spacer

EBI Dbfetch

ID   FP929052; SV 1; linear; genomic DNA; STD; PRO; 2573208 BP.
XX
AC   FP929052;
XX
PR   Project:PRJNA39179;
XX
DT   25-MAR-2010 (Rel. 104, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Ruminococcus champanellensis type strain 18P13T draft genome
XX
KW   .
XX
OS   Ruminococcus champanellensis 18P13 = JCM 17042
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Ruminococcaceae;
OC   Ruminococcus.
XX
RN   [1]
RG   metaHIT consortium -- http://www.metahit.eu/
RA   Pajon A., Turner K., Parkhill J., Bernalier A.;
RT   "The genome sequence of Ruminococcus sp. 18P13";
RL   Unpublished.
XX
RN   [2]
RA   Pajon A.;
RT   ;
RL   Submitted (23-MAR-2010) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
XX
DR   MD5; a58d19c654c49755aebb5139d42ef3a1.
DR   BioSample; SAMEA3138364.
DR   EnsemblGenomes-Gn; RUM_R_24660.
DR   EnsemblGenomes-Gn; RUM_R_24670.
DR   EnsemblGenomes-Gn; RUM_R_24680.
DR   EnsemblGenomes-Gn; RUM_T_24220.
DR   EnsemblGenomes-Gn; RUM_T_24230.
DR   EnsemblGenomes-Gn; RUM_T_24240.
DR   EnsemblGenomes-Gn; RUM_T_24250.
DR   EnsemblGenomes-Gn; RUM_T_24260.
DR   EnsemblGenomes-Gn; RUM_T_24270.
DR   EnsemblGenomes-Gn; RUM_T_24280.
DR   EnsemblGenomes-Gn; RUM_T_24290.
DR   EnsemblGenomes-Gn; RUM_T_24300.
DR   EnsemblGenomes-Gn; RUM_T_24310.
DR   EnsemblGenomes-Gn; RUM_T_24320.
DR   EnsemblGenomes-Gn; RUM_T_24330.
DR   EnsemblGenomes-Gn; RUM_T_24340.
DR   EnsemblGenomes-Gn; RUM_T_24350.
DR   EnsemblGenomes-Gn; RUM_T_24360.
DR   EnsemblGenomes-Gn; RUM_T_24370.
DR   EnsemblGenomes-Gn; RUM_T_24380.
DR   EnsemblGenomes-Gn; RUM_T_24390.
DR   EnsemblGenomes-Gn; RUM_T_24400.
DR   EnsemblGenomes-Gn; RUM_T_24410.
DR   EnsemblGenomes-Gn; RUM_T_24420.
DR   EnsemblGenomes-Gn; RUM_T_24430.
DR   EnsemblGenomes-Gn; RUM_T_24440.
DR   EnsemblGenomes-Gn; RUM_T_24450.
DR   EnsemblGenomes-Gn; RUM_T_24460.
DR   EnsemblGenomes-Gn; RUM_T_24470.
DR   EnsemblGenomes-Gn; RUM_T_24480.
DR   EnsemblGenomes-Gn; RUM_T_24490.
DR   EnsemblGenomes-Gn; RUM_T_24500.
DR   EnsemblGenomes-Gn; RUM_T_24510.
DR   EnsemblGenomes-Gn; RUM_T_24520.
DR   EnsemblGenomes-Gn; RUM_T_24530.
DR   EnsemblGenomes-Gn; RUM_T_24540.
DR   EnsemblGenomes-Gn; RUM_T_24550.
DR   EnsemblGenomes-Gn; RUM_T_24560.
DR   EnsemblGenomes-Gn; RUM_T_24570.
DR   EnsemblGenomes-Gn; RUM_T_24580.
DR   EnsemblGenomes-Gn; RUM_T_24590.
DR   EnsemblGenomes-Gn; RUM_T_24600.
DR   EnsemblGenomes-Gn; RUM_T_24610.
DR   EnsemblGenomes-Gn; RUM_T_24620.
DR   EnsemblGenomes-Gn; RUM_T_24630.
DR   EnsemblGenomes-Gn; RUM_T_24640.
DR   EnsemblGenomes-Gn; RUM_T_24650.
DR   EnsemblGenomes-Tr; RUM_R_24660.
DR   EnsemblGenomes-Tr; RUM_R_24670.
DR   EnsemblGenomes-Tr; RUM_R_24680.
DR   EnsemblGenomes-Tr; RUM_T_24220.
DR   EnsemblGenomes-Tr; RUM_T_24230.
DR   EnsemblGenomes-Tr; RUM_T_24240.
DR   EnsemblGenomes-Tr; RUM_T_24250.
DR   EnsemblGenomes-Tr; RUM_T_24260.
DR   EnsemblGenomes-Tr; RUM_T_24270.
DR   EnsemblGenomes-Tr; RUM_T_24280.
DR   EnsemblGenomes-Tr; RUM_T_24290.
DR   EnsemblGenomes-Tr; RUM_T_24300.
DR   EnsemblGenomes-Tr; RUM_T_24310.
DR   EnsemblGenomes-Tr; RUM_T_24320.
DR   EnsemblGenomes-Tr; RUM_T_24330.
DR   EnsemblGenomes-Tr; RUM_T_24340.
DR   EnsemblGenomes-Tr; RUM_T_24350.
DR   EnsemblGenomes-Tr; RUM_T_24360.
DR   EnsemblGenomes-Tr; RUM_T_24370.
DR   EnsemblGenomes-Tr; RUM_T_24380.
DR   EnsemblGenomes-Tr; RUM_T_24390.
DR   EnsemblGenomes-Tr; RUM_T_24400.
DR   EnsemblGenomes-Tr; RUM_T_24410.
DR   EnsemblGenomes-Tr; RUM_T_24420.
DR   EnsemblGenomes-Tr; RUM_T_24430.
DR   EnsemblGenomes-Tr; RUM_T_24440.
DR   EnsemblGenomes-Tr; RUM_T_24450.
DR   EnsemblGenomes-Tr; RUM_T_24460.
DR   EnsemblGenomes-Tr; RUM_T_24470.
DR   EnsemblGenomes-Tr; RUM_T_24480.
DR   EnsemblGenomes-Tr; RUM_T_24490.
DR   EnsemblGenomes-Tr; RUM_T_24500.
DR   EnsemblGenomes-Tr; RUM_T_24510.
DR   EnsemblGenomes-Tr; RUM_T_24520.
DR   EnsemblGenomes-Tr; RUM_T_24530.
DR   EnsemblGenomes-Tr; RUM_T_24540.
DR   EnsemblGenomes-Tr; RUM_T_24550.
DR   EnsemblGenomes-Tr; RUM_T_24560.
DR   EnsemblGenomes-Tr; RUM_T_24570.
DR   EnsemblGenomes-Tr; RUM_T_24580.
DR   EnsemblGenomes-Tr; RUM_T_24590.
DR   EnsemblGenomes-Tr; RUM_T_24600.
DR   EnsemblGenomes-Tr; RUM_T_24610.
DR   EnsemblGenomes-Tr; RUM_T_24620.
DR   EnsemblGenomes-Tr; RUM_T_24630.
DR   EnsemblGenomes-Tr; RUM_T_24640.
DR   EnsemblGenomes-Tr; RUM_T_24650.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02004; group-II-D1D4-5.
DR   SILVA-LSU; FP929052.
DR   SILVA-SSU; FP929052.
XX
CC   This is a reference genome for the metaHIT project
CC   DNA source: INRA Clermont-Ferrand-Theix -- http://www.clermont.inra.fr/
CC   Sequencing technology: 454
CC   Genome coverage: 26x
CC   Annotation was added using ab initio prediction IMG/ER --
CC   http://img.jgi.doe.gov/submit (Markowitz, Szeto et al. 2007).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2573208
FT                   /organism="Ruminococcus champanellensis 18P13 = JCM 17042"
FT                   /strain="type strain: 18P13"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:213810"
FT   CDS             complement(199..465)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16294"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9J9"
FT                   /protein_id="CBL16294.1"
FT                   /translation="MPGVGGALVCEFACGLDVQLPHQPVNPLSGADHFPPDHVKQGVQP
FT                   GGWLLLMQGNKLTRQSLILLFSGADAPVKPGVVAAAGDFQKSA"
FT   gap             767..1403
FT                   /estimated_length=637
FT   tRNA            complement(2041..2116)
FT                   /locus_tag="RUM_T_24650"
FT                   /product="transfer RNA"
FT   CDS             complement(2279..3298)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16295"
FT                   /db_xref="GOA:D4L9K0"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9K0"
FT                   /protein_id="CBL16295.1"
FT                   /translation="MKKKFAQMLSFGITVAAMANLAVSVQAADLPYCWGTTDSDVFSNM
FT                   QQLDDKGMMAWVGKSYGAQDHYKVLAKENSSDTACSSFYVAYINENQLRFTLRPGLNAY
FT                   YQAVEIIKQYYPNLACGKYSSESDAYLYRIVDPFAPEGTYELQNLQTEVSSAETADALM
FT                   RDLAKAGLISEFYSWGQTARYYEVQKLRSESGLTYHSDTDVSWTAVEDYLRAKGLDWTV
FT                   VKHDYYYQITPKETCAFETEFALAADLYEAYNLQPEYLCPESITNSVLGTNSLAVDGDI
FT                   NLDCSIDIADTVLLARFIAEDQEIEITSTGIDNGDLDKDGSVTMSDVSVLLRQLANLD"
FT   CDS             4122..7064
FT                   /transl_table=11
FT                   /locus_tag="RUM_00140"
FT                   /product="Dockerin type I repeat./Ricin-type beta-trefoil
FT                   lectin domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16296"
FT                   /db_xref="GOA:D4L9K1"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018242"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9K1"
FT                   /protein_id="CBL16296.1"
FT                   /translation="MKKIGSLLLAGALGLNLAAMGMSHRVPTAAAADKSCVVENLDRGI
FT                   CAINTGSGMLVNWRFLANDPDDAVFRLYRGNTLVYTSDAGDATSYLDKGGSASDTYRVE
FT                   MLSGGTVQTNDTCKLTSNTNYFQLNLDPPTSSGCTYSPNDCSVGDADGDGQYEIFLKWD
FT                   PSNSQDNSKGGKTDKVYIDCIKLDGTRLWRIDLGWNIRAGAHYTQMLVADYDLDGIAEL
FT                   VCKTSDGTVDGTGKVIGDGSKVYRNSKGYILTGPEYLTLFDGKTGAALDTINYNPGRGT
FT                   VSAWGDKYGNRVDRFLGAVMYLDGERPSAVTVRGYYTRMTACAYDVVDKKLKQRWYFDT
FT                   GNSSSAQGYGDGNHNCMPADVDGDGKQELILGATCLDDDGKVLWCTNKGHGDALHVGDL
FT                   LPNRPGIEVWVCHEDKPYGVSLLDGKTGQTIFHVDGSSDTGRCCADNVWAGNDGAEFWG
FT                   LGNDVFNGSGTKLSMRRPAINFLSYWDGDLEREILDGYTDSPATISKVKTDGTLTTLLT
FT                   TDGYYTCNTTKGTPCLSADLFGDWREELIVRASDGKSIRIYCTPYDTDYRITTLMHDVQ
FT                   YRTQVAGQNIAYNQPPHPSFYLGSDQPLPARPTVTVLGGTPVVPGKTGAVIDTTHTYRI
FT                   RNVNSSLCLEVADGTAANGTNVQQGNGTANGWQFRDGGDGYYYLYSRVGDGNTYLLDLD
FT                   YGKTDNGTNIGIYSNTHSDAQLFKLVDNGDGSYTITTKATKDASCIGVTGGSTDNGANV
FT                   VQWACDGSDNQKWTLEIVVDPMNGTLFRDVQVLDTAHYQNWKLGTNTGVGSLLFGDRDV
FT                   VYAALPEQLQGAEALLTACDSKNVDTDLATFTAGADMTVYVLLDSRVAIVPAWLSTWSK
FT                   TELTAANDKDVSFVLYSRDAAAGEKITLGTNGQSAGCVNYTVLAVEQVKSIQGDVNGDG
FT                   SVSISDAVLLQKHLIRRSALAADQAVRADLNGDGVVNAFDLVLLRRLLAK"
FT   CDS             complement(7152..9383)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00150"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16297"
FT                   /db_xref="GOA:D4L9K2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9K2"
FT                   /protein_id="CBL16297.1"
FT                   /translation="MQERKRIAVIMNESESVYQQRMLKGIITQAYSLNWDVAVFSCLTN
FT                   YYYDCAHQTSEHNIFALINYKKFDGLLYARSTIRNAHLQEKLDAELRQNCQIPIVLLDE
FT                   PSDTLPYVLTDDCSAFRQLTEHFITVHGMTDIYCLTGFQGNPLAEQRVTGYRQALETHG
FT                   IPYRQEAVFYGDFWSSSGEQLGARLVNKEIPMPQAIVCANDAMAIALCNYLTNHGIQIP
FT                   EQVAISGYDATPECQENLLSMTSFIRANYELGVCAVSRLYTLLTGKQCTNVQSPTASIV
FT                   TGRSCGCGDDLQHLAQEMAYHKKIANYEGLYKNSNMAVSLTLAETIDTCMNQVYSHLYM
FT                   IRDYKEYYLCLCEDWAGSCDVAEPTAYRKTGFPENITIKAVVGASGDLRDYSFPAKDML
FT                   PALVEEREEPRAYYFTPLHHNDRFFGYSVISYGSTPDCYDEIYCRWNATISTAIEFIRV
FT                   QNFLKSMYNRVHLSAIRDSLTGIYNQEGFRQALQQQYNRARDQELSLLVMIANIDDLRQ
FT                   INDTYGHLEGDNAIIVFSNALTNTFTSNERCARLSGDQFAVVGSGEYDADAETRFTNAL
FT                   NSYLEHYNHSNTQVPKITASLGFFCGRIPPQSGPDSLVQIALNQMEQNKLQRRTERSSP
FT                   YYAEFSKLREKIYATPAYNWSIDAMCKEMILSRGYFQKLYTRCFGISFTQDVINSRIAH
FT                   AKKLLAQTDQSIAVIAEKSGYDNYVHFMHQFKKIVGITPTDYRRKKRQA"
FT   gap             9528..9826
FT                   /estimated_length=299
FT   CDS             complement(11318..12019)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16298"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9K3"
FT                   /protein_id="CBL16298.1"
FT                   /translation="MPENIFGIKSILTASTMTIGEFLTCILCSALLGFLISLIYIFTHR
FT                   KTGYSQSYVLTMTMLPAIIAVIILIIGDSVSSALSLAGAFTLVRFRSAPGDPKDIAYVF
FT                   FAMAVGLCCGMGYIGCAFLFFLLLGVIMFVLNAVHYGAPNVSDMTLKITIPENLNYMGL
FT                   FDRVLTENTTYWRLKRVKTTDFGTLFDLVYSIKVKNGIDQKKFIDDLRALNGNLNVTLV
FT                   LYKYDDKIYEK"
FT   CDS             complement(12012..12761)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00180"
FT                   /product="VTC domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16299"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9K4"
FT                   /protein_id="CBL16299.1"
FT                   /translation="MAIRTFQRREVKFLLSKAQYDALQPILLDYMNPDKYCVNGKEYGV
FT                   YNVYYDTDDNFLIRESLAKPYYKEKIRLRSYASPAGPEDTVFLEIKKKIGGIVTKRRVT
FT                   MTLQQANAYIQTRVKPQSEKFLQMQVLKELDVFLNNYAVSPKQYISYQRSAFFGKDNSD
FT                   FRLTFDRQITARREDISLASGNYGSQIIRPDQRLMEIKVTDSIPKWLSDALSELNIYKT
FT                   SFSKYGTAYKQYIRSKIEEDRSVMIYA"
FT   CDS             13236..16316
FT                   /transl_table=11
FT                   /locus_tag="RUM_00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16300"
FT                   /db_xref="GOA:D4L9K5"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR025584"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9K5"
FT                   /protein_id="CBL16300.1"
FT                   /translation="MKSGKANRRRMLAGMLALSVLCTSGVIRTGASVSAAATVAGDVNL
FT                   DGTVDAKDVTALQQYLIRKATLTATAAENGDLNGDGVLNSVDLALLKRQVLASTPQAEA
FT                   TYIHLKDTSIEVEGDHATLSNSNKTVTIDASGTYYIDGTLTDGQIIVNVPDIVADAETV
FT                   KLFLNGVNITGVSAAPILIENAENTSLNLVAGTTNYVYDGATYAENTAAIYAKDDMTIK
FT                   GEGALVVTASTQYGIHCNNDLKITGGDITVITENTTTKMDGIRAKQSVRIKDGTVKVNA
FT                   TGDGIKSTKADVNISGGNVSVKAGNDAIQAETTIDISAGTLLACGDRGLTSITATNITG
FT                   GSVCATATDSQAALVRASQGCMLLTYAAEWTKGNEIAVKSGATTVYAATPNKKFDYVLL
FT                   SSPDLTTSAAYSLYTGGQQMKHSADATGVFQMSADASFTGVEALNGSGTVTTEAGVQLN
FT                   GSSLTVSGEGVELTSSTIATITQPGIYNVTGSMTGGQIVVNVDKTTYADAIVELVLDGI
FT                   ELTNTADSPIYVASVGDECRITAKNGTTSTISDGTNYTNADSDSGAIYSKDDLKIKGKG
FT                   TLIVNGNYQDGIVSKDDLKIWNGSVTVNAVDDCLRGKDSVRIGDPDDTDYSALDLKLTS
FT                   TSGDGIKSSGTDTGKGYVTITGGTVDITSKSGDGIQAEQTFTMNGGNVTINTYQGHGYT
FT                   GSGSSGGGGGWGGGMQDGNNNKVDLSVKGIKAVGLYDTDGTTYLSGGDLIINGGTLNID
FT                   STDDSLHCGGNMSINGGNITLASADDGMHSDHNLTIGESTTGGYDAPWINVTYSYEGVE
FT                   GLTIVQNCGTVMVTSKDDAYNAAGGADSSGMGGGWGGGWGGGSVGGGSYSMTFNGGYTF
FT                   VSAAGDGLDSNGEMIFNGGYVFVSQTGGGNGPLDCGDGYSITYNGGTVIAAGSSSMFEY
FT                   PSNKAFLSTTSVSAGSTITFTNASGTVIATFTLPNASQEMVLCSTESNVSCYTGGTLSG
FT                   VTYFGSQDGTNRCGYGGTISGGTSVSESGGGGNRPWG"
FT   CDS             complement(16462..17562)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16301"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9K6"
FT                   /protein_id="CBL16301.1"
FT                   /translation="MPTETEQRFPRTGHSSQSDIDSLLAELGYHQPPRREEPTPPAQKP
FT                   EPQPIREAAAPAKKEKPRKKTEPKPEPKPVKIIQEPADPPLLDIPIQHAKPLVKDTPPR
FT                   KPHSKSKKAQPALLKTLQSALDENIEEIELLTKLPVAEGTSPSEARRHRRRQILYFFIG
FT                   VFFLFAAVLGCIQISKSMRQRFAGFANNETQKQDFADFLEPVVVMDIADFDSVSDLDPD
FT                   QILSAAIWDFMIHGDMDKYEHTMDIVTVPAIDIEAHAAKLFGEGLSFSHHTIGTGDMRF
FT                   YYNSDNKSYNIPAAPSYFSYTPLVEQISKEEDRYTLTVAYKEEVPSWQKHDSAAETAKE
FT                   MEFVLQELNGAYILRSAKNISTEGTL"
FT   CDS             complement(17596..18843)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00210"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /function="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16302"
FT                   /db_xref="GOA:D4L9K7"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9K7"
FT                   /protein_id="CBL16302.1"
FT                   /translation="MTDILELGKRAQAAAPAIAAAAPAVKNAALAAIADALIARTGEIV
FT                   KKNQEDIERAVANGMSQSMIDRLLLNPQRIVAIAASVRTLIDMDDIVGSVEHGTIRPNG
FT                   LQILKTRVPLGVIGIIFESRPNVTVDAATLCLKAGNAVILRGGKEALCSNAHLVAVMRE
FT                   AVESAGLPADVVQFVDDTSHETAEKMMRMNQYLDVLIPRGGAGLIRAVVEHASVPVIQT
FT                   GTGNCHVYVDDSADLEMAVNIVDNGKTQRPSVCNAVESLLVHKDIAQEALPLIKARLDQ
FT                   HKVVMHGCQTTRSILGPDVQPATEEDYAKEYLSYDISVKVVDSIDEAIAHISRYGTKHS
FT                   EAIVTRSLEHARKFQTQVDAAAVYVNASTRFTDGGEFGMGAEIGISTQKLHARGPMGLH
FT                   ELTTVKYLINGEGQIR"
FT   CDS             complement(19694..20647)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00230"
FT                   /product="Lactate dehydrogenase and related dehydrogenases"
FT                   /EC_number="1.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16303"
FT                   /db_xref="GOA:D4L9K8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9K8"
FT                   /protein_id="CBL16303.1"
FT                   /translation="MRLVILDWATMTAHEDLSPECFRPFADEIDCYSLTSPGEAAARIG
FT                   DAELVLCNKVPITGEVIEACPNLKYIGLFATGYNNVDIPAATARGIRVCNAGSYSTNAV
FT                   AQLVFAFMLDHFSKLPLYNLDVRQGKWCTSPTFSYFPYPTMELAGKTLSVIGFGSIGKA
FT                   VAKIADAFGMQVLVSTRTVPAHAPYPMVTLAEAFARADVLTLHCPLTEDTRQLVNAIRL
FT                   GSMKPSAILINTARGGVVAEHDLAEALNNDVIAGAYLDVLQQEPMNPDTPLRHAKNCVI
FT                   TPHIAWAPLETRQRLLGIVTDNLQHFLAGNPQNLVN"
FT   CDS             21171..21569
FT                   /transl_table=11
FT                   /locus_tag="RUM_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16304"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9K9"
FT                   /protein_id="CBL16304.1"
FT                   /translation="MCCLKSGCPAILLSILGGVGAALLYYFDFLTLTVAAPYVVPIALV
FT                   LIVIAATAAIASAACSVMCLRAAVCRYGLCLLYGAVVLLTVALLSFLLTNVPLLPFVLI
FT                   GAIAAIFSVIMLLSLITAIVRCICPRCS"
FT   CDS             complement(23872..25854)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00270"
FT                   /product="Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16305"
FT                   /db_xref="GOA:D4L9L0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9L0"
FT                   /protein_id="CBL16305.1"
FT                   /translation="MAKKQADYGNESITMLKGADKVRKRPGVIFGSDGLDGCEHSVFEV
FT                   ISNSIDEARAGFGDHIIVTRYQDQTIEVQDFGRGCPVDYNNTEKRYNWELVYCELYAGG
FT                   KYDAEGDTYAYSLGLNGLGLCATQFASEFMDVEIFRDGFRYNLHFEHGNNVGGLKKEPT
FT                   TQKKTGTRTRWKPDLDVFTDIQIPDEFFHDILRRQAIVNPNLLFTYRSQSEDGSFSVRE
FT                   FRYENGITDYVQEIVGDKAMTSIQHWQCEKKGRDRADKPEYKVRINVALTFSNQIKLTE
FT                   FYHNSSFLEHGGSPERAVRQAFVSQIDSYLKQNSKYLKNESKITYPDIEDCLVLVSSGF
FT                   STQTSYENQTKKAITNKFIYEAMTEFLKHQIEVYFIENPDEATRICEQILVNKRSRENA
FT                   ERTRLNLKKKLAGTIDLSNMVQKFVDCRTKDTARRELYIVEGDSALGSVKLAREAEFQA
FT                   VIPVRGKILNCLKADYAKIFKNEIITDIIKVLGCGVEVRTKANKDLSSFSLENLRWHKI
FT                   VICTDADVDGFQIRTLILTMLYRLTPTLIDEGYVYIAESPLYEINSKDKTYFAYTEKEK
FT                   TKILSHLEGKKFTIQRSKGLGENEPEMMSLTTMNPATRRLIQVTSDEAEKTFAAFDMLL
FT                   GDNLQARKDFISEYGGDYLELADIS"
FT   CDS             26109..28283
FT                   /transl_table=11
FT                   /locus_tag="RUM_00280"
FT                   /product="Clostripain family."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16306"
FT                   /db_xref="InterPro:IPR005077"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9L1"
FT                   /protein_id="CBL16306.1"
FT                   /translation="MNYKRIAALLLAGSMLLSAGGCLDLEEESSGGGRNESVPQTTVNR
FT                   NTPTVTPTRETGTRLVAGQDGALTIQRSRRENAVPMGADGTWTIFVYMCGSDLETVDSS
FT                   GTEDMEEMLQASTGDRVRFVVQTGGAEEWTAGKVDPDKLDRFVIQDGNMEKVDSQPGAS
FT                   MGDGSTLANFLAWGTASYPAANMGLVLWNHGSGSICGVCFDELYEDDSLSLEEVGSALE
FT                   SVYPNMTDSFRFIGFDACLMATVETANLLVPHADYMYASEDTEPGYGWDYTAIGAYLGS
FT                   HPDADGAALGKLICDSYYDACVDCESEEEATFSCTDLSRLDTFMQSWNEAARQMYDLTE
FT                   QPERLAELVRGITTALNFGGNNKAEGYTNMVDAGCILKNSKSLLPGAADALAALEECVI
FT                   YQRNGERRQDASGLATYYPLCIQGSEELSVFRNVCISPWYLSFVDKIAYGADHEGMLDG
FT                   YQKDLWLGEDSLFWSQDALESAAWSWDYWNREQGTSIGLSGEDGEISVQYEVAPYMDED
FT                   GNYVFQLSEETLWETDSVYNCLYMILDDGRILDFGADDDVYVDWDTGEVYDGFDGYWFA
FT                   LPDGQPLAAYLAEADYDYNIYTAPITLNGVDTNLRIRQDYGADSCTTSILGVWDGIDAE
FT                   SGQAARTIRPLKKGDQIVPRYTAYDTDTWEESTFVGSDYVYDGDPALEEYILPDGDYYY
FT                   GFCINDIYGGETYTDYVVYNVEGEEVYYYE"
FT   CDS             28583..28855
FT                   /transl_table=11
FT                   /locus_tag="RUM_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16307"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9L2"
FT                   /protein_id="CBL16307.1"
FT                   /translation="MYTVICTSVLETRTAPDQSLTYEVVVHPVCVESHCALSYGIRIYN
FT                   DTRFAEQMDLTLSKREILEFLNLLARNTAQPEELHDLAEDFLASL"
FT   CDS             29433..33524
FT                   /transl_table=11
FT                   /locus_tag="RUM_00300"
FT                   /product="Cysteine protease"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16308"
FT                   /db_xref="GOA:D4L9L3"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9L3"
FT                   /protein_id="CBL16308.1"
FT                   /translation="MRKNPKLYSRTLSACIALLMTASCMPWSTVVSAVDLLRQNAGKEQ
FT                   ELTFVASPMQAQKAAKEQADGEVTEAVSITPYHAALLAEPDYEQILGENYQFPESYDLR
FT                   DYGLVTPVRNQGGYGTCWAHGILGSVETGLIEQDDQIDLSEWHLAYFTYWGDDTYGQFD
FT                   MESDIFDQGGWSITGLNALTRWFGPVHEETLPYEDDEIRSFSDEEKLALRAQAAYHVQD
FT                   AYINNSYLDYHSGKVTRSNENLKAMLMNGHSVSFTFNTSDYYYNAETEAYYTPYYTWGN
FT                   HIVLLVGWDDNYPKENFSEHAQPENDGAWLIKNSWGTGGAEDGYIWVSYEDQSANDYVV
FT                   AIAEASDNYESQQSHDTFGWLASIAPGNVPTKSSYLSTVLTAEADTEVCAAAFYTTDNG
FT                   TEYEITVYTDLQDPTDPTSGTASTVTSGSELYCGYHTIDLAQAVPVAQGEQYAIVVKLT
FT                   NPVNPYPIATEALITAQDGTGETSEMTPIVEGRLEANTDYGETFISTDGKTWTDAYMQQ
FT                   FDYTSYYQNDEEALDMIKGAEDDETASGDDSKVLVTLGNVCLKAFTNSENHVSFSQPEG
FT                   PVPFGTELTLTSNSAEEIWYQIDDGKEQLYTAPIVIDHAMSVTAWGVTGEKAGGRLTKE
FT                   YTQKTASLTGVTLYGGGTQQRCTLDPEEVIQVPQYVDAVKLSAGTLYQYEVNGKTYHAG
FT                   EQSDAIALGYGDQTIEITASGEGVLPKTYTLEIYRPYVTLDYRAEILYFNAEECTITDE
FT                   NGNVLESNCDVADLMGQTLTGQYGEETWEEYIPQRPQMNLNLSVMDYARQLLGPVDMDW
FT                   YYTYSDWLMLAHSEDFSDEQLARNFGTELIEEGVCAFLCEPGETYYFRIAATDSDFASE
FT                   SYSVTVPARPAAPTKKLTVESTDTTLQVSGVSGAEYCIVEKELATMEDLEEMIFIVAEL
FT                   SGISYDQALDMLYDRYGVTNKEELLDAINEPMFEEWTEESLFEYLIPGTDYYIGVRYAA
FT                   TENAFASELAYETFRTTGERPAVVIDYLAETLRFDEKTVQVSYTFDAYAYFENFEYLNE
FT                   NGELTFSESVEFNKGETLRFSAGSTSLSYFTGKSLNVSFTDDSTAPYTLEIPARPDAPA
FT                   YTLNYLEGRTEEVVGPDVVLFVGFYQYDEPDERTFYYDDMVTMGMLDEDGRLLLESCGN
FT                   GEISFYTVGASNRYFASAHSEPVLVPSAEWNVESKEIIYEIVDNVLKIRAMEHVEYQLS
FT                   QIVSDAGEEAVIYGWTTEPEFTLEPGPLYIVYARLQATEECIASGTVQFMVSTDFEPYF
FT                   LGNVNKDYKIDVADAVLILQDCANRLTGQDAVLDDTAQYYADVNSDGEVTVGDAVSVLQ
FT                   FRAQDLISPVTQWSDILAVG"
FT   CDS             33715..34968
FT                   /transl_table=11
FT                   /locus_tag="RUM_00310"
FT                   /product="serine hydroxymethyltransferase"
FT                   /function="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16309"
FT                   /db_xref="GOA:D4L9L4"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9L4"
FT                   /protein_id="CBL16309.1"
FT                   /translation="MYETMMDTIGFVEKYDAEVGEAMNKELVRQRRNLELIASENIVSP
FT                   AVMAAMGSVLTNKYAEGYSGKRYYGGCECVDIVEDIAIERAKKLFGAKFANVQAHSGAQ
FT                   ANTAVYFALLNPGDTVLGMNLAHGGHLTHGSPVNLSGKYFNFIPYGLGDDERIDYDKVE
FT                   ALAKEHQPKLIVAGASAYPRVIDFARLSEIAKSVGAYLMVDMAHIAGLVAAKQHPSPVG
FT                   YADVVTSTTHKTLRGPRGGLILTNDEELAKKINKAVFPGIQGGPLMHVIAAKAVCFGEA
FT                   LKPEFTEYQKQVVANAQALANGLVKRGFNLVSGGTDNHLMLVDLRPFDITGKELEHRLD
FT                   EVYITVNKNAIPNDPQSPFVTSGVRIGTPAVTSRGLGVTEMEQIAEFIYLAAKDFDANA
FT                   DAIRAGVGEICKQYPLYE"
FT   CDS             35043..36305
FT                   /transl_table=11
FT                   /locus_tag="RUM_00320"
FT                   /product="Recombination protein MgsA"
FT                   /function="Recombination protein MgsA"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16310"
FT                   /db_xref="GOA:D4L9L5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9L5"
FT                   /protein_id="CBL16310.1"
FT                   /translation="MTPLADKIRPTTLDEIVGQPHLLAPGKPLRRILERGQVTNMIFYG
FT                   PSGVGKTTLARIIASNSNMTLYKLNGTSASVGDIKEIIAQTGTLAGCNGILLYLDEIQY
