"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28298"
FT                   /db_xref="GOA:D4M8V3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8V3"
FT                   /protein_id="CBL28298.1"
FT                   /translation="MSKAGKNWNPLTFLADNAVPIVFIAISAVAIPLSGFSFSHLVQEL
FT                   LIRIGRNSFLILSLLIPIMAGMGLNFGMVLGAMAGQIGLILISDWAIVGIPGMALAMLV
FT                   GTPIAILLGILCGNVLNRAKGQEMVTSYILGFFINGLYQLVVLYFMGWLIPISNPVILL
FT                   SRRYGVRNTVNLQGIRGVLDNLVPVSFPFFGGTVRVPLATLLVIAVFCLFIVWFRRTKL
FT                   GQDMRAIGQSQSVADSAGIAVNRTRIIAIVISTVLACYGQVIYLQNMGTLNTYNSHEQV
FT                   GMFSIAALLIGGASVSRASIANVFAGVVLFHLMFIVAPMAGKNLMGQAQIGEYFRVFVS
FT                   YGIIAIALVLHAWKRNRDREASRRSLRGPAEGREEA"
FT   CDS             1223530..1223997
FT                   /transl_table=11
FT                   /locus_tag="SY1_11110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28299"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8V4"
FT                   /protein_id="CBL28299.1"
FT                   /translation="MMRFLQRALALILLVALGVWLFYVGREHQVLLDNKTIELEGRTFK
FT                   ALQEVRVSVNGAEPVELYPRDRDMVKVVGPAFSLRVEIEDPGSDVELVEREVRVGFGKD
FT                   LMLSFPLMAASRDFVLPPPTSQQAPAPEAVASEDALASGVGEEVPAAPTNP"
FT   CDS             1224226..1225785
FT                   /transl_table=11
FT                   /locus_tag="SY1_11120"
FT                   /product="propionyl-CoA carboxylase carboxyltransferase
FT                   subunit"
FT                   /function="propionyl-CoA carboxylase carboxyltransferase
FT                   subunit"
FT                   /EC_number="6.4.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28300"
FT                   /db_xref="GOA:D4M8V5"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8V5"
FT                   /protein_id="CBL28300.1"
FT                   /translation="MGFRSMEELCEELREKRAAAFNGGGEKAIAKQKEKGKGTARERID
FT                   QLLDPGSFVEIDEFVTHRCTNFGLEKTRPLGDGVVTGWGTIDGRKVVVFSQDFTVLGGS
FT                   LGEMHADKICKVMDLAMEMGCPVIGLNDSGGARIQEAIDALNGYGKIFFRNTHASGVIP
FT                   QFSVIMGPTAGGAVYSPALTDFIFMVNKTGVMHITGPAVIKAVTGEEVTSEALGGAATH
FT                   NNISGNAHFMAADERECFAQIRKVLSYLPLNNLDDAPDKPTNDAVDRADPSLRETVPTN
FT                   PNVGYDVHEVLRKVLDDGEFTEVQAGWAQNILTGYGHIGGRSVGIIANQARVMAGCLDI
FT                   NASDKASRFIRHCDAFNLPILTFVDVPGYLPGVTQEHNGIIRHGAKLLYAYSEATVPLI
FT                   TVILRKAYGGAYLAMASKSLGADVVLAWPQAEIAVMGAEGAANIVFRKEIAEAGNPEET
FT                   RAEKIDEYRKAFANPYVAAERGLVDRVILPEETRLSIWQALNALESKRVSRPDKKHGVI
FT                   PH"
FT   CDS             1225806..1226210
FT                   /transl_table=11
FT                   /locus_tag="SY1_11130"
FT                   /product="sodium pump decarboxylases, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28301"
FT                   /db_xref="GOA:D4M8V6"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8V6"
FT                   /protein_id="CBL28301.1"
FT                   /translation="MNAMHFDGLSGAAYVSLVAFSIVFIVLLGLTLVIFAMRFFAAGER
FT                   PKPDDGATAPQRPQSASAAPAARAEGAQARVVAAITAAILAATGGMGRVVSIAPETVDA
FT                   VQKGARWTRAWRASGVLNLISRSVDRGWKH"
FT   gap             1226362..1226550
FT                   /estimated_length=189
FT   CDS             1226974..1228065
FT                   /transl_table=11
FT                   /locus_tag="SY1_11160"
FT                   /product="uracil phosphoribosyltransferase/ribose
FT                   5-phosphate isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28302"
FT                   /db_xref="GOA:D4M8V7"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8V7"
FT                   /protein_id="CBL28302.1"
FT                   /translation="MKAAVGCDHAGFVLKRAVLDFLKERGIEVQDFGTFSEDRVDYPDF
FT                   ALEVARAVSLGDADCGVLLCGTGIGMAVAANKVSGVRASACNDVESARMAKAHNDLNVI
FT                   TLGGRFIKPEQVRGILDAWLATPFEGGRHVQRLNKIAMAEQTTLSVGSSGEGRVAIFNH
FT                   PLVQHKVGIIRDKDTNVKEFRALVQEIAGLMVYEITRNLPLQEIEVETPVARTKAQTLA
FT                   GKTIAVVPVLRAGLGMVDGILQLIPNAKVGHIGLYRDPDTLVPVEYYCKLPQDVEERDV
FT                   FVLDPMLATGGSASAAISLIKERGGKKVSLVCLIAAPEGIERVHREHPDVDVFIASLDS
FT                   HLNDHGYIVPGLGDAGDRLFGTK"
FT   CDS             1229041..1230132
FT                   /transl_table=11
FT                   /locus_tag="SY1_11180"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28303"
FT                   /db_xref="GOA:D4M8V8"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8V8"
FT                   /protein_id="CBL28303.1"
FT                   /translation="MAPVIRVLRENGNFDVTVLATGQHTDMLVQALSHFCIKADVNLNI
FT                   MRRRQSLDHITSSVLTGVGSFLDGAPQDMILVHGDTSTTLAAALAAFYRHIPIGHVEAG
FT                   LRSHNMALPFPEEANRVLTDRLASLYFTPTESDAENLRREGVDPRRIHVTGNTVIDALF
FT                   WTLENLAQPEVLRELPPETPLVLMTAHRRESWGEPLMRICSAVSELIQQRPYVRVLVPL
FT                   HKNPEVRDRIQERLGMYPQMLFTEPLSYPDFVSAMNRSLFILTDSGGIQEEATALRKPV
FT                   LIMRTLSERPEAVTLGTGVLVGTERETILRESLRLLDDAAYRRSFSDRGMPFGDGTASP
FT                   RIRDVIGRFFNSGTDEDWEIDLK"
FT   CDS             1230129..1231391
FT                   /transl_table=11
FT                   /locus_tag="SY1_11190"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /function="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28304"
FT                   /db_xref="GOA:D4M8V9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8V9"
FT                   /protein_id="CBL28304.1"
FT                   /translation="MNVMRIEGGRPLQGTVRTQGAKNAALPVMAACLLLKGGALTLANV
FT                   PELYDVSTMMELLTALGVTARREGKEVTLGVADEVSWEAPESLVRKMRASSLVLGPLLA
FT                   RCGRAALPLPGGCSIGSRPIDLHLKGLVQMGAKIEIRNGVVCAQADRLRGRRIYLDFPS
FT                   VGATENLMMAAALAQGETIIENIAREPEIDNLAAVLRSMGVPIDMEGTGCVRIKGVEEV
FT                   RSCRERVIPDRIEACTYLLAGVMTGGRVTVEDAIPAHIDSLLAKLEEAGVRFAVNGSAV
FT                   TVFPADRLQSVSLKTMPFPGFPTDLQPQMAAALSLAEGTSVIEESVFQARFLYAAELNR
FT                   MGADIRVKGDTAVISGVERLSGANVKATDLRAGAALIIAGLAAQGRTQVEDMVHVWRGY
FT                   EAIDVKLRSLGAQVELAEDVR"
FT   gap             1231834..1232033
FT                   /estimated_length=200
FT   CDS             1232488..1233111
FT                   /transl_table=11
FT                   /locus_tag="SY1_11220"
FT                   /product="uracil-DNA glycosylase, family 4"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28305"
FT                   /db_xref="GOA:D4M8W0"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8W0"
FT                   /protein_id="CBL28305.1"
FT                   /translation="MDDKERDAAWEAAWEDLRGRVAACRRCGLCEARTNTVFGQGAVRT
FT                   PIVMVGEGPGADEDAQGLAFVGRAGQLLTKILSAAGIDRESVFITNVVKCRPPNNRTPT
FT                   QEEMLKCADFLEAQLLLLRPRILVCLGNTPLKWLLRTSEGITALRGRWFDWRGVQLFPM
FT                   FHPSYLLRNDSRQKGSPKDLTWQDVQNLKARLDEITKRKGTEAN"
FT   CDS             1234614..1235777
FT                   /transl_table=11
FT                   /locus_tag="SY1_11250"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28306"
FT                   /db_xref="GOA:D4M8W1"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8W1"
FT                   /protein_id="CBL28306.1"
FT                   /translation="MTTGGTGRKRVAVIGATGSVGSAILSVCRAHPDEVEVRALAARRP
FT                   SEKLRMLSREFEATMLCAHDAPRGTEGFLTGPEGLVAIAESPEVDQVLFASSGTAAIPA
FT                   LQAALRAGKEVSLANKESIVVAGPWVIPLVSRPDQLRPLDSEHNAIWQCLHGEGEGRAV
FT                   RSIRLTASGGPFRTWTAEELKTVTPDMALKHPVWAMGAKITIDSATLMNKGIELIEAMF
FT                   LFGLEPAQVDALVSPGSFVHGLVEFTDGSVKLLAATPDMRLPAASCIFWPERRFPAPDF
FT                   APPLLVPRTISFEAPDPVRFPAMRIARTAMERRGAYPALLVGSDEVAVDRFLKGQIGFT
FT                   DIAAVVEETLESCPLPAPGSLEEALFALEEGRRRAAAVCDGLSRCRA"
FT   CDS             1235823..1236875
FT                   /transl_table=11
FT                   /locus_tag="SY1_11260"
FT                   /product="RIP metalloprotease RseP"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28307"
FT                   /db_xref="GOA:D4M8W2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8W2"
FT                   /protein_id="CBL28307.1"
FT                   /translation="MLISFVSFVIVIAVCVVVHEFGHFITARCLGVQVHEFAFGMGPAL
FT                   WQRKSTGPEPMLWSVRAFPVGGSCRLAGMGEEEREEAVLPGKGFNEQPGWKRFLILLNG
FT                   SLFNVLLALLLTAVFLWGHGALDMEHTRIGEVMPGFPAEAAGIQVGDSITAVNGRSVQE
FT                   WREMSEALREEAERGGDVRVEVRRGEEVLTISTPIPMSEEHGRPMLGITPALVRYSPKD
FT                   AVLNAGQYTWRMTTLMLRGITDWILRRQEVDVTGPVGIASMSGQAMRAGWWAFVTFVAL
FT                   ISLNLGLLNLFPIPALDGGRILFVLLEMVFRRRLPERVENWIHTAGFVLLILLMLAITC
FT                   QDVYHLFWTK"
FT   CDS             1238261..1238812
FT                   /transl_table=11
FT                   /locus_tag="SY1_11290"
FT                   /product="Ethanolamine utilization cobalamin
FT                   adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28308"
FT                   /db_xref="GOA:D4M8W3"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8W3"
FT                   /protein_id="CBL28308.1"
FT                   /translation="MATGKQEHTTHLLGAEVVGKTHPRIELRGRLDELNARIILMQARA
FT                   RAAGERQLEADLEEVRVKAVREAMMAEVTDAPCGELALWGLTEEEIHQRSHTPARFYGK
FT                   GHLDLHADMGLWAAEINLLRTLVRETELVACRAFDDGAGGVTRPDVVKMLNRLSSALYI
FT                   LIYNYLPEGFTRFYGRIGQR"
FT   gap             1238913..1239469
FT                   /estimated_length=557
FT   CDS             1239605..1239955
FT                   /transl_table=11
FT                   /locus_tag="SY1_11300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28309"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8W4"
FT                   /protein_id="CBL28309.1"
FT                   /translation="MCLNTKIRNHHSRRAHGDRAGFLSQQTDGPHGKRSGQDSHGRKAE
FT                   YLTRLLENVYLSDIVERRRGRQEQNSLLRIGDSFRKIIIIVRDNIRPRHDEAGITTIGI