FT                   LNKKQQQSLLEYIENGSLTLIASTTENPYFAVFNAIISRSTVFEFKPVTAKELEPAVER
FT                   AFRLMGQELGADCQPEDGVVSYIASGCGGDVRKAVNTVELSVLASETRDGVMPVTLETV
FT                   QQLTQRSNMRYDRDGDQHYDLLSALQKSIRGSDENAALHYTARLLEVGDLLSLVRRILV
FT                   IAAEDVGLAYPQAMPIVKACVDAALQLGLPEARIPIAEAVILLATAPKSNSAYLAIDAA
FT                   AADLQRGTTCEIPRQLQNKHFDGADAKVRGQHYLYPHDYPNHWVKQQYLPDELKDRVYY
FT                   QFGQNKQEQAARAYKELIQKK"
FT   CDS             complement(36289..37224)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00330"
FT                   /product="Ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16311"
FT                   /db_xref="GOA:D4L9L6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9L6"
FT                   /protein_id="CBL16311.1"
FT                   /translation="MNKFLPEGYRIQTEENKRAVSTPARLAEAMERGTILEGRVTICDS
FT                   SHNLWVELPGMQAVIPRKEGAVGIREGTTRDIALISRVNKPVCFVVTELTCDAAGAPLA
FT                   ILSRRIAQERCQAQYLDACRPGDILPACVTHLEPFGCFVDIGCGIPSLIPIDSISVSRI
FT                   SHPADRFTVGQQLRVIFKGREGKKILLTHKELLGTWEENAAQFQPGETVAGIVRSVENY
FT                   GIFVELTPNLAGLAELKPNVTVGQHASVYIKSILPERMKIKLILVDVFAPSVPEPAELH
FT                   YFIQDSHMDRWQYASAASTKSMESLFTSSV"
FT   CDS             complement(37296..37658)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16312"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9L7"
FT                   /protein_id="CBL16312.1"
FT                   /translation="MTLSANFSSIDTAEAALRRIRAACPGIHKIRILASPTHRIAGSGM
FT                   DRHLPGVFSIVPTRTTAMGNEFVTQVMSETLPSRHDPEPFLRESVTLQLSCLPGSAHQI
FT                   SGLLVAMGGSLVRTLS"
FT   CDS             37657..37758
FT                   /transl_table=11
FT                   /locus_tag="RUM_00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16313"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9L8"
FT                   /protein_id="CBL16313.1"
FT                   /translation="MKKAPFEVKYTESVRFLQIRDKDIVENHSRKIR"
FT   CDS             37857..38057
FT                   /transl_table=11
FT                   /locus_tag="RUM_00360"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16314"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9L9"
FT                   /protein_id="CBL16314.1"
FT                   /translation="MDIRPKDQLVMKKPHPCGGNVFFVIRSGMDFRLRCTTCGREFLIP
FT                   RSKIERHIRQVIRPEQDHAAE"
FT   CDS             38097..39182
FT                   /transl_table=11
FT                   /locus_tag="RUM_00370"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /function="bacterial peptide chain release factor 1
FT                   (bRF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16315"
FT                   /db_xref="GOA:D4L9M0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9M0"
FT                   /protein_id="CBL16315.1"
FT                   /translation="MFEKLQIMEQKFEEISQRLSDPAVTTDIAVYTQLMKEYKNLEPIV
FT                   QKYRAYKRSAQSMQEARELLDAGSEDPELREMAQAEFETEKEQLAEYAEQLKILLLPKD
FT                   PNDDRNVIIEIRGGAGGEEAALFANSLYRMYTMYAESRGWKQEVLSANPTELGGFKEIS
FT                   FSITGEGAYSRLKYESGVHRVQRVPETESQGRIHTSTVTVAVLVEADEVELAINPTDLK
FT                   IDVFRSSGAGGQHINKTESAVRITHLPTGLVVECQDERSQFKNKDRAMMILRSRLYERM
FT                   QQEQQDKIASQRRMQVGTGDRSERIRTYNFPQGRLTDHRIGLTIYRLEDVMNGNLDEVL
FT                   DALATADQAAKLAMQQAEGEA"
FT   CDS             39203..40228
FT                   /transl_table=11
FT                   /locus_tag="RUM_00380"
FT                   /product="translation factor SUA5"
FT                   /function="translation factor SUA5"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16316"
FT                   /db_xref="GOA:D4L9M1"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9M1"
FT                   /protein_id="CBL16316.1"
FT                   /translation="METELLTPDEAGLQKAAGLIREGQVVGMPTETVYGLAADATNRDA
FT                   VAKVFAAKGRPMDNPLIVHISSMEELEQAVSRVPELVASLADAFWPGPLTMIMPKSELI
FT                   PMETSGGLDTVGVRMPSHPVAQALIRIAGVPIAAPSANRSGYPSPTTAQHVLADMQGRI
FT                   PAILDGGACSCGLESTVVAFDDDRTVRILRPGFVTKEMLLEHVPNVVIDPAIFRQVSAS
FT                   EKVASPGMKYKHYAPNAAVTLVEGSPELFRQFLALQQADGVYALIFDGDAEQFPYPHMT
FT                   YGGTSIEQGRQLFARLRELDQIGAKTVYVRMPQKDGVGLAVYNRLIRAAGFDIVHLSPR
FT                   I"
FT   CDS             40947..42374
FT                   /transl_table=11
FT                   /locus_tag="RUM_00400"
FT                   /product="Aspartyl aminopeptidase"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16317"
FT                   /db_xref="GOA:D4L9M2"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9M2"
FT                   /protein_id="CBL16317.1"
FT                   /translation="MSKDKQEKGGKNAAKELKKALFYQKEHGCKRMSESELKKCDKFSE
FT                   KYKAFLDAAKTEREANAYAIALLEKHGFTEYHTGMKLKAGDKIYRNNRDKAVLAAIIGT
FT                   EDIAKGVRICAAHIDSPRLDLKQVPLYEDHELALFKTHYYGGIKKYQWTTIPMALHGVI
FT                   VKADGTKITVNIGEDEQDPVFCVSDLLPHLATEQMKRPLAQGVKGEELNLLVGSRPFLD
FT                   GEESSAVKLNILHILYEKYGITEADFLSAELEAVPVSKARDVGFDRSMIGSYGHDDRVC
FT                   AYTALMATADCKDPRYTSVLVLTDKEETGSDGNTGLCSSYLQYFIADLAAAFGQEARTV
FT                   LSHSRCLSADVNAAFDPTFPDVLDPRNAAFLNYGVVVTKFTGARGKSGTSDASAEFVAT
FT                   IRNLMDENQIIWQTGELGKVDMGGGGTVALYIANMDVDTIDVGVPVMSMHAPMEVVAKI
FT                   DVYMAYKAFLAFISDKT"
FT   CDS             42506..43357
FT                   /transl_table=11
FT                   /locus_tag="RUM_00410"
FT                   /product="Sporulation factor SpoIIGA."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16318"
FT                   /db_xref="GOA:D4L9M3"
FT                   /db_xref="InterPro:IPR005081"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9M3"
FT                   /protein_id="CBL16318.1"
FT                   /translation="MKLVMVMYIYVDVLLILNLYVNYFLLLATGRLMHLPCGRKRCIAA
FT                   AAVGSLCALTIFLPPMHWALCTLLRFAMGVPVVWICFGRRMRLRDVVCFFVVSMGFGGA
FT                   MLAVSLWRRPVGMAFNNASLYLDFSPACLLICTVAAYALTCGIRFLVDRSTMTQGHYRV
FT                   VIRYGPRVIGMEALADSGNLLMDRLSGKPVILCGGAELEQLVQLEGNLTDPAAYAAMAM
FT                   HCKGMRLIPCATVTGSGVVPVFAPDEVLICEACSGARKPVDALIGIQQERDGAIFNPKL
FT                   LI"
FT   CDS             43396..44094
FT                   /transl_table=11
FT                   /locus_tag="RUM_00420"
FT                   /product="RNA polymerase, sigma 29 subunit, SigE"
FT                   /function="RNA polymerase, sigma 29 subunit, SigE"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16319"
FT                   /db_xref="GOA:D4L9M4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014200"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016263"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9M4"
FT                   /protein_id="CBL16319.1"
FT                   /translation="MIGNLYRRLVQWLTGRGGVYYINGSDTLPPPLSKEAEAEAFARLG
FT                   TGDAESARQTLIVHNLRLVVYIAKKFESTGIGIEDLISIGTIGLIKAVNTFCPEKNIKL
FT                   ATYASRCIENEILMFLRKTSQYRSEISIDEPLNIDWDGNELLLSDVLGTDEDIVNRGIE
FT                   AEAEKSVLRQAVDGLEPREKRIMQMRFGLLGGREKTQKEVADEIGISQSYISRLEKKII
FT                   RRLKTEMDRV"
FT   CDS             44181..44960
FT                   /transl_table=11
FT                   /locus_tag="RUM_00430"
FT                   /product="pantothenate kinase, type III"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16320"
FT                   /db_xref="GOA:D4L9M5"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9M5"
FT                   /protein_id="CBL16320.1"
FT                   /translation="MILTVDVGNTNIVLSVYDQEQRLFTSRMATQASKMEDEYAVDMMN
FT                   LFRLYGCESASFEGAILSTVVPQLVGVLRRAIDRVCSCRVYVVSSGIKTGLNIKLDNPG
FT                   VVGADLVCGAVAAKRRYPMPCIIFDLGTATTISALDASGAFLGGSIFPGVQVSLHALST
FT                   ATAQLPHIDPDAFHDVIIGTNTIDSMRSGVILGNASMMDGMIERYRSVLGQEATVVATG
FT                   GMAELILPYCKTEGIVLDTDLLSDGLYMLYKLNSKSE"
FT   CDS             45006..45623
FT                   /transl_table=11
FT                   /locus_tag="RUM_00440"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16321"
FT                   /db_xref="GOA:D4L9M6"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9M6"
FT                   /protein_id="CBL16321.1"
FT                   /translation="MEETIKNSGAQKLDVKRLTVLAMLAAVIVLMAFTPIGYLKVGAVS
FT                   ITFIMIPVVIGAVVTGPRGGALLGAVFGITSFIQCFGLDTFGTAMMSINPVFTFLLCMV
FT                   PRVLMGLLAGMIYKGMCKATKNGILPFAVSCLSGAVLNTVGFVGLFLLLFYNSITALLG
FT                   TDTVAGAIGLLVTGNALIEAGVCLVLGTAIAKGLVHVLPRNK"
FT   CDS             46016..46825
FT                   /transl_table=11
FT                   /locus_tag="RUM_00450"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16322"
FT                   /db_xref="GOA:D4L9M7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9M7"
FT                   /protein_id="CBL16322.1"
FT                   /translation="MATMELEKTLPSAENNVEIMLDQVGMVYQNADGKDVTALTSVSLD
FT                   IQKGEFVSLLGPSGCGKTTLLRIIADLLQPTSGTVQIGGETPRAARLKQRYGMVFQSAV
FT                   LYDWRTVRKNVMLPLEIMKVPKADRIERADKMLKLVGLTDFADHYPRQLSGGMQQRVGI
FT                   ARALAIRPEILLMDEPFSALDEFTREKLHVDLLRIWRKTNKTIIFVTHNIQESVFLSDR
FT                   VCVLSPHPGRLSAVVNIDLPRPRTMEMKETPEFTALVAKVRNSFEGV"
FT   CDS             46853..47662
FT                   /transl_table=11
FT                   /locus_tag="RUM_00460"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16323"
FT                   /db_xref="GOA:D4L9M8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9M8"
FT                   /protein_id="CBL16323.1"
FT                   /translation="MKRLKRFFRSGTMVTLVWVLGIAAIWEGFAYYVAQTKRTPLNVLP
FT                   HLWQIIGSFFSDKMITGQMTMIQLIGNSCAETLSRAAIGFLIGTVLGYLLALLMNLSGI
FT                   VEKIAFPYLMIIQMIPILGMAPIILAITGDINTSRIVIAAILTFYPVSTNTLAGFKAVE
FT                   KEKHELMYSYAASKFQHYIKTIIPSSIPYFFTGLKISAPMAITASILVDTLQGGNGLGC
FT                   MLSQSLKGGMSRLVFWDIVLISAVIGILSFYLMGLLEKLICPYKRKS"
FT   CDS             47676..48479
FT                   /transl_table=11
FT                   /locus_tag="RUM_00470"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16324"
FT                   /db_xref="GOA:D4L9M9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9M9"
FT                   /protein_id="CBL16324.1"
FT                   /translation="MKQLKRLAHMAPNVLLPLGVAVLLVILWQTQVLHKLLGTDTITLP
FT                   LPTRIGEIISQNTAAIGQHVEITLTVALGGLLLGSLLGYGIAVIATIFPKWGAGGLTIV
FT                   SAFNAIPIVALAPVINNWTRDFSNDVSTRSTFAKILVVTIFCTASMSVNAFRGLTELKP
FT                   FSEDLMKTYAARHTTVFAKLRLPNSVPYVFTALKVSVPASVIGALVSEYFAEDTVGVGR
FT                   QIRENIVKGQYPTAWAYIAVACLIGISMYAILMLAEHFILKRRKG"
FT   CDS             48525..49649
FT                   /transl_table=11
FT                   /locus_tag="RUM_00480"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems, periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16325"
FT                   /db_xref="GOA:D4L9N0"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9N0"
FT                   /protein_id="CBL16325.1"
FT                   /translation="MKHRKTSAFALVAVLAMVQLTACGTAQSSESAPGSAATGSSAASS
FT                   SAGGESSEEIIKAASAAGKIGNWGLGNEYEIQALLTKYGLPTDYITQDFTMDQFDSDAV
FT                   TLASAMTYNELGLVVNGYDGGYNYGDSVATIDMNDEGVAMLEDNLFCSKAFAQSNPNTV
FT                   KAFVSASMKGWYYACEHPDEAAQIVFEAGSSVSADHQAYMAKEVAKLVTTDMKGNTVSA
FT                   DKVGQMQDEAMQQTLDLAKKYIILEDASAKEKLQSLTLDDIRSTDYLTYDKDKDGAVEK
FT                   SAVSVQLKWLPQAQFMGYYVAKAKGYYDEVGLDVTIVSGGGDISETTAVYNGTVDFGVT
FT                   WVSNLINADAGGMDLLEVAQVYQRSGLVLVYKKK"
FT   CDS             49776..51128
FT                   /transl_table=11
FT                   /locus_tag="RUM_00490"
FT                   /product="dihydropyrimidinase"
FT                   /function="dihydropyrimidinase"
FT                   /EC_number="3.5.2.3"
FT                   /EC_number="3.5.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16326"
FT                   /db_xref="GOA:D4L9N1"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9N1"
FT                   /protein_id="CBL16326.1"
FT                   /translation="MDLIIKNGTVVTPSGMYKADVGVQDGKIVEIAASIPAEAKEVVDA
FT                   AGKLVLPGAIDGHTHLAMPFGGTISSDDYFAGTRAAACGGTTTVFDFAMQDFGESMVDT
FT                   IKRRDAMCAPDAAVDYGFHVAVKDVSGGLLDTMAEAVAYGVPTFKVFMVYDFGVDDGVF
FT                   YQVLEKAKSCNALIEVHAENRDIIAARTKEFLAEGKTDAWYHYLSRPEFVEAEADMRAI
FT                   QWAKSLDAPLYIVHLANKQGVEAVTKAQQEGYEIYAETCPQYLEFTSEVYKRPDGRNFI
FT                   CSPPMKGEESRQALWNAINTGVISTLATDHCPFQSYEKDWGKDDFTKVPNGCAGIENMY
FT                   PYMLAAANAGKITFEKAVELCAANPARIFGCKDKGAVEVGKDADLVIYDPELDFTITND
FT                   KMHSDCDHTIWEGVSLHGYPIATYSRGRLVYRDGEFVGERGWGRFVKRSRI"
FT   CDS             51166..52626
FT                   /transl_table=11
FT                   /locus_tag="RUM_00500"
FT                   /product="dihydroorotate oxidase B, catalytic subunit"
FT                   /function="dihydroorotate oxidase B, catalytic subunit"
FT                   /EC_number="1.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16327"
FT                   /db_xref="GOA:D4L9N2"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9N2"
FT                   /protein_id="CBL16327.1"
FT                   /translation="MLNICNEAARCLLCGDAACTAACSKGYDPAGMLRSIRFGNPAGAV
FT                   WKVDGTGCASCDGACEQACRHYDFPLRIRQTAAALPKRRAKPDLNRLATDFLGVPCENP
FT                   FFLSSSVVASGYDMCARALSMGWAGVVFKTIGLFIPQEVSPRFDAIGKEDTPFVGFRNL
FT                   EQISDHDPEENFETLRRLKEAFPEKVIVSSIMGRNEAEWTELARRSEQAGADIIECNFS
FT                   CPQMCGNGLGSDVGQDPELVRAYTAAVRKGTRLPILAKMTPNLAHMELPAIAAVEAGAD
FT                   GLAAINTVKSITGVDLDSMASLPQVDGRSAVSGYSGKAVKPIALRFIYDMASCDRLKGV
FT                   PISGMGGIETWQDAAEFLALGCGNLQVTTAVMQYGYRIIEDLLYGLADYLEGKGFASVE
FT                   QLVGAGVGKIVPAEQLNRSTLVYPKFDQSRCIGCGRCCISCEDGGHQAITLRKGKPVLD
FT                   AARCVGCHLCRLVCPMGAIGVSRRIPKP"
FT   CDS             52650..53810
FT                   /transl_table=11
FT                   /locus_tag="RUM_00510"
FT                   /product="Purine catabolism regulatory protein-like
FT                   family."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16328"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9N3"
FT                   /protein_id="CBL16328.1"
FT                   /translation="MPISLSRLCENTEKSYQLRLIAGRDGLDNPVRWVHMIEDPEVTGF
FT                   IHGNELVFTTGIRQRGVDWLLDFVVNLREHGAVGLVVNLGPYITSIPPQVIVYCEQNAF
FT                   PLFTIPWEEHIIDVTYDFCHRIVSSEEIETSVAAAFRNLIFSPEKEDGYRTAMLRSGFH
FT                   NESSYTIMALRLKTTRKIRKLSDLWKQYSFSMGRILKKSAYPACVFQQENNLILVRQKS
FT                   SPAEMKRLYTAIQRLLDKQDSLFAGISTVEEGWGKVPELYSEAVSALTVACQRRVPCME
FT                   YADLGIYKVLFGVRDTSILSDYVKSTLGVLMEYDRKNNTDYVQTLRVYLDSNGSVQQVA
FT                   QKLNFHRNTVNYKMKMIREILQTELRDTDKMNYMLAFCIMEMLDAV"
FT   CDS             53828..55162
FT                   /transl_table=11
FT                   /locus_tag="RUM_00520"
FT                   /product="Adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16329"
FT                   /db_xref="GOA:D4L9N4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9N4"
FT                   /protein_id="CBL16329.1"
FT                   /translation="MGKLSGEQVKAYHKQYNLQSWSKQGSINPIPVEKAEGIYIWDYEG
FT                   NRYTDMSSQLVNLNVGHGNRRIIDAIKEQAEQFCYMAPSYAVESRSLLAKMVIDRMPDN
FT                   MGKVFFTNGGADANENAIKIARMYTGRNKIFSRYRSYHGSTFGAGNLTGEPRRYPLEPG
FT                   IPGFVKFFDPYLYREQLPFESEEAASAYYVGKLREQICYEGPDSVAAIVMETITGSNGV
FT                   IIPPKGYLPGVRKICDEFGIMMICDEVMAGFGRTGKLFAFEHFDVKPDIVSFAKGITCG
FT                   YVQLGGVCVSKEIAAYFDDHLLSCGLTYSGHPLACAAGVACLEYYDEAKILDNVNAVGK
FT                   VLGELLEQLKETHPCVGDVRYIGLFSSIELVKDKGTREPLVPYGKDPEGIMGKIIGMLR
FT                   AKGFMTYSHENMLFVSPPLIITEAQLREEMEKMDQVLTQVDQTML"
FT   CDS             55175..55567
FT                   /transl_table=11
FT                   /locus_tag="RUM_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16330"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9N5"
FT                   /protein_id="CBL16330.1"
FT                   /translation="MSPKSYQHAERIPLAQLIETNRFRLVMHAQFEQPCGLSELPVELE
FT                   LSAGFAGKLPFPVPWDKWLYGFVRVNEFLGRLRQEKQVQGISLHDWGDQFLVLLDAPTG
FT                   EIPYFVGRNEVAQLLADCLKPPELRK"
FT   CDS             55628..56890
FT                   /transl_table=11
FT                   /locus_tag="RUM_00540"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16331"
FT                   /db_xref="GOA:D4L9N6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9N6"
FT                   /protein_id="CBL16331.1"
FT                   /translation="MYVCSKERMTDKIRTFSKFGDAGHGGITRYSLSPEAIQARNEFIR
FT                   RMKAIGAEIEIDDVANIYATLPGSAPDAKRIVMASHCDSVKNGGNYDGILGVMSAMEVL
FT                   ETVAAEKIPHKHPLTAMIWTNEEGSLYPPAMMCSGIVCYDYLPEDIRAKFRYEDMMASK
FT                   SILDGSKTFGQALDASGFKGDKKYRLSPDRYLYMFETHIEQGPILEDNGKDIGVVDCVL
FT                   GMFNYRLKFYGQTTHAGTFPMPKRRDAFLAASLALCYLHEEIDKLGYPELVYTTGEVVC
FT                   HPCVHTCVPDYFDFSFDARHEDPKVLEQVLAIVKGCADKTWAGCTCKVEKAWNRDTVYW
FT                   NKKLVGYVKAAAEELGVSHQYIHSGAGHDAQFASYMLPTTMIFVQSKDGLSHCEPEYSS
FT                   PEHCTEGASVMLNAVLKADAE"
FT   CDS             56904..58061
FT                   /transl_table=11
FT                   /locus_tag="RUM_00550"
FT                   /product="Alcohol dehydrogenase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16332"
FT                   /db_xref="GOA:D4L9N7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9N7"
FT                   /protein_id="CBL16332.1"
FT                   /translation="MSRAFIVPRQILTGSGALEAAAPLLGSMGTHALIVTGQIVVTLPC
FT                   FQSLTGLLEAQGVQYTVFTGITDEPTDRMIEAGTAAYRDHGCDFLIGIGGGSPLDAMKA
FT                   IAVLAACGGSITDYMGKEISGKLPPMAAIPTTAGTGSEATQFTVITDSEQGIKMLLKGQ
FT                   VLVPQLAVVDPALSVSAPKRITAATGLDALTHAIESYTSRKRQPLTDTVALAAVKRIFR
FT                   YLPTAYSNGSDLTARSEMVIAALEAGMAINNASVTLVHGMSRPIGALFHVPHGISNAML
FT                   LEKCLDFALEGDYPGFAALARAIGAADTATPDPQAAEALIGAVRELCKTCQVPTLEEYG
FT                   IDRTAFFSAMDKMAEDAIASGSPANTMKPVTKADVIRIYRSLWDR"
FT   CDS             complement(58083..58433)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16333"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9N8"
FT                   /protein_id="CBL16333.1"
FT                   /translation="MLFTGISKTFSTEQEQQYAAIGAFWDELATIYGREQLQGLGYHWT
FT                   AKSIEYVIGLKQGEIPGANCTVTLPDQHWQYATGRTEQLGMLYARIYQKGALLYEIETF
FT                   DDSGNCCIAYYR"
FT   CDS             complement(58504..59586)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00570"
FT                   /product="RNA polymerase sigma factor RpoD, C-terminal
FT                   domain/RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16334"
FT                   /db_xref="GOA:D4L9N9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9N9"
FT                   /protein_id="CBL16334.1"
FT                   /translation="MAEKNESIDALIERAKASGKLSTRELNDAFERFDLDAEQIDSFYE
FT                   TCINNNIEIVEDFMPDTDLKLGLDSDLSDDLEMALSTEGIAIDDPVKIYLKEIGRVPLL
FT                   SAEEEIELAQRMSKGDSYAKKRLSEANLRLVVSIAKKYVGRGMQFLDLIQEGNLGLIKA
FT                   VDKFDYTKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETITKVKKIISQLLHET
FT                   GHEPTADEIAERLEMPVEKVREIMRIAQDPVSLETPIGEEEDSHLGDFIPDDDAPAPAE
FT                   AASLILLKEQLNEVLSTLTEREAKVLKLRFGLEDGRSRTLEEVGREFEVTRERIRQIEA
FT                   KALRKLRHPSRSKKVKDFLD"
FT   CDS             complement(59598..61343)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00580"
FT                   /product="DNA primase, catalytic core"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16335"
FT                   /db_xref="GOA:D4L9P0"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9P0"
FT                   /protein_id="CBL16335.1"
FT                   /translation="MPLPDEFIYQLKLANPIDTTMGRYVHLIRSGSNYKCLCPFHSEKT
FT                   PSCTVYTGTQSFYCFGCGAGGDVITFTKQIENLDTYEAIKLLAERGGLEMPENDLNKDG
FT                   AKLKLRILEMNREAANFFYRNLLQGQDKRGLQYAVQRGLTPKAIKKYAIGYAPAAWDGL
FT                   MKHLEGLGFTREEMLSAGLIRQNARGCFDFFRERVMFPIIDLRGNVIAFGGRLIEGEGP
FT                   KYLNSGDTPVFKKSRNLFSLNFAKNANVKQLILAEGYMDVIAINQAGFEQVVATLGTAL
FT                   TAEQARIMAQYATEVVLCYDSDSAGQNATHRAINLLSEAGLHTRILKVQDAKDPDEYIR
FT                   KFGATRFKLLLDNSGGAINFELARCREGLDLATEQGKIDFLRRTVQVLAGIRNEMEREV
FT                   YLSRIAKEEEISLDILHSQVKAQLRKSYYTEKKQSWNAMMAKSSFRDELNPEAPQYQRE
FT                   AKAEEQILAYLFLHPDLLPEVEKRLKPEHFFTSLHRKIYEVFCERMPETDTFSVSMFRD
FT                   ACSDAEMGRITGIMAHNAEVALTADTLNDCIRLLLQAKEHEKINADQLSDDDLLSIVNQ
FT                   ARNKN"
FT   CDS             complement(61348..62343)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00590"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase,
FT                   putative"
FT                   /EC_number="3.1.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16336"
FT                   /db_xref="GOA:D4L9P1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9P1"
FT                   /protein_id="CBL16336.1"
FT                   /translation="MTIREQTEILELGTLSPYACTCVGNAKRSRPEPKCPYRTEFQRDR
FT                   DRILHCNAFRRLKRKTQVFLSPVGDHYRTRLTHTLEVAQIARTIARALRLNEDLTEAIA
FT                   LGHDLGHSPFGHSGEAILDEICPYGFKHYLQSVRVVHYLEKKGQGLNLTFEVKNGIACH
FT                   TNKIAATREGNIVRLSDKIAYINHDIEDATRAGILTPADLPSHLTAVLGTDKSQRITTM
FT                   VASVIENGPDEIRMTKPIKAAHDALRTFLFSNVYTNPVAKAEEEKAKGLVEKLYGYFIK
FT                   HPEKMPDEYKQILRRFDLHRAVCDYISGMTDGYAVDLYQQIFIPQSWGSR"
FT   CDS             complement(62429..63061)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00600"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16337"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9P2"
FT                   /protein_id="CBL16337.1"
FT                   /translation="MKYKTIAAPCTRTLIEKRSEFIAAVTPVQTAEQAIACIQDAHAAY
FT                   RKARHHVYAYVLRDQNISRYSDDGEPQGTAGLPVLDVIRKQGLTDVCCVVSRIFGGVLL
FT                   GANGLVRAYGQACAQALRDAQIMEMCACRSMTIQCDYTFYGRLQFALASDPVIITDTQF
FT                   TDAVTVTLLVLEEQAQSLCDRLIDLSNGTITVSLEDAGYRDFSSVLP"
FT   CDS             complement(63113..63316)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00610"
FT                   /product="LSU ribosomal protein L31P"
FT                   /function="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16338"
FT                   /db_xref="GOA:D4L9P3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9P3"
FT                   /protein_id="CBL16338.1"