FT                   WNFLLDADSLDL"
FT   CDS             1241157..1241669
FT                   /transl_table=11
FT                   /locus_tag="SY1_11320"
FT                   /product="Protein of unknown function (DUF2848)."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28310"
FT                   /db_xref="GOA:D4M8W5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR021269"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8W5"
FT                   /protein_id="CBL28310.1"
FT                   /translation="MYWIEPERISAASSVWVVGNKTSGEGEVFLARCSQGNLHVTVASD
FT                   HTDRALETVSVSKAKQIATKLVGAIFWRVDDVRDHWDEIELRVWNDGKIYQEGTLGQML
FT                   PPEALLELAEEDSPVKGGRISLFSGTLPVIGGGLVYGSRYVLSLRDPVLNRELWHEYAV
FT                   QVLPDRN"
FT   CDS             1241682..1242482
FT                   /transl_table=11
FT                   /locus_tag="SY1_11330"
FT                   /product="Predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28311"
FT                   /db_xref="GOA:D4M8W6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8W6"
FT                   /protein_id="CBL28311.1"
FT                   /translation="MKLRVGVLQFDVVLGDRTKNRATLQRWLKSALVPSDLTTVLVIPE
FT                   IWDVGYALPRAKELADPEGKGAAEFLGALARQYGVWFAGGTVLASTPEGFANRGQVVNP
FT                   RGELVEYYDKVHLIRLMEEDKYFVPGRKECLFDVDGIRAGCVTCYDIRFCEWVRTYALD
FT                   GVQVLFVGAEWPMSRIDHWEALLRSRAIENQMYVVACNRCGESEDTLFGGRSMILGPKG
FT                   EVLFQAGAGEEAGFVILDMDEVEKTRGFLTVFNDRVPGIYKVER"
FT   CDS             1242540..1243538
FT                   /transl_table=11
FT                   /locus_tag="SY1_11340"
FT                   /product="tripartite ATP-independent periplasmic
FT                   transporter solute receptor, DctP family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28312"
FT                   /db_xref="GOA:D4M8W7"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8W7"
FT                   /protein_id="CBL28312.1"
FT                   /translation="MKMKRRMLLSVVALLCVGFWTKAAFAAAVNIKLAHGGSLEHQYHI
FT                   GAMEFKRLVEEASNKEIEVTIFPQGQLGGERELAESVRMGTVEIGELAASNMAGFVPEL
FT                   QVFGIPFLFTGKNAVYSVLDGEIGAELNGYMLNKGFVNLGYWEVGFRNMTNNVRPIKKP
FT                   EDAKGLKIRVQESKIWIEFMKALGAVATPIPFGELYSALQQKVTDGEENPIATIYSMKY
FT                   YEVQKYVSMTAHTYEPALVIVNQQWFEGLDPKYQAILKDAAIKTATLQRVKLAELEKER
FT                   LEIIRKAGVEIEENPDHAAFAELTKDLYKVISDTVPEELVMRIRDAIAKAQ"
FT   gap             1243979..1245270
FT                   /estimated_length=1292
FT   CDS             complement(1246393..1247673)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11370"
FT                   /product="TRAP transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28313"
FT                   /db_xref="GOA:D4M8W8"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8W8"
FT                   /protein_id="CBL28313.1"
FT                   /translation="MEAILIFSILIVTIAFSIPIGITLGLSTWIMMLFTSNIPMVMIAQ
FT                   KAFTGLDSFPLLAIPFFILAGSLMCSGGISRRLVTLAESLVGWIVGGLAMVTVLACMFF
FT                   AAISGSGPATVSAIGSFMIPAMKERRYDAGFAAAITAAAGTIGVIIPPSIPFVIYGIVA
FT                   KASIGDMFIAGIVPGIIIGIALMLVCYFTARKRHYLSMAERPKFSSVAKAFREAFWALL
FT                   VPVIILGGIYGGVFTPTEAAVVAVAYSVFIGKFVYRELTMATLYDCLKSTALINGATSF
FT                   LIGLSMAFANYLAMAQIPAHIAQWFTSFAESPFLLMIIINFFLLVLGCFVDNIAAVIIL
FT                   TPILLPVVRSIGIDPIHFGLIITVNLACGFISPPYGINLFVASAISGENIESISREIVP
FT                   VFCAMVACLLLFTYFPVLTMGLLKVLR"
FT   CDS             complement(1247675..1248226)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11380"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   small permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28314"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8W9"
FT                   /protein_id="CBL28314.1"
FT                   /translation="MTLKKFLNNFEEYFCVWTLAIMTIVVFVQVVMRYVFANSLSWSEE
FT                   LARFIFLWFSWVGASYAVRERSHFRVEMLVDLFKGASRIWIEYLVLLIWFAFSFFLTWY
FT                   GTKLVLFIRGAGQVSAAMRMPMTWPYAAVPAGCALMCVRLIVEIWKLHKNGLSHAESGE
FT                   VRATELKPSGDTTEPLEGGK"
FT   CDS             complement(1248316..1249296)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11390"
FT                   /product="tripartite ATP-independent periplasmic
FT                   transporter solute receptor, DctP family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28315"
FT                   /db_xref="GOA:D4M8X0"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8X0"
FT                   /protein_id="CBL28315.1"
FT                   /translation="MKKFLGAALLVLIAASGVQAADYTIKLGYIGSESHPTMTVMKDVF
FT                   AKQIEEGSAGKIKVELYPNGQLGGDRELCEGVQLGAIQMAIPSSSVLAGFEKRIQVLDL
FT                   PYLFTTREAAFAAVDGVLGEKLNGLTAEKGILILGYQENGFRHVTNNRNPIHTPDDMKG
FT                   LKIRTMENPMHIAFFKALGANPTPMSWGELYTALQQGTVDAQENPYAMIDDGKFYEVQK
FT                   YVSETGHVFSFEVLIANKAFIDGLPEALRDLVLKAAKDATEAQRKAMAEEEESFKKKVT
FT                   EAGMTANELTAEEKKPFVAATAEVYPQFADELGQDLMEIIKQVQK"
FT   CDS             complement(1249400..1250632)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11400"
FT                   /product="Uncharacterized conserved protein (DUF2088)."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28316"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8X1"
FT                   /protein_id="CBL28316.1"
FT                   /translation="MPVLLDESYRYPLPKMHRVRQHFSRPRLDDLEAQIRREFEKACIA
FT                   DRIKPGARVAVAVGSRGIKNLARIVKEVLVQIQRWGGNPFIVSAMGSHGGGTQEGQLHI
FT                   LNSYGITENAMGIPIITAPDATRVGKTKSGLEVWVDSAALEADLIVPINRVKLHTDFVG
FT                   DIQSGLCKMLTIGLGNHVGCSALHEASFEGFAETLIEAARIVMARAPVGFGVAILENAY
FT                   DETAMIEAVPVEDIVEREKELLQTAKGLMPTLMLPDIDVLVVEEIGKDISGAGFDPNVL
FT                   GRSSLLKKFVLPVPKIKRMILLDVTAPSHGNAIGVGLFDVITRRVLEKLDLPSMYANAL
FT                   AVKAPEDVKIPITAESEEEAVRFALQLARGVDRANLKIVRIKNTLNLETIEVSEALLPC
FT                   VEGNKKLERLS"
FT   CDS             complement(1250677..1251102)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11410"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28317"
FT                   /db_xref="GOA:D4M8X2"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8X2"
FT                   /protein_id="CBL28317.1"
FT                   /translation="MADEIKVYKCRGIVKGKAAGEAIVSRDAMCFYLTDPITGNVIERN
FT                   HAIQGKCIANKILALKSGKGSSVVQVDGFYQLWGKHNLPSAIIIKETEPVIVSAAVMVG
FT                   CTMVDRLEADPFSVIQDGDYVEVDADAGEVRVQKSGK"
FT   CDS             complement(1251102..1252319)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11420"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28318"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8X3"
FT                   /protein_id="CBL28318.1"
FT                   /translation="MRLTDEEKRILDGAEGVGKQKAMEMLYALALTFDAEKLISIKRAH
FT                   VALSGQEGDTYWCELLADGGATCAVPPTTNPYWDTDYLTKFYDVTKEELDLANRTGDAY
FT                   RRIGAKLTYHCAPGVCSNVPFFGEHVAFSESSATPYVNGALGARSNRESSISALAAAVI
FT                   GETPYYGYHIDENRRGDFLIEVEAEMKDHYDWGMLGHCVGPIAGTRIPVLKFKKEVRPG
FT                   PEDFLYFGAEAATSGSVAMYHMVKITPEAPDVESAFGGRKVPAAEVVLTNKDLEAEEDR
FT                   LTPAVGDINLVMLGCPHYTYSQLLEVERLFNGRKVNHNTAFWILAESGAVELAERSHLR
FT                   EHLELLGVRMVGNTCIDEPCWKSFEGSLGLTDSPKCAYYRERRGQPFAIRRLSECVEAA
FT                   IKGRLV"
FT   gap             1252643..1254080
FT                   /estimated_length=1438
FT   CDS             1255325..1256695
FT                   /transl_table=11
FT                   /locus_tag="SY1_11440"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28319"
FT                   /db_xref="GOA:D4M8X4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8X4"
FT                   /protein_id="CBL28319.1"
FT                   /translation="MPTPFEENGLQAPPQRGATLQIISRLCSLAAVFLAAFLVVYYGNA
FT                   LLLRLHGHLLDRQGNVTTLSFALSRVLIHGLQNMLIVVAWQAVARRLSHRTAHFADAVN
FT                   IVVPPVAFMATAWLLPHLSPNLTLSFSMSPVLAFLLLCLFHALTLRVENVLDRSLALIL
FT                   WLFASHSLEMITGVPFPQSALPEADAAFVSMTGFTLFFCFLAGAMSSSWLLVKYSIRLS
FT                   VLKNSWIGAELKRGETSVSGINMLDVNNLVHDMKNVIAVIKGTARMMDKKEPSERTALL
FT                   LKAADYMGTMTQELLSGDEKHDLALSELFRTIERHSSAFPWKDEVSMHAAPEVEGAHIM
FT                   ANKLRLIRAIFNILDNAWRGNALVGAHGILLQVRLDIHGRMAEFEIIDNGPGYSGTQAA
FT                   GQSGWGSTGLGLAFTRRVISLHGGSLAITSRKDQKRGARVVIYLPILQGPRPSTPDA"
FT   CDS             complement(1256643..1257377)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11450"
FT                   /product="Uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28320"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8X5"
FT                   /protein_id="CBL28320.1"
FT                   /translation="MLVHWKKLVLLAALCGALCCAALAFAAPLRDAFGGFVTWLVETIG
FT                   RLGYAGIAALMFLESSFFPFPSEVVMPPAGYLAWRGEMSLWGAIAAGIVGSVLGALFNY
FT                   WVAVRLGRPLLLKYGRYFLVSEESVSKAEGFFIRHGHVSTLVGRLVPVIRQYISLPAGI
FT                   ARMPLGTFTAFTALGAGGWVVALTLVGYLLGGHQEGLGRYLHVISLGCVGVALLIAAGY
FT                   AAWLCLRRRASKAAGPGGLGGK"
FT   gap             1257385..1257615
FT                   /estimated_length=231
FT   CDS             complement(1257773..1259824)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11460"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28321"
FT                   /db_xref="GOA:D4M8X6"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8X6"
FT                   /protein_id="CBL28321.1"
FT                   /translation="MNDVGGVDRGLERGQDDAARMAELYEELAHHARLYYDEDAPEIPD
FT                   AEYDALVRELAELERAHPDRVRPDSPTRRVGGTVLEGFEKVRHERPMLSLDNVFSAGEL
FT                   SSFLERIRGDVPEDDWTFTCEMKIDGLAVSLLYEDGRFVRGATRGDGRVGEDVTENLRT
FT                   LRTLPMRLKGAPAGRVEVRGEVLMTWDRFNALNERREELGEPPFANPRNAAAGTMRQLD