FT                   /translation="MKEGIHPKFEECTITCHCGNVMKTRSTVGDIKVEICSKCHPFFTG
FT                   KQKLVDTGGRVDRFKKRFNLDK"
FT   CDS             complement(63451..65172)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00620"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.2"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16339"
FT                   /db_xref="GOA:D4L9P4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9P4"
FT                   /protein_id="CBL16339.1"
FT                   /translation="MNTMEKDLYHLWCEKAVDDADLQIELKQIADDADAIQDRFYRDLA
FT                   FGTGGLRGVIGAGCNRLNIYTIRRATQGLADYVNADFQNPSVAIAYDSRIKSTVFAQTA
FT                   AAVLAANGIHVHIYKELMPTPMLSFAVRQLHCDAGIVITASHNPSKYNGYKVYGSDGCQ
FT                   LTLDAAQRVTDYIEAHQMFDDVKTITFEEGLANGMISYIEQDVLDAYFENVLKQGIHTD
FT                   LCASSGLKVVYTPLNGTGNKPVRTILKKIGITDVTVVPEQENPDGHFTTCPFPNPEIRE
FT                   ALALGLKLCETCKPDLLLATDPDADRVGIAVPDGNGGYALISGNEMGAMLFEYICASHT
FT                   QMGTMPKNPVVVKTIVTTDLVRAIAKEYGVEVIEVLTGFKFIGEQIGFLEKKGEESRYV
FT                   FGFEESYGYLAGTYVRDKDAVVASMLIVEMAAYYRTKGITMIQARDALYEKYGMFLHSQ
FT                   QSFQFEGESGMLKMQQIMDQLRNDPPKTIGGLPVTNIADYEQSISTCVETGAVTKLTLP
FT                   KSNVLAFTLTDGASVVIRPSGTEPKIKAYYTTTGKDRASAAALEAKLQEDFSGLLQ"
FT   gap             65406..65738
FT                   /estimated_length=333
FT   rRNA            65921..67414
FT                   /gene="16S"
FT                   /locus_tag="RUM_R_24670"
FT                   /product="16S rRNA"
FT   tRNA            67526..67601
FT                   /locus_tag="RUM_T_24220"
FT                   /product="transfer RNA"
FT   tRNA            67612..67688
FT                   /locus_tag="RUM_T_24230"
FT                   /product="transfer RNA"
FT   rRNA            67895..70725
FT                   /gene="23S"
FT                   /locus_tag="RUM_R_24660"
FT                   /product="23S rRNA"
FT   misc_RNA        70106..70214
FT                   /locus_tag="RUM_24690"
FT                   /product="Pseudoknot of the domain G(G12) of 23S ribosomal
FT                   RNA"
FT   gap             70773..71117
FT                   /estimated_length=345
FT   CDS             complement(71154..72824)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00630"
FT                   /product="hydroxylamine reductase"
FT                   /EC_number="1.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16340"
FT                   /db_xref="GOA:D4L9P5"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9P5"
FT                   /protein_id="CBL16340.1"
FT                   /translation="MGNNMDLNYEMFCYQCEQTAGGKGCTKLGVCGKTPEVAGLQDLLI
FT                   YQLKGISCCQKILMDRGEKPAEDIVRFVESVLFTTLTNVNFDAAVHVELLLQSQQIKEQ
FT                   LRQAVGEAPEVAQVSYNLPETQAKMLRDAPMAGIMYDRDLDPDIRSLRQTILYGLKGIS
FT                   AYGHQARELGFHSEQVDAFYFLALEAITDDTLSVEELIRWTMRTGEIALEVMKVLDDAN
FT                   TQTYENPSPRMVNTRLKKGSFIIVSGHDLKDLEQLLQQSEGSGVNIYTHGEMLPCHGYP
FT                   GLKKYKHLAGNFGGAWQEQQKQFDNLPGCILMTTNCLMRPRESYKDRIYTTNVVGWDGV
FT                   KFIPRKENGEKDFSEIIAHAKALGGYPEDAPPHEILVGFGHHATLEHAEEIVAAVKAGK
FT                   IRHFFLIGGCDGARPGRNYFTEFAKLVPQDCVILTLACGKYRFNKLDFGTVAGLPRLLD
FT                   VGQCNDAYSAIKIATALADAFDTDVNCLPLSMIISWYEQKAVAVLLALLSLGIQNIYLG
FT                   PELPAFFSPNVLQYLADTFQIHQISEPQDDIKTCLKQTI"
FT   CDS             complement(72997..75312)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16341"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9P6"
FT                   /protein_id="CBL16341.1"
FT                   /translation="MSFTIKNGTIVHYEESGTLEKLKLKKTAEAVATPAKATRIGDEAF
FT                   LSAGLVRINVSSGVTDIGDKAFSLCKHLQTVSLPNTVQHIGKSAFDGCTELQTLTIPDS
FT                   VTSVNAWAFHGCTGLTELTLPTNLTRIERGICSGCKSLTELVIPPGVTSIGMRAFEGCS
FT                   SLKHITLPATVRSIEPEAFADCTELVHIYMQNGVQEIGEDAFRGCMHLREIFVPPSVTA
FT                   LHPYAFGDHPERLHLIAAQSNSVAFQFAQMHRIVTYTERETAQLRTVQDPAFEIEYGIV
FT                   RRYIPQPGIRNVIVPPGVIAIGDRAFEKCRDIDTVLLPEGVQVIGSFAFSGCKSLKLIT
FT                   MPQSLNRIRNHAFRECTALQTIQIPPLVEKISKNTFHSCTSLRSVQIPPTVRIIEESAF
FT                   QYCMSLLQAVLSPALKTISKSAFESCSSLQSVIIPEGVEQIDTHAFYCCSCLRQITIPT
FT                   TMRTIDPNAFAETPFADRGTGHYKIGGFLIRGDVSQPIPPDTYRIGPKAFAHSNLQCAM
FT                   LPQGLHSIGESAFAHCTYLTQVSIPDSVEDIEDNAFSYTPWLSAQTEPFTIVGKGLLLR
FT                   CNFQEENLTIPEHVRKICAYACEQLPIRTLMLPASMEVIGSGAFQSCPKLKTITLPASI
FT                   RHMGGYIFHDCRTLFRVNLCEGVPYIAQSMFSQCYALEQLALPISIQEIRQDAFFASGI
FT                   RKLVLPYGVQRIESGAFLRCKQLESLEIPFSVREIAENAFEEANKFHLHAPIGSYAQRF
FT                   SKKNAANFQFVPLDETQS"
FT   CDS             complement(75317..76228)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00650"
FT                   /product="conserved protein of unknown function
FT                   cotranscribed with Bmr (bmrU)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16342"
FT                   /db_xref="GOA:D4L9P7"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9P7"
FT                   /protein_id="CBL16342.1"
FT                   /translation="MKRIYFIYNLKSGKGTIRSKLGDVIDLCTKAGYEVTARSTQSRMD
FT                   ACTVAEYACLQNYDMIACSGGDGTLNEVVHGVMNSGMSVPIGYIPSGSTNDFSRGLGIP
FT                   RGIVNAAGWMLQGGRYVCDVGQFNDKYFMYVAAFGALVSVTYETPQQTKNVLGHAAYIL
FT                   NGITRLNTIRSYHMRVEYDGKCIEDDFIFGMVTNSASVAGMISLENFLLDDGVYEVTLV
FT                   KTPRNPLDLHKIVNSLLNIKEDLDTRQIKCFRASRIRFTSAEPVPWTVDGECGGDVTQA
FT                   EVINLKRAVTFAVGQQSNPEGT"
FT   tRNA            76451..76526
FT                   /locus_tag="RUM_T_24240"
FT                   /product="transfer RNA"
FT   CDS             complement(80894..81688)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00670"
FT                   /product="Predicted thioesterase involved in non-ribosomal
FT                   peptide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16343"
FT                   /db_xref="GOA:D4L9P8"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9P8"
FT                   /protein_id="CBL16343.1"
FT                   /translation="MILFCIPAGGTNPFAPWSRRLRADIRLHILDLPGRGRKIRQQPLT
FT                   DLNAILPTLAEEIRQTCGEGESYMLFGYCSGGIVAYELCRYMQQTGAPLPGQVFLFGIG
FT                   APDRLQSHGEGAADTPEFRQMLEQFFTPESMGSEAAAAQAADAYLSAYRQSPEVSFSQV
FT                   FPELSEETEFEKTQLLFLLGGALQQIAQDNTMLEQYRLRQQEPVVLPTTGILGFGTEDT
FT                   FVPKEDVLEWSRFFAASQTLAVPGDHYAILRQPEPFLARINQ"
FT   CDS             complement(81685..81933)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00680"
FT                   /product="Phosphopantetheine attachment site."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16344"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9P9"
FT                   /protein_id="CBL16344.1"
FT                   /translation="MNTQLQQEIRQLWCDNLGCPTAEEADNYFVCGGTSISAIRLLSAI
FT                   RDQLGVTLDYTELFEYQTLEALSRRIAAALTAKEEAV"
FT   CDS             complement(81930..82679)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00690"
FT                   /product="Predicted thioesterase involved in non-ribosomal
FT                   peptide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16345"
FT                   /db_xref="GOA:D4L9Q0"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Q0"
FT                   /protein_id="CBL16345.1"
FT                   /translation="MTSSRGKWFPTVLEHPDSSCRIFCFPHAGAGPTAYLEWLRYIPEE
FT                   TDFFPVAYPMREQRRRESMPDSLQLLGQQIAAENAALFREKPCILLGHCAGAAIAYETA
FT                   AALEAQGIIPNLLTVSAANAPCVPLTLSVDPQMELPQAAQVFKQFGFIAEPFASNEAYV
FT                   RCFVPVLLQDFILFQNYCGRKGQKLHCPILEIHGEEDPMIQPERLKEWELYTDQLTHMT
FT                   VPGAHFYFSPETLPRLMQAMLEKGQNQ"
FT   CDS             complement(82676..82924)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00700"
FT                   /product="Phosphopantetheine attachment site."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16346"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Q1"
FT                   /protein_id="CBL16346.1"
FT                   /translation="MNQEQLTKEIKEIWMEILESEEELGTEESFFEVGGNSMLATMMVE
FT                   NINDRYGCGLELNDIYEYNTIVQLAEFVASHTQGAAE"
FT   CDS             complement(82940..84643)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00710"
FT                   /product="Beta-ketoacyl synthase, N-terminal
FT                   domain./Beta-ketoacyl synthase, C-terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16347"
FT                   /db_xref="GOA:D4L9Q2"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Q2"
FT                   /protein_id="CBL16347.1"
FT                   /translation="MYEQTIAVVGMGLRYPSAETKEALCSMLEQGISAPVGDHQARGDL
FT                   LGIPDYHQFLQSIRCIDHLDWFDNSYFGLVKPEVMEMPPELRLTMLCAAQTVMDGGYST
FT                   EKLSRRRCGAVVSHTTGSYRHLLPRTTFLSFFNNMPGMTCGYLAHYFRLNGPVYHLDST
FT                   CSSSLTAVAAACNHLLLGQADLMLAGGVQICLPINQQEARDMQSNVLSLGAEQRCIPFD
FT                   IHAAGFYSGEGAGFVLLERYEDAVKCGDHIYGIIRGYGMQSNADLSPTIYAPNAQAQLT
FT                   ALRQAWDMAGITREDLTEFEAHGAATKQGDAAEVQSMTQALTGRENPEPVYLTAVKSNL
FT                   GHTGCAAGITSLLKMLCAFQQHAVYPIAGFTEPAPELKLSEAHLEPVRRTIQMEPAKRR
FT                   IADIGSYGLNELNVHLVLENYIPEQDAPVPEESRTCFLKCSGCTEDALRLCLEQIRQAV
FT                   QETNQFGDLIYTLNCGREDLAYRCFLRFRDRQTLLEQLQDPDAVRVVKCRPMHGAAKAF
FT                   SDPAQLEQAYLTGDAIDWCSWYQNAGYRSIPTVTYPFAHKSIWPKVPEQS"
FT   CDS             complement(84654..85397)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00720"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16348"
FT                   /db_xref="GOA:D4L9Q3"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Q3"
FT                   /protein_id="CBL16348.1"
FT                   /translation="MAERKCALVTGSVTGMGRAMILRLARDGFDTVINYHRQERAEGAR
FT                   QLIREVQAMGTGAIAVQADVSQSTDCDRLVQEATDAFGRIDVLVNNAGITNLTPMQQMT
FT                   DEDFHRVMATNAYGTFYMMRSAVPIMKRQRSGSIINISSVGGLYGAPWSIGYAASKGAV
FT                   ISMTKTAAKELAISKIRVNAIAPGGCKTCIIEMGEKQLQAQLKYVTMGRLGLPEEMAGA
FT                   VSFLASEDASYITGHVLEVSGGVMM"
FT   CDS             complement(85390..86148)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00730"
FT                   /product="Predicted thioesterase involved in non-ribosomal
FT                   peptide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16349"
FT                   /db_xref="GOA:D4L9Q4"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Q4"
FT                   /protein_id="CBL16349.1"
FT                   /translation="MNSKWFAYGMTHEQADLNLLLFPFAGGCPSVFVQWKRLLCPKANV
FT                   YPVLYPFREARRSEQLPDTVQQLAQSLAAENEAVFSGKYAIFAHCAGASVAYETILAAK
FT                   QLYGTEPEWLIVSGAEPPEYSLESLRYLADASPAEFLNYLISGGFAEESVRDNPAFLSY
FT                   YLPIISADFRMLFSYRMTAAPPLHCPIFRFRGDTDKVIDPARLDAWQHYTEGICTEQVF
FT                   SGGHYYFTADPAPVCSSINRILEQGGEANG"
FT   CDS             complement(86141..87973)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00740"
FT                   /product="Peptide arylation enzymes"
FT                   /EC_number="2.7.7.58"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16350"
FT                   /db_xref="GOA:D4L9Q5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Q5"
FT                   /protein_id="CBL16350.1"
FT                   /translation="MRIKVDLNQTTYPRCILEMKRRFGDRIALRDKDGDMTYRALCTSS
FT                   EQLGAYLLSQGIRPGEKVVLHLGNTRLFIQCLFALELIGALPVIVFSACREHEVFSIAD
FT                   TTEAAAYISFRSFKGFDCTETATRIADRIDSIRTLFFDDQLEALDLSGYALAPEQIADP
FT                   SPEDPAYIVLSGGSTGIPKLIPKKQAATLWSAEKCAEACGLDETTRYLTAMPCAHYFHI
FT                   CGPGFMGAFLQGATDILCYSSLPSDIVSLIRQEKITETALVPSVASECIAYAKKHGNPK
FT                   QMFESLRLVQLGGAMCTADVIHAVAEEMGCVPQQIYGMGEGLVYATYPQDSLDFILKYQ
FT                   GINTSAYDSVKVVDEAGNPVPDGEFGELIAKGPNIATAYYKNDEANRVKFTADGYYRTG
FT                   DRVRLVEGKYLQVVGRIDDMINRAGEKIFPAELEMHLRQCSGVREAAVFGIPDPALGSR
FT                   IAAFVICDEDTSGAAIRRELIAAGLASFKIPDDIFFKDAFPLTSVKKIDKHALKQEAEE
FT                   RIRHAEQETLQSFDHIGDPTERSVYTAWARALNTGELTGDCCFIELGGNSITAAAMLRE
FT                   LEQAHGISLELEDFYCADTLDAFCGLVKERIAHE"
FT   CDS             89049..89750
FT                   /transl_table=11
FT                   /locus_tag="RUM_00760"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16351"
FT                   /db_xref="GOA:D4L9Q6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Q6"
FT                   /protein_id="CBL16351.1"
FT                   /translation="MLIEFKNAVKKYGDNAENTVYAMDHVDLGIQEGELCVILGPSGSG
FT                   KSTLLNMLGGLDRLDEGALLVGGKDLMKLGKNELTEYRRSQVGFVFQFFNLIPDLTVEE
FT                   NIQVASDIASNPMDLDTLLQDLDIAKYRSRFPKELSGGQQQRVAIARSVIKNPKLLLCD
FT                   ELTGALDSKSSRSVISLVDQINRTYKTTTVIITHNEAIRDVADRIVRIRDGKVVSNQLN
FT                   PNRRKAEDIDL"
FT   CDS             89747..91963
FT                   /transl_table=11
FT                   /locus_tag="RUM_00770"
FT                   /product="Predicted ABC-type transport system involved in
FT                   lysophospholipase L1 biosynthesis, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16352"
FT                   /db_xref="GOA:D4L9Q7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Q7"
FT                   /protein_id="CBL16352.1"
FT                   /translation="MRKINKRYFRSMRTNRSFHLVVILLTVLIGTLIIAAISTASLMGQ
FT                   VYRQGIRDCNTEDAQFMTMFPIPEDRIGHLEERYDVKLESMTYYDEEAGDYVLRLAAEN
FT                   TAVNTCQVTAGNAPAGDGEVMLSERFADAQGLHIGDRVQIGGKQFTVSGFMVRTDYLCM
FT                   LRALTDTFPDYNSFGLAVGTSAAVEAMPDIHSYYAVRFDRDNSLEFRKGVNEEFRILSY
FT                   TAAASNMRIQSALNQSELVMSVAVIIAPVLYGIVLLLIVLMLSRKLKAEQKQIGTLIAL
FT                   GYRTGEIRRHYALYSLVPGVIGSVLGLICGYAATFPFSQMYFNFFEALPHTVTAKPLLA
FT                   VLALVLPPLLYVCAGDLTVRLMLRKDPVQMLRQTDAGKVSSGVLADKRMPFRRKYRIRS
FT                   VLGHKARSAVIIIGVAVSTLCILMGWITKDSADNIVDSSVDQIPYNYSYLLNTTEFQLP
FT                   EGAEAALVSRYERDDSTLLFSLWGYQEDTAYFKMQTLKGEPMAYGSYYMTNAAAESYGV
FT                   QPGDNFTFRDLITTEEHTIQIAGILDDNINSAVYTSTANAAEIMGYDAVDRNTIVSNEK
FT                   LELDADMVLSETSREDYRESVKSAVQVYYKMCYIVLFVGFMLGVLSMYLISGMIVEENT
FT                   VNISMLKILGYRKREIRNLVLTGNHLLLCIGFVVGIPLALAVGGSVCASSAETTGMLIS
FT                   LYVKPVSYLITLLIVLASYLLSLVLAGRKVERIEMTESLKRNNE"
FT   CDS             91956..92708
FT                   /transl_table=11
FT                   /locus_tag="RUM_00780"
FT                   /product="Phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16353"
FT                   /db_xref="GOA:D4L9Q8"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Q8"
FT                   /protein_id="CBL16353.1"
FT                   /translation="MNSTLGGSLLISLEGHAATPDPALLKLLPADRLERLRRYVQTADR
FT                   LQCYAAGLGAMYLAARLADCSLRQVQLHTPQWQPPYALCRGKRLCMSISHAGDYVLCMG
FT                   DSAPCGCDVEQIRDVPEYMELAQRYYSPAEYEALLRIPEGSARRQAFFTLWTGKEAYVK
FT                   WLGIGLSRPLSTFTVSVQGSVLLAEDSAGVDGCPAGSTITVPGYCISRFGVHANAPLDR
FT                   ISCRELEDRLRAEGNEDEHEYNLYGSDL"
FT   CDS             92671..93936
FT                   /transl_table=11
FT                   /locus_tag="RUM_00790"
FT                   /product="crotonyl-CoA reductase"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16354"
FT                   /db_xref="GOA:D4L9Q9"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR010085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Q9"
FT                   /protein_id="CBL16354.1"
FT                   /translation="MNMNTTYTDQIYEPGTLPPLGCIPRRMHAWTIRQDRLGDPLTAFR
FT                   DEIVELPALKPHEVLVANVSVGINYNGIWAARGAPKNVLDANGTYGDDRQSFHICGSEA
FT                   SGIVYATGEAVSNVRVGDPVILSASKYDPDCPWIRSGGLPEYSPTYHMWGYEGNWGAFA
FT                   QFSKVSDYQCVLKPSELDWDEAAVCCATGTTVNRMLCHWDGNRIREGDVVLIWGGAGGL
FT                   GTSAIQQTRAYGGIPIAVVSGAERGAYCKSMGAAGYIDRTRFTHWGSIAGLDEAGMRRW
FT                   SMQAARFRNEIYEIAGGRINPAIVLEHPGGDTLATSLFVCAPGGMVVLCGATTGYLATV
FT                   DLRHLWIYQKRIQGSHAGSPENLKEYLCLRQTYDFASSVCRVYPWDQLPNAHKDMEQGT
FT                   NLMGKFAVRILPDSWLEERNCL"
FT   CDS             93933..95138
FT                   /transl_table=11
FT                   /locus_tag="RUM_00800"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.3.1.179"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16355"
FT                   /db_xref="GOA:D4L9R0"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9R0"
FT                   /protein_id="CBL16355.1"
FT                   /translation="MNRVAITGLAPITAMGTGKAFFEHLLKKEAVIRRIPPEYTGAPLS
FT                   TGWYVPFPEVDYKPFGRDFLRMSAMASRNACTGAAAALLALKDAGLEQPDPDTAVFFGV
FT                   GAPHSQEVVKGYRSITEHKPMHPCTNPMIMTNSVPAWISILLGIHGVSQVVSTACASGT
FT                   SAIGEAYLHIRSGRGSMAICGGADDLACDEGMMLRSFDVLGALTKAEDGIPRAFSQERS
FT                   GFLFSEGAACALILEEYASARKRGARIYAEITGYAATCDAYHIVQMPPVPTQIIRMLEQ
FT                   LTVGEQIDYYNAHGTGTPVNDRTEQLALTETFGERAASIPVTSVKGILGHTIGASGAIE
FT                   AAVCAYSLHNQVIHGNLLGTPLPGLCLPEESREVSIRTAISASFGFGGHNAALKFRREE
FT                   PA"
FT   CDS             95135..96712
FT                   /transl_table=11
FT                   /locus_tag="RUM_00810"
FT                   /product="Long-chain acyl-CoA synthetases (AMP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16356"
FT                   /db_xref="GOA:D4L9R1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9R1"
FT                   /protein_id="CBL16356.1"
FT                   /translation="MITETQHTPIPELEGFASMLRFITRQYGAQPAFCYDAPQMRRCSY
FT                   AAFADMVYALSDTLSGQSGRKILFAGQNSLPFIVTFFAVVCSGNTAVPVNKDIGEAELQ
FT                   QILQNCQPDMLILLEGASDALHKLYGTFAPEARLSAEEIRRILQTPRTEADVPEPDASP
FT                   AAETPDCIVYTSGSNGVPKGVMLTQSALMADAVSFTRAVYPAPTSLLCLPLHHMFGWTT
FT                   SVLGPLLCGAEIYINGDSILLSRDMQLFSPVHIQAVPAVLEFFYRQIRRQIRNDPNPEY
FT                   RQAVEGEEILEQSVEERRIYFAKFRAMLGEQLRYVISGGAALSREITEFFWKLGVTILC
FT                   GYGMTECAPVISLNTIACNVFGSIGPVIDCNQVRIADPDAEGIGEIRVKGRNMMLGYYN
FT                   REEETAAAFDAAGWLKTGDKGYLDENRCLFITGRIKNLIIRSSGENVSPEELELALSVL
FT                   PGVTEVLVYEQAGLILAEVYGESGMQETIRAGVDRVNGTLPMYKRIDRVLFRDTPFPKT
FT                   PTNKIKRN"
FT   CDS             96959..97174
FT                   /transl_table=11
FT                   /locus_tag="RUM_00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16357"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9R2"
FT                   /protein_id="CBL16357.1"
FT                   /translation="MTLDELKELLQKNKVQLEGELDPDTVIGTLGMDSFDVMMLTFDLE
FT                   SAAGHELKLTLSDRVGDILRAVNDGN"
FT   CDS             97164..98360
FT                   /transl_table=11
FT                   /locus_tag="RUM_00840"
FT                   /product="Acyl transferase domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16358"
FT                   /db_xref="GOA:D4L9R3"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9R3"
FT                   /protein_id="CBL16358.1"
FT                   /translation="METERYRLALFSGSDEAHLRQQIAAAGYQDGDRLTVDLQAPCRTY
FT                   LVYRGQEDWCRQTDPTARLPVCRVGKPGKTLFLFPGNGIHQKNMLATLRQVSPYFEQTL
FT                   GELAALAKPYTPVELLDETQENPLVNQLRVYASELAIAGFWTRLGCPPDAVIGHSMGEY
FT                   AAAVCAGYLSPADGFFLLAKRDGLMQEAVPHALAAAETTPDRILQLGQDGGIPLEIAGY
FT                   NAPEVVTVCCPHSQLHQLNQLCKEAGIRLSIINPDHGGHYSGLEQGAARLAALAAQVSF
FT                   HKPLRRMLSTVCPDGSCTPAEPAYWGAHMCRPVQFQQALDMVQKETLGRVIDLGVSPVL
FT                   LSMAMKNLGNLRCAWIPTVRAGRNYRRYILDAVGTAFLSGVCIPPDALDSGGSLTMKG"
FT   CDS             98365..99672
FT                   /transl_table=11
FT                   /locus_tag="RUM_00850"
FT                   /product="Condensation domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16359"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9R4"
FT                   /protein_id="CBL16359.1"
FT                   /translation="MEEQQKYYVDENGQWEFPLGLRQLAMVQMDLNGRNKYGQDSGVGN
FT                   VGNGLRMRFPIDRQRLEQSIQRVVDENDALRLILVQKGDTYTQRVLAHYQFQLQVYEAQ
FT                   GDTEQERLQSAVAIASKQVNTVIDWFNQPSFRIFLVQLAENDYLFVWLAHHWIGDGSTT
FT                   GLIMDQVFRYYEHPDAPKPETDTYLHFLRDETAFFQSDKGKKQLAYWKQEVEGYQMLDI
FT                   TKAAVGAPASGYDHMYQIDRSGVEQLAQRYHTSMFNVILLAYHLGVAYLLDNPDTIIGV
FT                   TSANRTSKRYFRTMGYIAHSLQHRMRIREEDKLADLLEASKDTFSKNMANLAAGHYYDR
FT                   TQFCLTYQNFVAGAETSEKQLEKVPIPTKRSVEQFFLLVFEGADKLALAMVGNGLIYTE
FT                   HFLESLKGYMESVVALLSQQPDATLAQLRAYYEKNQ"
FT   gap             101281..101509
FT                   /estimated_length=229
FT   CDS             complement(102074..102823)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00880"
FT                   /product="Phosphotransferase enzyme family."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16360"
FT                   /db_xref="GOA:D4L9R5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9R5"
FT                   /protein_id="CBL16360.1"
FT                   /translation="MNLNNVVAVRNIKTVYRDGDKAIKVFNEDYSKADVLNEALNQARV
FT                   EETGLDIPRILEVTKLDGKWAIVSDFIEGKTMSQIMQEEPERMNELLEQFVGIQLHIHE
FT                   QRAPLLTKLKDKMNRKISETSLDATTRYELHTRLEGMPKHNKVCHGDFNPSNIIITPAG
FT                   KSYVIDWAHATQGNASADAARTYLLFMLKGQEQLAEQYLRLYCLRSNTAKQYVQKWLPI
FT                   VAASQSVKGKPEERDFLLKWADVVEYE"
FT   CDS             complement(102839..105439)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00890"
FT                   /product="acetaldehyde dehydrogenase /alcohol dehydrogenase
FT                   AdhE"
FT                   /function="acetaldehyde dehydrogenase"
FT                   /function="alcohol dehydrogenase AdhE"
FT                   /EC_number="1.2.1.10"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16361"
FT                   /db_xref="GOA:D4L9R6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9R6"
FT                   /protein_id="CBL16361.1"
FT                   /translation="MNENRIVDSVEALEAKLREIRKAQTQFSTYSQQQVDAIFRAAALA
FT                   ACKQRIPLAKQAVEETGMGVVEDKVIKNHYAAEYIYNAYKNAKTCGVVEEDAAYGIKKI
FT                   AEPIGVIAAVIPTTNPTSTAIFKTLLALKTRNGIIISPHPRAKHSTIAAAKVVLEAAVA
FT                   AGAPAGIIGWIDVPSLDLTNMVMKEADIILATGGPGMVHAAYSSGKPAIGVGAGNTPAI
FT                   FDDTADILLAVNSVIHSKTFDNGMICASEQSVIVLESIYDAVKQEFQKRGCYFLSPEET
FT                   EQVRKTILINGALNAKIVGQPAYRIAELAGVAVPEHTKILIGEVESVDISEEFAHEKLS
FT                   PVLAMYKAADFQDALDKAEHLIADGGYGHTSSLYVDTVTGQDKIARFSACMKTCRILIN
FT                   TPSSHGGIGDLYNFKLAPSLTLGCGSWGGNSVSENVGIKHLLNIKTVAERRENMLWFRA
FT                   PQKIYIKKGCLPVALEELGAVMHKQKAFIVTDSFLYQNGYTKPITDKLDELGIRHATFF
FT                   DVAPDPTLACAKEGTKAMTAFAPDCIIAVGGGSAMDAAKIMWVLYEHPDADFLDMAMRF