FT                   SRIVAERGLDAFLYYLVDAPSLGVTRQGDALEWLAERGLPIQPAWRRCASLAEAEAFIV
FT                   EWQERRFSLPYVTDGAVVKLDDLTLWDGLGATAHAPRWAVAYKYPPEEARTRILSIDVS
FT                   VGRTGALTPVANLEPVRLAGTVVQRAGLHNEDEIRRKDVRVGDVVRVRKAAEIIPEVVA
FT                   VEKECRTGAERPFEMPERCPACGSEAVRLPDEAVLRCPNRASCPAQLKEGLRYFASRAG
FT                   LDIRGLGERLAEQLIDSGRVKTLSDVYDLPEEDWASLDRMGEKSARNLMGALEASKDRP
FT                   LSALIAALGIRFVGRRVAELLAERFGSMDALSAASEAEIADVEGVGPVIASSVEAFFRD
FT                   EANLALVERLRERGLNFSSGDAAGHEGTELEGKSFVFTGELSSMKRAEAEALVRAHGGS
FT                   ASGSVSSKTSFLVAGAGGGSKRRRAEELGVPIVSEEDFLRMIGGSAPA"
FT   CDS             complement(1259939..1260568)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28322"
FT                   /db_xref="InterPro:IPR023811"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8X7"
FT                   /protein_id="CBL28322.1"
FT                   /translation="MAGAFSLRVSAEKRGIRAVVSKAIRGVDAMQHRCKVTVIDKRCFP
FT                   EYQEKYLADPKSGPCPFYHVGDEFIFYRYADEDTFWTMGRGSQCGEAWDCISRYIYTAL
FT                   QGGSIMRHWTNDERMMIACCNDGTRPVVFKIERQDYKVVRLAGAEDAAREVEAKAALEA
FT                   LEGVEGVLVRPDKRWIEVYMPPEGTVDDALLRKAVSAAGLSTERID"
FT   CDS             1260887..1261525
FT                   /transl_table=11
FT                   /locus_tag="SY1_11480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28323"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8X8"
FT                   /protein_id="CBL28323.1"
FT                   /translation="MDELRAYAVLGVPGDSPFTAVHQAYCLLCCLYSAENDPSPEAAMK
FT                   YQEVRTAYAVLKEKFENKSISTQRNHDVSVPQGSFSADAIANLIFFEARREKEEKRRRR
FT                   IRLLGAVGGSLLFPILSGSGMYLLFGLLSIPATYLLCSFLEQNDILSQRGTDEAFFSLP
FT                   CLSWFLWHLFVSFEAYRGDASFLLVVKLIGRQTYFIMIAYFLSLWLRRG"
FT   gap             1261641..1262272
FT                   /estimated_length=632
FT   CDS             complement(1262405..1262749)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28324"
FT                   /db_xref="InterPro:IPR025455"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8X9"
FT                   /protein_id="CBL28324.1"
FT                   /translation="MRQWVGNEPRFHPHAAQHDFEAWLLPYWTTIQKLALHDKAAPQGQ
FT                   PETIDHGKPPACHIKEIFEAGKRKKSYVKPRDAKAILRDNDLLIAIGQCPELKAFVNTL
FT                   LVLSGGQAIP"
FT   CDS             complement(1262812..1263009)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28325"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Y0"
FT                   /protein_id="CBL28325.1"
FT                   /translation="MKLSIIVEGRTETAFKEALTAFLRSRISRMPRLDFLPQDGRIPKA
FT                   EKLKRLVHNLLQGARITSSL"
FT   CDS             complement(1263006..1264319)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28326"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Y1"
FT                   /protein_id="CBL28326.1"
FT                   /translation="MKTTNDGFSYRVFFERVFDPIAMYRVAGAPAKGAWGGSDFLRMKG
FT                   ESHERAGGVRDLQDQENCHRGISEAAIAGYSSEALHGPDRCERGGEDLLFGRPYAPLRL
FT                   GRWEVGRNPVPIRRGRKAVDSWQMRRNGVGRRYGGARLRASEVSASNGAQGSRLFHNPG
FT                   DAVAAEVGSSQAFFYIDAHHGRVEYYNTETKRLDVPDWDYNPGETALSQVPRMFRQPEA
FT                   LRRVLATATQYHTLDVGSRAPIKLPQPVKPADLPGANGEALLPFLYSLRESDRPRFDAV
FT                   TDALRAAYPDFEELTFPPAAAGMLALSWKDKKFESPIYADELSEGTLRFLWLTALLQSP
FT                   ELSTVTMIDEPEVSLHPELLDLLAQLMREASARTQLIVTTHSDRFVRFLKPDEVYVMDV
FT                   GEEGEATITPADTLDLARWLDEYSLDEVWRMGRMGGRA"
FT   gap             1264959..1265575
FT                   /estimated_length=617
FT   gap             1267770..1269245
FT                   /estimated_length=1476
FT   CDS             1269865..1270827
FT                   /transl_table=11
FT                   /locus_tag="SY1_11560"
FT                   /product="Entner-Doudoroff aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28327"
FT                   /db_xref="GOA:D4M8Y2"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Y2"
FT                   /protein_id="CBL28327.1"
FT                   /translation="MNEVLQRIADVGVIPVVTVDNPNHALPLGTALLEGDLPVAEVTFR
FT                   TNAAEESIRVLASELPDLLVGAGTVLTVEQARKAVSAGAKFITSAGFNPDLVGYCMDNG
FT                   ILVVPGANTPTQVEQGLRAGLSLMRFFPAEQSGGPAMLRALSAPYHAMHYIPSGGVNAA
FT                   NLQGYLALPCVLAAAGSWMAPPDLIAAERFDDVARLSRQAVIQAVGFELDHVGINEPDA
FT                   GTAQDESELMCDLFGFPLRQGNKSFFVGDGFEFMKTPFLGMHGHIALSVLSMTRALAFL
FT                   ARKGMGTRSETERHDERGRLTFVYLDREIGGFAIHLMQR"
FT   CDS             complement(1270858..1271853)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11570"
FT                   /product="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28328"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Y3"
FT                   /protein_id="CBL28328.1"
FT                   /translation="MSALGSEKNSGAASDGSSREAACGAGWRALARCAALFCLAASLWG
FT                   GPAWGAAFVSFPTSWDVGQAFAVSITSDADYDAPTVTWLKRTVSLDVEPGGDGRISYAL
FT                   LGSYVRDVKPGEYPILFEFTQGEQRFHVKGKVALRARKYPQERLRVSPKMVSPPKGELA
FT                   RIKREAALAARAKGTMTVQRKWTTPAQKPLDMMKVTSSYGFQRVYNGTPRGYHAGTDLR
FT                   SAVGTAVRAPFAGTVVLVGDHYYAGGSVYVDSGNGVVSVFFHLNESLVKVGQRVARGQV
FT                   VGRSGRSGRVTGPHLHYGLCLAGQYVDPMPLFETSVTQLLKRAGRAKVAD"
FT   CDS             complement(1271850..1272713)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11580"
FT                   /product="inosine guanosine and xanthosine phosphorylase
FT                   family"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28329"
FT                   /db_xref="GOA:D4M8Y4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001369"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Y4"
FT                   /protein_id="CBL28329.1"
FT                   /translation="MGRDDKSSYECAFDAALYILQRQRVYCEPLTAVVLGSGLGAVAEA
FT                   VEDPCTVDVEDIPHWPVPTAPGHAGCVVLGKLEGRPVVVMQGRIHCYEGHSIRRAAFPA
FT                   RVARMMGVRQYVATNASGGISAQMEPGTIAAVEDHINLMGDNPLAGPLDLRWDTQFPDL
FT                   THAYSPRLLKLRDRAADEAGVQLQRGVYAAFKGPSYETPAEIRMARMMGADLVGMSTVP
FT                   EVIVANSMGLETAVLSCVANKAAGLSEKPLTESEVLSVMAESAYPLTAIIRGLMRELNR
FT                   EDNKAE"
FT   gap             1273317..1273701
FT                   /estimated_length=385
FT   tRNA            complement(1274890..1274965)
FT                   /locus_tag="SY1_T_24720"
FT   CDS             complement(1275251..1275673)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11620"
FT                   /product="flavodoxin, short chain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28330"
FT                   /db_xref="GOA:D4M8Y5"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Y5"
FT                   /protein_id="CBL28330.1"
FT                   /translation="MSKVAVVYWSGTGNTEAMAKAVAEGAKAKGAEVDVLTCGEFSADK
FT                   AAGYSGIAFGCPAMGSEVLEESEFQPMFDGVKDKCAGKKVALFGSYGWGSGEWMESWES
FT                   DCKAAGIALAAPSVTCNEAPNAEGLEACKELGASIC"
FT   gap             1276440..1277984
FT                   /estimated_length=1545
FT   tRNA            1280564..1280653
FT                   /locus_tag="SY1_T_24600"
FT   gap             1280888..1281894
FT                   /estimated_length=1007
FT   CDS             complement(1282637..1283320)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11680"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28331"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Y6"
FT                   /protein_id="CBL28331.1"
FT                   /translation="MKATKKSEALILFSRLPIGSETKTRLSPLLDEGQREALHRSFWAD
FT                   AFATALELRDRADLFLYWTGSGRPEAYSDLIPAAFALRGQRGLTLGDRMLAAARDAFEA
FT                   GYERAAIVGTDIPQMRPDSIRRAFDLLAEADVVLGPTPDGGYWLIGLKRAIPELFDISA
FT                   PWGSGGVRLGTLERARGLGCICAETDSYRDLDTPEDLHAFLEERHPYGAATRSCLERLL
FT                   GRGAV"
FT   CDS             complement(1284062..1285042)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11700"
FT                   /product="Predicted Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28332"
FT                   /db_xref="GOA:D4M8Y7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024521"
FT                   /db_xref="InterPro:IPR026351"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Y7"
FT                   /protein_id="CBL28332.1"
FT                   /translation="MTFAGRDDPLACVPPFRGKLPDPRVGQTLERLDVLQVNVGRLCNL
FT                   ACRHCHVEAGPNRTEVMSRSTMEHCLRVLAAWGFRTLDITGGAPEMNPDFRFLVDRGTA
FT                   AGVHVIVRTNLVILHESGYDDLPEFMAERGVEIVCSLPYYSERDCDRQRGAGTFRSAIS
FT                   MLRRLNELGYGKDDRLALNMVYNPGGAFLPPPQASMEQEYKLKLGAEYGIVFNRLFTIT
FT                   NNPVGRFGAFLVRSGNMAGYMRRLHDSFNPVAAEGMMCRSQLSVGWDGRLYDCDFNQAL
FT                   DWTVEGTDRIGDLRGDRPSRRNIRLGNHCYACTAGSGSSCGGATA"
FT   CDS             complement(1285039..1285386)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11710"
FT                   /product="alkylhydroperoxidase AhpD family core domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28333"
FT                   /db_xref="GOA:D4M8Y8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR026445"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Y8"
FT                   /protein_id="CBL28333.1"
FT                   /translation="MTTEKTNAYYDADDLNRFAEMGQCASPLWEKFSAYYGAVFEEGEL
FT                   TKREKALIALAVAHTVQCPYCIDAYTKSCLENGVNEAQMTEAVHVACAIRGGASLVHGL
FT                   QMKNIVGRLEL"
FT   gap             1285444..1285709
FT                   /estimated_length=266
FT   CDS             complement(1285840..1286733)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28334"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Y9"
FT                   /protein_id="CBL28334.1"
FT                   /translation="MGIHSNATPPARGSFHRTMRFHQCLAFSPLFCRAVGADGTVGTKK
FT                   GRARRVFFPGCSLAAYAPEHVLAAWQYLCERMEGVGALLKCCGKPLKLMAMTGEFRRRF