FT                   SDIRKRIYTFPHMGEKASFIAIPTSAGTGSEVTPFAVITDEATGTKYPLADYELMPNMA
FT                   IVDADLMMHAPKGLTSASGIDAMSHALEAYASVMATDYTDGLALKAIQTIFDYLPRAYE
FT                   KGAEDPAAREKMANAATMAGMAFANAFLGVCHSMAHKLGAFHHLPHGIANALMLDEVLR
FT                   FNAAEVPTKMGTFPQYDHPHTLARYAEIAEFLHISGKDDTEKLEGLIAKLDQLKEQIGI
FT                   RKTIRDYGIDEAAFLESLDAMTEQAFDDQCTGANPRYPLMSEIKQMYLNAYYGK"
FT   CDS             105805..106371
FT                   /transl_table=11
FT                   /locus_tag="RUM_00900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16362"
FT                   /db_xref="GOA:D4L9R7"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9R7"
FT                   /protein_id="CBL16362.1"
FT                   /translation="MADMSNFFDKVKESAANAAAATGKAVKGASNSAKKMAETAKLKHE
FT                   ISGLEDKTAGVFREIGELFYTRSNGEADEAYAELFAKVAETRKEIEQKQAELSQLENSA
FT                   TCPACGKRVKSSAVFCSYCGAKVKQEEPAEESVAETPDKSHCPACGAETVADAVFCPAC
FT                   GARMTPAEDVVDVPKEDVTVEPAKE"
FT   gap             106505..106857
FT                   /estimated_length=353
FT   CDS             106861..107133
FT                   /transl_table=11
FT                   /locus_tag="RUM_00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16363"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9R8"
FT                   /protein_id="CBL16363.1"
FT                   /translation="MKTLFEEQQLEPMRDDCDPGDWDDPFEFGADQFDGIAIEWIRIHP
FT                   RYLEHRGRLIPPQVQDASEQFESLLQKYVIPFEQHGSDYLIYGYR"
FT   CDS             107250..107471
FT                   /transl_table=11
FT                   /locus_tag="RUM_00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16364"
FT                   /db_xref="InterPro:IPR020256"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9R9"
FT                   /protein_id="CBL16364.1"
FT                   /translation="MQEYERRGLYGRSQMPMGGRFPEETPLAMAYVPMQTWEEPYDMEE
FT                   GFCRGTIFPSLYYPFLAAGGEADNGRKG"
FT   CDS             107455..107709
FT                   /transl_table=11
FT                   /locus_tag="RUM_00930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16365"
FT                   /db_xref="InterPro:IPR016571"
FT                   /db_xref="InterPro:IPR024207"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9S0"
FT                   /protein_id="CBL16365.1"
FT                   /translation="MDERVKLLRQVQQCDFTLYDLQLYLDTHPACRRAMEQYEKHLRHR
FT                   RELEEEYVRRFGPLRAEQAAGSEPWSWVENPWPWEGGQC"
FT   CDS             107709..108284
FT                   /transl_table=11
FT                   /locus_tag="RUM_00940"
FT                   /product="Mn-containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16366"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9S1"
FT                   /protein_id="CBL16366.1"
FT                   /translation="MFAYEKKLQYPVNIKQPNPKLAKAIITQLGGPDGELGAALRYLSQ
FT                   RYAMPYGEVSGILTDIGTEELGHVEMISTIVYQLTRNLTPEEIKRSGFDTYFVDHTTGI
FT                   YPIAASGQPFTASFFQSAGDVITDLTEDLAAEQKARTTYDNILRLADDYDVRDAIRFLR
FT                   QRELVHFQRFGEAFRTEKLFCQKQNVPA"
FT   CDS             complement(108312..109760)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00950"
FT                   /product="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16367"
FT                   /db_xref="GOA:D4L9S2"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9S2"
FT                   /protein_id="CBL16367.1"
FT                   /translation="MGKTKRNLIYQTLYQMLTLVLPFVTAPYISRVLGTENTGIYSYTY
FT                   TTVNYFMLAALLGIETYGTRTISRVRNDQNALNKAFSSLFYCHICVAGLCLVVYMIYVL
FT                   CFSGAYRVYALIQALYILAELLNINWFFFGIEEFKITVTRNLVIKLLTIASIFLFVKDK
FT                   GDLIVYITIMALGTFISQSFVWIFLRKYVKFVKASCSEIFQHLKPMSVLFVSVIATSIY
FT                   RMVSKTMLGAMGELSSLGCFEYADKIIRMPLSIITAIGLVMLSKTSNMYVKNNKGAVSL
FT                   VSKSMEAVLIFASAIAFGLCGIANNFAVLFFGAEYAYTGQLIEAMSISLIFMSWNNVLR
FT                   TQYLMPKCKDKEYVIAVWAGAMVNIVSNLIFIRLWGATGAALTTSISYFVVSLVQSHYV
FT                   KAELPVFQYLKRSAIPFAAGAVMLVCVKLVGHMLKCSWVTLCIQVLTGAIVYAVLVLIY
FT                   LKKSDSFLYAGLVQPFLKKRKPSK"
FT   CDS             complement(109760..110833)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00960"
FT                   /product="Fucose 4-O-acetylase and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16368"
FT                   /db_xref="GOA:D4L9S3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9S3"
FT                   /protein_id="CBL16368.1"
FT                   /translation="MNTQPLVNPPKGRILAIDFLKALAIILVVFSHINAYNGSAKIWAI
FT                   CFAPNVFFFSHGVVCRSKIHQLSDWKDFILNRIVSILAPYLIWGMIYSPLTAKNIVKLC
FT                   YGSHESLSLADSLTSLWFLPCLFAGDLLFALILWAAEQIKSPKGRLIFLTAVVTGVLAV
FT                   CPFLPHFSKGWPFGADVALQAVAWIGLGYLTMYLLKDRINPGTGKQTHPLVLVLIAAAG
FT                   LALSLTAFCNTSMPGGYVMMAEARYGNYLLYLVSAAGGTAFVFALSFLLARIRNRFFVR
FT                   SFQLIGQSTMVIFAVHKFVIKTLQNVLTGIAIPHAAAAAVILITAIGVSLCVMPFINTY
FT                   LPLLAGKMKYKKVFGET"
FT   CDS             complement(110836..112038)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00970"
FT                   /product="Putative glycosyl/glycerophosphate transferases
FT                   involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16369"
FT                   /db_xref="GOA:D4L9S4"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9S4"
FT                   /protein_id="CBL16369.1"
FT                   /translation="MEYKQPGLPRKVLHKLRETCYTAFGNAFTKPDPKLIVFSSEPDFS
FT                   DNSRVLFEYMQDNGFAESYKFIWLVNEPEQFASLHYPNTTFVQKNDAYRYLRRETLKAL
FT                   MQAHYYIGTHIRQKRIRKSGSGQIILNLWHGCGFKDTQHMPWNDAFDYVLVPGDVFIET
FT                   KSRFFGCSKDRILPIGYPRYDLFRKHNPNTDAFVNSFRVNADTRLIIWMPTFRKTGKNK
FT                   YPEEHIAYSFPLPVLQSAEDLLKLDQACREKNLVILVKKHQYQQDFGIDNVALTNIRFI
FT                   DNQTFSDHQIQMYEFLPCTDALISDYSSVAIDYLLIDKPIGFTLDDYESYKQTRGFVFE
FT                   DPLAYMPGAHIYTLEELIRFVGDVAEGAPDPYKAQRAEVRTHTNKYGGDFCKRIIERFE
FT                   L"
FT   CDS             complement(112043..113233)
FT                   /transl_table=11
FT                   /locus_tag="RUM_00980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_00980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16370"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9S5"
FT                   /protein_id="CBL16370.1"
FT                   /translation="MVFRTTFRIRTSELIFLAVYALFAAATIIDASLITLGSIKTLINY
FT                   GSVGVLAAVFISRTYSLKQIRFYLLFGIFVFAAYTTKRTFLLVYMLLLLNARYSSFRKI
FT                   ALTSLIATTLSILFVILCCKAGLITDLVYNRNGVENAHSYGFGHYSSISYFALFLTLTW
FT                   LYLRRRAIGWIEIGVLAAFNYGIYRITTTRLSFYLALFVLAAYVVIVKYHWIRLSSKPI
FT                   RFLSTIGFPVSFAVCILLHYFYNPKNALLEKLNEMLNSRLLMGKTAFEQYHLKLFGQSI
FT                   QMVGIKSATFGEGHQVYFYIDSGYVYALIGYGILFTALLLTLYTIVLRNTAKKEQGVLF
FT                   IWAVTVMLFSISNNAWVSITYNPLLFYVIVPEANNALTRLLDRIRGWKPKKLKLGW"
FT   CDS             complement(114225..115211)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01000"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16371"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9S6"
FT                   /protein_id="CBL16371.1"
FT                   /translation="MKKTIIFDTAIGTSNIGDIVILESLETQLENLLKQCFVVRYATHL
FT                   KNFNFLTYLRLRAKRRYADECDYKFIMGTNLLSYDIFNTRRQWQIGLLTWPLYKNVIVA
FT                   GVGTTQGRRRLTAYSKWIYKRILSKKYIHSVRDEESRELLESIGIRAINTGCPTLWKLT
FT                   PEFCSQIPTEKASQCAFSLSGFKDQLDREKDGEILKILQQNYKALYFWCQTTEDEKYLD
FT                   SFPDTKDIPRIYNLDVFGALLDKGDIDYIGTRLHGGIFALQHKVRSIIISIDHRAAGFH
FT                   DTNNIVCLKREEIDKLDAMLNSTIRTEIVLKQENIDRWKAQFITGRE"
FT   CDS             complement(116262..116975)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01020"
FT                   /product="4-diphosphocytidyl-2-methyl-D-erithritol
FT                   synthase"
FT                   /EC_number="2.7.7.60"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16372"
FT                   /db_xref="GOA:D4L9S7"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9S7"
FT                   /protein_id="CBL16372.1"
FT                   /translation="MNVAVIFAGGTGQRMNTKVTPKQFLEVHGKPIIIYTLEQFEEHDE
FT                   IDGIVIVCLVDWIDHLKKLLSKFGIRKVKEIVPGGETGQMSIFAGISKAHELFSDDDFV
FT                   LIHDGVRPVIDRDTISQNIQCAKENGCAVTVSPAIETIALKEGSTIKNIMNRKDCWIAK
FT                   APQTFRIGSIYQAHLQAQADSRYDFVDSASLMLHYGTKIYPVEGKPDNIKITTPSDYYI
FT                   FRAMLDASENSQIWG"
FT   CDS             complement(116993..118138)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01030"
FT                   /product="Putative glycosyl/glycerophosphate transferases
FT                   involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC"
FT                   /EC_number="2.7.8.12"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16373"
FT                   /db_xref="GOA:D4L9S8"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9S8"
FT                   /protein_id="CBL16373.1"
FT                   /translation="MKDFFKLLIFWACRAFFSLFSIFPIRKNRVTFVSYKGAQYSCNPK
FT                   AVSEYLLTHCKDQFEVVWGLDDPATYDGIRDERVTVIKHGTLKFYKLLCTSRFIITNVD
FT                   YLSYIRFRKEQYIIQTWHGGGSYKKVGAQTKNINYFTAKRRSYFNARTDAFISSSAIFT
FT                   RDTIQGSFHFQGQILDYGMPRNDLLFTKDPEKAAQIKKRLGLSEEQHILLYAPTYRQII
FT                   KYTDYELDESRLKTALQNRFGGEWVILYRLHPMLKDTFDAASHDVMDVSHYNDMQELLF
FT                   VSDILITDYSSSMWDFSLTHRPCFLFATDLRSYQNERDFYTDIHSWPFILTENNDELAE
FT                   KIAAFDEEHYVNDVIAYHEASGSYETGSACRKVAELMRSKL"
FT   CDS             complement(118161..118850)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01040"
FT                   /product="Bacterial transferase hexapeptide (three
FT                   repeats)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16374"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9S9"
FT                   /protein_id="CBL16374.1"
FT                   /translation="MFSRLVSKLKKREYLIDETIQGTELIGIVWERFCMLIRGLFKKCF
FT                   FRSAGKVFFCGRHCVLKSKGKISVGSGVTIHQGCRINALSKQGIRMGDNVNIGPECILE
FT                   CSGVITELGEGIVIEDNVGISARTFIGARADVFIGHDTIIGPYCSIHAENHVFSDPDTP
FT                   IRMQPCSRKGVHIGPDCWIGAKATILDGVTIGQGCVIAAGAVVTKSLPDYAVAAGVPAR
FT                   IIKYRNA"
FT   CDS             complement(118878..120056)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01050"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16375"
FT                   /db_xref="InterPro:IPR015393"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9T0"
FT                   /protein_id="CBL16375.1"
FT                   /translation="MQNIFIVGSKGIPGSYGGYETFVDKLTEYHQDQPEIKYHVACAVD
FT                   EAEKVGEFTYHNAHCFNVLRKPIGPAQAIFYDTDALKYCVAYIKQHHISNPIVYVLACR
FT                   IGPFFNKYVKQIHQLGGKVYVNPDGHEWMRAKWPAPVRKYWKISEQLMVKHADLLVCDS
FT                   KNIEKYIRTSYESYKPQTTFIAYGAETRKSTLTDADPALTDWYRSKGLAPGEYYLVVGR
FT                   FVPENNYETMIREFMKSHTKKHFALITNVSDKFLEDLKRKTGFDRDPRIKFVGTVYNTE
FT                   LLMKIRENAYGYFHGHEVGGTNPSLLEALGSTRLNLLLDVGFNKEVAEDSALYWNKSDG
FT                   DLARLIDQADQMLPEEIDRYDQLSTDRIRQAYSWDYICGRYMDLFLNNCSEM"
FT   CDS             complement(120077..120685)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01060"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /function="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16376"
FT                   /db_xref="GOA:D4L9T1"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9T1"
FT                   /protein_id="CBL16376.1"
FT                   /translation="MGQIKVDQHVGGIQGLCIIQPAVHGDSRGYFMETYNQNDMQEAGL
FT                   DIAFVQDNQSCSTKGVLRGLHFQKQFPQTKLVRVIRGSVFDVAVDLRSNSATYGKWFGV
FT                   ELTAENKKQFLIPKGFAHGFLVRSEIAEFCYKCDDFYHPGDEGGLAWNDPAIGIDWGVT
FT                   GTYPGSASGSGYTLPDGTGLMLSEKDQLWLGIQDTFKFN"
FT   CDS             complement(120685..121545)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01070"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /function="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16377"
FT                   /db_xref="GOA:D4L9T2"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029900"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9T2"
FT                   /protein_id="CBL16377.1"
FT                   /translation="MKALVTGVKGQLGFDVVNELKNRGHDAVGVDIEEMDITDPESVSR
FT                   VIGEAAPDVVIHCAAWTAVDAAEDPENIAKVRAVNAGGTRNIAQVCKKLDCKMMYISTD
FT                   YVFNGQGTQPWQPDCRDYAPLNVYGQTKLEGELAVADTLEKYFIVRIAWVFGKNGSNFI
FT                   KTMLNVGKKHDTVRVVSDQIGTPTYTLDLARLLVDMAESEKYGYYHATNEGGYISWYDF
FT                   TCEIYKQAGYATRVVPVTTAEYGLSKAARPFNSRLDKSKLAENGFQPLPAWQDALQRYL
FT                   KEIDF"
FT   CDS             complement(121542..121988)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01080"
FT                   /product="cytidyltransferase-related domain"
FT                   /EC_number="2.7.7.39"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16378"
FT                   /db_xref="GOA:D4L9T3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9T3"
FT                   /protein_id="CBL16378.1"
FT                   /translation="MKPYKIGYTQGVYDMFHIGHLNLINQAKALCDYLIVGVNSDQLVE
FT                   RYKNKTPVICQEDRRTIVENIKAVDQAVIADTLDKTEMLQALGFNAVFIGDDWKGNARW
FT                   IRTEEELRRFGVDVVYLAHTPDISSTALRKATEQTGSTACVEET"
FT   CDS             complement(122000..123034)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01090"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /function="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16379"
FT                   /db_xref="GOA:D4L9T4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9T4"
FT                   /protein_id="CBL16379.1"
FT                   /translation="MTIIVTGGAGFIGSNFVYLQLKEHPEDRIICLDKLTYAGNLSTLQ
FT                   EAMEHPNFRFIKADIADRAAVEQLFEQEHPDIVVNFAAESHVDRSIENPGIFLQTNIMG
FT                   TQVLMDACRKYGIQRYHQVSTDEVYGDLPLDRPDLFFTEDTPIHTSSPYSSSKAGADLL
FT                   VLAYYRTFGLPVSITRCSNNYGPYHFPEKLIPLMISRALADEALPVYGKGENVRDWLYV
FT                   EDHCKAIDLVMRKGRAGEVYNVGGHNERTNLEVVKTILKELGKPESLITFVTDRPGHDM
FT                   RYAIDPTKIHSELGWLPETKFEDGIRQTIQWYLDNKKWWQDIISGEYQNYFDQYYRQKG
FT                   RVDQ"
FT   CDS             complement(123050..123946)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01100"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /function="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16380"
FT                   /db_xref="GOA:D4L9T5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9T5"
FT                   /protein_id="CBL16380.1"
FT                   /translation="MKGIILAGGSGTRLYPLTKVTSKQLLPVYDKPMIFYPMSVLMNAG
FT                   IRDILIISTPHDLPRFRELLGDGNQFGIHLSYQVQPSPDGLAQAFILGEEFIGDDCAAM
FT                   VLGDNIFAGHGLKKRLRQAVERAEQQNLATVFGYYVDDPERFGIVEFDKDGKAVSIEEK
FT                   PAHPKSNYCVTGLYFYDRRVVEYAKSLKPSARGELEITDLNRIYLNEGALSVELLGQGF
FT                   TWLDTGTHESLVEASNFVKTIEDHQHRKIACLEEIAYLNGWITREQVLQAYEILKKNQY
FT                   GQYLMDVLNGKYLDTLH"
FT   CDS             124447..125910
FT                   /transl_table=11
FT                   /locus_tag="RUM_01120"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16381"
FT                   /db_xref="GOA:D4L9T6"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9T6"
FT                   /protein_id="CBL16381.1"
FT                   /translation="MIALYARQSVDKPDSISISQQLELCRYEARGAPCRCFADRGYSGK
FT                   NTERPAFGEMMAAVAAGQIRTVIVYKLDRISRSVLDFARMMQQFEQQGVQFISATEKFD
FT                   TGSPMGRAMLNICIVFAQLERETIQKRVADAYAARSDRGLYMGGPVPFGFRRIPAVLGG
FT                   VHTSVYVPEPEEAAQLSLIYRLYADPAVSLGEVAARLRAEGMQKRGRDWERARIREVLR
FT                   NPVYVQADRQVYAFFAARGAQLVNPQSDYIGENGCYCYKSRDASGGEGCLQNRRIVLAP
FT                   HRGLIPADLWLACQQKNTKAPTVRHGDGSWLSGLLYCGACGSGLTAKQGSRGRYLYCAR
FT                   RLHKGVCSGIGTLEAGALEQAVEQLVLDRLNGLGTLYGETLPDPALTGLEHALTETEQE
FT                   LTALLEKLPQADTALFSYINNRVTGLHLRRAQLEGQLAEQTAKASGQGILPDAALWHGM
FT                   SPADRRRAAGVLIRRVEADPEQITIYWRL"
FT   CDS             126135..127409
FT                   /transl_table=11
FT                   /locus_tag="RUM_01140"
FT                   /product="folylpolyglutamate synthase/dihydrofolate
FT                   synthase"
FT                   /EC_number="6.3.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16382"
FT                   /db_xref="GOA:D4L9T7"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9T7"
FT                   /protein_id="CBL16382.1"
FT                   /translation="MDFLESMQWLHGQRDRGIRPGLDTMQALLARMGNPQKGLQSIVVA
FT                   GTNGKGSVCAMLSAVLEAAGCSAGTYTSPAVFQLLEQYKLGTSCCTAEQFAQACTLVRQ
FT                   GAEALARDGIYPTGFELETAAAFALFAQQGCGLAVLECGMGGDLDAVNVAENRLLAVIT
FT                   PIAVDHTRFLGDTPEEIARHKAGIVTPGCPLVTAPQTPAVLSVLEDACAAAGSRCIPVP
FT                   EGALTMLEDTPKGMLLKPEEGEPYLLGLHGAYQCGNAAVALEACRQLAKAGLPISDGDI
FT                   RRGFAAARHPGRFQLLGEAPVFVLDGAHNPHGMDAFCTGLEQMFPGREILAVMGVFRDK
FT                   AYDRMLQRLSRTASGLYAVTAPGARGLDARQLGAAAEAYFSRVRVEPDPVQGIREAARH
FT                   SDAVIAVCGSLSFLAEVAAEINKVK"
FT   CDS             127421..127972
FT                   /transl_table=11
FT                   /locus_tag="RUM_01150"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16383"
FT                   /db_xref="GOA:D4L9T8"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9T8"
FT                   /protein_id="CBL16383.1"
FT                   /translation="MDAEKIRQGVRLLLEGIGEDPEREGLRDTPDRVARMYAELFAGYA
FT                   DSASTHLSTTFASPDSEMVLEKDITFYSTCEHHLLPFFGKVHIAYIPDGRVVGISKLAR
FT                   TVEVFARRLQIQEQMTAQIADALMAELHPKGAMVAVDAEHTCMTMRGIKKPGTRTLTYC
FT                   SRGAFAKDPELKREFFSLVR"
FT   CDS             127969..128445
FT                   /transl_table=11
FT                   /locus_tag="RUM_01160"
FT                   /product="uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16384"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9T9"
FT                   /protein_id="CBL16384.1"
FT                   /translation="MTVTNRIAANELFLQCVEKNSKYEENRQFCKHGWEHLMDVARIAY
FT                   IINLERGYGLERDLVYAAGLLHDCGRYVELEQETPHEKVGARLAKRILRECDCPETWIS
FT                   QIGQAILEHRKGRATSELGDLLFEADKRSRPCFRCEAEAECNWKSSQKNQKIKY"
FT   CDS             128454..129275
FT                   /transl_table=11
FT                   /locus_tag="RUM_01170"
FT                   /product="Dihydropteroate synthase"
FT                   /function="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16385"
FT                   /db_xref="GOA:D4L9U0"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9U0"
FT                   /protein_id="CBL16385.1"
FT                   /translation="MKTRIGNRVYGNHTYIMGILNVTPDSFSDGGRYTGLDAALYHAEQ
FT                   MLREGADILDVGGESTRPGYTRISDEEEISRITPVIEAIRARLDIPVSADTYKPAVAAA
FT                   ALQAGADMINDIWGFQAEPGMAEVVAQAGAACCLMHNRKEPVYDSFFEDVLSDLRRSIA
FT                   LAKAAGIPDDRILLDGGVGFAKSREQNLEIIRRGSEIAALGYPVLLGTSRKSVIGLTLD
FT                   VPVDQRLEGTLATTVVAVMTGCQFVRVHDVLANRRAVDMTEAILGKERQDG"
FT   CDS             129268..130086
FT                   /transl_table=11
FT                   /locus_tag="RUM_01180"
FT                   /product="dihydroneopterin
FT                   aldolase/2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16386"
FT                   /db_xref="GOA:D4L9U1"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9U1"
FT                   /protein_id="CBL16386.1"
FT                   /translation="MDKIRIQNLTVFANHGVLPEERVLGQKFLISAELYLDTRAAGMQD
FT                   DLTRTVNYAQVCSFICQQMQQTFQLIEAAAEHLAQGILREYPLVRRVDLELAKPWAPVH
FT                   LPVESVSVQISRSWHRAALSMGSNLGDSRAHLDAAVRALQSDPMCRSCRMSDYLVTRPV
FT                   GYTEQPDFLNGAMVLDTLYTPHELLDNLQRIEQSRHRERVIHWGPRTLDLDLIFYDDRI
FT                   ISDARLQVPHPEAANRFFVLKPLSELAPYWMHPVLHRTVAQLLADNPEPV"
FT   CDS             130083..130577
FT                   /transl_table=11
FT                   /locus_tag="RUM_01190"
FT                   /product="Dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16387"
FT                   /db_xref="GOA:D4L9U2"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9U2"
FT                   /protein_id="CBL16387.1"
FT                   /translation="MNLIAAVDGAWHIGLGSRTAYYLPQDLHHFRRLTYGGVVVMGRKT
FT                   FETLPHPLEGRVNLVLSRCMQPRPDIVLCRELSLLPGMLRSMENRPVWAIGGAEIYRLL
FT                   LPYCTCAHMTYTERIYPADCTFPTPLPALGWMLESEEPVPDTNGEFQFRVYRNPAPKTL
FT                   A"
FT   CDS             130631..131497
FT                   /transl_table=11
FT                   /locus_tag="RUM_01200"
FT                   /product="Sugar kinases, ribokinase family"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16388"
FT                   /db_xref="GOA:D4L9U3"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9U3"
FT                   /protein_id="CBL16388.1"
FT                   /translation="MEKITVMGEALLRLYTGQPLEQAEQFQVTCGGTGLETACTIARLG
FT                   GRCSLLACIGEDPFGDRILEWLTRHGVDTDQMQHTGRAATTLCFVREGMQAYYPAPGAD
FT                   RMLSAAALREERLGESCILHVSSMDLGEEPCRFAHQRAIRTIRQQGGCISFAPCYHPAL
FT                   WDSSAAWQAAMRSFLPFADLITVGQESLALLTGCPDAAGAHRLLLEGNCKLLCYLSGQG
FT                   VRLTNGRSTAVVPVDQPVPEPAAAGALLYALAQDWIPGKGLSGLSHGELYRLAEFIVLY
FT                   ALPPALG"
FT   gap             131534..131935
FT                   /estimated_length=402
FT   CDS             complement(131996..132559)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01210"
FT                   /product="uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16389"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9U4"
FT                   /protein_id="CBL16389.1"
FT                   /translation="MTRDEAWTLLTQYNQGAFHLRHAVTVEGVMRYFAQELGFGDEADF
FT                   WGIVGLLHDLDFEQFPQEHCRKEARILKEYGAPEALIHAVVSHGYLIGTDVEPEHTMEK
FT                   VLYATDELTGLIGAVALMRPSKSVSDLETRSVRKKYKSKGFAEGCSREVIQRGADMLGW
FT                   SLDELIERTILAMRRCEEAYSQFQ"
FT   CDS             complement(132614..133069)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01220"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16390"
FT                   /db_xref="GOA:D4L9U5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9U5"
FT                   /protein_id="CBL16390.1"
FT                   /translation="MERRMERLTADKLDAFIDLRLTQLKEEGTLETDLRPALEDYLHRH
FT                   LADGSFVSWILTEGNRILATSGISFVEKPPYPGAPNGRIGLLSCMYTDPACRRQGIASA
FT                   LLERIVAEARARDCRVIQITASRMGEKLYQSFGFVRHARFFQLSLDK"
FT   CDS             133226..135763
FT                   /transl_table=11