FT                   DAVRRDLDLMGAEEVIVACQNCYTIFRHFDEDRRVRSFWTILAEMGLPEGSRGSARGLE
FT                   VSIQDSCVTRGVPEIYDGVRTVLGELGATVREMDCARDRARCCGCAPMIAVGDVRLGYE
FT                   AMKKRAEESPCGTIVSYCASCRSAMRTGGRESLHLLDLIFGGGWTDRSTPPPDRSLRSW
FT                   LNRWRTRQRLGKLVCR"
FT   CDS             complement(1286738..1287415)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11730"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28335"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Z0"
FT                   /protein_id="CBL28335.1"
FT                   /translation="MGRCGKPLVFLGIAIVAFILNRHYGWSDFLSGPGGLEAMREAVRG
FT                   NVLTASLIYVAATTVGCVLLALPGVTFAIVAGLLFGPLLGTALCLAAATIGAVLAFLAG
FT                   RYFLRDAVAPWVERNRYLKRVLFEDVGRSGVVLLMITRLVPLFPYNLQNFAYGITGIGF
FT                   WPYTLYTALFLAPGVTFFTLGAAGLGDAENRRFYLILAGALAVLVTAAGLYLRRRYVEK
FT                   SGA"
FT   CDS             complement(1287415..1288173)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11740"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28336"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Z1"
FT                   /protein_id="CBL28336.1"
FT                   /translation="MSETKNVQDAACKPGQLGGAGRRYAGKAVLLILLAAAIGAYFVWP
FT                   PYRGVIDSIFSAFATGDFAAVRRFVERYGTMAAAVSFLLMVFQSIVAPLPAFLITFANA
FT                   NLFGWWRGAILSWASAMAGAAACFYIARILGRDVVEKLSSKTGLRSIDAFFERHGAQSI
FT                   LIARLLPFISFDIVSYAAGLTSMGFWPFFIATGVGQLPATIVYSYVGGMLTGGAKLFVT
FT                   GLLILFALSILIVLLKQVYTERKKRSDRSA"
FT   CDS             complement(1288588..1289112)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11750"
FT                   /product="Predicted DNA-binding protein with PD1-like
FT                   DNA-binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28337"
FT                   /db_xref="GOA:D4M8Z2"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Z2"
FT                   /protein_id="CBL28337.1"
FT                   /translation="MKKFLFGFVLCLMMAGTCFAVDSGDAVKADISDAVPSNARFYTIR
FT                   LVPGTDVVKELRAFVDKKGIQAAAIVSAVGSLSEANIRFADRSEGTLMKGKYEVIYFGG
FT                   TLDAEKHHLHLSIADEDGRMWGGHMMKEGSITRTTMEIVVMELTDVVYKREKCPISTYN
FT                   ELVVYPREAAK"
FT   CDS             complement(1289163..1289609)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28338"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Z3"
FT                   /protein_id="CBL28338.1"
FT                   /translation="MRQDLLPRGLRLLTHLLTLAQLALFAGGLWLHRLSFRRAGVNHHL
FT                   SFMKRTVEKLYLTDAVTTALTVVALGVAFFLFCFARRAIGERGWRVMATPAVGAVLALA
FT                   FVVELWLPSLKALPAWPVLLGVTALAFVLQVVKTLLKARIERLK"
FT   CDS             complement(1289606..1291018)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11770"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28339"
FT                   /db_xref="GOA:D4M8Z4"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Z4"
FT                   /protein_id="CBL28339.1"
FT                   /translation="MRKFLCFACLASLMLPAACWGADFPKASTEDVVALVGKGGGVLLD
FT                   ARHPDIFNGWALDGLPRGGHIEGATDFAYTFLTCGYDEKGNLEKKTRDEVLSDTLARKG
FT                   LTPGKRVIVYDTDGKDAPLVADYLRSRGFEDVSLYDAKPWIDDESRELVSWPAYELLVP
FT                   AEIVEKIAAGNVPAGFTPAREIKIFDVNWGDEEGSGYLKGHVPTAVHINTDSIEPPQVF
FT                   DEKQRRWVSEEESDSVKKLWKLPDDATLLKLLLDNGITADTCVICTGSEPMAAARFAVV
FT                   CRYMGVKDVRLMNMGLEGWRLAGYALATDSVKPVPVSDFGERAPESKAWIESIDEVAKK
FT                   LGTEGFTLVDNRTREEFLGKTSGYSYHNIAGRIEGAVYGCAGELSSSSMYYYRNIDKSM
FT                   RNGDEILALWKELGIDTGNHLSFMCGSGWRVSEILWYARVMGLNDTSIYSDGWIGWSDE
FT                   GRPFVTGEPAAK"
FT   CDS             complement(1291189..1293627)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11780"
FT                   /product="Chlamydia polymorphic membrane protein
FT                   (Chlamydia_PMP)."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28340"
FT                   /db_xref="InterPro:IPR003368"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Z5"
FT                   /protein_id="CBL28340.1"
FT                   /translation="MLALCFAFVSPADARVYRVNGSAIASGDGGSWSTPLNEAGFAAAL
FT                   SGAVSGDEFWIAKGVYRPAIPVSTDAVTTAEQGKSFTLKEGISLYGGFAGDETEREQRK
FT                   PDNNVVVLTGDLGLDDGRDAWGVTLSADVIRGKNSKNVLKGTNVKGVRLDGVAVSGGDQ
FT                   GVGAGLSLGRSDIVIQNCLFQGNRAVSFGGGINAAAASLDVCSSRFLGNRGGPNSHGGA
FT                   VNSVQSYLKLVDCRFEGNATGADKPGNKAGNGGAVQFSDKKGGDKTLTVERCRFSNNTA
FT                   GAGGGGLYVQNAGTDVTVRGTVFEGNRATHNGGAARFSTSTNILVEDCLFTGNSTVIEG
FT                   GAIYNSEVGSGDRGMTIRSCTFSGNKTYDDAHVADPNKGSGGAVYNGVSSPVLVNCTFT
FT                   DNEAKYGGALFNRTGSYPLLLNCTFFGNKAIPQGGQGGEGSSVYNTKCKTGACKPGGGR
FT                   IVAFNSIFWDGGAEEIVSENDDDSGAALHRSIVRGGAVRGGEVVLSEVTSDDPRLSSPG
FT                   NHGGSVPTCLPAWNSSARDRGWRVGALTSADVLSADVFWRDWAECAIPAVDARGVARPQ
FT                   FGGVDIGAVELTSTPQPQPEPGPSPVPQPGPDPKPEPQPQPQPQPNPDPAPKPVPKPIP
FT                   EKPITEAPAEAPMDARYDDSGAWTLAVGEVGSDGTAEVVVSVRLKPVPRRLTLLDVETR
FT                   NFVEASTAVFLDGEPVTFSAAVSDTGMTRLYEYELRIRGRVRGEALNGAVGQRAALAAM
FT                   TYMLEGDEVPTRLAFSGDGVSLNGMKRETSRSGGGCDAGLSALALMALLPVVGRRRGRR
FT                   "
FT   CDS             complement(1294396..1294665)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11800"
FT                   /product="Protein of unknown function (DUF3343)."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28341"
FT                   /db_xref="InterPro:IPR021778"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Z6"
FT                   /protein_id="CBL28341.1"
FT                   /translation="MSESTGARHYVLFPDVKNAQSLYELMKAAGVRCTFAPTPREADRC
FT                   CGLAVLYQDAGERGRIERMAAENGVQVLRFFDGATGDPDRMKFC"
FT   CDS             complement(1294679..1295956)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11810"
FT                   /product="Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA
FT                   dehydratase subunit, BcrC/BadD/HgdB"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28342"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Z7"
FT                   /protein_id="CBL28342.1"
FT                   /translation="MADYRAMWEGLGMDVKTHDLLCEALPQAFGDVYLSQENRPEGMDY
FT                   FNMVVAEIHGIRPMELVEHHKKGGRVVGSFCIHVPDEVVVAAGAIATGLCSGSQFWVPG
FT                   GEKKLPTATCPLIKASLGARFDRTCPFFRLADLFVGETTCDGKKKAWEILAEDAPMYIM
FT                   DIPQMKRERDYAHWRDDIRGYIRRLEELTGNGVTEGSLHDAIVLLNGKRRALQRLSDFR
FT                   KLDAVPISGKDVLLITQIAFYDDPGRFTSMVNKLCDELDQRAREGVSVFPKGAKRILLT
FT                   GTPLSIPNWKLHHLVESLGGAVVCEEMCTGIRYYERCVDEDGRTLDEMVDRLTERYLGG
FT                   IHCACFTPNSERVDDILRLAREYRADGVIDVNLKFCNIYDTEGYFVERALKDAGIPVLG
FT                   VETDYTDQDAEQLKTRIGAFLEMLGA"
FT   CDS             complement(1295988..1296851)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28343"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Z8"
FT                   /protein_id="CBL28343.1"
FT                   /translation="MNLFESLEEQRREAYVRAVLRASGTDDVVGFIGSRVPLELLNALG
FT                   LMVLPVYGVDGEILKYSREKGLCPVIDATLTYARTDRCPLIHSSRLIVVDDGCPIMARE
FT                   VSRLPGKEVHVYRTEDPMRLEHLMEKLERVYGRGLDDGALDAATADSRRLTELLFNLKY
FT                   HSGLDGRSVYVLEYYLNFLSVPERFEVLRQASGAAEFSAAPVDFLPVRVQSGAGIYRQL
FT                   DRQLSGSLYRILEGEGCQGCVQEVVTGEGRDFLRAKYDRKRKSVAVYDYVYPNCPFGTG
FT                   TEIGYD"
FT   CDS             complement(1296848..1297603)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11830"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28344"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:D4M8Z9"
FT                   /protein_id="CBL28344.1"
FT                   /translation="MLYAGIDIGSTASKAVVMNDGKDEILARKLMPSGWNGRETAEALL
FT                   AWLLSLGCRREDLRITATGYGRVSVPYADDTLTEITCHGRGACFLGGEDLTVIDIGGQD
FT                   TKVILVRGGRVADFIMNDKCSAGTGKFLEIMANRMGVTLPELFELAERGREITISSMCT
FT                   VFAESEIVSLMGLGTPREDIACGAVGSVVAKVAVQVARKAADDAYFLTGGFCDSAMMLR
FT                   KLSQALHAPVRTTSDARFAGAIGAALLGK"
FT   gap             1297930..1298536
FT                   /estimated_length=607
FT   CDS             complement(1298867..1299529)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11850"
FT                   /product="amine acid ABC transporter, permease protein,
FT                   3-TM region, His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28345"
FT                   /db_xref="GOA:D4M900"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:D4M900"
FT                   /protein_id="CBL28345.1"
FT                   /translation="MDLNFVGQVFLKMLPALPRTLSVTVLPFIAALFLGLMVTLPIVYK
FT                   IPVLKPLCKVYVSFFRGTPFIGQLFMIYFGLPRMFACLSAMDKIEGFVLTMALNSSAYL
FT                   SEIIRGAFLAVDRGQIEAAKSINLSRMQTLRLIVIPQAIPVAVPGIVNVLIDAIKGSSL
FT                   AFTIGILDITAVAKIQAGITFRYFEAYMAMVMMYWFIVLVLEQMQKRYEQRIKLTSA"
FT   CDS             complement(1300331..1301071)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11870"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family (TC 3.A.1.3.-)"
FT                   /function="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family (TC 3.A.1.3.-)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28346"
FT                   /db_xref="GOA:D4M901"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M901"
FT                   /protein_id="CBL28346.1"
FT                   /translation="MIEIRGVKKSFGSLDVLRGIDLDIDRGEVVSIIGPSGTGKSTFLR
FT                   CLNYLEEPEAGTVIFGDGKVFDFSRFENKLICELRSHSSMVFQNFSLFANLTAGENIAL
FT                   HLQKVKKWKYDKVTERVTELLRMMGLEDKADSYPRQLSGGQQQRIAIARAMAIEPEIML
FT                   FDEPTSSLDPELVKYVLGVIRRLADCRQTMLIVTHEMKFAQEVSDRVIFMDGGRVLEAG
FT                   SPDDIFERPKHDRIKEFLDLVREG"
FT   gap             1301252..1301601
FT                   /estimated_length=350