FT                   /locus_tag="RUM_01230"
FT                   /product="Glycosyl hydrolase family 9."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16391"
FT                   /db_xref="GOA:D4L9U6"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR001956"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9U6"
FT                   /protein_id="CBL16391.1"
FT                   /translation="MNTKRTLKRRLKALGLSGAMLAGALCLPGAAPQGGDLLANAAGDA
FT                   ASGFDANFAKLLQYSIYFYDANMCGTDVSENNRLNWRGDCHTYDAQVPMDTEHTNLSSA
FT                   FLTANKDYLDPDGDGFIDVSGGFHDAGDHVKFGMPENYSAATVGWGYYEFRDAYAATGQ
FT                   DAHVETILRYFNDYLMRCTFLDDSGDVVAFCYQVGDGDIDHAYWQAPEIDTMDRPAFFL
FT                   TGDKPQTDYVASAAASLAINYLNFKDTDEAYAAKSLKYANALYDFARDHEKELSDNGDG
FT                   PKQYYSSSKWQDDYCWASAWMYKITGDHAYLEEIYPNYDYYAAPCYVYCWNDMWGGVQC
FT                   VLGEIVSEMYPNFIDEYKEAAGKSPYEEMDCWASVKEALDTYMSGGIGEISPQGYFWLN
FT                   TWGSARYNTAAQLIAMVYDKYTNNNQPSKYSDWAKGQMEYLMGNNDITYQERIDANTEA
FT                   ENSGNPAPYSADELHGPRCFIVGFNDVAAAYPHHRASSGLSKCEDTKPQKHVLVGALVG
FT                   GPDNKDLHNDVTKDWIYNEVTIDYNAAFVGASAGLYHFYGTDAMQPDPDIDLGTSEEEG
FT                   GGQDYWVEAYAVDDKQTSGAGVTKLAMLVCTDSNKPRTDISVRYYFSVKELSNPSNVSL
FT                   VKGDELYDQTSVETDFDGVLSGPYQYDASFDPDIYYIEVKWDGYNIANANKKYQLAVGF
FT                   YYGDTWDPTNDWSYQGITKCKDTYQDGSETRTDYICVYSGDTLVGGIEPNGSKPVVTTA
FT                   ATTEGSGTTTTTTTTTTDTTVLGDVDGNGKVEVNDLVRLARYVAQDQELTPALTAQQVT
FT                   NADVNCDGTVDASDITMIARALARLTSLEDFGK"
FT   CDS             complement(135831..136340)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01240"
FT                   /product="Ferritin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16392"
FT                   /db_xref="GOA:D4L9U7"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9U7"
FT                   /protein_id="CBL16392.1"
FT                   /translation="MDNKVANLINEQINKELYSAYLYLDFANYYAAVGLDGFENWYRIQ
FT                   AQEERDHAMLFYQYLQNNSEPVVFASVDKPDWTRGDNMTPLIKGLEHEKYVTSLINTIY
FT                   AAAYEARDFRTMQVLDWFVKEQGEEEKNASDLITKMELFGSDAKGLYMLNSELKARVYA
FT                   APSLVL"
FT   tRNA            136618..136694
FT                   /locus_tag="RUM_T_24250"
FT                   /product="transfer RNA"
FT   CDS             137020..137079
FT                   /transl_table=11
FT                   /locus_tag="RUM_01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16393"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9U8"
FT                   /protein_id="CBL16393.1"
FT                   /translation="MIAAKTATQNKIQEVKKDE"
FT   CDS             137072..137368
FT                   /transl_table=11
FT                   /locus_tag="RUM_01260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16394"
FT                   /db_xref="InterPro:IPR025463"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9U9"
FT                   /protein_id="CBL16394.1"
FT                   /translation="MNDWERLHRQAERYKQSYPPGTRVMLLNMNDPYSPVESGMRGTVQ
FT                   SVDDIGQLLMKWDNGRALALVPGEDSFRRLTQEEIDRELQEQAQEQTINEQSM"
FT   CDS             137405..138514
FT                   /transl_table=11
FT                   /locus_tag="RUM_01270"
FT                   /product="DNA-methyltransferase (dcm)"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16395"
FT                   /db_xref="GOA:D4L9V0"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9V0"
FT                   /protein_id="CBL16395.1"
FT                   /translation="MAIPFIDLCSGIGGFHSGLVNTGHYRCVGHAEIDKNAEKAYNAIY
FT                   GEEGGLNYGDLRTINPRELPHFDLLCGGFPCQSFSVAGRRLGFRDTRGTVFFEIARILA
FT                   EKRPPFLLLENVLGLLSHDSGRTLNTIFSALVDMGYNLEWMVLNSKYFGVPQQRRRLYI
FT                   VGYLDPRCAGKVFPLSGGNAKNLKQLIPGPQGQRVYETDGIACTQCAGSGGWGGKTGLY
FT                   FIDMNADPVITDVARCITARQDSGVSNHRGEHSAVLIEDAPRAILTPDRETVRQQGRRM
FT                   KEPNEAMFTITAQDKHGVYHKGRIRKLMPIECWRLQGFTDEQFYKAQATGLKDGHLYKM
FT                   AGNAVSVPVISAIGQRLYEINHEFGIVKE"
FT   gap             138851..139963
FT                   /estimated_length=1113
FT   CDS             139981..140343
FT                   /transl_table=11
FT                   /locus_tag="RUM_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16396"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9V1"
FT                   /protein_id="CBL16396.1"
FT                   /translation="MMYGAPSWYDWSIKNWGTKWNSYGYDNLDRSDISENPAFSFYTAW
FT                   SAPHPIIEKLAERYPEVSFEHEWADEDIGMNCGRKTYEHGECTDTYYPEAKEAELFANN
FT                   LWGYETDTEMTEEQTL"
FT   CDS             140340..140927
FT                   /transl_table=11
FT                   /locus_tag="RUM_01300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16397"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9V2"
FT                   /protein_id="CBL16397.1"
FT                   /translation="MSIKKIDKNELRGYERKEGLILQGCGGNPREWVDGINNLFTKEGI
FT                   LLDGTKFGDDNCAVFENNGLTCLLYEFNDDTKVDIGKLAMWRIRTHSDLGGTWLSDYVE
FT                   NKLGGFSLTGTKKPDCPLIGQNGNIFNLMGIAARTLRHNGLAEQSKEMTKRITDTAQSY
FT                   DEALGIIGEYVNITSVNDCSEDMDAGMEMRYD"
FT   CDS             140920..141072
FT                   /transl_table=11
FT                   /locus_tag="RUM_01310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16398"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9V3"
FT                   /protein_id="CBL16398.1"
FT                   /translation="MIEMLFFLIGMVLGGLVAFVILCCFQLHRINRYEAQLQRLKAQLS
FT                   ARDTN"
FT   CDS             142110..142334
FT                   /transl_table=11
FT                   /locus_tag="RUM_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16399"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9V4"
FT                   /protein_id="CBL16399.1"
FT                   /translation="MEYKTEFTILLPEKLTAALDIDEDTLFETYFDDGKIKVRVIDESE
FT                   FEDELSNCDLTDNGKECAECPNYCRSCGR"
FT   CDS             142365..142670
FT                   /transl_table=11
FT                   /locus_tag="RUM_01340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16400"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9V5"
FT                   /protein_id="CBL16400.1"
FT                   /translation="MNRKIVKVLGKRGRITIPYEIRVRNKIGYNDILSFEEKDKNTIIV
FT                   RKEKLCGGCTPECFDEENSIPIEDFIDSLTPEQQRRATIYLNLLWAQKESASVGRT"
FT   gap             142806..143711
FT                   /estimated_length=906
FT   CDS             145149..147437
FT                   /transl_table=11
FT                   /locus_tag="RUM_01360"
FT                   /product="Rad3-related DNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16401"
FT                   /db_xref="GOA:D4L9V6"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9V6"
FT                   /protein_id="CBL16401.1"
FT                   /translation="MFEITYSDNETFEAYQNAGKAHKGGTYDFTFENRYIIYHANLRHK
FT                   VDYIAIDMSTGLASFVITKNPGNLYTEASYKRLIPHILYSVKYTGDMRYLNRFADDPLT
FT                   VIDSIFRVVLPNNGYNIREEQIALAKKMYIGFTEKQVALCEAEVGTGKTLSYLVAAIVA
FT                   KHHNGITYRQNLPVTITTSSIELQKALVEREIPHLSKMLLDYYIIERPLTAVLRKGKEH
FT                   YLCRYRLDDFLKNIRMYPEKYKTTIETLEQMSNLRAGIDLDRYRLSGAIKSRICIKGTC
FT                   AGCARKKECTYNEFAKRMYDLPDLDFQVTNHNMYLMSQKTKTDDHPPLLRESCFVVVDE
FT                   AHKFKEAAEDTFGERIGEKDIPRYVNAVKILCSTKANRDKYKEFLANIIKENDALFNSL
FT                   RKKQHGDIEEERGNIISLSVFQTAKLNKIMYLIDKIEGMKIKRNYGIPVTGSYLKTAIA
FT                   AINKTSKSTIWLDTDENGLLSLCSTPKDINNIFRSKIWDRNVSHVLTSGTLSDGTDFEY
FT                   FKAENGLDFIQHRLLLESRTESPFDYTNHTRLYIPTGMPTPDNDNEDYFKAIADEIYGI
FT                   IKATNGHTAILFTSYKTLNLVHDLLRDRLTAYDTICMTRSNKNAITDFKKSKNGILFAS
FT                   GSMWEGVDCVGDCLSSVIIVRLPFPMRSALMEEKKNNCDSVGDFVDRYCTPNMLIKLRQ
FT                   GVGRLIRCESDTGVVSILNPRAISKSYSGKIGQALHKFPKVDSAQEIECFMRGVKDEEY
FT                   YGEKKENMK"
FT   CDS             147434..147592
FT                   /transl_table=11
FT                   /locus_tag="RUM_01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16402"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9V7"
FT                   /protein_id="CBL16402.1"
FT                   /translation="MIAEKQTKSANFLRIIAILKSLRDDSKISIQEYSRAKKYYKKLTG
FT                   ADIFIAD"
FT   CDS             147758..149056
FT                   /transl_table=11
FT                   /locus_tag="RUM_01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16403"
FT                   /db_xref="GOA:D4L9V8"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9V8"
FT                   /protein_id="CBL16403.1"
FT                   /translation="MLIEFRFKNYRSFRDEAVLSMEATGLGTFKNCLIQEKSTKLLPGV
FT                   AIYGKNGGGKSNVIRAFWLAVQFIRNAQRTQHEKAEIPVMPFGLNDYSKSDPTSFKFIY
FT                   VQNGIKYWYGFSATRESIVSEYLYHAPKGQKAVVFLRDGQKFSFTEEKTKRSMIGEMVA
FT                   ANQLFFSVACTMNDAVCIGAMRWFRDCIFFSRDYTDIPRQLLEYSEDKNMLKAITEYAK
FT                   TADLGIEDMQFEFDSKEIKDDESFPANVPEGIKAALTQFMHALSETSNNSEVKLRMGEV
FT                   TAKAKHLGENKNGERVLYSLDLSDESDGTRKLMSLAPAIESALQNGGVLLADEIERELH
FT                   PVLVNYIISKFQSKNSNPNGAQIIFTTHNTELMNMELLRKDQLYFADKRNNDGASELYS
FT                   ISDFATRTTDNIRKGYLVGKYGATPDIEIEEVE"
FT   CDS             149056..149709
FT                   /transl_table=11
FT                   /locus_tag="RUM_01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16404"
FT                   /db_xref="InterPro:IPR025591"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9V9"
FT                   /protein_id="CBL16404.1"
FT                   /translation="MPRQLRKQKAYIVVFCEGESERAYMEFLKKKFSDVAAFKFNCSTN
FT                   LFEEADSKFKKDKRFSDYTEETDEIWFFFDVETKDISKWDSRLEIIKRLRRLRKRPNIK
FT                   VRLLMTSGCIEYWLMLHYEMFAPPVQTEAEKKEMLTRLVRKEPTYQKGDFVSTAKIAEH
FT                   YPTAVINAKQAVSFLLQDGLPGLDDTDERNRWLCTNCLTFSTVYEAIDFLESLA"
FT   gap             150426..151372
FT                   /estimated_length=947
FT   CDS             complement(152692..153606)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16405"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9W0"
FT                   /protein_id="CBL16405.1"
FT                   /translation="MDDYSSFVPNVHFEKIPIKNLVSNQDYQRNLSQARIEKTAENFDL
FT                   FQINPVKVSRRDGINYVFNGQHTIEIVALASGSRETPVWCMIYDDLCYEHEADIFANQM
FT                   KFAKNLAPFEIFVANLEAKNQEQLMIRDLVESYGLKISAKRAPGHICAVSTLEAIYSKY
FT                   GYQVLNRVLRLIIGTWEGDSNSFSANIMNAVTKLCVVYKDQLKDEVFSEKLGAVSIKQL
FT                   TRTARDRRKGSMGFAEAMLLEYNGKRKSNAGKLFMNKLYARDVSLWIEPDENEDFDDSE
FT                   TFEDFAIGQLGEDKESDNNESNN"
FT   CDS             complement(153608..154549)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16406"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9W1"
FT                   /protein_id="CBL16406.1"
FT                   /translation="MELKRLKIDEEFRHLIRPLRHREFLQLEQNIINDGCRDPIVVWHN
FT                   TIVDGHNRYEICMRHSIPFDTKDMEFECREAAVAWICANQLGRRNITEETRKFLIGMQY
FT                   ENEKVVTRIRNKIGRNQHTLDISTMDEEDADKACRHWTAQRIAEDNNVSAATVQKYAIF
FT                   TRALEEIGKKEPKLVPKILSGQYKIAHKHVLEMAELNPQDLRRINRKIDRNPAEFMHYK
FT                   ATRPVVQGNKSVHSEGDIPTGPSVKDMPEYDPDAEISSLTLTIPSWKSSIERAKNTADL
FT                   TIVSPRAKGDLAQALRELRNTIADMLSEVEDT"
FT   CDS             complement(154549..154929)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16407"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9W2"
FT                   /protein_id="CBL16407.1"
FT                   /translation="MSEQTRQQVTIAVDLKKYRIRIHRSTLALLGTPKYVQFLVSPSAM
FT                   MLAIQGTDKRTNYSHRVNLAALHPDNSYEIYSTSFVNKLCSLVEGLDSAYAYRLTGEII
FT                   AEENAGVFPLSSLQKIDGLEER"
FT   CDS             complement(154889..155674)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16408"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9W3"
FT                   /protein_id="CBL16408.1"
FT                   /translation="MNDITEQRTMTETFAPQADSELHKIPVLKDEEELIEMSTDFNLEE
FT                   FQVVRREFFAHIREPAVTFNNRKFYVNSACLTKFPHTDYVQALINPHTKILALRPCGEN
FT                   ERGSFQWCSIGQGKRKPRQTTCTLFFLKMFDMMDWNPDHRYKMLGNIIRANGEYLIAFD
FT                   LTSTEVYQRTYDAEGAKSTASRTPVYPIGWQNQFGMTLNEHKQSMLVNIFDGYAIYSIK
FT                   ENKAVRQSPTATVTADTVALPEGEINHERTDSTTSNYSG"
FT   CDS             complement(155685..157553)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01460"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16409"
FT                   /db_xref="GOA:D4L9W4"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9W4"
FT                   /protein_id="CBL16409.1"
FT                   /translation="MIDKTKRLEKEQAKAKTKKRIYVEVDPENYDYFPETRQADYYDND
FT                   VPQRVAIYVRVSTDDVRQTTSFELQKKYYEDFVIKHPHWTLVKIYADEGISGTSLNKRE
FT                   QFLQMISDAKRGKIDMIITKSVSRFARNIYDFIGIVRDLAERNPPVGVFFESEGIFSLN
FT                   DDSQLALSFQATMAEEESHTRSRSMETSLRMRLDNGIPLTPKLLGYMHDADGTLIPNPD
FT                   EAPTVKLAFYMYLYGYSSQQIADAFNALGRKSYLGNINWTSNGIVQILRNERHCGDVLT
FT                   RKTFTPNFRTHKAKKNRGQRPQSRYRNHHPGIVSRDDYIAVQRMLDNAKYGNKSILPEI
FT                   RVVEDGVLKGFVTINPRWAGFKEGDYYLASKSVYSSPEEEPHPEEEIQFEVEAGDFDLR
FT                   GFEIARGEFFDAPRQPHAIIYHKFIKFSTACVRKFGTQNYIEILINPISRKLAIRPTTK
FT                   ENRNSVMASKPEKGILYPRLIPTAAFSETMFNLLGWNIEYKYRILGTLYEQDGVVAYIF
FT                   DTVDSEAYFKPNVLSKENGEEDCTNVQPLMPSGKRIRAIPESWTSSFGKQFYAQEKSVT
FT                   ELQRQSEEDWMLRLEGQLFETGNKLHVTGFEELKSFITQELQGVDI"
FT   CDS             complement(157546..158148)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16410"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9W5"
FT                   /protein_id="CBL16410.1"
FT                   /translation="MDEIDIHAKLAQIETAPHFSEIFDGDTERAEMIAEHLIWLHTIRR
FT                   ERPLVSKPYKVGIYIRYFNQTKYENYLDFHKKGFVDTLALCPKWELVDFYIDEGSTAPN
FT                   MENAPEWCRLLQDCLDGKVDLIITQKVSNVTKKPQEITIMSRYLATLPHPVGIYFISED
FT                   IFTLASYYQEDMRDTDFFPDGWVSLPDDDSERRLLHD"
FT   CDS             complement(158439..158804)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01480"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16411"
FT                   /db_xref="GOA:D4L9W6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9W6"
FT                   /protein_id="CBL16411.1"
FT                   /translation="MRELDDARYKAIGARIRDVRLQRNMSQAELAEKAFISVPHMSEVE
FT                   NGKTKLRLSTFVYITEALQVSADVLLRTNTPEVNGIYQGEFNDLLADCSPAEIDSIIKI
FT                   VKELKTTMRMKKDEYLF"
FT   CDS             158936..159298
FT                   /transl_table=11
FT                   /locus_tag="RUM_01490"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16412"
FT                   /db_xref="GOA:D4L9W7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9W7"
FT                   /protein_id="CBL16412.1"
FT                   /translation="MQINYILLGQRIRAFRTKKGITQMELAERIDRSAAYMSYVETAYK
FT                   FCSLDTLVRVANELNVSTDDLLIDSLTNTIKASNHEFTAILSDCSDYEMRVLLDIVKAT
FT                   KQAMREYKYLTRANRR"
FT   gap             159940..159942
FT                   /estimated_length=3
FT   CDS             160252..161217
FT                   /transl_table=11
FT                   /locus_tag="RUM_01510"
FT                   /product="Predicted phosphoesterase or phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16413"
FT                   /db_xref="GOA:D4L9W8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9W8"
FT                   /protein_id="CBL16413.1"
FT                   /translation="MGKIFFTGDLHFGHANVIAFDNRPFKTVEEMDAELIRRWNSKVGK
FT                   GDLTYVLGDMIWKARNDDAPELIKSLNGQIILIKGNHDRFLHNAKAKAALAGIKDYDDI
FT                   CVTLEDGTKKRVILSHYFTPMYNGHRYQAIHLHAHSHFTDEADFEVNFAERLNNIGCRN
FT                   EIYNVGCMYWNYEPVTLDEIIEHGRTIRPTYGERSAEYMTQFPWEKKQTVHPENEIRWN
FT                   VFYHNCNSRSIETFNVFEHGSFREYVKRAAKKYQSKEDFAKQLRSEVMYYFWSKCEWEV
FT                   LVTPWISPRESEKKKVDVCWQIMNNWDVFVDYTWANRKKL"
FT   CDS             complement(161527..162174)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01520"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16414"
FT                   /db_xref="GOA:D4L9W9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9W9"
FT                   /protein_id="CBL16414.1"
FT                   /translation="MTHAYNESYLSNAKDRLSSFFDYAINDCKIKPDWITVLFINTGYA
FT                   EQFERGNPAYVAGMSGVELARAVILKAYGRKELPKPTNSEECSPEYWAGWALAEYQWYC
FT                   GRRFKDIFERIPLTKIIGMYSVYHEMDITNFIDTMEEFYKAAEGDSNLKRIRESRGLSQ
FT                   SELAEQSGIKVRNIQMYEQRVNNIDKAQAQTLYKLSRVLGCDIEDLLENPMM"
FT   CDS             complement(162140..162838)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16415"
FT                   /db_xref="InterPro:IPR025051"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9X0"
FT                   /protein_id="CBL16415.1"
FT                   /translation="MSTIQLLHGTDHIIEVPDINIGNPHNDYGRGFYCTCVDEMAKEWA
FT                   CKKNTDGFVNVYDFDEDGLKVLNLLSGNHTVLNWIALLLQFRTFKLDSEVAVDARDYII
FT                   EHYSVDLSGYDIVVGYRADDSYFQYAESFVSNTLPLRSLNKALRLGKLGEQTVVISQRG
FT                   FERLKFVDAYSVDKNVYYPKFLDRDTKARDTYRKEIKKTKSYRDDIFVLDILREEMSND
FT                   DSRIQRILFE"
FT   CDS             163019..163459
FT                   /transl_table=11
FT                   /locus_tag="RUM_01540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16416"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9X1"
FT                   /protein_id="CBL16416.1"
FT                   /translation="MTYEDDEPYDPYLHIDTYKDFYSRSMFLVNYGKSVKGRVKKDKPT
FT                   RYCGYASKVSIAAFEIDEYDTIGYWLTPEEYKKLSDKEKQEYSYYEWDEYEDWYRVYNL
FT                   IVSRVDTMLGYFCRWAEYAIKDANPDETCPTADYVRLLVYRC"
FT   gap             163967..165036
FT                   /estimated_length=1070
FT   CDS             165236..165598
FT                   /transl_table=11
FT                   /locus_tag="RUM_01570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16417"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9X2"
FT                   /protein_id="CBL16417.1"
FT                   /translation="MSYDIHLNDPVTKQTIELENPHFMRGGTYAIDGTKELSLNITYNY
FT                   ACVFCRPEVLGEKGIRSIYGKTGAESIPVLQKAIDALTDEVDPDYWKATEGNVKKSLYQ
FT                   LLSMAHMRPDGIWDGD"
FT   CDS             165613..165861
FT                   /transl_table=11
FT                   /locus_tag="RUM_01580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16418"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9X3"
FT                   /protein_id="CBL16418.1"
FT                   /translation="MEIVMNNELKLAQVWCSHADQRDKAKQQKLKEFIADCRKKKIFVC
FT                   VYESGDGSLLKNTKELLAHNLNNPTPRTKTSKSHDAR"
FT   CDS             166031..166675
FT                   /transl_table=11
FT                   /locus_tag="RUM_01590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16419"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9X4"
FT                   /protein_id="CBL16419.1"
FT                   /translation="MYDFEYVSKKEAAPAKNELIEIINKVQDILRNKDVSFQFQFIGSS
FT                   SRNMITCDRQSNIGYDFDVNLDVFYDDDRYDPGKIKHIMMDAFNSVVLRYGYGYCEDST
FT                   RVFTIKKIDHWRSRIMQSCDFAIVNNYTDKAGTVLQQYIRFNKEQRSYVWVDQTKGYYT
FT                   KPKEDWLKKHGYWDEVLERYLYKKNNNEGLVKKSRALYAEAINEIYMKHRA"
FT   CDS             166714..167610
FT                   /transl_table=11
FT                   /locus_tag="RUM_01600"
FT                   /product="Protein of unknown function (DUF2971)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16420"
FT                   /db_xref="InterPro:IPR021352"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9X5"
FT                   /protein_id="CBL16420.1"
FT                   /translation="MRLYRYVRALETIKCGDHDEASEVTDISEKLKKSIQESKLFFSHP
FT                   ASFNDPLECTIPITIENHEKKQKEYAAYLESIISEKVGSRNDESKRSKRIYEASEYGIS
FT                   LENCLVACFSRDGNNQLMWSHYADQHKGVCLCYELPDTPEEFKRQIEWSEQINSIKSDY
FT                   GLEVYGDSVDYQKKRPSLHISNTSLPVDKWSFDSDYAINDAIFTKPECWMYEKEWRLAL
FT                   ITPGASKKRFAAGIDTSNYYATLPREWLKSVTFGLRLEKEYCEKIKSIFKDNYYSTVEF
FT                   RKAKMVHDEFRIIIEPY"
FT   gap             170772..171644
FT                   /estimated_length=873
FT   CDS             complement(172003..174009)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01640"
FT                   /product="DNA-methyltransferase (dcm)"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16421"
FT                   /db_xref="GOA:D4L9X6"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9X6"
FT                   /protein_id="CBL16421.1"
FT                   /translation="MDKKQLTLGSLFSGSGGFELAGIYAGIKPVWLSEIEPYAVLVTHN
FT                   RLPDVKHYGDVSKLSGADLPPVDIITFGSPCQDMSIAGKRSGLDGERSGLFHQAIRIIN
FT                   EMRDSTNGKYPRYILWENVEGALSSNDGEDFRIVLQEICNIKTNAVSVPQPDKKWHRGG
FT                   VIMGNNYSIAWRLLDAQFFGVAQRRRRMFLVGDLDGRRAVAILSDESRLCGDFAQSFRA
FT                   GQGTAEGAAEGAGTAGTGRYCINTQGQSGVSVTVDHAGTLVAQDHGNHPAVLEAAGFCT
FT                   EHSAQARGIGYEEEKAPTLRAGVVPAALLFENHSADTRYRGPLDISPTLSATLGMGGNN
FT                   QPFVVHPPKAYGICAKHSNSMQSDNPHSGFYEANTARTIDTSDQSPVKNQGGMCVVAFE
FT                   PGAASRVGGHIYPDGKSGTLRTNAGDNQQAVVAPETFDVRFTSSGTKNARGHCYKTEIC
FT                   RCLDTGGQDLESNHRGIAVVNDTTETYALQGSMIGRSEKNGPQGSGVNKDVCFTLNTAD
FT                   RHCIAAPEGDHYSTSKNSHHTVAAHEQANTLVASDWKDPPLVNDNPNDEPVYIVRRLTP
FT                   TECARLQGLPDWWCKNLDNQNPTAEDIGFWRDVWNEWSDLNGKKRKSESQIRKWLADPY
FT                   SDSAEYKLYGNGIAVPCGYFVLSGIAWAAQDSE"
FT   CDS             complement(174002..174226)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16422"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9X7"
FT                   /protein_id="CBL16422.1"
FT                   /translation="MTKRECAIVTAYTGFSMLKGNDLGHLYRYLSGFIGRPVYSHEIPA
FT                   VAEAYREQIKQDFLALCRNATDTEVDADG"
FT   CDS             complement(174223..174726)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01660"
FT                   /product="DNA modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16423"
FT                   /db_xref="GOA:D4L9X8"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9X8"
FT                   /protein_id="CBL16423.1"
FT                   /translation="MTGENDAPCMIVFCAFQQIPEVIRQAEKYGFKNYIPLVFCKNYSP
FT                   QVLKANIRIVGATEYALVLYLGKLPKFRNTDANGKRHMIFDHFDWVRDGKDIPKIHPSQ
FT                   KPISVLKRLIEIFTDEGDVVIDPCACSGSTLRAARELGRHSYGFEVSKDFYTKACKQML
FT                   GGTG"
FT   CDS             175901..176527
FT                   /transl_table=11
FT                   /locus_tag="RUM_01690"
FT                   /product="Type I restriction modification DNA specificity
FT                   domain."