FT   CDS             complement(1302114..1302794)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11890"
FT                   /product="amine acid ABC transporter, permease protein,
FT                   3-TM region, His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28347"
FT                   /db_xref="GOA:D4M902"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:D4M902"
FT                   /protein_id="CBL28347.1"
FT                   /translation="MIFQFDYFLKMFSIIFLGFKNTVSMAFLSLFFAVLIGFVLAASRY
FT                   YNIPVLKQFSVVFTSFFRSTPFIAQLFVFYYGFAQVSATVRGLSSFWAVVIVLSLSFAA
FT                   YMGENIRGAISSVDRGQFEAGISIGMTPWQTIRRIVIPQAARVALPGMVNSFANLFKST
FT                   SLAFTVGVMDMTSCAKNEVNLTYRYLEGFVALLIVYWVILALVSYGQSLLERYLNRPYV
FT                   QEAR"
FT   CDS             complement(1302892..1303716)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11900"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28348"
FT                   /db_xref="GOA:D4M903"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D4M903"
FT                   /protein_id="CBL28348.1"
FT                   /translation="MKRFWGWGLILAWVFIACISREGIASEDKVIRVATPGTYAPFTMY
FT                   DEATQEWSGFEIDMWRTIGEKAGYEVQWVRLDNPATFAELDLGRVDTVAKQISITPVRQ
FT                   QKYDFTRPFFFSPYCLTVAADNEAIKSWKDMEGKTIGLSEGSAMNEFIAAMDPENKVKK
FT                   SVYGSGSSILHEVAMGHVDACPYAFLVLPYRLKKNPELKLKSVDIENPIYVEVNVYPFA
FT                   RTDRGRELLKLTDGVLTQMIEDGSYAKLCEKWFGTNVMESKYAKEYREKQGK"
FT   CDS             complement(1303790..1304608)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11910"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28349"
FT                   /db_xref="GOA:D4M904"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D4M904"
FT                   /protein_id="CBL28349.1"
FT                   /translation="MKRFWGWGLILAWAFIACVSREGIASEDKVIRVATPGNYAPFTMY
FT                   DEATQEWSGFEIDMWRTIGEKAGYEVQWVRLDLPANFAEMDLGRVDTVAKQISITPSRQ
FT                   QKYDFTQPYFFSPYCLTVREDNNEVKSWKDMEGKSIALREGGSELEFVAVLDPENKVEK
FT                   SIYESNMLQDVSLGRVTATPYPFLTLPWVLKKNPELKLKAVDLENPIFTEVNAYPFART
FT                   DRGRALLKLTDDILTQMIEDGSYAKLCEKWFGTNVMDSKYAKEYREKQGK"
FT   CDS             complement(1304682..1305515)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11920"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28350"
FT                   /db_xref="GOA:D4M905"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D4M905"
FT                   /protein_id="CBL28350.1"
FT                   /translation="MKKALLSALILGLGFVVCTAAVAAAAEKDAERVIRVATPGTYAPF
FT                   TMYDELTQEWSGFEIELWRLIGEKAGYEIEFVRLDLPATFAELDLNRVDTVAKQISITP
FT                   ARQQKYNFTQPFFFSPYYIIVAEDNNEIKSWKDMEGRSIALAEGSAMNEFIAALDPENK
FT                   VKKSVYESDKLVFQEVSVGRVDAYPGPYVELLDVLKRNSSLKLKAVDMENPIYVEVNAY
FT                   PFARTDRGRALLKLTDGILTQMIEDGSYAELCEKWFGMNVMDSRYAKEYREKQGK"
FT   CDS             complement(1306044..1306772)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11930"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28351"
FT                   /db_xref="GOA:D4M906"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M906"
FT                   /protein_id="CBL28351.1"
FT                   /translation="MTSSNKLLETRGLTKRFPRGVGDFCAVDHVDFTLCEGDFGHIVGR
FT                   SGSGKSTLVNLLSGLLAPFSGETFFDGLPLPYGDDAAMAHLRNEQIGYVPQDAHLLPHL
FT                   SVWDNVRLPLYLDGGLPNKEGVDGGERHALELLDRMGIAARRDAFPWELSGGEARRAML
FT                   ARALLKGPRLLIADEPTADLDVLTSHEVMEEIRRVHSEGMTVLMITHELELLNYGTKIW
FT                   TMEDGRLTEGQNLVVPKGAD"
FT   CDS             complement(1306786..1308021)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11940"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28352"
FT                   /db_xref="GOA:D4M907"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4M907"
FT                   /protein_id="CBL28352.1"
FT                   /translation="MVDKIAEERTRKPLTRFRLAYLNVAHSASRTKSLVFLVTLLSFAI
FT                   FTGGYLSLSLGRGMSSLADRLGADILVIPSGTEGQVQGTILKGNPSKFYMPFSILNDVT
FT                   ATPGVAAASPQLFLATLSAGCCNFAIQLIGFDPETDFNIRPWVTRQLQGTLESCDIVVG
FT                   ANIVAQEGETLMFFGETFRVAARLERTGMGFDSSAFVTVESARHLMGNERFRLNYPEVN
FT                   DPTTISSVMVRVDEKSDVADVARELCRRLKGSGVTAISSMDVVRGVTEKFKSMRVHALL
FT                   LSVILWGVSFAVLKLIFTVLMNERKSEFALLRIMGAPRGYLRGLVLTEAFLVSLSGAVL
FT                   GTALSAFLCVVFNRVLTVSLGMPFLNPSPGQFFLLAIGSLLLALFTGPMAGWSFAQRLN
FT                   RKETLTLLRADR"
FT   CDS             complement(1308031..1308432)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28353"
FT                   /db_xref="InterPro:IPR025531"
FT                   /db_xref="UniProtKB/TrEMBL:D4M908"
FT                   /protein_id="CBL28353.1"
FT                   /translation="MKKGNVFAAVIVVIGILIAVLPTWGPAAVCPLPDGGRWMKCHWMG
FT                   MAELGVGALAALLGVLMFLQKDKGVRRGLSQALAGLSLLAAALPGGLIGGCKNLQMPCQ
FT                   AVSIPVLYALSAGLLLFALLSLHAAREKE"
FT   gap             1308663..1309354
FT                   /estimated_length=692
FT   CDS             complement(1309419..1309970)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11960"
FT                   /product="Uncharacterized protein conserved in archaea"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28354"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:D4M909"
FT                   /protein_id="CBL28354.1"
FT                   /translation="MGIDPSDPKNAHGENWARLKLYDSEKVAADVRKGLTYSKEPKYGL
FT                   FLAPIEDMDKRPDVVLIVANPYNCMRIIQGYAYHHGMPASINMIGNQAVCLECTARPYV
FT                   TRDINISLLCIGTRHRAGWGNDEMAVGVPQEQFADVVDGIVQTINQMESDANKEMIKKK
FT                   FRDKNIPISIRFHYNYYMDC"
FT   CDS             complement(1310198..1311028)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11970"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28355"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D4M910"
FT                   /protein_id="CBL28355.1"
FT                   /translation="MKKKVMASLMALAVVVGLTAECASSEAVKPGEGTTVTIAGTAVSQ
FT                   VFYEAFKDLYESLGYKTKFILFDSNPVCLEACATGETMVSIGQQLKFVHSYNTNNGTNL
FT                   EMVKPYGMYTGIGLYSEKYDSVDKIPDGAQIAVMNDATNEDVSLKVLQEAGLIKLAGDV
FT                   EFATVADIVENPKNLEFVEMEQAQTVTALEDMAGACCWFTHMSAAGKNPSVYLVRDNVM
FT                   INYPMGITVNRTDVESDWAVNMAECLRNADVQAKINEAFPNVFEFYTDDAQVKQ"
FT   CDS             complement(1311058..1311741)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11980"
FT                   /product="ABC-type metal ion transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28356"
FT                   /db_xref="GOA:D4M911"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4M911"
FT                   /protein_id="CBL28356.1"
FT                   /translation="MEAFTRAFQNSNLMRYLPTAIIPAIGETLVMVTISFVLSVIFGVM
FT                   FGIILVMTDKSGLSPHPAFHAILERITDITRSFPMMILIVAIAPVTRFFIGTRIGVKAA
FT                   IFAITLGSTPFAVRLTENALNTVDPQLIRMAQSIGATKLQIVFKVMLVEALPTLISNFT
FT                   IMAINILNTSAMAGAVGAGGLGAVALTYGYQRFDYLIMYFIVIILILLVLVIQTIGSRL
FT                   YEYTK"
FT   CDS             complement(1311746..1312570)
FT                   /transl_table=11
FT                   /locus_tag="SY1_11990"
FT                   /product="ABC-type metal ion transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_11990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28357"
FT                   /db_xref="GOA:D4M912"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M912"
FT                   /protein_id="CBL28357.1"
FT                   /translation="MQMITFENVCKSYDGVDVLNNLNLKIADNEAFGIIGPSGVGKSTI
FT                   LNCLNGLEKYQRGSVVVDGVRVETLSDAELRRFRKNVGLIFQNFSLIGRKDVFHNISFP
FT                   MECWGCSKTEIKDRVEELAEVTGMQEKLKSRPAELSGGQKQRVAIARALALNPRYLLCD
FT                   ECTSALDPRSTASVLELLESLREKYKITIIIVTHEMAVVRRFCERVGIIDGGKASLVGN
FT                   VAEVFREVPQQLRAVLGDEEGKVSFTIDIHDFESCRKFLDDRGIRYGIAEEY"
FT   CDS             complement(1312677..1313825)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12000"
FT                   /product="Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA
FT                   dehydratase subunit, BcrC/BadD/HgdB"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28358"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D4M913"
FT                   /protein_id="CBL28358.1"
FT                   /translation="MLSLPKNFESYDEKRRNAFLALYDVKKKGKKVVGTFCSYTPTELI
FT                   HAAGAIPVGLCGNSEQGILEAETRLPKTLCPLIKSSYGLAMTDQCPFFYFSDGVLAETT
FT                   CDGKKKMYELLGEIKPVHVMKLPQGKDQALAVESWTEEVRLAAGFLEDLLNVEITEEKL
FT                   HDAIVYRNRVRRALIELYEVAKAKPSPVSGYELTTVSESADFHFTDDSLIEKLAEKTRE
FT                   FRHRVRETTPDRPRVLLTGCPNTGLREKLIHRMEDMGADYVCSDHCAGPRTLRFVVDED
FT                   KDPYEALAERYLKINCSVMTPNGGRFDDLKHLVSEYKVDGVVEAVLQGCHTFAVEAWNT
FT                   KKTVYEELGLPYLRIDTDFSQSDRGQIETRLGAFIEMMRMAT"
FT   CDS             complement(1313877..1314086)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28359"
FT                   /db_xref="UniProtKB/TrEMBL:D4M914"
FT                   /protein_id="CBL28359.1"
FT                   /translation="MANFRDSLTFKNYDQERLIIDSIAARLSAEENAFRKTCGEDEEER
FT                   GTGSFACKVTVENWIGELWRGGAA"
FT   CDS             complement(1314119..1314898)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12020"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28360"
FT                   /db_xref="GOA:D4M915"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M915"
FT                   /protein_id="CBL28360.1"
FT                   /translation="MALLTVDHVKKSFADRDGHVRSVIDDLSFEVMKGQFVSLLGPSGC
FT                   GKTTLLTILAGFQTCTEGTAALEGRPIEGPGVERGYVFQNYALFPWMTVRSNILYSLRI
FT                   AGESREKQEVRLNELLELAHLKGHEGKYPIQLSGGMQQRVAVVRALAGRPKVLLLDEPL