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16424"
FT                   /db_xref="GOA:D4L9X9"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9X9"
FT                   /protein_id="CBL16424.1"
FT                   /translation="MLAHGELPQHLRTYAVPKYKHFHLANPLTHTWEQCELGAIIQAVQ
FT                   ELTSDFENYPLYSLTIENGVTPKTERYERSFLITKETDLFKIVPEQCFVSNPMNLRFGA
FT                   IGFNDSGKKVSVSGYYDVFSIDRGECSNFWCVYLKTANSLKRFDDVAIGSLIEKRRVHF
FT                   SQLTEMSFPAPNMNEKKKLGEFFERLERLITLHQRKSKIGKMPLK"
FT   CDS             176540..177472
FT                   /transl_table=11
FT                   /locus_tag="RUM_01700"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16425"
FT                   /db_xref="GOA:D4L9Y0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Y0"
FT                   /protein_id="CBL16425.1"
FT                   /translation="MLQTFTKESLFHEYYAQWIKVYKEGAIRPVTLNKYLVTLEWLKKL
FT                   SPNLKLGDITRITYQQLINDYAETHERQTTMDFHHQIKCAILDAVDEGLIARDPTRKAI
FT                   IKGKTPRAKKPKYLNQFELHTMLNHLKLTPQISWDWFILLVAKTGMRFSEALALTPKDF
FT                   DFPHQTLSINKTWDYKHGTGFLPTKNRSSVRKIQMDWQTVIQFSGLVKGLPEDKPIFVK
FT                   ESQKVYNATINDILERHCKAAGVPVISVHGLRHTHASLLLFAGVSIASVARRLGHASMT
FT                   TTQKTYLHIIQELENKDIDIVMRSLSELS"
FT   gap             177607..178607
FT                   /estimated_length=1001
FT   CDS             178677..178898
FT                   /transl_table=11
FT                   /locus_tag="RUM_01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16426"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Y1"
FT                   /protein_id="CBL16426.1"
FT                   /translation="MNTQRDINLTFISSKGFDVFTVDGLNKALHWLQTADADNLMYGEP
FT                   SGDEFDIMVGEMRRPMLIASVEQAIAQL"
FT   CDS             178917..179513
FT                   /transl_table=11
FT                   /locus_tag="RUM_01720"
FT                   /product="uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16427"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Y2"
FT                   /protein_id="CBL16427.1"
FT                   /translation="MITREEAYTLLKKYNKDPFHIQHALTVEAVMKWYANELGYVDEAE
FT                   HWGIVGLLHDIDFELYPEEHCLKAPELLKDGGVSDDIIHSVCSHGYGITVGCGVTIDVE
FT                   PIHEMEKVLFAADELTGLIWAAALMRPSKSTKDMELKSLKKKYKSKGFAAGCSREVIER
FT                   GASQLGWELDKLLEMTLQAMAASEDKINAEMVAEG"
FT   CDS             179518..179835
FT                   /transl_table=11
FT                   /locus_tag="RUM_01730"
FT                   /product="Predicted protein tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16428"
FT                   /db_xref="GOA:D4L9Y3"
FT                   /db_xref="InterPro:IPR016919"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Y3"
FT                   /protein_id="CBL16428.1"
FT                   /translation="MHLLFLCSQNKRRSLTAEKLFDGQNGHQARSAGTENNARIKLTPG
FT                   LVGWADIIFCMEKKHVRRLKEKYSDIIADKTVICLNIPDDYSYMDDDLCELFESVVPEY
FT                   L"
FT   CDS             179913..180221
FT                   /transl_table=11
FT                   /locus_tag="RUM_01740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16429"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Y4"
FT                   /protein_id="CBL16429.1"
FT                   /translation="MTTDNNEVEQILDRDTYRRIKKMDRATLEGLIQDIFERGRKKGLA
FT                   EAGEIVDESMADDGGGTLDLRAVEAEIRGIKGIGEKRVEEIMLIFEKHLGILDEEGQ"
FT   CDS             180273..180437
FT                   /transl_table=11
FT                   /locus_tag="RUM_01750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16430"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Y5"
FT                   /protein_id="CBL16430.1"
FT                   /translation="MLLFFQSIMEESFSAAIKREPHGKHKADILSKAKRRLKPPNVSFM
FT                   RSQEQLIIT"
FT   CDS             180530..180643
FT                   /transl_table=11
FT                   /locus_tag="RUM_01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16431"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Y6"
FT                   /protein_id="CBL16431.1"
FT                   /translation="MPDSEMAAISEFTALPENLTYPAITPVLFEYLANKSL"
FT   CDS             180737..181225
FT                   /transl_table=11
FT                   /locus_tag="RUM_01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16432"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Y7"
FT                   /protein_id="CBL16432.1"
FT                   /translation="MKRVLVKSIHGAFDYVMKHYYPYGIAAEAAEQGALTDTYAVISIQ
FT                   DSHTGGFGVTFAENQFCKGVLTLYFDDIVTEVDGAVLFDDDMAESIINFIELHKTKVDT
FT                   LLVHCYAGQSRSRAVGAFAVEMLGGDNRKYFEEGAPNQYIYDVLESAWVRRQLGKIEF"
FT   CDS             181624..181761
FT                   /transl_table=11
FT                   /locus_tag="RUM_01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16433"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Y8"
FT                   /protein_id="CBL16433.1"
FT                   /translation="MLRKQFFEKYKEVDLPLPMTPIAQDKPFDFRKLEKKNGICHSLGY
FT                   "
FT   CDS             181807..182070
FT                   /transl_table=11
FT                   /locus_tag="RUM_01790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16434"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Y9"
FT                   /protein_id="CBL16434.1"
FT                   /translation="MDGYINIKGVQKPEEVINDLVTGFAMGDALFLSDARYWYLGGCDP
FT                   YSMYVNNTTGKVIAVIPYENQAICLSDSISNLVMYMKCELDY"
FT   gap             182385..182784
FT                   /estimated_length=400
FT   CDS             183264..183764
FT                   /transl_table=11
FT                   /locus_tag="RUM_01810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16435"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Z0"
FT                   /protein_id="CBL16435.1"
FT                   /translation="MDYFAELKTPAELFSEFTDYLESRLPSMESDLGVEFDVIEGGDYP
FT                   MAINESNHSATATITYCGIEIGSVVVSDCLNKESFSDSPISWLFLPFENFYELDISLVS
FT                   INGLGINGDYETQKEHLYFMNLQKKDSERNYYDYIFETESTVLMCLYTDNKLNSFTLKI
FT                   KNQ"
FT   CDS             183783..184577
FT                   /transl_table=11
FT                   /locus_tag="RUM_01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16436"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Z1"
FT                   /protein_id="CBL16436.1"
FT                   /translation="MKKIHCFKCYIAIISVILCWALWGCSTYNSSETEYVSEIATSDRS
FT                   VLTERQKHILAEESLPTDLDELTASQKRGIMNIENAFLYLDEKYPGIEFDYVSHYPAGL
FT                   MGQEKTDFIPKGYDKEDSRNLITVEKDRKGIFDDRNGYMLVAVRETMEKVITEYVESYF
FT                   GEGNVKVYIHPYLAEMEYGDEINENTVKDKVKSTAVLFASDELCTETQLDAFSDNYKND
FT                   GHDFECEFRATIIRKSDFEGLTFNNCGDMYDSDHIIYDIDIE"
FT   CDS             184597..184869
FT                   /transl_table=11
FT                   /locus_tag="RUM_01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16437"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Z2"
FT                   /protein_id="CBL16437.1"
FT                   /translation="MTYFTAEELCMIEMLTYFNEARNAIYGAVSLSVTDNNTFTYKTEN
FT                   KTIGEILSEFDSDKIAILKSNNSIIDTSYFISGKEWGAGNRIHIE"
FT   gap             185041..185230
FT                   /estimated_length=190
FT   CDS             186121..186231
FT                   /transl_table=11
FT                   /locus_tag="RUM_01840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16438"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Z3"
FT                   /protein_id="CBL16438.1"
FT                   /translation="MTILTSMISIIFGIQSKASTKKLRKTKIYIMTQIMV"
FT   CDS             188629..191295
FT                   /transl_table=11
FT                   /locus_tag="RUM_01860"
FT                   /product="Hemolysin-type calcium-binding repeat (2
FT                   copies)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16439"
FT                   /db_xref="GOA:D4L9Z4"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR003995"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Z4"
FT                   /protein_id="CBL16439.1"
FT                   /translation="MIRSTQAPGDDVVYGDAGDDAIIGGEGNDLIYGGDGNDTIEGNTG
FT                   NDTIYGGSGNDTITGNEGDDMLYGGDGNDMLDGGEGNDILDGGEGDDSLSGGTGDDTLS
FT                   GGDGDDTYYINADHGNDTIYDSEGRSTLVFGDELSAEDYALRIDIHSGISLVHHETGET
FT                   ISIPDFINMPEYYDFTFDGEAQIIGGGDSRQVIEGTDEDDVITGGSGFNIIKGGDGNDT
FT                   ITGGDNLNFIYGGDGDDTITGGNGINIIRGEGGDDTITDGTGDGYLDGGDGNDTIHAGA
FT                   GNDILIGGAGNDRLFGEDGDDVIAGNDGDDYLSGGDGNDTLYADAGNDELHGGNGNDSL
FT                   FGGDGDDTLYGDAGDDYLEAGNGTDTLYGGTGNDIFVGGEGINYIYGEDGNDTFYGGNG
FT                   LNYMYGGDGDDNFTGGELADYIEGGAGNDTMNGGNGNNEMYGGDGDDYIYGGDGDDYIY
FT                   GGNDDDYIEGGNGDDHLYGGNGVNTIYGGAGNDIIYSGDHGSFLYGGDGNDRIYAGGGA
FT                   DVLDGGAGNDYLQGDHGGDTYIFGIGYDIDTINASADLNTIRIHGYTVADMHNTRMANN
FT                   DLVIDFGEGTGDRLVIQGFFNFNSNRDFNFVFDDETVLGQYDIQAASAPIIGTDADEWL
FT                   AIQGNDGGVIHAGAGNDGLSGGSGNDELYGEAGNDTLYGNDGNDMLDGGAGNDSLNGGN
FT                   GEDTYIFAKGYAQDTINEWGSDHSIVMLTDINSDEITVSDQWGSNLLISVNGTDDVLTI
FT                   SNFKWGQSTFTFKFADGAEGYVDKDTWQLVLTKQPDEIEDTEQVNAELLESLYADDTCL
FT                   SDLLTDGSTVITDMTESTVLTDENDDISDVTDIQAMLLAENMSAFGNNDQISDSVNITD
FT                   ITVDTSLTDSLLVGALQ"
FT   CDS             191365..194736
FT                   /transl_table=11
FT                   /locus_tag="RUM_01870"
FT                   /product="type I secretion system ABC transporter, HlyB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16440"
FT                   /db_xref="GOA:D4L9Z5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003997"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR010132"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Z5"
FT                   /protein_id="CBL16440.1"
FT                   /translation="MAKKQDSGLSCFMIVMKFHGIPITKEQAENLSVLDPVQKTGEIEI
FT                   MQSAKALKMKAKLCNLNIKKLKDVNAPMIAKGNDDEFFIIAKSQDDKFMILHTDKPAPE
FT                   VVTRDELAKMWDGTAIIINKKGVIDREAVFSFKWFIPTILKFKKEFIQVLIAVFTIQIL
FT                   GILTPVMTQVVVDKVLVHRSISTLHVLTIGIAIVYIYELILGLAKNYVFTHTTNRIDVM
FT                   LSFRLFKHLFALPLKYFESRRVGETVARVRELDSIRNFLTGTPLSSMIDLIFIIVYIVV
FT                   LFCYSKMLTVIVICSIPVYAILSAIVTPLFKKRLDEKFETGANTQSFLVESITGVQTVK
FT                   SYALEPKFEKKWGDLQAEYVKASYKTSMVSATAGTTGQFIQKVFDLLILFFGAKAVMDG
FT                   NFTVGQLVAFRMLSGRVSGPVLRLVQLWQEYQQASLSVKRIGDIFNTAPEPILNANQSS
FT                   MPRVQGKIIFDQVHFRYNPQGGEVIKGMSFEIPAGMVVGVVGRSGSGKSTISKLIQRLY
FT                   IPEAGKISVDGMDISLVNPAMLRKQIGVVLQENFMFNGTVAENISIHCPTATMDRIIEC
FT                   AKIAGAHDFILELPNGYDTIIGEKGMGLSGGQKQRVAIARAILNDPRILIFDEATSALD
FT                   YESESIIQNNLKEICKNRTVIIIAHRLSTLKDAQKIMVIDKGNLVEYDTHEKLMTLNGL
FT                   YAYLYIISSKGVRSMDKAQKDYVLRHSSKRDKELKYDFMPSMLEIIERPAHKAGTVIIL
FT                   GVFTLLIAAIVWACLSKVDIVVTSSGTMQPVGNISSLNTYTSGTVKSINVEEGAYVKAG
FT                   DVLIELDTQSIDIDVEALSQQKEVLEAQKEIYTMIKNGEDVSTVDITKYGANLQPYILT
FT                   IIDNEKAYQNNLSILESTKENAGLTRDIAQIKYDDYNTNPMISVAEFNAQKLVLQQAEN
FT                   EYLQAELNILNAQTSYSEQINSNISDINSKLKQADSELEKYQLSLDYQKVIAPVNGYIN
FT                   SIAVNNVGETVTSAQQIITIVPADAPVEMACYVKNMDIADIMVGMEAEIKLEAYPYNKY
FT                   GTVKGTVKYISPSSFNSEQLGSVYLVKLDVDNTNPGINVMSGLSGSVEVKIGKQSVMRY
FT                   FLDPIVKGFDESLKEK"
FT   gap             195317..196932
FT                   /estimated_length=1616
FT   CDS             196946..197413
FT                   /transl_table=11
FT                   /locus_tag="RUM_01880"
FT                   /product="HNH endonuclease."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16441"
FT                   /db_xref="GOA:D4L9Z6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Z6"
FT                   /protein_id="CBL16441.1"
FT                   /translation="MSEHQHDSTAAPLWMYFQTVINWVNTIFPKWRKEMKGLDWGRLYH
FT                   EHKSDVLDPAALETKITALMADKEVTKNSGIYEYLLTGKEKYLSRRQFDEEDARTVYEQ
FT                   QQGICPICGQHFDFEKMHADHITPWHAGGKTVPENLQMLCRDCNLKKSGQE"
FT   CDS             197652..198956
FT                   /transl_table=11
FT                   /locus_tag="RUM_01890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16442"
FT                   /db_xref="GOA:D4L9Z7"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Z7"
FT                   /protein_id="CBL16442.1"
FT                   /translation="MKNAILKSISATNFGPFNGTIEFDMETSVPKGQIIENHTFFAGDN
FT                   QQFNKIAYIYGANGSGKSNFCKIILQIQRTIMLSPIRASNNPQLLDMLPLKDELAVQRN
FT                   HFKFDVSGKERATSYSIQILIDDVLYTYSFSIAENYDVISEKLTKKKRRTETILERTSP
FT                   KYESITLKSELKPFQDNVHVVKDNALCLSMASFLNNKLATTIVSTITNIQVVNMAAFRG
FT                   LSNLSEETFSAEKKEEYLRILKSADPTLEDIQVEFNEKKVEKHSLDSDDLENRAVVLKS
FT                   VRVDVKSTHSIYDNHKAVSQSKLPFLQIESNGTIKLLDILPTIFDALSTGNILIVDEIE
FT                   NGLHPTVVKKMIELFYNPETNPHNAQLICTTHNILLINEAVQRDEVWLMDKNEFGESSM
FT                   IHISDIPGLRSYDKLGQKMIEGAFGAMPNIINNMQ"
FT   CDS             199160..199324
FT                   /transl_table=11
FT                   /locus_tag="RUM_01900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16443"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Z8"
FT                   /protein_id="CBL16443.1"
FT                   /translation="MATKTKTGQKAPVSGQYKPVGSKTEVTLVKGKTVPPTPKGATTFV
FT                   LVDKTKHGK"
FT   CDS             199333..200106
FT                   /transl_table=11
FT                   /locus_tag="RUM_01910"
FT                   /product="Domain of unknown function (DUF1883)./TIR
FT                   domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16444"
FT                   /db_xref="GOA:D4L9Z9"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR015073"
FT                   /db_xref="UniProtKB/TrEMBL:D4L9Z9"
FT                   /protein_id="CBL16444.1"
FT                   /translation="MKFIHTDLGNLDKGRIVEIVLKGNAANVQLLDSTNFNNYKNGRRY
FT                   HYTGGLAKQSPVRLAVPHSGHWHVAIDMNGLRGTVNASVRVLPTALPTIKQQPSLASMP
FT                   SLVHNRGFGIDVDIDNDPEYDVFISHASEDKDEIVRPLANALVEKGVKVWYDEFEMKIG
FT                   DSLRRKIDKGLANSRFGIVVISKDFIKKGWTNYELDGIITKAVSGEQIILPIWHNITKK
FT                   EVLDFSPSLADKLARNTAINTVDEIATEISELILQ"
FT   CDS             complement(200371..200841)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01920"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16445"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA00"
FT                   /protein_id="CBL16445.1"
FT                   /translation="MRIKTVCFTGHRELPADDLPEISKHLEDTLVKLIEQGYRYFGAGG
FT                   ALGFDTLAAQVVLRLRERYPQIRLILVLPCLNQTRGWPQEDIDTYEEIKRCADKVTYTS
FT                   EHYFRGCMQKRNRHLVDNSSACICYLTKPAGGTAYTVNYASEHGLTIINIAK"
FT   CDS             200983..201315
FT                   /transl_table=11
FT                   /locus_tag="RUM_01930"
FT                   /product="Predicted transcription factor, homolog of
FT                   eukaryotic MBF1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16446"
FT                   /db_xref="GOA:D4LA01"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA01"
FT                   /protein_id="CBL16446.1"
FT                   /translation="MSDIAKIIGQRIRNYRTQKGLSQEKLAELAGCHPTYIGQLERGEK
FT                   NATLESVEKIASAMDISLSELFDKLGKSGSNNIAAKCYDLVASKNEAEQKQLYKMLQEM
FT                   DKYKNQ"
FT   CDS             complement(202715..204094)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01950"
FT                   /product="glycyl-tRNA synthetase"
FT                   /function="glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16447"
FT                   /db_xref="GOA:D4LA02"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA02"
FT                   /protein_id="CBL16447.1"
FT                   /translation="MINTEKTMDKIVALCKGRGFVYPGSEIYGGLANTWDYGPLGVELK
FT                   NNIKQAWRKKFVQENKYNVGLDSAILMNPQTWVASGHIGGFSDPLMDCKECKTRHRADN
FT                   LIEDFDGTNPAGWSNEQMMNYIKEKEIPCPSCGKKNFTDIRQFNLMFKTFQGVTEDSKS
FT                   ELYLRPETAQGIFVNFANIQRTTRKKIPFGVAQVGKSFRNEITPGNFIFRVREFEQMEL
FT                   EFFCKPGTDLEWFDYWRSFCKNWLLSLHIKEENLRLRDHDPEELCFYSKATTDFEYLFP
FT                   FGWGELWGVADRTDYDLNQHIKTSGKQLDYFDPETNERYVPYVIEPSLGVERLFLALLT
FT                   EAYDEEEIAPGDVRTVMHFHPALAPFKAAVLPLSKKLSEKATEVYEMLAKHFPVDYDES
FT                   GSIGKRYRRQDEIGTPFCITYDFDTLEKDNCVTIRDRDTMEQERVAISDLVAYLEKKIE
FT                   F"
FT   CDS             complement(204158..205225)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01960"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /function="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16448"
FT                   /db_xref="GOA:D4LA03"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA03"
FT                   /protein_id="CBL16448.1"
FT                   /translation="MEIKFEKAASLKAKPTDESALGFGKIFTDYMFVMEYETGKGWHNA
FT                   RITPFADLSLSPAAMCLHYGQEVFEGMKAYRRADGGIQLFRPRENFKRLNQSNQRLVIP
FT                   QINEEDALQGLEELLKVEKDWVPHSKGASLYIRPFIIAVDPFLGVHPGDKYLFIIILSP
FT                   SGAYYASGLNPVNIYVESKYVRAVRGGMGFAKTGGNYAASLIGQDEAHKQNYSQVLWLD
FT                   GVEQKYIEEVGAMNIFFVIDNEIVTPMLQGSILPGITRKSTIELCKSWGMKVSERRIDI
FT                   QEIADAYDAGKLQEVFGTGTAAVISPVGHLKWNDKVMEINDNKIGPISQKLYDTMTGIQ
FT                   WGEIADPFNWIEKID"
FT   CDS             complement(205282..205404)
FT                   /transl_table=11
FT                   /locus_tag="RUM_01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16449"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA04"
FT                   /protein_id="CBL16449.1"
FT                   /translation="MKNLMKAVLVIAAVLGALVSVKLALDLYDEKIRRCYIRAN"
FT   gap             205691..206142
FT                   /estimated_length=452
FT   CDS             206503..208287
FT                   /transl_table=11
FT                   /locus_tag="RUM_01980"
FT                   /product="CDP-Glycerol:Poly(glycerophosphate)
FT                   glycerophosphotransferase."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16450"
FT                   /db_xref="GOA:D4LA05"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA05"
FT                   /protein_id="CBL16450.1"
FT                   /translation="MFGGIKYRINRLQDMAFRRYISHYIVQAMQLNTQRNKVITCDFIL
FT                   EADTSPQDEFELFKYIYGQHNEYFVPYYIINEHCAAYPEIKAKYGDNIIPYSAENIVSF
FT                   AFYMKELFKTTKFICGGFQVLHALCLGITDGCKRSPYVYSFFTQHGVNFFKDNFISQSS
FT                   YSAFLFDKIMISNDFEKNLFMNRACYKEENLVKNGLFRWDLLSADHAQSNKSIFIYFTH
FT                   RRYLRNIEDIQDTVYVRTITSLLRNKEFNRLIEENGYTVQVALHHTVLQVCGNDILQGV
FT                   QILKDEEIADAKKNAALLITDYSSMCFEMWFQHKPVIFLNVPDTEDCLTYGHKTDLPAP
FT                   YSGKEDYIFNVAQNVDECVSMLGHYFATGFRFSQEECQKRDRFFYYNSDFCARFYQYLV
FT                   DTRNDTKTLYHLPVNFSMEFARCPDINTYAIELPTPHGRWVVRKKAHFSFFVPTDSKDL
FT                   AIQIRFRPYLRYKQYKFFAKVGVNGHWLPRREVFTRGIKAFVLDVPRSWIGADGKIEIQ
FT                   FKFSHVYKRSQLRIPGGDQRYLSIQLLTMDLLERDHSFAEVKDQFEAINEERARQRALL
FT                   EQGQDEEWSNQHDTDADE"
FT   CDS             208265..209044
FT                   /transl_table=11
FT                   /locus_tag="RUM_01990"
FT                   /product="ABC-type polysaccharide/polyol phosphate export
FT                   systems, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_01990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16451"
FT                   /db_xref="GOA:D4LA06"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR030194"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA06"
FT                   /protein_id="CBL16451.1"
FT                   /translation="MTQTLMSKFQKHRFLFEELVKRDFKKKYKRTVLGMFWSILSPLLQ
FT                   LLVMSVVFVKFFGRSTPHYTIYLFAGNLTYSFFKESTTGGMNSLMMNANIITKINVPKY
FT                   LFLLSKNVSSLINFGLTLIIFFLFVAIDGIPFTPKFFLLLFPILCLIVFNIGVGFILSA
FT                   MFVIFKDIQYLYDIFTLLLMYLSAIFYPVDSFSTTVQHLFYVNPMFTYISYIRSIVLYN
FT                   TIPPLWHHGLCLLYALLAISIGALIYKRNNYKFLYYM"
FT   CDS             209055..209795
FT                   /transl_table=11
FT                   /locus_tag="RUM_02000"
FT                   /product="ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16452"
FT                   /db_xref="GOA:D4LA07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA07"
FT                   /protein_id="CBL16452.1"
FT                   /translation="MKKVTLQNISVRYITGDFTDIGLKDYVIQKLKRQYHVKEFWAVND
FT                   VSFSLEEGDLLGIVGSNGAGKSTLLKVISGIMCPTTGKMSVEGTIASLLELGTGFDGEL
FT                   TVRENTFLRGAMLGYTREFMNKKYEEIIDFSGLGEFQDRRFKQLSSGMKSRLAFSIACL
FT                   VNPDILILDEVLSVGDGAFRKKSERKMAEVIKNGATTLLVSHSLDQIRRMANKVLWLDK
FT                   GKQIEFGDTKTVCDHYAAFLKEKK"
FT   CDS             complement(210074..210136)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16453"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA08"
FT                   /protein_id="CBL16453.1"
FT                   /translation="MQHPKLHIPMMLHKTQKGEI"
FT   gap             210140..210419
FT                   /estimated_length=280
FT   CDS             complement(210643..211038)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02020"
FT                   /product="Thioesterase superfamily"
FT                   /function="Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16454"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA09"
FT                   /protein_id="CBL16454.1"
FT                   /translation="MKEFALGTKGEAETQVDESRLACTVGSGSLPVYATPMMVALMEQA
FT                   ACVAVRDALEEGETSVGTALNILHTAATPPGMEAHAVAEVTEVSGREITFHVVAYDRCG
FT                   KIGEGMHKRVVVRAERFLEKTNGKMAK"
FT   CDS             complement(211058..212065)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02030"
FT                   /product="Phosphoglycerol transferase and related proteins,
FT                   alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16455"
FT                   /db_xref="GOA:D4LA10"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA10"
FT                   /protein_id="CBL16455.1"
FT                   /translation="MSEAFADFRPVAKRLGLQTNAYKQFDAVGAEGCKGTAVVPTFASF
FT                   TVRTEFELLFGLPVRSLNDPNMPQQLMEDRPQPTLARYYKENGYATAYVHPFLSTFYNR
FT                   EEVYSNFGFDTMLFEDDFTVDVNYYGAYIDDETVFNQILKLVQDTDQPLYLHTTTMQNH
FT                   QPYNKGEDPDAEFDNYLTWIARTGDSLRAFTNALKKLEEPTIVLFVGDHFPSLKGEDSV
FT                   YDQLGINGNNCQVLYEQSYYLWSNYKLDYSGVPDTELSAFYLPYVVMDLAQIPRDSYLQ
FT                   RMHDKMQSLPVYATNYDPDGARDSMLDMLTYDRICGEDLSGQELIEKTEPETKN"
FT   CDS             complement(211989..212882)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16456"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA11"
FT                   /protein_id="CBL16456.1"
FT                   /translation="MQKMLNRLRSGITALNQRRDRNTGRYAVTNFLLTALFPLFIVCMA
FT                   ELNQDKYPSKLILFCVERPSVMIFNVLMAALIFGMLLLLFKRGWRAMAVQSFVYMLLSV
FT                   IELFKFGTNGNHLLLSDMKLANSLKSISSFAYIQITPQLITYLLVVTAYVGAAFWFNPR
FT                   QRLKLSRRLISAGACLATFAAIVAVPGVSSTVYGLFDVDTSEADNTIPVEREVRQQQLS
FT                   GVFRTDHLRGAGKPAPGAGGVRSGRHPDHAGGKCGSDRAERQGAAQCDRGHVRGLCGFP
FT                   PGCKAAGASDQCLQAV"
FT   CDS             complement(214222..215451)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02060"
FT                   /product="Predicted nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16457"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA12"
FT                   /protein_id="CBL16457.1"
FT                   /translation="MKISGIVCEYNPFHNGHAYHIAKTRENGATHIVAVMSGNFVQRGD
FT                   AAVLGKLTRAQIAVASGVDLVLELPVAYSLAPAELFARGAVFLLRGLGCVEELSFGSEC
FT                   GDPARLSQAVKASVSCGKSDAMHQLLREGLPYPRAMRRLVLEQYGEELARVFDGPNNLL
FT                   AVEYLKAMIFLGAKLQPFTVPRKSAMHDMLEGHSGSIASASFIRSCIEENEEYDELVPL
FT                   LTAHALAQAGSSGCIGRLRNLERLILYRLRTVTQQELEEQFEMGPGLDGRILGARNSNS
FT                   LDEALHAIKTKRYPMARIRRLLLCLLMGLRKEDLQTPPPYGRVLALNERGCEILAAAKG
FT                   KSTIPFATSLAKLGEISPQARRYAELEARAADVYGLATRCITSSEQEYRAKITLTPPQE
FT                   QETTETTEQE"
FT   CDS             215705..216913
FT                   /transl_table=11
FT                   /locus_tag="RUM_02070"
FT                   /product="acetate kinase"
FT                   /function="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16458"
FT                   /db_xref="GOA:D4LA13"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA13"
FT                   /protein_id="CBL16458.1"
FT                   /translation="MKTMIILVVNAGSSSLKYQLIDMKDESVIAKGNCDRIGIDGHISH
FT                   KTLDGRTLNEDCDFPTHTEAFMKLVDVLTKGDASVIKSMDEISAVGHRIVQGAEIFDKP
FT                   VLVTDEVIQQIDDLKELAPVHNHAHALALWACKKVMPANVPQVVVFDTAFHQTMPEKAY
FT                   MFGLPYEDYENYSVRKYGFHGTSHRFVSNALAQALGKDIKDLKIVSCHLGNGSSITAVQ
FT                   GGKSIDTSMGFTPLDGLLMGTRTGCVDPSAVTFVAEKHHFTPSQMSEYMNKKSGFLGVS
FT                   GISSDNRDITAAAEKGDKRALLAKDILVYEIKKYIGSYAAAMNGLDAVLFTGGIGENSD
FT                   DVRAEVCRNMDFFGIKLDEEANNGCRGQLKRISAPDSRVEVWIVPTNEELLIARDTLSL
FT                   ISK"
FT   CDS             complement(217436..217672)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02090"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16459"
FT                   /db_xref="GOA:D4LA14"
FT                   /db_xref="InterPro:IPR009242"
FT                   /db_xref="InterPro:IPR023218"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA14"
FT                   /protein_id="CBL16459.1"
FT                   /translation="MTQEKMDRISALYRKSKAEGLTEAEKQEQAALRQEYRDSVRKSLA
FT                   GQLEHTYIIDETGKHKAEEYFEEKKAEAKKHQS"
FT   CDS             217750..218466
FT                   /transl_table=11
FT                   /locus_tag="RUM_02100"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16460"
FT                   /db_xref="GOA:D4LA15"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA15"
FT                   /protein_id="CBL16460.1"
FT                   /translation="MKPVTLITGGSRGIGAACVRIFAAQGRRVWFTYYQSEAAAQQLAA
FT                   RTGAVPIRSDVSDPACNAALAEQISAAGGLELLVNNAAVSETELFQCLSPERAARLYGV
FT                   NYLGAADLTRRLMPLLLQRHGGCILNIASMWGQTGASCEADYSASKAALIGLTRALAKE
FT                   AGPSGVRVNCISPGVIATDMNGHLSPEELQALAEETPLGRLGTPEEVAQAAAFLASEQA
FT                   AFITGQVLGVNGGFLI"
FT   CDS             218644..218946
FT                   /transl_table=11
FT                   /locus_tag="RUM_02110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16461"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA16"
FT                   /protein_id="CBL16461.1"
FT                   /translation="MKKRTIFALLAASAAVAAGAAYVLSRKKHGCCCDYDAGDLEDDCD
FT                   CCNCELDGDCPVEDLDDAEMPAVDVDDAETGETAEAPAENAPAEDADKSADKTEA"
FT   CDS             219287..220756
FT                   /transl_table=11
FT                   /locus_tag="RUM_02120"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /function="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16462"
FT                   /db_xref="GOA:D4LA17"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA17"
FT                   /protein_id="CBL16462.1"