FT                   GAIDFQMREIMQNELDLLVRQVAATVVMVTHDVSESVFLSDRVLVMGAGGCRLLADVAI
FT                   DMPRSRDRSSRRFKDYVGDLTDLLRRAFRESEEPFSE"
FT   CDS             complement(1314879..1315649)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12030"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28361"
FT                   /db_xref="GOA:D4M916"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4M916"
FT                   /protein_id="CBL28361.1"
FT                   /translation="MGRRKGFVCMLAGTLVVCLLWYFLARAIDRSLILPDFLVTMKTFF
FT                   LGWFDKKVMSNLGITLMRVFMGCVYAVAIGLPLGLLMGSSRTALVALSPYVNSIRQVPI
FT                   MAWVPLSIIWFGLGDGPTIFMIAMSAVFPILINTISGVMNIDPNYKNAARCMGAGTWQV
FT                   LRDVVVPGALPSFLTGCRLALGGAWMSVICAEFIATSKGFGYIMVEAQVRMNTPLLYAL
FT                   MIMSALVGFAMDKSIVLLEHSLTGWRYKDGAPDR"
FT   CDS             complement(1317698..1318168)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28362"
FT                   /db_xref="UniProtKB/TrEMBL:D4M917"
FT                   /protein_id="CBL28362.1"
FT                   /translation="MTRLVPWGAALLCALFLLAFPGPGAAPGGAEDVFLPVTSHPLMAV
FT                   FRKSLPDREVLLTTPGDCNADGIEDLVVVYREDRDKNHMVAVYSDGGAFRLSAPVRAPL
FT                   ENCRLQWRDIDEVPPVELLVSGQKGIYIGYAVFRFVDGEWISLFGDGMDGCC"
FT   CDS             complement(1318165..1319262)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12070"
FT                   /product="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28363"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D4M918"
FT                   /protein_id="CBL28363.1"
FT                   /translation="MRLFLQYGWQFCQYSWGMLETSGPWLILSFLFCGVLHAVLRPETL
FT                   QRSLGNKKLSSIVKATISGMLLPICSCGVVPLSLGLYYSGAYLGPTLAFLVATPIINPA
FT                   AVILAYAMLGPQIATIYLISGFVIPFVIGIVGNALGGPELQSPAAAGLAAAPSAREERP
FT                   ALPPLMQRIRGGIEWGFNDLAVQTCRFIVVGTAFAALLLTVVPTSFILDYLSDPRLVSL
FT                   LGITLLGCVMYVCALGHIPFIAALVSAGAAPGVAVTFLLSSVATNFPEMVSIWRLIGKR
FT                   AVTLYTGMLVLFGLAFGYITNFLLADNFRPVFDLTRSQGKIDFVSRISIDFPDGFKVFC
FT                   AILVLCIGGYGWILQWRRSLRRREA"
FT   CDS             complement(1319259..1319513)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28364"
FT                   /db_xref="UniProtKB/TrEMBL:D4M919"
FT                   /protein_id="CBL28364.1"
FT                   /translation="MTKVEFINTCPCCDGHVDVLNELQKRFPEKIDLKIYYAGKDFDYL
FT                   PKYGPITRGTMIVDGKDRYEDLNRRTIEKVVSEAIGEEL"
FT   CDS             complement(1320035..1321936)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12090"
FT                   /product="threonyl-tRNA synthetase /Ser-tRNA(Thr)
FT                   hydrolase"
FT                   /function="threonyl-tRNA synthetase"
FT                   /function="Ser-tRNA(Thr) hydrolase"
FT                   /EC_number="6.1.1.3"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28365"
FT                   /db_xref="GOA:D4M920"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:D4M920"
FT                   /protein_id="CBL28365.1"
FT                   /translation="MLKFEGSNGKSCEFDRESVRASEVLEALGLQKKAIAAKLDGAAVD
FT                   LNREIRAGGRVEPLTAADEEGLDVLRHSCAHLMAQAIERLYPGTHFGIGPCIKDGFYYD
FT                   VDATGTITEQDLPAIEAEMRKLTGAAEKVEREEMRREDALKFFKDRGDPYKEELISELE
FT                   APTVSLYRQGDYVDLCRGPHVPDTSVIRNFKLLSVAGAYWRGSEKNKMLTRIYGTAFAT
FT                   PDELKAYLKRMEEAKLRDHRKLGRELDLFSLHEEGPGFPFFHPKGMVVMNTLIDFWRRE
FT                   HVRRGYQEVRTPQILDRELWLRSGHWDHYRENMYFTEIDEKPFAIKPMNCPGGILIYKT
FT                   QLHSYRELPMRIGELGVVHRHERSGVLHGLMRVRCFTQDDAHLYCEPSQIQQEVMGIMD
FT                   LCRYVYSDVFGFKYAVELSTKPENAMGSTEQWEAAENGLRAALEQSNTPYRVNEGDGAF
FT                   YGPKIDFHLEDCIGRTWQCGTIQLDFQMPERFDMHYIAEDGKEHRPVMLHRTILGSLER
FT                   FMGILIEHYAGAFPYWIAPVQAELIPISEAHRAYAEELRKELMSWGVRTETDSRDEKLG
FT                   KRIRDAQLQKVPYMIVIGDKERDERQVAVRERTKGDLGSMSLEAFQKLLSAEFNPIH"
FT   CDS             1322621..1323934
FT                   /transl_table=11
FT                   /locus_tag="SY1_12100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28366"
FT                   /db_xref="GOA:D4M921"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="UniProtKB/TrEMBL:D4M921"
FT                   /protein_id="CBL28366.1"
FT                   /translation="MNASQEIQAVIEALPDPVLILAPNRGRVLAYNKAFVDKWGFAEET
FT                   FMDKPFLKMPQFSRAIQRGLIGVYAKARHRRAEIAPFSFCYPDMKGFLKTFSASASPIE
FT                   EAGSVDVPCVMLRFQELPQMDEATIRAQKDSEAFNIFTDITDEPWLEFRPPLPIVAPGI
FT                   EDSDRRDHLAHIGKHLRLVRASKAAIHFYGLVERDMESEDGAIKLKEKNFPAFFSRSED
FT                   ACRMLDILTTIGFIRARSALLDRKGNVIEAEVSCASQFGQGNSLAAIYCIFHFSEEMIN
FT                   CRNAFREGQQMRDFTFNQPFLGLGQLVPQRPLKRPEAESAEAELGKLVNAILLVAANDA
FT                   LLKLHNAQKSRFLMQPMSVLFPNTSHAVAVLRELFVTRESSFALYDGNGTLQHITIFKA
FT                   IFNDADELVRILISTSDHSQGIEEHYNNQPIPLRPKPA"
FT   gap             1324054..1324304
FT                   /estimated_length=251
FT   CDS             complement(1324507..1325493)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12110"
FT                   /product="conserved hypothetical protein (putative
FT                   transposase or invertase)"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28367"
FT                   /db_xref="UniProtKB/TrEMBL:D4M922"
FT                   /protein_id="CBL28367.1"
FT                   /translation="MSGKKKDPSEKAAKEPRRDDLLWKDILNRFFVPMLHSLLPDLARD
FT                   LDEKRDVVFLDKELRRLARFTQRSEGGEPDGNRFVDLLANVPLRTQEDAWILLHVEVQG
FT                   RGGNEDFPLRMHRYRGLLEGRYRRHVSALALLIEPLSEAQSYGIYSWEGYGTRVKYEFP
FT                   VFKLYEGDEEALKASDNPFDWAHLAGLRAWKSRSSEPRKLSYLKEMLKLLDEQGWPHAD
FT                   KAQLLVFMEGVIHLTEDESSREYEEWESALEEAKEAGRMYVSIMERKGIEKGIQLGRTE
FT                   GIQLGEARGVAATARRMLGMSFTSEQISQATGLSPDEVAALRAGTGN"
FT   CDS             complement(1325765..1327801)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28368"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:D4M923"
FT                   /protein_id="CBL28368.1"
FT                   /translation="MRKRFFAILALILALAFPVAPAGAELIFTRQDNSYANTALGIVLG
FT                   DGVPIHPLVSNMGGNQGQGIYPFVNADGNFRVAITLYTLNGTDVINIHDPGPKENWKIP
FT                   QTWNRPQEAGTSLHNTRILVPSGGYLYGTAYDIPTINRVSTRGDQYTEDKTYLYTPSSS
FT                   GNKAHGEGLVPYGDALYAIFTEGHDVWNIAGVGYAPNRLVKLDKDLNVLANKPMLGKNL
FT                   DGFTPGAYIRQGNLLYVATLGGVQPFGNTYNPDSCVEIVNLDTMEVSAPVTARRMKEKD
FT                   PTFSHMFGAVASAWGKIYVQATQWVSEEEYKPGYSIRVYETTAERLAAGDLGTLLRDFK
FT                   GKYGYRMGLVYDPERNYLWAGVGYSLWRYDGTNWREFDANALGGNISAYTAISIQTGPV
FT                   IPPSPSPSPSPSPSPSPSPSPSPTPQPGQPESGIVPSLPGGSPEGIQAVKPEYFAASGQ
FT                   AEELTKAAEALSRTGLTRDDLRADSDSGVVKLAPRVAREVAKKVLPASETTATVKLLPV
FT                   LTARLNKAGGVAAAGVALTVTDPKGKRGADVKLLKVTGPDKGVLLTWAARPADFADGRF
FT                   TVLDDKGNIVEDLKPYIPYVLTLFIRDGGPLDLDGAADGKVVDPAAILTVEASGTPAPE
FT                   PKPDTNPGQPDKGKGGGGGCDAGFLLGWLLLAAAIPVVLRRRG"
FT   CDS             complement(1327851..1328978)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28369"
FT                   /db_xref="GOA:D4M924"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D4M924"
FT                   /protein_id="CBL28369.1"
FT                   /translation="MQIHREKDFLSCFDDRTGRYFRTGIIRDGRDTGEDPFMSSFPELV
FT                   DVGIMGHCRHGKLGLCRAAGVECYQDGPHSDAPDMELDDFLELARQCSSRTYQFALGGC
FT                   GDPDQHENFAEILQICRHYRIVPNYTTSGLGMTKDIAELSGRHCGAVAVSWYRSTYTLR
FT                   AVSLLLNAGVKTNIHFVLARDSVAEAIRLLTGKGPSEGFPVGINAVVFLLHKPVGLGSR
FT                   EKVISLEDESFKEFLKLVNSRTFRYRVGFDSCTVPALVNNPGIIDMKSLDTCEGARWSA
FT                   YVTPDMKMLPCSFDNQDRRWEVNLRDNTVEAAWNSSTFEDFRTCLRTSCPECDKRSLCM
FT                   GGCPVRPEIVLCGRRLDFQRQIDNPGTTGKSSVGK"
FT   CDS             complement(1329023..1329391)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28370"
FT                   /db_xref="UniProtKB/TrEMBL:D4M925"
FT                   /protein_id="CBL28370.1"
FT                   /translation="MKIRMDFVTNSSSSSFIVARQGELNEKQKEAIIKFVEEKMLGKKV
FT                   LGPESGEKDIQDFFEDNYVVDEDGIREALKEGKDIYSGTLDLETAEVYYTRLFQDLWAV
FT                   LDQTGDGNFVAIDDDLSY"
FT   gap             1329481..1330341
FT                   /estimated_length=861
FT   gap             1332842..1333486
FT                   /estimated_length=645
FT   CDS             complement(1333691..1335109)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28371"
FT                   /db_xref="UniProtKB/TrEMBL:D4M926"
FT                   /protein_id="CBL28371.1"
FT                   /translation="MYRKAMKRWPSGMLLFALALVLGAPASANLLYTVHDNNYASTSVG
FT                   KIVGDTAIVLATNVGGNWGQVIFPFKRGAADRVAVTLYPNSNPYYPGDEVRIYDPASLN
FT                   WSSPESTLTHVRLKNIRALAFMGGHPYGIGYDCTPFAFAYSEDPVRRSAKVARWNHMWG
FT                   TTYWPDNLYTHLFQYESPSGYTANGEGLAAHGSFVYALFKSYTGNYPNFVYSPNKLVKL
FT                   NAELGQVGALDLHGKNTDGSIPGAYCQSGSTLYLTSWGGLHFFISNWHPESRIEKVNLN
FT                   GMSTETLVTGQQMHDNDPSWKHHFTAIALHGNTAYVQAATWKEFPGTPFAMPGGEVRIY
FT                   KCSMSDIGTLPQTAPVQTIATDAIWQLGMVQEGTYLWVAVGDRLHRYSLPVTASSQATV
FT                   FSSGSAIPLGGNISAFAPLPLPQEVFTAESALDTLKQADIKEEKGNSRGCEAGLPWAGV
FT                   LLAAAVPFVLRRRG"
FT   CDS             complement(1335662..1336081)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28372"
FT                   /db_xref="UniProtKB/TrEMBL:D4M927"
FT                   /protein_id="CBL28372.1"
FT                   /translation="MEDAEQERDGELTAPLNRLDYWMMYLSGMAAEEMPEEVAKDEMIS
FT                   QALDLEKQFLQNQEERQRYITSYKAMVDDLMTDETIRRVARDEGLVEGEAKGKVEGIAA
FT                   TARRMLNRGVSPEQVADFTGLSRGEVEALRAGTGN"
FT   CDS             complement(1336273..1339146)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12180"
FT                   /product="The GLUG motif."