FT                   /translation="MLSDANKFSKEGLTFDDVLLIPGESDVTPNMIQLGTTLAGKVKLK
FT                   TPIMTSAMDTVTESKMAIAIAREGGIGIIHKNMSIEKQADEVDKVKRSENGVIVNPFSL
FT                   TENHFVYDADELMGKYKISGVPIVDNEGKLVGIITNRDMRFMTDFNTRIADVMTKDNLV
FT                   TAPVGTTLQEAQEILRAHKIEKLPLVDQDGYLKGLITIKDIEKSVQYPNSARDERGRLL
FT                   CGAAIGVTADILDRAKALIDAQVDVLVLDSAHGHSANIMRCVKMVKEAFPDTPVIAGNI
FT                   ATAEAAEALIQAGADALKVGIGPGSICTTRVVAGIGVPQITAVYDVACVAEKYGIPVIA
FT                   DGGIKYSGDIVKALAAGANVVMLGSLLAGCEEAPGATEIFQGRQFKVYRGMGSLGAMEC
FT                   GSKDRYFQEGAKKLVPEGVEGRVPYKGVVADTIFQLCGGIRSGMGYCGCKDIPTLHEKA
FT                   KFVRITGAGLKESHPHDIYITKEAPNYSAQI"
FT   CDS             220947..221393
FT                   /transl_table=11
FT                   /locus_tag="RUM_02130"
FT                   /product="Protein of unknown function (DUF3036)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16463"
FT                   /db_xref="InterPro:IPR021354"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA18"
FT                   /protein_id="CBL16463.1"
FT                   /translation="MKWTPTASLRLTTILNWVALGVVTFLMFFIPVMAKWYDDVSLAPP
FT                   IFLPLCICLYLSAGLGLTALLSLARLLHNLNRNRIFVAQNVTCLRLISWCCFGVALVFL
FT                   VLAWFRSLGLLVAFAAAFFGLILRVLKNVFARAVALQDEADYTI"
FT   CDS             221406..221630
FT                   /transl_table=11
FT                   /locus_tag="RUM_02140"
FT                   /product="transcriptional regulator"
FT                   /function="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16464"
FT                   /db_xref="GOA:D4LA19"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA19"
FT                   /protein_id="CBL16464.1"
FT                   /translation="MPIVVNLDVMMAKRKISSSQLAEQIDLTPANLSILKNNKAKAMRF
FT                   STLARICKALDCQPSDILEYIPEEEDTHD"
FT   CDS             221623..223236
FT                   /transl_table=11
FT                   /locus_tag="RUM_02150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16465"
FT                   /db_xref="InterPro:IPR025231"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA20"
FT                   /protein_id="CBL16465.1"
FT                   /translation="MTEQNPDLRIPEPVPDPKPDEAPAPDAAATPDPAAQSGEQTFVYA
FT                   GLPRIPAHFTRSQKLLAFCCPLAGFGVLRYMILHALGLPATLVCWGVLTLGILFLKRTP
FT                   RIRFTWSHRCMAAVLYLFPLLFCISDNKTMTGLCALYELAGIPFFFYHVASGEAALPRC
FT                   LPLALYKALLDYPGQNNLMFPAIRQCLQKRKLSRNALYVLGGLLLGLPLTLLVYALLLS
FT                   VDQNMGILTDWIRADWYRNLMIYLVQLLLGLPIGMFLYNSLYNNATRRNIRSLRQSDCT
FT                   RILEGMRIAPGMLLYAIMTPVCFVYAVYIGLQASYLFSGFAGTLPEGFSYAGYARSGFF
FT                   ELCFLSVLNFLLIALLFLTCRRQGDARPLPLRIYSSILCVITLLLIATSESKMCLYISE
FT                   MGLTPKRVYTAWFMLFLALVFLMLLLRQFRPRFHLARGVLVTGTLMLGLLAFSLPDAWI
FT                   AAYNLNAYKAGKLPQLHISDFVDLSDDAYLLYPDYRQQLEEMSPSVYEIHLTRRWEKDA
FT                   KDPFRQYNYATWRFMKRYLP"
FT   gap             223509..223784
FT                   /estimated_length=276
FT   CDS             complement(223895..224371)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02160"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16466"
FT                   /db_xref="GOA:D4LA21"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA21"
FT                   /protein_id="CBL16466.1"
FT                   /translation="MMQVRLVTVGKLKEQYLREACAEYAKRIGRFAKLQILELEEARLP
FT                   ENPGEKEIAQALEAEASAIEKACAGYVIALCIEGKQQKSEAFAGLLTRLGVQGQGTVTL
FT                   VIGSSFGLAERIKRRADLRLSMSEMTFPHQLARVMLLEQLYRAFQIQAGGKYHK"
FT   CDS             complement(224373..225155)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02170"
FT                   /product="Metal-dependent hydrolases of the beta-lactamase
FT                   superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16467"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA22"
FT                   /protein_id="CBL16467.1"
FT                   /translation="MARIYPLFSSSKGNASFVGSPHGGVLIDAGVSCKRLMQALGDCGI
FT                   PESAIRGIFITHDHSDHIKGLRMVTKRLKVPVYAQAQTLEKLIAGEHLAPGCPAQVMEG
FT                   AVTAGDAELTAFDIPHDTVQSCGYRIRTGDGRTCAVCTDLGHVTPTVHQALLGCDLVLL
FT                   EANYDPRMLANGPYPGYLKQRIASERGHLSNPDSGALAAALVAAGTTRLILGHLSQENN
FT                   TPALAEQTVEQALGQFRRNGDYLLEVAPVETTGRMVVF"
FT   CDS             complement(226645..227325)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02190"
FT                   /product="Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16468"
FT                   /db_xref="GOA:D4LA23"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA23"
FT                   /protein_id="CBL16468.1"
FT                   /translation="MLLCGVMLAGGVTGCGKKEASLSEEKIINYDMPAEGEKIVELNIK
FT                   DYGTVKIRLFAEECPKAVENFLGLVEQKYYDELIFHRVVKDFVIQGGDPKGNGTGGESM
FT                   WGTGFKQEISSKLCHFEGALAYAVASDKLNNSQFYIVTGDTVTEQTFEQLKAYGKTYSD
FT                   QVKQMYYEHGGQPYLDGDYTVFGQVIEGLDICKKINDVAVDSKSKPKEQVTIESMKVTE
FT                   YHAQ"
FT   CDS             complement(227607..228536)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02200"
FT                   /product="Beta-propeller domains of methanol dehydrogenase
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16469"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA24"
FT                   /protein_id="CBL16469.1"
FT                   /translation="MRHWKQIVSVLCLVCMTLLLTMPAAALSSKDADHAYPIHKDNCGL
FT                   YDVEGNLPEDEAAELTQKIRDTAEELQMYVAVVIVGEETPFSGDSAVERYADDAYDELF
FT                   NQEYGVNTDGVLLVVNNSTQYDYISTCGMGQFYYTNSDDSNRVDDMLVAMHSALVAGDY
FT                   PRVVEQFCQQLVQYKNQGVPKGYYTYNSGSKTYLYLDDNGKLIEADRLPFKWGWWIFIA
FT                   SIVGAGVALVVYFCIKSQYKFKAAPSPTTYVCHNKVKMDVQTDTFLREYTTKTKIETSS
FT                   GGGGSRSGGGSSHHSSGGSSHGGGGRHR"
FT   CDS             complement(229682..230974)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02220"
FT                   /product="Putative virion core protein (lumpy skin disease
FT                   virus)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16470"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA25"
FT                   /protein_id="CBL16470.1"
FT                   /translation="MGILKAVAGAVTGGLADSWLEVVEPDNMTATTVCTRGVQVSNKRS
FT                   SNKKGTENIISNGSVIHVGVNQMMLLVDGGKIIDYSAEPGYYEVYLSSTPSMFNGELKD
FT                   SIKETFSRIKFGGQPSGSQQVYFINLQEIKGIKFGTRNALQYFDNFYNAELFVRCHGSY
FT                   SIKITDPLKFFSEAVPRNAEHVDINDINDQYFDEFLSALQAAIGQMSVDGQRISALPSK
FT                   SLELAKYMSNVLDADWNELRGMEIVSVGVASISYDEESKKLINMRNQGAMLSDATIREG
FT                   YVQSTVAGGIQAAGSNTAGAGNAFMAMGMGMNAAGNFMGAASATNAAQMQMQQQQQAAQ
FT                   ALKPNGAVQQMDDGAWTCQCGQMNSGKFCSNCGGAKPAPAGSWTCKCGQVNTGKFCPSC
FT                   GSPAPQAGTWTCACGSVNEGAFCSNCGRKRG"
FT   CDS             complement(231151..232248)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02230"
FT                   /product="Cellulase (glycosyl hydrolase family 5)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16471"
FT                   /db_xref="GOA:D4LA26"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA26"
FT                   /protein_id="CBL16471.1"
FT                   /translation="MKRCIALALSVCLLLFGCADSSSQQGSQADRRIMVEGTSFKVDGK
FT                   ELWFNGVNTPWDNWNDFGGEYDAQFWDEHFAQLHDKGINASRVWISCNGEVGVKIKEDG
FT                   SVTGLKDKMWEDLDSFFEIARKHEIYIMATLMSFDHCKDSNSKHQRWRTMLQSEEMSQT
FT                   YVDNYVIPFVKRYDDNDYLFSVDLCNEPDWIVENSECGQLQWQDLSRFFAQCAAGVHQN
FT                   SDVLVTVGMGMVKYNSDNYSGNYVSDKVLKGFAGEDAFLDYYSPHFYEWQVANWGNAFE
FT                   KSPKDFGMPVDRPVVLGECPAEGLKNAKKPLTQCTDSAYSNGWQGVFAWTSNGVDDCGG
FT                   FDQVSASAEQMYQKIPELIFPAGKS"
FT   CDS             complement(232625..233632)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02240"
FT                   /product="Galactose mutarotase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16472"
FT                   /db_xref="GOA:D4LA27"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA27"
FT                   /protein_id="CBL16472.1"
FT                   /translation="MNTTQQIEWNGTPCIELCAGGYRAWIAYEIGANVIRFRDEERGME
FT                   IFRYREDNNAEHIKQSPEVWGLPTLYLPNRFADGVLKTSDAVYQLPVNEAAPYNNHIHG
FT                   FLHKRAHTVVEHHADDNCAVLKTQYRYDENDPFFEYLPIRFLAEYTFTLSACGLEHKVR
FT                   LTNLSDKMMPISVATHTTINTPFVDGGKEEDIRLTVPIGKRCELDERCLPTQRFIDLKL
FT                   YDLEYKNGTKCPVLQDINNDMYFAEETELEGQSFYGAIVEDTASGKRICYQVSPEYKFW
FT                   IIWNDRGFNGYFCPEPMTAMIDAPNLELPRETTGYREIRPHDTFEANQRFFTMD"
FT   CDS             complement(233716..234618)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02250"
FT                   /product="phosphatidylserine decarboxylase precursor"
FT                   /EC_number="4.1.1.65"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16473"
FT                   /db_xref="GOA:D4LA28"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA28"
FT                   /protein_id="CBL16473.1"
FT                   /translation="MGIIRRRDGSQTVTDETQDRALAFLYRTAPGRSLLKLLVQPWVSA
FT                   LGGAALDHPLSTVLIPGFVRHFQMDLSDYQKETYRSYNAFFTRQIRPEARPVDPDPAAL
FT                   ISPCDAKLTVYPITPDSCFPIKQSLYRTGDLLGCHRLARRFAGGQCLIFRLTVEDYHRY
FT                   CYPEDGVKSRNRLLGSELHTVNPIALEGYNIYKRNCRSACLIRTAHLGTIAMIEVGALM
FT                   VGKIVNHHGAGNVRRGAEKGMFRFGGSTVVVLLQKDAAVLDPDILQNSAEGVETAVHYG
FT                   ERIGTAQQCSHCLDKQGAV"
FT   CDS             complement(234622..235242)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02260"
FT                   /product="Phosphatidylserine synthase"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16474"
FT                   /db_xref="GOA:D4LA29"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA29"
FT                   /protein_id="CBL16474.1"
FT                   /translation="MIGFYNYTVLLTYAGFACGCCGIYYALSGHPGIGIILLLLAGFCD
FT                   MFDGKVARTRKRTDAEKQFGIQIDSLSDLVCFGLLPAVIGYASGLNRPLDLAILVFFTL
FT                   AALIRLAYFNVTEDQRQKQTSEVRKVYEGLPVTSVALIFPPLFSFRHDIGALFPQVYGT
FT                   LLLVVGLAFITRFKIKKPGIRCMFAFIGIGALELAWLLYKSRG"
FT   CDS             complement(236998..237519)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02280"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16475"
FT                   /db_xref="GOA:D4LA30"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR023812"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA30"
FT                   /protein_id="CBL16475.1"
FT                   /translation="MMEKEKKLRNMVYTGLFAALICLTTAFILHIPVGNGYIHLGDSFI
FT                   YLAACMLPMPYGILAAAIGGSMADLLSGYAIYAIPTAIIKSMLAGCFYSMGVSRTKTLL
FT                   SRRSVIASVACVAITVVGYYLTAVILYGNPVAQIAETVPANLVQAGCSAALFCIAAFAL
FT                   DRVKLPMLRR"
FT   CDS             complement(237648..238502)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02290"
FT                   /product="Pyridoxal/pyridoxine/pyridoxamine kinase"
FT                   /EC_number="2.7.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16476"
FT                   /db_xref="GOA:D4LA31"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA31"
FT                   /protein_id="CBL16476.1"
FT                   /translation="MHNKNRPPRVACINDLSGYGRCSLTTAIAVLSAMGVQACPAPTAI
FT                   LSKHTGFPHFTFQDFTPHLGAYLADWGELEFDAVYTGFLGSAEQIRLVEDFLAQQRARQ
FT                   HTPPHVIIDTVMGDGGKLYPTYTPDMCRRMKRLVSHADVITPNITEACILTGTDYPGEE
FT                   LSTAQARALACRLYDLGAGAVVITGIVREPVLCNLVYDGRELYFDAEDRTERMFSGTGD
FT                   LFASIVSARLAAGGTLPEAVTLAGSFIAAATRYTLSLGTPTQEGVCFEPCLSRLAPGQD
FT                   VKE"
FT   gap             238751..239206
FT                   /estimated_length=456
FT   CDS             complement(239284..240111)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02300"
FT                   /product="conserved hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16477"
FT                   /db_xref="GOA:D4LA32"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA32"
FT                   /protein_id="CBL16477.1"
FT                   /translation="MSGMLYIVGTPIGNLGDVTMRQLDTLRTVDFIAAEDTRVTRGLLT
FT                   HFDIHKPLVSYHDHSGIRCAEGIVERLRAGESAAVVTDAGMPCISDPGEELVRLCWEAG
FT                   VQVQVVPGPSAAVSALAISGLPTGRFAFEGFLPAAKKQRTARLAELTGEQRTLIFYEAP
FT                   HRLTATLEDLYQAFGERRIALCRELTKLYEQVLRMTLPEAISYYKEKAPRGEYVLVLEG
FT                   AAREDAPALTFEEVLEQVRRQVDAGMRAADACKTAAKASGFSKNELYRALLEG"
FT   CDS             complement(240108..240830)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02310"
FT                   /product="Predicted O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16478"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA33"
FT                   /protein_id="CBL16478.1"
FT                   /translation="MEVKREPLGRLHICVSDAHRFGTDAFLLAAFSRYQARDVACDLGT
FT                   GCGIIPLVMERHMPPRQIYGLDIQPEAIRLLEQTVAENRLTNLTPVLGDLRTLWADAPL
FT                   EQCTLVTCNPPYKAQGAGMESAGDAARIARHELLCDISDVCGSAARLLRFGGRLCLCNR
FT                   PERLCDVLCAMRSAGIEPKRLRFVAKHPDTAPWLFLVEGKKGAKPFLQVEPTLAVRQGD
FT                   GVTPELEAFYRLGTEEEA"
FT   gap             240929..242314
FT                   /estimated_length=1386
FT   gap             242842..243205
FT                   /estimated_length=364
FT   CDS             complement(243287..243880)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16479"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA34"
FT                   /protein_id="CBL16479.1"
FT                   /translation="MRRIPTHKKWFAAALVCAVLLGAECIAAWAGGLLLLPGVHGFVTP
FT                   GLGLLLTVLLGITLWKYRRAKQRISRPCIWLGGAAAVGCAVSLVGIVLAARTPAQKQEF
FT                   FYQGGGSAVTVYARSRQTQVEFTVCDGTNPFLAKRLDRVTLAAGTESTWDIACDWETSD
FT                   RVRLVFRSGKHAQVLEEELERVYRCADQEVYWIN"
FT   CDS             complement(243893..244552)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02330"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED/haloacid
FT                   dehalogenase superfamily, subfamily IA, variant 1 with
FT                   third motif having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16480"
FT                   /db_xref="GOA:D4LA35"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA35"
FT                   /protein_id="CBL16480.1"
FT                   /translation="MGEKGLQAVIFDLDGTLLDSMHVWEQVDQRFLRENRILPPAGISD
FT                   RLKTMGIREAAAFFISEFALDMTPEQVIARIENLAAEEYRLRIPLKPGVLEVLDGLDAR
FT                   HIPYCIATATYDSLVEAALERLGIRHRFRFVLTCSQVGSTKAKPDIYLECARRLGHAPR
FT                   EILVAEDALHAIETANSAGFFTFGVYEPTAAADWQRIREISGGWGMELTELLQYFI"
FT   CDS             complement(244552..244824)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16481"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA36"
FT                   /protein_id="CBL16481.1"
FT                   /translation="MDPEERQALQVEQENQEKLMKVCRWCHILVCLFLTVLTGVLLHLI
FT                   GAGGVFVGFTCVLAFGAYVWLERRFLRKHVNRVVKRFFDSRRHAH"
FT   CDS             complement(244837..245556)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02350"
FT                   /product="RNA methyltransferase, RsmE family"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16482"
FT                   /db_xref="GOA:D4LA37"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA37"
FT                   /protein_id="CBL16482.1"
FT                   /translation="MPRFFLPALDPVQPVITGEDAHHIGFSLRMRPGEQLTVCAGGVDY
FT                   DCRIREITGDCVYLEVQGQAPCAAEPTVALTLYQALPKTDKLEQIVQKAVELGAARIVP
FT                   VLTRRCISRPDPGQFSKKQQRLQKIAHAAAKQAGRGIIPEVGGMLTFSQALEELGGQQL
FT                   PVMLYEAGGVSMSQLTVPRTGSIGVLVGSEGGFDPEEAAQARLAGIQPVWLGPRILRCE
FT                   TAPLTALSLLMYLSGNL"
FT   tRNA            complement(245741..245816)
FT                   /locus_tag="RUM_T_24640"
FT                   /product="transfer RNA"
FT   tRNA            complement(245888..245963)
FT                   /locus_tag="RUM_T_24630"
FT                   /product="transfer RNA"
FT   tRNA            complement(245973..246049)
FT                   /locus_tag="RUM_T_24620"
FT                   /product="transfer RNA"
FT   tRNA            complement(246057..246132)
FT                   /locus_tag="RUM_T_24610"
FT                   /product="transfer RNA"
FT   CDS             complement(246274..248316)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02360"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /function="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16483"
FT                   /db_xref="GOA:D4LA38"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA38"
FT                   /protein_id="CBL16483.1"
FT                   /translation="MNELFRPISALRGVGEKRAKAYARLGIQTPYDLLFHIPRSYLDFR
FT                   NPEPVLSAPLDTPCVVEGCITRKLPEQRIRKGLSVFKATATDGESDFTVVFYNNFYAFD
FT                   ALKVGETYRFAGKLTGTLLRREIHSPQYLRADCPVLMKPVYPLTNGLTNPMVQANMRQA
FT                   LELLRREPFDGLPSGIRRQYDLCTLPEALGVVHQPASEPILQEAKRRLAFDALLQLQLG
FT                   MLMLRNRSRAQTAYTMDPDTDLTPFYASLPFAPTNAQKRSIAEICGDLCRTVPANRLLQ
FT                   GDVGSGKTAVAAAACYFTCKNGFQSALMAPTEILATQHYHTLEGFLSPLGIRVGLLTGS
FT                   LPAKEKRRIRTALQAGELDVLVGTHALIQKDTVFPALGLVITDEQHRFGVGQRAALAQK
FT                   GGTPHKLVMSATPIPRTLALIVYGDLDISVLDELPVGRLPIRTYAVTGKLRQRAYGFVR
FT                   SRMDAGEQAYIVCPMIEEGESDLLAVTSYAEQLRAGAFAAYRVGLLHGKMKPAEKEQVM
FT                   ASFKAGELDLLVCTTVVEVGVDVPNATVMLIENSERFGLSQLHQLRGRVGRGSKQSHCI
FT                   LITDSTSEESRERLRVLSSTTDGFRIAEEDLKLRGPGDFFGSAQHGLPPVHLAELAEDM
FT                   ELVRQTQQAARDILEADPQLRDPVNHALRADVVRLYARNGENGLN"
FT   CDS             complement(248413..248673)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02370"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16484"
FT                   /db_xref="InterPro:IPR007347"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA39"
FT                   /protein_id="CBL16484.1"
FT                   /translation="MEVLKVSSKSVPNSVAGAIAAVIREQRTVEVQAVGAGAANQAIKS
FT                   IAVARGYLAPIGIDLICIPAFANIVIDGEDRTAIKLICEQR"
FT   CDS             complement(248897..249679)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02380"
FT                   /product="conserved hypothetical protein TIGR00282"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16485"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA40"
FT                   /protein_id="CBL16485.1"
FT                   /translation="MQILFIGDVVGKSGCRYLERTLPELRRQYGADVTIVNGENSAPGN
FT                   GITTASAQQIFQCGADLITTGNHAFQRRDSLAIFERRDVLRPANYPEGCPGHGVEILDL
FT                   GRCRVAVLNLMGTVFLEALDNPFAAADALLAEIDTPNIFVDFHAEATSEKKCMGYYLAG
FT                   RVTAVCGTHTHVQTADEEILEGHTGYITDAGMTGPARSVLGVDVQRATDKQRLHCPVQF
FT                   IEATGEAMLNGVSITFDPSTGKCTKIERIFMRESTNVR"
FT   gap             249964..250469
FT                   /estimated_length=506
FT   CDS             complement(250584..251153)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02390"
FT                   /product="Response regulator with putative antiterminator
FT                   output domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16486"
FT                   /db_xref="GOA:D4LA41"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA41"
FT                   /protein_id="CBL16486.1"
FT                   /translation="MERGLIISSTEKSVAFFRDMLGHAGIQDLTVVSSAGEARRRMLEY
FT                   EYDICVINAPLPDEYGESLSCSIALHTTSEVILVVKAEQFDSICHKVEDCGVITVAKPV
FT                   NRGLFWNAIKVTQAASVKMQRMYCENRKLQQKIEDLRIVDRAKCALISYLRMSEQEAHK
FT                   YIERQAMDMRLPKREIAEEILRTYEV"
FT   CDS             complement(252513..253220)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02410"
FT                   /product="glutamate synthase (NADPH) GltB3 subunit"
FT                   /function="glutamate synthase (NADPH) GltB3 subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16487"
FT                   /db_xref="GOA:D4LA42"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA42"
FT                   /protein_id="CBL16487.1"
FT                   /translation="MTLSAKELGYEKLNEAVRHAAGEIQINDCFGERFIGCGAADKTIT
FT                   INGTPGNAMGAYLNGATMIVKGNAQDAVGDTMNAGRIVIHGNAGDALGYAMRGGEIYVK
FT                   GSAGYRAGIHMKEYMEKRPLIVIGGSTGSFLGEYLAGGLMIVLGLDTDQVPVGNFTGTG
FT                   MHGGHIWIRSSVKPTNLPAQVCVEEADPQEILPYIENYAKLFGVSVETILAKPFYRLSP
FT                   NAKNPYKRLYTVN"
FT   CDS             complement(253217..254449)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02420"
FT                   /product="NAD(P)H-nitrite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16488"
FT                   /db_xref="GOA:D4LA43"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA43"
FT                   /protein_id="CBL16488.1"
FT                   /translation="MKYVIIGNSAAAIGAVEAIRKTDRTGQILILSSEPYHTYSRPLIS
FT                   YLLLGKTTEEKMLYRDRDFYEKMHCDFRPNTTVVKLDPEQKQVLLADGSTESYDRVLVA
FT                   TGSSPFVPPMAGLDTVEHKTTFGSLEDAKRLSGMIDSRSRVLIIGAGLIGLKCAEGIAD
FT                   TVKSITVVDLAPRVLSSILDDAASARIKHYLEQHDLRFFLGESVKEFSGNTAILTGGGQ
FT                   IEFDCLVLAVGVRANTALVKDAGGAVGRGITVDDHMRTSLPEVYAAGDCTESMDCAEQQ
FT                   IKIMALLPNAYMQGACAGANMAGQEAVFDTAIPMNSIGLFGLHMMTAGSYHGETFVQDD
FT                   GTGFKELFYENDRLCGYILIGDIHRAGIYTAMIRNRTPLRSVDFDLLCREPELMAFSQA
FT                   DRKVMLGGREK"
FT   CDS             complement(254446..254895)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02430"
FT                   /product="Fe-S-cluster-containing hydrogenase components 2"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16489"
FT                   /db_xref="GOA:D4LA44"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA44"
FT                   /protein_id="CBL16489.1"
FT                   /translation="MKRVYVNEEWCLGCHLCEYYCAFAETGKPNMALALKHQTIRPRIH
FT                   VEEENGVHFAVSCRHCEDPLCVKSCLTGALSVKDGVIRINSDRCIHCYTCILACPYGAI
FT                   VPSDNGAVKKCELCVNTATGLPNCVQGCPNGAIVFEDSEERKVSV"
FT   CDS             complement(254931..256436)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02440"
FT                   /product="glutamate synthase (NADPH) GltB2 subunit"
FT                   /function="glutamate synthase (NADPH) GltB2 subunit"
FT                   /EC_number="1.4.1.14"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16490"
FT                   /db_xref="GOA:D4LA45"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA45"
FT                   /protein_id="CBL16490.1"
FT                   /translation="MAINFLYPDYEVVRNQDRCIGCRVCERQCANEVHSYNAELDKMLS
FT                   DETKCVNCHRCVTLCPTHALKIVKNDHTFKENANWSGKTIQEIYKQANTGGVLLSSMGN
FT                   PEPYPVYFDKLLLNASQVTNPPIDPLREPMETKVFLGAKPSRVQRDEKGELVNNLSPQI
FT                   KLSVPIMFSAMSYGSISYNAHASLARAAQELGILYNTGEGGLHEDFVKYGANTIVQVAS
FT                   GRFGVHKGYLESGAAIEIKMGQGAKPGIGGHLPGAKIVGDVAKTRMVPVGSDAISPAPH
FT                   HDIYSIEDLRQLVYSLKEATGYTKPVIVKIAAVHNISAIASGIARSGADIIAIDGFRGG
FT                   TGAAPTRIRDNVGIPIELALASVDKRLRDEGIRNNVSIVVGGSIRSSADMVKAIALGAD
FT                   AVYIGTAALLALGCHLCRSCQTGKCNWGIATQRPELVKRLNPEIGYQRLVNLVTAWRHE
FT                   LMELMGGMGINSIESLRGNRLMLRGVGLTDRELEILGVKHAGE"
FT   CDS             complement(256436..257533)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02450"
FT                   /product="glutamate synthase (NADPH) GltB1 subunit"
FT                   /function="glutamate synthase (NADPH) GltB1 subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16491"
FT                   /db_xref="GOA:D4LA46"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR012375"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA46"
FT                   /protein_id="CBL16491.1"
FT                   /translation="MSLPREGEVRIPSGCAVSGMFSKSGKRMNGEQIIRSIEVMHDRSN
FT                   GLGGGFAAYGIYPEYKEYYAFHIFYDDSSTKQECERFLERHFDIINLSKIPTRKMPQIT
FT                   DVPLIWRYFVTPLPTKLAESQLDEREFVAKCVFHINTRIKGSYVFSSGKNMGVFKAVGF
FT                   PEDVGRFYRLDEYAGYCFTAHGRYPTNTPGWWGGAHPFALLDYTVVHNGEISSYDANRR
FT                   AIEMYGYKCTLQTDTEVIAYIIDYLHRKQGLNWQEICSVIAAPFWQTIAAMPEQERAKH
FT                   EYLRNVFASQLITGPFSILVGFNGGMMALNDRLKLRSMVVGEKDDMFYVASEESAIRVI
FT                   QPELDKVWSPRGGECVLVTLEGGKA"
FT   CDS             258127..260226
FT                   /transl_table=11
FT                   /locus_tag="RUM_02460"
FT                   /product="L-glutamine synthetase"
FT                   /function="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16492"
FT                   /db_xref="GOA:D4LA47"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022147"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA47"
FT                   /protein_id="CBL16492.1"
FT                   /translation="MDQTDMHSLFGSKVFNDAVMLDRLPRDVYRALRKTMEKGTHLELD
FT                   IANVVASAMKDWAVEQGATHFTHWFQPMTGVTAEKHDSFITPDGSGSVIMEFSGRELVR
FT                   GEPDASSFPSGGLRATFEARGYTAWDPTAYAFIRGHTLYIPTVFCSYGGEALDKKTPLL
FT                   RSMDAINRQALRVLRLFGNTNASRVITTVGPEQEYFLIDRKLYEKRRDLKCCGRTLFGA
FT                   RPPKGQELADHYFGSIPPRVSAFMAQLDRELWRLGVLAKTEHNEVAPAQHELAPIYTTT
FT                   NLACDHNQLTMELMKTVAAQHGMACLLHEKPFAGVNGSGKHNNWSISTDTGMNLLEPGG
FT                   TPYENAQFLLFLCAVIEAVDEYQDLLRVSVASAGNDHRLGANEAPPAIVSMFLGDELTD
FT                   ILHAIESGTLYVGKEQVQMEIGATVLPHFFRDATDRNRTSPFAFTGNKFEFRMLGSAQS
FT                   IAGPNTVLNTIVADVLGKYADRLEHSVQFQKDLDELIRTVIHDHKRIIFNGNNYSPQWV
FT                   AEAEQRGLTNLPGTPEALRTLIDPKNIALFTRHGVFTEAEVRSRYAILLENYSKIGHIE
FT                   ALTMIDMVNQEIIPAVVTYQSQLAQLAANKKLAQSEASIALEDGLLKKLSRLSECLVKR
FT                   TQSLSDCLMEIKPIQDPYQLASAYRERIYPAMTELRCVADNLELICGRDHWPLPSYGDM
FT                   LFSIE"
FT   CDS             260284..260403
FT                   /transl_table=11
FT                   /locus_tag="RUM_02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16493"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA48"
FT                   /protein_id="CBL16493.1"
FT                   /translation="MYAFLYLRKIRNITGWLLAGIQKQCSAPDVQKEGGFYEC"
FT   CDS             260393..262159
FT                   /transl_table=11
FT                   /locus_tag="RUM_02480"
FT                   /product="ammonium transporter"
FT                   /function="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16494"
FT                   /db_xref="GOA:D4LA49"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA49"
FT                   /protein_id="CBL16494.1"
FT                   /translation="MNAEAIFEAVDKELWGVWFLIGAALVFFMQCGFAMVETGFTRAKN
FT                   AGNIIMKNLMDFCIGTVVFILIGFGLFLGEDMVGLIGKPGLDIFTAYENFDYSNFVFNL
FT                   VFCATAATIVSGAMAERTKFLSYCVYSGVISALIYPVEAHWIWGGGWLAQLGFHDFAGS
FT                   TAIHMVGGLSALIGAKILGPRIGKFETDKDGKVTKVNAIPGHSLTLGALGVFILWFGWY
FT                   GFNGAAAKSIDQLGSVFMATTIAPAIATVTCMIFTWLKYGKPDVSMCLNASLAGLVGVT
FT                   APCDVVDCLGASIIGIVSGLLVVFGVWLLDYKLHIDDPVGAVAVHFCNGIWGTVAVGLF
FT                   ANPKVPGYSLANADGKQLAGVFYGGGFELFGYQLLGMVSVIAWTAVTITITFLIIKHTI
FT                   GLRASRHEEVVGLDITEHGLASSYADFIPTTHIETTASGKEKEVANVIPAAPVEKSVPV
FT                   EHKKSVSIASDAGVKMTKVDIITNIERFDALKNALYGIGITGMTVTNAMGCGMQKGAAE
FT                   YYRGVPVEARLLPKVKVEVVVCKVPVETVVETVKQALYTGKIGDGKIFVYDVENVLKVR