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28373"
FT                   /db_xref="UniProtKB/TrEMBL:D4M928"
FT                   /protein_id="CBL28373.1"
FT                   /translation="MQTMKARAFCTAFLLAFLVLFSPAANAANWIDSADVSWYDEGKSE
FT                   FTLTSEAQFAGLAKLTLEGKSFKDKTVSLGADLDLGSKEWTAVGAFEGLFDGRNRSITL
FT                   GTGNTTALFSDLLKGGILRNLHLSGTVNLAPKGASPVMQEGFRWADGTLLGVNRGIVEN
FT                   CSFKGKVRYVGSEGVVRALGGLVGCNPQRLPGNPSSIIRGCRVSGALEMAPEAGSASSG
FT                   VPLVQVLIGGIAGINLGDIEDSVFEGMLNRTMGGGSIVAGGIAGGLDGCFDILSGGSYR
FT                   NCFASFDMKSSVPMQEAAMMTAMGTPDTTCLGGIVGRLYDQTEIENCRARAELEYQCGI
FT                   DNVCAGGILGFGFAKIINGVFEGNVTIAGTPMAPLIPEASLVRAYGGVAGLGAGLICNS
FT                   FAKGTVTGPDGAVGGIAGYAFGKVENCSAACNVSSEGDNANVGALVGNNQDAQGAVSNC
FT                   RWVSGLGADKAIGAGDKLDSTDVVAAESALPATSVAMIPWIGLTENKTASVKAEVYPLD
FT                   AFNGETVSLKISPLDENILKVESDHAGMAVVRGVKKGTSGLKLSCNGLLGDTSYYPASF
FT                   VTVRLIRLASLSLSPKVIELAQKDQSAEIHMAIAPDAGAVSYLPKWTFSVLEGTSAAAD
FT                   DIELMPTADGLGAAVTLVRPVSGAKYRVLAEAVDGSGLSDDVIVMVKYNPPAPVSPDVS
FT                   PDVPAPTSPDVPAPTSPDIEPGEPEVGIAPRLPDGVPAGVGASKPAFFGGSEAAALKNA
FT                   AAALSDTGLEAKDLAFDPDTGIVRLQSRVAREVARKVLPEGATVKRVRTLPVLSATLPQ
FT                   GANVAAVGLELTGRDLMAKKASEVELLKATGPDTGALLKWSGKPEEFGDGRFTVLDGSG
FT                   RGVDELQPRSRYVLTVFIGDGGKYDLDGEANGKVVDPLALLSLKGGSAPGPQPGPDGKD
FT                   GGGGGCNAGLGWLLLLAAVVPVALRRQ"
FT   CDS             complement(1339396..1340802)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28374"
FT                   /db_xref="UniProtKB/TrEMBL:D4M929"
FT                   /protein_id="CBL28374.1"
FT                   /translation="MHCKAMKRWLSGMLLFALVLAFGAPASAHLLYTVQDNNYTSTSVG
FT                   KVVGNTTTILANNVGGNWGQVIFPFKRGTADRVAVTLYPNTNPYYPGDEVRIYNPASFN
FT                   WSSPESTITHARLKNVRALVFMGGHPYGIGYDCTPFAFAYSEDPVRKSAKVARWNHMGG
FT                   TSYWPDNLYTHLFQYEAPSGYTANGEGLATHDSFVYALFTSHTGNYPNFVYSPNKLVKL
FT                   NAELGQVGAIDLNGKNTDGGIPGAYCQDSGTLYLTSWGGNQPASSNWHPESRVEKVNLS
FT                   GMSTQTLVTGQQMRNSDAMWKHHFTAITLHGNTAYVQASTWNQIGPGATPSGEVRVYSC
FT                   SISSLNTLSQTLPVKTIPITGAWRLGMVQDGTYLWVAAGDSLYRYALPVTASSVATVFG
FT                   PGGTSLYGNISAFAAIPSLRGVSAAQAAMDEPVQTMAAKDEKDGGSGCDAGFGWLLLLA
FT                   VVPVALRRRG"
FT   gap             1341382..1342112
FT                   /estimated_length=731
FT   CDS             complement(1344793..1345152)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12210"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28375"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D4M930"
FT                   /protein_id="CBL28375.1"
FT                   /translation="MPLLPRNKNLLGYARLLRREMTPQERRLWYEFLRDFPMKFYRQRV
FT                   VGNFIVDFYCASFKLAIEVDGGQHCDEAVVKYDLERTKFLKSLGITVLRYTNLDVAENF
FT                   EAVCVDIENFVKGRS"
FT   gap             1345217..1345723
FT                   /estimated_length=507
FT   CDS             complement(1345746..1347914)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28376"
FT                   /db_xref="UniProtKB/TrEMBL:D4M931"
FT                   /protein_id="CBL28376.1"
FT                   /translation="MANGDSTMGGIVGQGGEIRNCRAQVVLGADSEFINTLDEDSHHYQ
FT                   TILGGIAGVNGDLIEGCLAEGSIRYVGSDDVVYAGGIVGRGKGGDVVQCVFSGDIGVGN
FT                   TSWGETDAPSSAGGIAGLGDKNIRSCFARGKVANKLGVSGGLVGHLAHAQKLVRIENSS
FT                   SACAVSSTSGLAGELAGTASTYGDKYQIVRCLWVSEGENPLGANSPKVELVSCDRVPSD
FT                   ADLPVTVALLPTQLGLTERKRGELSVELYPEVSSQIGNVTFAWSLRESEVGVLKLDEGK
FT                   TATASMMGLKEGAAEVMAQCGPLVEENVSKPSCLVFVHRVLMEKLSLRPKTLVLRNKNH
FT                   KENIRTLIDPDKNTVSYPPKWRIEVVAGNSAEADDIELTPADGGFGAAVALVRPVSGAE
FT                   YRVVAEAVDGSGLSDDVIVTVNYVPPVPGSPDVPVPPVSPDVSPDVPAPVSPDVSPDIK
FT                   PPLSPDVKPPVSPDITLPDVPDDPETGIAPKLPDGAPAGVGASKPAFYGGSENAALKNA
FT                   AAALSDSGLKAKDLTFDPDTGVVRLQSRVAREVAREVLPKDVSLKKVRTLPVLSASLPK
FT                   GATVAAVGLEITGADLMAKKASEVKLLKATGPDTGALLKWSGKPEEFGDGRFTVLDGSG
FT                   RVVDELQPRSRYVLTVFIGDGGKYDLDGEANGKVVDPLALLSLTGGSAPEHQPGPDSKD
FT                   GGGGGCNAGLGWLLLLAAAVPVVLRRRG"
FT   CDS             complement(1348130..1348636)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28377"
FT                   /db_xref="UniProtKB/TrEMBL:D4M932"
FT                   /protein_id="CBL28377.1"
FT                   /translation="MKTMKVRALCAAFFLAFLALPAPSAEAANWLDNADISWYEDVVSA
FT                   NPQATEFEISTPEEFAGLVELTQRGNAFEGKTVSLKSDLDLNGAEWTPVGTFSGVFDGK
FT                   GHVVKGRTTLFSHISGEGALLRGLRKVGDSSGSGLVKVLSKGTVEDCFFKGAVLTDPTP
FT                   PLALP"
FT   gap             1348720..1349714
FT                   /estimated_length=995
FT   CDS             complement(1349837..1351192)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28378"
FT                   /db_xref="UniProtKB/TrEMBL:D4M933"
FT                   /protein_id="CBL28378.1"
FT                   /translation="MYRKTMKRWFSGMLLVTAVLVLSAMPVAAANLLFTAQDDLFNNAR
FT                   LGKISGYRVYTLSRDIGGKYGQGIFPFKNANQERVAVTLCQTFDGVQPDVIQVYDPRFI
FT                   STLPVLTGHPYLPNIRSMVSKGSYLYGTSYMGKANAQNTKARVARIGMSGSTYTPDMDH
FT                   VYEYNPPSGDGHGEALVSYGNFLYALFTSQTGSYPNFVYNPSRLVKLNAELGQVRAIDL
FT                   YGKNTDGGTLGATCLSGGTLYIAAWGGSQPTAPNYNPDSMIESVNLNNLSHTTCVTGSQ
FT                   VAGRETGWRHHFTSIVIVGSTAYVQAVSWNASWIGGEVRLYAVPVASLGSLGRAHRVDT
FT                   VSFSGGWRLGMVQDGQYLWMAAGKNLRRYTLPANGTANMVFGPNGVSLGGNISSFMPIP
FT                   SLRSVFAAQTAQEEPVQAMAAKDEKDGGSGCDAGFGWLLLLAVVPVALRRRG"
FT   gap             1351372..1352090
FT                   /estimated_length=719
FT   CDS             complement(1352431..1354416)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12250"
FT                   /product="Outer membrane receptor for ferrienterochelin and
FT                   colicins"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28379"
FT                   /db_xref="GOA:D4M934"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:D4M934"
FT                   /protein_id="CBL28379.1"
FT                   /translation="MKVGPPSPAFVLLLFALTPVFVLGAVGPALGTTELPEERVVAPPV
FT                   EDEDKLLLSPGSVTVVRPQEMKGEQKNLPELLKQVPGLHVVETKGRGAYTVASIRGSSA
FT                   AQVAVYVDGVLMNLGSEAAVDLSTIPVENVERIEVYRGYIPSRFGGASMGGVINIVTKK
FT                   PEKSGGTLSLGAGSWGRARAGLAWDAPLGGGSLFLGLNHDRTDGDFRYPNDNNTPYTPT
FT                   DDYEADRENNRYANTDVLLKWNDDHWRVEGGWKRNDRALPYPAPGADKPESPRGADFRV
FT                   DQWNVVLARRQTWGDLEWGFRAEYLGQSKRYDDPADTIGGWGEQHNRYDTDRLSFALDG
FT                   ALPVGDHHLLEFLWNYYDETLNTDGDVVKKMRGFREHNRYSWNAQVQDTIGLGRGDDLW
FT                   LTPVVRWNAADGRTEFSWGAALDWRMSREWTLKLTGGTYNRAPNLYELYGDGAFVIPNP
FT                   SLRWESGTQWDVGLAWKGQLWGGEATAELTAFGRHSDDLIDYLMTNPRFAQYVNIGKAR
FT                   VIGTELEVSAEWAKWALYLAATWMDPKNETPGYMDGDPLANRPEWEGLLRATRKWERSS
FT                   AFAELRYVGRNYYDMQGEVGWTDLLTAGLGVRWQPKENLKLVLGVDDLFDKGPDLKLFA
FT                   VGTGPERMLWYPLQGRTFYVSLIWTF"
FT   gap             1354915..1355469
FT                   /estimated_length=555
FT   CDS             complement(1356262..1356654)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12280"
FT                   /product="Biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28380"
FT                   /db_xref="GOA:D4M935"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:D4M935"
FT                   /protein_id="CBL28380.1"
FT                   /translation="MRTRPRRKVDLDITPLIDVLFMLIIFFVLTTSFVQGRVEVDLPRG
FT                   EGTPPREDRTLLVSVKADGTVLWDGTPAASADVPTLAARAVAESRDVLLAGDRAAPYGA
FT                   VAELLELLRHEGLDRAGLALRGVAVP"
FT   CDS             complement(1356651..1357274)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12290"
FT                   /product="Biopolymer transport proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28381"
FT                   /db_xref="GOA:D4M936"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D4M936"
FT                   /protein_id="CBL28381.1"
FT                   /translation="MLEYMRAGGGIMWIIALLSFVALAVVLERLFFFTRSRTDPGRLEV
FT                   GLGRALRDGDLQTALALAEAGNSSLHRLFAAVFSCWELPDETVRLLAERRIRRELYRWE
FT                   RHLPVLEVTARVAPLLGLLGTVLGMVEMFRSLHQGGAVDAIAVTGGIWKALFTTVAGLV
FT                   AAIPMVLAHSLLQGAVDSQAETLERGVDFLLRERAVREAGRPES"
FT   CDS             complement(1357490..1358476)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12300"
FT                   /product="ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28382"
FT                   /db_xref="GOA:D4M937"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="UniProtKB/TrEMBL:D4M937"
FT                   /protein_id="CBL28382.1"
FT                   /translation="MRGRRSALFVLFSLSAAVLVVAPLVGMHALSWRDIWPGEGQGHRI
FT                   FWELRLPRVCLAWVTGATLGVCGAVFQALFRNPLASPDMLGVSTGAAFGAVLSIRLGLT
FT                   VSLLSGQSGLSVPAFLGAGVATIVVCAAGSWRRRSTSSLLLSGIAVSFLFSSLTLIVQY
FT                   TGNYVDTFRMARWTMGSVQAVGFGTLWTTLPALLFILAVAVFCAPELDLFLCGEELAES
FT                   RGVSVKRLRIGLFVGVSLAVAASVSACGPVGFIGLMGPHICRRLVGPVHRTLVVASALF
FT                   GGAFLVACDTAARTLWAPAEIPVGVLTSCMGASFFLWLLLRRERHER"
FT   CDS             complement(1359287..1360219)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12320"
FT                   /product="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28383"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D4M938"
FT                   /protein_id="CBL28383.1"
FT                   /translation="MFLTRVRRHFCVALSLLLLFAAAAAAAPARIVSLSPVGTEILFDL
FT                   GLEDRIAGVTEFCDYPPEAKLKPKAGGFTEVNLESLVVMSADLLVLQDLHRQELAPKLE
FT                   ALGIPYYILSQESTEDICRGILELGELCGVQDRAEARVAEIRSRLDALASRLKDLPRPR
FT                   VLLSVSRELTLDYLETLYVAGPSGNFYNELIRMAGGVNAVEEGPSYVKISQEGVLKIDP
FT                   EVILDLVGDQSYYHAPDAADPDRVFSSEHLMAPWLRLSDVRAVREGRVHILRGTFLLRP
FT                   GPRIPQIVEAFARCIHPGALSDDQAPAAR"
FT   CDS             1361081..1363321
FT                   /transl_table=11
FT                   /locus_tag="SY1_12340"
FT                   /product="type I secretion system ABC transporter, HlyB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28384"
FT                   /db_xref="GOA:D4M939"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR010132"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M939"
FT                   /protein_id="CBL28384.1"
FT                   /translation="MFDEVHDPTHRAGDPEEIKRENLRLFDDALLALAVAAQIAGLPAD
FT                   PEGLRRAFPASDAGALPLTLLRAARSLGLKAKRIETSLEKLDRMPQPTLLLLPDGQVFV
FT                   LLAADFKKDKKRVMLLRPGEKQPFVWDCARLEEVWHGDAIPLVRRFSFAELGRKFGIGW
FT                   FLPVILRFKRHLVEVFVGSFFLQTFGLITPLFSQVIIDKVLVHKGLSTLDVLVIGLFLI
FT                   NVFEMVLNVTRTYVFSHTTNRVDVILGAKLFKHLLALPLPYFEARTVGSTIARIRELET
FT                   IRSFITGTALTVVLDLIFTIVFIAVMFFYSPTLTLISLAALPFFIALSAMATPAIRERL
FT                   NRKFERNAENQSYLVEMVTGIQTVKSLAIEPQLNGRWEGMLANYVRASFRAGFLSSLAG
FT                   GVAQLIQKTSTLAILWFGARMVMKGDFTVGQLIAFQMLSGRVTEPILRLATLWQDFQQV
FT                   RVSIERLGEVLNFPAEPESTPGRSSLGRVRGRIEFDHVQFRYKMDGPPILDDVNLVIEP
FT                   GTTVGIVGRSGSGKSTLTKLVQRFYVPVNGRVLVDGVDLAQVNPPWLRRQIGVVLQESF
FT                   LFNRSIRDNIAVVDTAAPLDRIIAAAKLAGAHDFIMELPDAYDTLVSERGASLSGGQRQ
FT                   RIAIARTLMTNPRILIFDEATSALDYESERIIQHNLQDICRGRTVFIIAHRLSTVRMAD
FT                   VIIAMDRGRIVERGTHDELLGNADGLYSFLYRQQALLGDEGSWEGGRKTCSA"
FT   CDS             1366377..1366925
FT                   /transl_table=11
FT                   /locus_tag="SY1_12370"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28385"
FT                   /db_xref="GOA:D4M940"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:D4M940"
FT                   /protein_id="CBL28385.1"
FT                   /translation="MIGYMTIAQEKTRPSRGELLGVELEVRRYPDPVLKKVAEPVTVFD
FT                   DELADFVGKMRTVMRVSDGVGLAAPQVGVLRQIAVVDYKEEAYDLINPRVLEQGGEQEG
FT                   EEGCLSFPGIYAMVRRPEWVRVEAQDVRGEVHVHEASGFLARAFLHEMDHLNGKLFIDY
FT                   LSPLKRGAIRRKMMKKKEG"
FT   gap             1367509..1367846
FT                   /estimated_length=338
FT   CDS             1368157..1368723
FT                   /transl_table=11
FT                   /locus_tag="SY1_12400"
FT                   /product="NUDIX domain."
FT                   /EC_number="3.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28386"
FT                   /db_xref="GOA:D4M941"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D4M941"
FT                   /protein_id="CBL28386.1"
FT                   /translation="MAQSSWEGQERRASGRRIYEGRILNLRVDEVTMPSGRTAEREVVE
FT                   HRSAVGILALTGRDSVLLARQYRYAVGEETLEVCAGLIEPGEDPRVAAERELQEELGVK
FT                   PGRLQEVGGFFSSPGFCTEYLTLFLADDLQNSRLPQDEDENVSAVEVPYGEVPGMMADG
FT                   AFRDSKTFAALAWLMAREGIPPRVR"
FT   CDS             1368816..1370978
FT                   /transl_table=11
FT                   /locus_tag="SY1_12410"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28387"
FT                   /db_xref="GOA:D4M942"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D4M942"
FT                   /protein_id="CBL28387.1"
FT                   /translation="MLKNLRISAKLALGFGLVLSMFAVAAIFSWSSISHVQEEMRYLNK
FT                   LTDLSTLISDLDDALKIVTNNLSALRLSESKEDLDALKSSLDALRAHPRKVNDLVASEP
FT                   RMQVLRGGTSTSVQVRTLPELEGYIDAFGRSVAAYETTLRSQQAAMASLTDDLEKTTAV
FT                   IGTIIEKLSAPKSETTAYDAAGVVRSETNEVGTAEDLRYKLTLFRRQYVYALYKRDVAL
FT                   LEGAATDFDKWAADYEAFRSSASEDWLKDLTASNDGLVRSTRGDMESILKAYREARSAM
FT                   EDCLKNASGIKDCALSIYSLTDRRVNELMMGSYSALSSALTLLLSLVVLSIVLGAFIAW
FT                   AIARGISKPLGIVVDLTARAEGGDLTLKREDFPYDGRDELGALGEALMKMIAAQRTAVS
FT                   EVLTTADQAAAKSVDILDNCKRSLDSATRVKDAVQKAVALMENNSSSLQESNAGTEEMS
FT                   AASMTSAQAATDCAEFISNMTTVTNKAVDTVQGTIKDMGELQKKTQESGQKLQDLVDSV
FT                   DKISEFVGVITSIADQTNLLALNAAIEAARAGEAGRGFAVVAESVRKLAEESNRAAGNV
FT                   RALIETLQGSARETKSASDETATLLSQTMEKGTSAKDSLSEAMEQIDKANDRIQNIAAV
FT                   AEEQAASSKEIAAGIDNVTKSSSEILEHLEKIAEAMDETTAVSTSTTKESDAQADLVQH
FT                   VKDAISVFKVADSEDRGRRSRKALHG"
FT   gap             1371075..1371688
FT                   /estimated_length=614
FT   gap             1373407..1375372
FT                   /estimated_length=1966
FT   CDS             1375573..1375644
FT                   /transl_table=11
FT                   /locus_tag="SY1_12440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28388"
FT                   /db_xref="UniProtKB/TrEMBL:D4M943"
FT                   /protein_id="CBL28388.1"
FT                   /translation="MIAANISVLEELRALKRTLQDSL"
FT   CDS             1376002..1376676
FT                   /transl_table=11
FT                   /locus_tag="SY1_12460"
FT                   /product="peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28389"
FT                   /db_xref="GOA:D4M944"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:D4M944"
FT                   /protein_id="CBL28389.1"
FT                   /translation="MLLRMYLRYAERDGLKATVLEATNDEEAGIKSATVMMEGDNAYGF
FT                   LKAERGVHRLVRISPFDSAHRRHTSFASVLVTPEFSDDVDVDIRPEDLKVDTYRASGAG
FT                   GQYVNRTDSAIRITHLPTGIVVTCQNERSQHMNRQVAMHVLRSKLYERALQERQDELAS
FT                   VVGDKKETTWGSQIRSYVLHPYTLVKDHRTGLEKGNAQAVLDGDIDDFIMEYLRFRARR
FT                   EL"
FT   gap             1376925..1378461
FT                   /estimated_length=1537
FT   gap             1379206..1380197
FT                   /estimated_length=992
FT   CDS             1380296..1381225
FT                   /transl_table=11
FT                   /locus_tag="SY1_12480"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /function="signal recognition particle-docking protein
FT                   FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28390"
FT                   /db_xref="GOA:D4M945"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4M945"
FT                   /protein_id="CBL28390.1"
FT                   /translation="MAFFARLKEGLKGVKERWSGGIARLFSGSSFDDAFWEELEDRLIA
FT                   GDVGVELSEELVESLKGEVRARGIASPEALRDVFVERITAELLSVPGMGKPFETEPAPQ
FT                   VLLMVGVNGSGKTTSAGKLALQFKGQGKGVVLAAADTFRAAAVEQLQIWGERVGVRVVA
FT                   QGQGSDPAAVAFDAWQAARSAGADLLIVDTAGRLHDKHNLMEELRKIQRVLVREAGEDR
FT                   VQTVLVLDAVLGQNSVAQAETFNSILPVSSIVLTKYDNTAKGGVVLAIARRLRIPVRCI
FT                   GLGEAPEDLSPFDPAEFAAALMEGEAGR"
FT   gap             1381939..1382043
FT                   /estimated_length=105
FT   gap             1384971..1385478
FT                   /estimated_length=508
FT   CDS             1386078..1386632
FT                   /transl_table=11
FT                   /locus_tag="SY1_12550"
FT                   /product="Chromate transport protein ChrA"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28391"
FT                   /db_xref="GOA:D4M946"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:D4M946"
FT                   /protein_id="CBL28391.1"
FT                   /translation="MFKRLWSIYVRFFRIGAFTIGGGIVMLGVIEAEVRATGEFTDEEI
FT                   ADMIVLATAVPGPIATNLSFVAGRAMGGLPAAVTAVLGTATAPFLSILFLSSLIIEHLK
FT                   NPWMISFFLGATAGVVVVVWNSLWKMIRSSVLKGVPQALAFATTVGLLFVWDVNPFIAL
FT                   AAGGLVSILGGRFLPGGGRAS"
FT   CDS             1386629..1387210
FT                   /transl_table=11
FT                   /locus_tag="SY1_12560"
FT                   /product="Chromate transport protein ChrA"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28392"
FT                   /db_xref="GOA:D4M947"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:D4M947"
FT                   /protein_id="CBL28392.1"
FT                   /translation="MSTVLLLMGVFAKVALGAFGGGLATIPFIHRELVELHPWLTEEMF
FT                   GQTVALAQMTPGPVALNSATFVGYRMAGFWGSLGASAAVVGAPLLAIALLLWLISRASQ
FT                   RAQGRIAAFEKGLRPAVAGLLFVAFCTLARPLLPAPSSLRAMLPRLALIALAFLCLALS
FT                   RLRPFKAYPQLLILFAALMGLLLRGLLAAQ"
FT   CDS             complement(1388931..1390238)
FT                   /transl_table=11
FT                   /locus_tag="SY1_12580"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28393"
FT                   /db_xref="GOA:D4M948"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D4M948"
FT                   /protein_id="CBL28393.1"
FT                   /translation="MLTLVFAVFAALMAGSLACGYSMLWALAAGFAGFMGVGLRRGFAL
FT                   PSLLRMAWRGVRESLIVVRVMLTIGVLTGLWRAAGTFALLTAWGLRLLSPSTFILSAFL
FT                   LSCTLSYALGSSFATAGTLGVALMTVARSGGVNELAAAGAILSGIYFGDRASPASSCAN
FT                   LVAALTSMDLYDNVKLMMRTAFLPLLLALGLHAWLSFKNPMLGGEGAVLTSLNLDFHLS
FT                   PWCALPALVMLVLPLFKVKVLHSFGVSILCAFLCAVLLQRTGTAGALRFALMGFHAPEG
FT                   SVRAIFNGGGLVSMLEISAALMISGTFAGIFDGTGILKGLQSRLVRAMDALGAYPVTLT
FT                   LGTLANAVFCNQTVAVMMTVHVVRHPYGERGLPPAELAQDLANSAVITAGMVPWCIGCS
FT                   VPLTMMGAGAGAVPYAAYVYLLPLCYLLTRRRWFKG"
FT   gap             1391308..1391559
FT                   /estimated_length=252
FT   CDS             1392566..1396171
FT                   /transl_table=11
FT                   /locus_tag="SY1_12610"
FT                   /product="pyruvate:ferredoxin (flavodoxin) oxidoreductase,
FT                   homodimeric"
FT                   /EC_number="1.2.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:SY1_12610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL28394"
FT