FT                   TGESGYDALQDD"
FT   gap             262371..262708
FT                   /estimated_length=338
FT   CDS             complement(262908..263639)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02490"
FT                   /product="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16495"
FT                   /db_xref="GOA:D4LA50"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA50"
FT                   /protein_id="CBL16495.1"
FT                   /translation="MRRWSACIAGLAAVCILSGTVHAGDVHGYGQGCRYDGQNRPIGAV
FT                   EFNQQYGGYDACALSGDSRYILLTFDQGYENGYTAQILDTLKEKNVKAIFFLTGDYARK
FT                   ETALVQRMVDEGHVLGNHGMTHASMPKLEGAALEEEIMSLHRYVQDTYGYEMQYLRPPC
FT                   GEYSEASLAAAQRLGYKTVFWSFAYVDWLVDQQPDPAQAYSRMTEAAHGGGIYLLHSVS
FT                   ATNCAVLGDVIDSLRQQGYRL"
FT   CDS             complement(263784..264029)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02500"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16496"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA51"
FT                   /protein_id="CBL16496.1"
FT                   /translation="MCDKTMTFSVNQERENELKRNLTIVYDALVQKGYNPINQIVGYIL
FT                   SEDPTYITTYNNARSLIRHIDRDELLQVLVRNYLED"
FT   CDS             complement(264238..264411)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02510"
FT                   /product="Domain of Unknown Function (DUF1540)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16497"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA52"
FT                   /protein_id="CBL16497.1"
FT                   /translation="MEKNSHIQCTVQQCKHNNACCNLCSLDVIRIGTHEQNPTMAECTD
FT                   CNSFELRSNCCG"
FT   CDS             264650..265555
FT                   /transl_table=11
FT                   /locus_tag="RUM_02520"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16498"
FT                   /db_xref="GOA:D4LA53"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA53"
FT                   /protein_id="CBL16498.1"
FT                   /translation="MELSTKKTRPRLTFEIYIPEQAAPISKMMQTVDVLRSAKPDFVLA
FT                   TADHRHGTGLERAVEFASMIQSEGGIPGAVLIPSICYTRTRLKLQLQQMKRRGITRILA
FT                   VRGDGMRPDFEHADFPSAAELIEFIKEVDPEFRVASGCFPENHPESLGIVTDVWQLRRQ
FT                   ADAGACRMITRMFYSFRYFEAVQNRLEIAGVYLPMDAGIMPILRKEAVSLLRQDFGVRL
FT                   PRSFAQRLAQYEDDPKGFYEEGVKYANEQIRRLVATSAPGVHIFSHNDSELITRLSHGF
FT                   YDAVSDFQAGTLAQEFLSKA"
FT   gap             265698..266246
FT                   /estimated_length=549
FT   CDS             complement(268087..268437)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02540"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16499"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA54"
FT                   /protein_id="CBL16499.1"
FT                   /translation="MIIVENHIGKITITAAYLSALVGYTVTSCFGVSDMNDASPKEALL
FT                   SVLRRAKQIDKGVTIQSKDKKLIVNLHISVTFGTNISAIADSISNKVRFAVEEATGITV
FT                   SKVNVFIDGMNS"
FT   gap             268992..269606
FT                   /estimated_length=615
FT   CDS             complement(269754..271088)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02550"
FT                   /product="Trk-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16500"
FT                   /db_xref="GOA:D4LA55"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA55"
FT                   /protein_id="CBL16500.1"
FT                   /translation="MFDLLHKKIQLSSFQLIILGFAGVILLGACVLMLPISSQLRQFTP
FT                   FSEALFTATSAVCVTGLIVQGTGCYWSAFGQGVILSLIQIGGLGVVTIAVSFSLLSGRR
FT                   ISLMQRSTMQEAIAAPKVGGIVRLTGFILRGTFLIELLGALALLPVFCRDHGARGIWMA
FT                   VFHSVSAFCNAGFDILGTDQNPFPSLTEYAANPAVNIIIMLLILIGGIGFLTWEDIVVN
FT                   KWRLRRYRMQSKVILLMTVLLMAIPAVFFYTDLTELPTGQRILAACFQAVTPRTAGFNT
FT                   VNLLSLGGASNAVTMVLMLIGGAPGSTAGGMKITTVAVLFANAFATFRKREDAQMFGRR
FT                   IEPGAIRSAATILMLYMSLFFGGAVIISLCEQLPLSLCLYETASAVGTVGLTLGITPEL
FT                   GLVSKIVLILLMYMGRVGSLTLIYAAVSGKHLSPAKLPQEKIAVG"
FT   gap             271417..271988
FT                   /estimated_length=572
FT   CDS             complement(272191..272343)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16501"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA56"
FT                   /protein_id="CBL16501.1"
FT                   /translation="METMDNRKQEHSEQADSKDLFCSSLLDGWFTVHDGAYGQNETTLT
FT                   LNTPI"
FT   CDS             complement(272389..273399)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16502"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA57"
FT                   /protein_id="CBL16502.1"
FT                   /translation="MKRGKRSNYNDIENLEHAEKKFYGDQMKEMGCKGFVLRDIWDVLG
FT                   PYLLIIVAVISLLVGILIGWSWRASRDGGTLSVENSPEQATDAALTTEYRAEIPPDGTT
FT                   PVQTDIKQTTPGIQGEDSPTAPVTTVPEEEKPEVLPNEPENPNNPTPARTTPRQNPSWE
FT                   NDPGYDEPDDDDDEPASVQTSPRQTTPRQTTPRRTTPAETEPPVIRTTAAPVRTEPPVV
FT                   TTAAPPAPVLKGLYVSLSQSGSPTRVGGRYSTTFRIRLTNTAGSVSSKQKLLFTVPSGT
FT                   IVKEAPDGSSAYVSGKYLSITSGNEIQAGKSIYLYVTLEADEMLKESSIVLSSAQ"
FT   CDS             complement(273671..274012)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02580"
FT                   /product="Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16503"
FT                   /db_xref="GOA:D4LA58"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA58"
FT                   /protein_id="CBL16503.1"
FT                   /translation="MVRRGEIYYADLSPVVGSEQGGVRPVLIVQNDVGNKHSPTVIAAA
FT                   ITSQREKAKLPTHIELRAASCGLSRDSVVLLEQIRTIDKRRLKERMGELDAPSMSQVNN
FT                   ALEISFGLS"
FT   CDS             274262..276589
FT                   /transl_table=11
FT                   /locus_tag="RUM_02590"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16504"
FT                   /db_xref="GOA:D4LA59"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA59"
FT                   /protein_id="CBL16504.1"
FT                   /translation="MGFQGYDNRELSWLKFNQRVLEEACNPDAPLLERLKFTAIFQSNL
FT                   DEFFRVRVGSLYDQHLADPDKSDSRSGMTAKEQLKAIFRRVRELEPQRDNAYGEIMQAL
FT                   GAHGVMQVTYPTATDEERRFLDTYFKKEIRPLIVPMVVDKEHPFPFLKNQEIYAVLHLE
FT                   SKSGVRLGIIPVNEQFKRVIPLGENGKRFILAEDLILSLSPSIFKNFKVIDRTLLRITR
FT                   SADIAVTDAFYDYSNDFRQIMEELVKQRQKLMPVRIQLSASFNQTATDFLRKQMGIKNS
FT                   QIFPAKAPLDLSFVYGIQDVTREDTLLYPKRVPQNSPQVSETRPMLAQIKKQDILLHYP
FT                   YQSIRPFLRLLQEAAEDETVLSIKITLYRVARNSQVIDALCRAAENGIRVLVLVELRAR
FT                   FDEENNIGWSRRLQRAGCEVIYGSRAFKVHSKLLLITQKSRTGVHYTTQIGTGNYNEKT
FT                   SLLYTDLSLMTANQAIGAEAEKVFDALCADTQIEENGMLLVAPHTLRNQVLQLIDQEIR
FT                   RASEGLDSYIGLKLNSISDKILIEKLMEASDAGVHVDLIVRGICCVIGGIPGRTEHIHV
FT                   RSIVGRYLEHSRIYMFGTPDRARVYIGSADYMPRNTIHRVEVAVPLLDPAIRARVLHIF
FT                   DVYLHDNCKARLQQPDGTYVLTAPAEGEESRNAQEQLFDEAYAAAPKRRTRKPAAKPDA
FT                   PNPADAATATAEKPKRGRKPKAKPNAPNSADAATAPAEKSKRGRKPKAKPDAPNFADAA
FT                   TATAEKPKRGRKPRAKKEEPET"
FT   gap             276735..277201
FT                   /estimated_length=467
FT   CDS             complement(277348..278709)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02600"
FT                   /product="pyridoxal-phosphate dependent TrpB-like enzyme"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16505"
FT                   /db_xref="GOA:D4LA60"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006316"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA60"
FT                   /protein_id="CBL16505.1"
FT                   /translation="MAKEIPYKIYLDESEMPTAWYNLRADMKNKPAPLLNPATRQPCTA
FT                   ADLAPVFCEELVKQELDDTTPYFEIPQEIRDFYKMYRPSPLVRAYCLEKKLGTPAKIYY
FT                   KFEGNNTSGSHKLNSAIAQAYYAKQQGLKGVTTETGAGQWGTALSMACSYFDLDCKVYM
FT                   VKVSYEQKPFRREVMRTYGASVTPSPSTETAVGRKILEEHPGTTGSLGCAISEAVEKAT
FT                   TTEGYRYVLGSVLNQVLLHQSVIGLETKAALDKYGVKADIIIGCAGGGSNLGGLIAPFM
FT                   GEKLRGEADYRIIAVEPASCPSLTRGKFAYDFCDTGKVCPLAKMYTLGCDFIPAPNHAG
FT                   GLRYHGMSSTLSQLYADGLMEATSVTQTKVFEAAEYFARVEGILPAPESSHAIRVAIDE
FT                   ALKCKETGEEKTIVFGLTGTGYFDMVAYEKYNDGKMNDYIPTDEELAESLKKLP"
FT   gap             279290..279925
FT                   /estimated_length=636
FT   CDS             complement(280314..281453)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02610"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter ATP-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16506"
FT                   /db_xref="GOA:D4LA61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA61"
FT                   /protein_id="CBL16506.1"
FT                   /translation="MAGLSLRGIYKKYPGGVVAVSDVNLEIRDKEFIVLVGPSGCGKST
FT                   TLRMIAGLEEISEGELYIGDRLVNDIAPKDRDIAMVFQNYALYPHMTVFENMAFGLKLR
FT                   KVPKDEIARKVEEAARILDLTHLLDRKPKAMSGGQRQRVALGRAIVRQPQVFLLDEPLS
FT                   NLDAKLRAQMRTEISKIHKKLGTTFIYVTHDQTEAMTMGDRIVVMKDGFVQQIDTPQVL
FT                   YDQPVNKFVAGFLGSPQMNFIEAMLHQRDGKYVVEFGSNDTKTTRGVKYEIVIPEAKVN
FT                   ENLAHYVDKEVILGIRPENVHDEEMYLSNATTGVIKCTVDITELMGAETYLYLTCEGYP
FT                   LTARVSPRSTARPQDEIDIAIDPNRIHLFDKETENTIMN"
FT   CDS             complement(281570..282337)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02620"
FT                   /product="pseudouridine synthase family"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16507"
FT                   /db_xref="GOA:D4LA62"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA62"
FT                   /protein_id="CBL16507.1"
FT                   /translation="MRLDKCIADHSAYSRKEVKELLRRGSVRVNGAPEQDPGRQVDPEG
FT                   DEIMLAGVILPTALHRTYMLNKPKGCISSTRTGKTKTVVEFLPPELRKGIFPAGRLDVD
FT                   TEGMLLLTNDGDLAHRILSPRRHIPKYYLVQLAKPVVEKTVETFENGVVLEDGTRCLPA
FT                   RVAALPGVENTALVELHEGKFHQVKRMFAAVENHVEQLLRVQMGGLPIDVKLGKGDYLL
FT                   LLHKDIERLFKTPDFSEVLRFCACFFCSYWINE"
FT   gap             282487..283307
FT                   /estimated_length=821
FT   CDS             complement(283722..284096)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02630"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16508"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA63"
FT                   /protein_id="CBL16508.1"
FT                   /translation="MDDFFKNLLDTKDHSDEFTAEDINKNKAVAIVACFWVLFFVPLVA
FT                   AKDSGFAKFYANQGLILFLTTIVLNVAGGILANIPFIGFVLRMILSLASLGLFVFLLVN
FT                   AANGKAKEMPIVGGLFTAFQ"
FT   CDS             complement(284144..284587)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02640"
FT                   /product="transcriptional regulator NrdR"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16509"
FT                   /db_xref="GOA:D4LA64"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA64"
FT                   /protein_id="CBL16509.1"
FT                   /translation="MRCPFCGYEDTKVIDSRPADGKKRRRRECTNCQKRFTTFEVVERP
FT                   LLMVVKRDGSFEPFDRQKLIAGIYSAVKKRPVSVDAVSRLVDEIENYYANEMKTQVTSA
FT                   EIGDMVLERLKRIDPIAYVRFASVYKDFTDVEGFIRAIRELDG"
FT   CDS             complement(284600..285400)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02650"
FT                   /product="Sugar phosphate isomerases/epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16510"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA65"
FT                   /protein_id="CBL16510.1"
FT                   /translation="MQAGVSTACLYPRLLEESVYDLAVSGIAHTEIFVNTVSECTRTFV
FT                   SGMADTMKRFDMTCRALHPFTCPIEPMLFFSEYERRVADALEFHRMYFQAMNWLGAEIF
FT                   VFHGNQAGSSIPQELYFERFYRLAKLGKEFGVTVAQENVSRCTSGSLRFLKEMKRALGD
FT                   DAHFVLDTKQAIRSKENIFDVVHALGSSIVHVHISDHGERGDCLQIGKGRFDIRRFLRL
FT                   LRQEGADCSIMLELYRSNFSNLTDLVSNYNTLVHMIGSLEPAGR"
FT   CDS             complement(285510..286472)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02660"
FT                   /product="protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16511"
FT                   /db_xref="GOA:D4LA66"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA66"
FT                   /protein_id="CBL16511.1"
FT                   /translation="MSKQKKVRDYVGHMHIYIIISAIMILCAIAGSLIFGVEVAIEFKG
FT                   GTILNYSYTGDVDTAQVETLAKGILNTPVTIQTGEALGDGSGKTMTISFSCAEGSFTPE
FT                   VQGQLTTSIQGKFPDNQIKLLESNDVSPTSGKQFFYKCLVAALAASVILIIYIALRFKR
FT                   ISGWSAGMCAILALVHDLIAAYGTFVIAGFEINSNFMAVLLTILGYSVNNTMVIYDRIR
FT                   ENQKLMDKKTSIRELVNTSISQTMSRSIRTSVTTISTMLIISIVAVIMQVDSILSFSIP
FT                   LTVGLISGTYSSICIAPVVWVWWTEKRGKKTVADLQIRK"
FT   CDS             complement(287984..289420)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02680"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16512"
FT                   /db_xref="GOA:D4LA67"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA67"
FT                   /protein_id="CBL16512.1"
FT                   /translation="MSHTNSYESPFCTRYASPEMQYLFSADKKFTTWRRLWVALARAEH
FT                   QLGLPVTQAQVDQLEANVENIDYDVAREREKVCRHDVMSHVYAYGVACPEAKGIIHLGA
FT                   TSCYVGDNTDVIIMRDALQVVRRKLINVIGNLARFADSYKAMPALAYTHLQPAQLTTVG
FT                   KRATLWINELLMDLEEIDHRIASLKLLGSKGTTGTQASFMELFEGDSSKVKQLEQMIAE
FT                   EMGFDAVVPVSGQTYSRKVDAQVLAALGGVAQSASKFANDMRILQSFKEMEEPFEKGQI
FT                   GSSAMAYKRNPMRCERITALARYVMIDTLNPAFTAGTQWFERTLDDSANKRISVAEGFL
FT                   GVDAILNIMMNVTDGLVVYPKIVRRRVMQELPFMATENIMMDAVKKGGDRQALHERIRE
FT                   YSMIAGKHVKEDGLENDLCELILADEMFMISREEMDKIMQPEQFTGRSQEQVTEFLQEF
FT                   VQPVLDANQDILNETAELSV"
FT   gap             289880..290279
FT                   /estimated_length=400
FT   CDS             complement(290472..290897)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16513"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA68"
FT                   /protein_id="CBL16513.1"
FT                   /translation="MEQSIPKKLGMLALLTAGSLFAQTLLWVAYDYFQMQVWVMGALPL
FT                   LICLLYHAVQLDSGADKLMGRRFVFAGACLLPLLLGAALGLWMYWKYPGLEVFGGTGWG
FT                   GGVIQEIIAKYSARYLLTSGYLILFAGLDAVYFLRRT"
FT   CDS             complement(293529..294140)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16514"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA69"
FT                   /protein_id="CBL16514.1"
FT                   /translation="MKEKMQREYSIPFELFAKAFTLFQRKFVYPRCWIITAFLGAVIVF
FT                   YVSAALQDPGNTLTYVLIFACLAVIFIQWYNPKKIRRQLLNAIKDLGDETYRLTVEEDG
FT                   LTIGTILPEPEEDAEQESGDGFHDIFPEEPPQLADTVIPFNKQVKIVESAEFFLVYQVR
FT                   AMFYVIPKQAFSPEENRQLAGLFAEKLGRQFCPDKQTERN"
FT   CDS             complement(294152..296101)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02720"
FT                   /product="DNA gyrase subunit B"
FT                   /function="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16515"
FT                   /db_xref="GOA:D4LA70"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA70"
FT                   /protein_id="CBL16515.1"
FT                   /translation="MSETEQIKPGAQQYDESQIQVLEGLEAVRKRPGMYIGTTGSGGLH
FT                   HLVYEIVDNSIDEALAGYCTHIQVEILPGDIIRVTDNGRGIPTGIHPKEGISAATVVYT
FT                   VLHAGGKFGGGGYKVAGGLHGVGASVVNALSEWLELTVKDGSHVHFQRFERGNYAEPLK
FT                   IIGDTTEHGTSVMFKPDAEIFEETTVFDYEVLLKRMREQAFLNAGLTIELSDQRDPANP
FT                   QGEKMCYEGGIRQFIEHIHKTRGLESLSEQVIYFTGSKGDNAVEIAMQYNDSYNELILS
FT                   FANNVHTIDGGMHELGFRNALTKTLNEYGKRFGLLKDDSKLMGEDVREGLTAIISVKLT
FT                   DCQFESQTKVKLGNPEIKPFVESIVSEKLMNYLEENPAVARAIFDKSLAAQRAREAAKK
FT                   ARETARRKTAMESASLPGKLADCSERDIEMTEIYIVEGDSAGGSAKEGRDRRYQAILPL
FT                   WGKMLNVEKARIDKVYCNEKLMPVVTALGTSIGEDFDISKLRYGKVIIMADADVDGSHI
FT                   RTLLLTFFFRFMRPLITNGNIYIAQPPLFRVAKGKTFKYAFSDEERDKYIAQFNAESPN
FT                   AKVEVQRYKGLGEMDAHQLWDTTMNPDTRTMIKVEMADAVKADETFSILMGDKVAPRRE
FT                   FIEKNAKYAQNLDI"
FT   CDS             complement(296117..296371)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16516"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA71"
FT                   /protein_id="CBL16516.1"
FT                   /translation="MYIHLGNEISVSDKCVTGIFDLENTTIGKATKEFLERAEREKRVV
FT                   NVSYEMPKSFIVCNERGREVVYISQISVATLRKRANTLF"
FT   CDS             complement(296384..297496)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02740"
FT                   /product="recF protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16517"
FT                   /db_xref="GOA:D4LA72"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA72"
FT                   /protein_id="CBL16517.1"
FT                   /translation="MHLTGLEAEHFRNLEHIQLEPDPRYNLIVGQNAQGKTNLLEAIWL
FT                   LTGCRSFRGVRERDLVSFDQEVMRMQAAFRDSRREQHITYAIQKSSREKKITLNGVPLR
FT                   GGSRLFAQFQCVVFTPDDTMLIKGLPDKRRNFLDLCCAQIRPKNMDVLRRFENLTIQRN
FT                   QVLRSIGAGNGTPLDLAIWDAQLAVAGAHLSHIRHSYVQRFAPVCARLYNIITGGREQL
FT                   TVEYQSGMYRDYEMPETVTEPMQDYYLRKLTMSSTDDIRLGYTSIGASRDDLLFKINGK
FT                   PVRDFGSQGQKKSTALVLKLAQAEIYRHSQGQSPVVLLDDVMGELDKSRQELVYSIVQE
FT                   MQVFITTCNEGAVLGSDRGMRITIENGKIL"
FT   CDS             complement(297487..297708)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02750"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16518"
FT                   /db_xref="GOA:D4LA73"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA73"
FT                   /protein_id="CBL16518.1"
FT                   /translation="MQNQRVSIRTEFIKLDSLLKYAGLTDTGGFAKELIQGGQVKVNGE
FT                   ICTMRGKKIRSGDVVEAGEYRLTVEQCI"
FT   CDS             complement(297725..298831)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02760"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16519"
FT                   /db_xref="GOA:D4LA74"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA74"
FT                   /protein_id="CBL16519.1"
FT                   /translation="MKFSCKKEDICAAIGNVSKAVSVKSTITALEGIRIKLSYTVLELT
FT                   GYDLELGIRSTIEAVSEDCGEFVVNARLFSEITRKMSDEILTFETDEMLNIRITGAVTE
FT                   YCISAMSAEEYPDLPEVSDEHRFLVPQDQLKSMINQTAHAVSLNENKPVMTGALFDITE
FT                   DGNFNMVTSDGYRLALRTEHIDTAEVHRFVVPARTLSEVSRLLKEDAKAPCGIYNNFKH
FT                   IVFELGEITVFSRLLEGDFHNYRASIPPDKRTEVIVRTRELVNCLERCALLINEKNKAP
FT                   VRCVFENGTVKVSCKTGIGSISDTIPVDLSGDAVTIGFNNKFMLDALRASECDKLRIHL
FT                   SGGNRVVKIIPPEGDSFVFLVMPVDLKY"
FT   CDS             complement(299257..300624)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02770"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /function="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16520"
FT                   /db_xref="GOA:D4LA75"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA75"
FT                   /protein_id="CBL16520.1"
FT                   /translation="MNSFAEVFEQVKKYCIEVGNIGDVAINLWINTLIPVSLDGTKAVL
FT                   QCNSEFQKGVVLNNFKSLLQEGFRNTLGFDVELEIIIESQKPAEKVDIQELEKKHAQLE
FT                   KSFEGAEYDYTFDTFIVGKSNEFAYAACTAVAKHDRNKASDTYNPLFIYGPSGLGKTHL
FT                   MTAIANEMRRNDPNLNIVYVTGETFANELIEAIQKKQDTSLFHDKYRNADVLLVDDVQF
FT                   IAGKDSTQEEFFHTFNKLHSEGKQIVLTSDRPPKDIKILEDRIRSRFESGLIADISTPD
FT                   FETRIAIIRRKAELLDLNLPDEVAEFIANRLKTNIRQLEGAVKKLKALKHLAGSQPSIA
FT                   MAQSVIRDILTDDQPIPITVEKIIAEVANVYGVSPDDIRSNKRSSQISNARKVAIYVVR
FT                   EITQMPLASIGMEFGGRDHSTIVYAVNSISQSIQKDSSLKELVETLIKNIRERGKN"
FT   tRNA            300881..300965
FT                   /locus_tag="RUM_T_24260"
FT                   /product="transfer RNA"
FT   CDS             301127..301222
FT                   /transl_table=11
FT                   /locus_tag="RUM_02780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16521"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA76"
FT                   /protein_id="CBL16521.1"
FT                   /translation="MQCRTKDLVVKKQRFLNMTFHNAVENHVEIR"
FT   gap             301517..302567
FT                   /estimated_length=1051
FT   CDS             complement(302960..305539)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02790"
FT                   /product="BNR/Asp-box repeat."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16522"
FT                   /db_xref="GOA:D4LA77"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA77"
FT                   /protein_id="CBL16522.1"
FT                   /translation="MHMKKSLLAAALTLAVAASAVPATGIQAGAAATKSIESQMNWDTV
FT                   TISGGGFVSGLITGENNIYARTDVGGAYRYNATTKEWEQLMAFFTDADRGFLSVDAMAL
FT                   DPNDDNIVYALCGCAYFSDARTAVFRSKDGGKTWDSADVTNLIQVHGNGYGRQCGESIA
FT                   VDPDDPNTIYCGGDTVGMIVSHDAGVTWEAVDSFNSMGLFTNEIKWPTWTENVVKTTVG
FT                   TDYANCNGVSTIAIEKGKVYVGISDNTLECNMYVADVDGKKWEPLSKDLPADKFPSRIT
FT                   KDNAGNLLICYVGGLTFNGTGGGIYKYNTTTGEVTNISPTENSFGACMANPNNNDQLIA
FT                   TTCGVWSTNSWSKEDGAWGDWLYRSEDGGKTWTEYYPGKMGEYKWNAETGEMVQEQVID
FT                   YLDANGCSWVYGKAIHWSGSLIINPKDFDQIMVSSGNGIFKWDGIWGDSPKASFCAQGI
FT                   EEVVALDMVSVPGGAAYSAIGDYDGFIHTDVDKPATQYVPNMGSTGAIAYCPQNPQVMV
FT                   RIAENQNDIAPGFYSTDGGKTWTKMANTAGGKAAITQLDKDTYRIFLGKKDSGDLSYSD
FT                   DWGQTWNACTGIGSAYGSKPTYTFVEPNDPSTVYAYATYYNSSWHYSKTEPELSDANYT
FT                   LYISTDYGKTFTGTQICMYDQCDSAGRIASLEDNHLILAGGWYGLYDVKTAGGKAEVTK
FT                   KNVFYCKTVGYGAPEKKGGINTLYMYGKPQETDAEGIYRSTDGGDSWVCINTQKLYGGT
FT                   GNGNFLVGDMNTFGTVYMSTVGCGIVVGRLSGGTENPDILYGDVNADGIVDIADTVLLA
FT                   RYIAQDPAVKLTKQGLQNADCDPDGNIDSSDLTAIARYLAHLVDKLG"
FT   gap             306049..307278
FT                   /estimated_length=1230
FT   CDS             307599..309479
FT                   /transl_table=11
FT                   /locus_tag="RUM_02800"
FT                   /product="Endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16523"
FT                   /db_xref="GOA:D4LA78"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA78"
FT                   /protein_id="CBL16523.1"
FT                   /translation="MKLTKKLLSTVTAAALCMSLTSTFAGSFVNVSAANTTAIDMVEDM
FT                   GLGWNLGNSLSGSNTWDSGTLTPEQIETAWGNPLTTEAMIKEIKKAGFKTVRIPVTWYQ
FT                   AMEGKVDMDAYLARVQTVVDYCLDNGLYCIINTHNEASWLNASAQSKFTDLWKKIATYF
FT                   KDYDEKLVFEDMNEIEITNAQIMKLNQAFVDTVRATGGNNAKRLLLVPASNNNTDKCLS
FT                   SDFSAPKDSANMVAVSVHYYEPTTFCVAETDSTWGYTSTWGTNADYTLLEANLDKLEDK
FT                   FIDKGIPVIIGEYGVVTDEGKDDASIKKFLKEVASYSYGKNGMCAVLWDDSNAGTMKYF
FT                   DRTTLSWYDDEIKQIFADVISGGTEDPGTKTDRISLTVDEMTAEEKGYSIDMKPYGEMG
FT                   LTASSVVVEYELTSTKNSKQVSGDVVLSFNFTESGNDDEKTRHCWTFIDNAVGIDKTLT
FT                   TFEIPVGENTFPTGDKDDEGNAITKTGTFEMDYLKVENWWTWSGVTGDEPALNIKNVTV
FT                   IFDNFFYPDQPIETTTTTTTTTTETTTTTTTTTTTTVEPVGVKGDVNDDGEVTIADVVR
FT                   LCRYVAQDDTLAPAMTAAQVANADVNGDAIVDSSDITVLARFLAHLVETV"
FT   gap             309624..310190
FT                   /estimated_length=567
FT   CDS             310548..311237
FT                   /transl_table=11
FT                   /locus_tag="RUM_02810"
FT                   /product="Phage shock protein A (IM30), suppresses
FT                   sigma54-dependent transcription"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16524"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA79"
FT                   /protein_id="CBL16524.1"
FT                   /translation="MSIFTRLSDLLKANINDLIDRAEDPEKMVKQIILDMQKELNKSTQ
FT                   ALGKAVASEKMVEKQYNNAVATSANWEAKAKTALASGDQELAKKALSYKVKADEEAANY
FT                   KEMHETISEQTDAIRSQVEVLKSKLEEAKSRQAVLIARSQMAETQKNLAKSMGGFDASS
FT                   SLDKFNRMEEKITRKEAEAQAYREISGVDTSSQDEFEKLEQDSKVDAEMQRLMAEMGAQ
FT                   AAETPAE"
FT   CDS             311254..311439
FT                   /transl_table=11
FT                   /locus_tag="RUM_02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16525"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA80"
FT                   /protein_id="CBL16525.1"
FT                   /translation="MSEPAKVIIEKKDTSVPLRSLLPVLAGLIFLTGSLAAILYQTLRS
FT                   RSYHETWRSYDDCGWG"
FT   CDS             complement(311505..312962)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02830"
FT                   /product="prolyl-tRNA synthetase"
FT                   /function="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16526"
FT                   /db_xref="GOA:D4LA81"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA81"
FT                   /protein_id="CBL16526.1"
FT                   /translation="MAKDKKLVESITSMDEDFAQWYTDIVKKAELIEYTSVKGCMVIRP
FT                   YAYAIWENIQHILDGMFKATGHENVCMPMFIPESLLQKEKDHVEGFAPEVAWVTMGGSE
FT                   KLEDRLCVRPTSETLFCEHYANIVHSYRDLPKLYNQWVSVVRWEKTTRPFLRSREFLWQ
FT                   EGHTIHATAQEAIEETERMLNVYADFCEHSLAMPVIKGRKTESDKFAGAVATYAIEALM
FT                   HDGKALQAGTSHYFGDGFAKAFDIEYTDKENKRVNPHQTSWGVTTRLIGAIIMTHGDNS
FT                   GLVLPPAVAPIQAVIVPIAQHKEGVLEKANQLAEALKAQGIRVKLDDSDNSPGWKFAEY
FT                   EMKGVPVRIEIGPKDIEQSQCIVATRYNGEKQPVALDEAYGTLVQTVQQLLDKTIPEGM
FT                   FAKALENRTNRTYDCTSLEEITRALEEKGDGFIMAMWCGDEACEDKVKEVTGVGSRCIP
FT                   MEQRHIADTCVCCGKPAKHMVCWGKAY"
FT   CDS             complement(312949..313221)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16527"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA82"
FT                   /protein_id="CBL16527.1"
FT                   /translation="MEQAEYQWSRTDAMLWVGKIALLFFLILGLIYVFTVLTPKIAAWI
FT                   DKKRGKQPAYTQYDEHTKVKGVFEADLPKDKNQKENEEQKDNGEG"
FT   gap             313380..313942
FT                   /estimated_length=563
FT   CDS             complement(314145..315077)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16528"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA83"
FT                   /protein_id="CBL16528.1"
FT                   /translation="MTPTLTLTDVSGSTLTEAVCLSFRLEKERYTPFTTLTARFLTSRS
FT                   DFGNPASVAFRLDNQLLHQGVLDGLTMTKQKGMQTVQVSSRGFTSLLMQNQMAAGMLTG
FT                   VTLQSLMEKYTVPGVTYESGITQTNYVWVKEGTSQWDAIVNYGYKYNQGYPYISGANQV
FT                   RLTRSDGASITIGGDTLLSTGCGLDYTRMVSHIHMADADGNADAFSLENADATARNIAR
FT                   HRQISLDLQYAANPADCLAQKLRYSMRACQGVRAVYPGYHGEDLERHITLGSFAAGYIS
FT                   RMIVTGAGGRITTEVHLYRDKFCNLPEAT"
FT   CDS             complement(315074..315478)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16529"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA84"
FT                   /protein_id="CBL16529.1"
FT                   /translation="MTQVTDTAPKLYTLLLPTFTITVTDFTLSGGRQLREEPTVADDSR
FT                   MISPGVRRHTLTLMGFVPDSDAATLAPKLEQLCSSNTALTFSFAGMHFESLHTEQYAVR
FT                   QCKTLSAAQVQLTLAGVGEISQVTGEEDAT"
FT   CDS             complement(315475..315885)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16530"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA85"
FT                   /protein_id="CBL16530.1"
FT                   /translation="MGTIQSILTQLCDSIAATGAAIRLAYDKIPISDPPCRYMTGAVTA
FT                   VQLASPSDYAGGSLYPLKLQLEFHLLAPAADTPGMLYDRLEQQLMTPILDSGYTVMQLR
FT                   AEAPQIQPKLNKMELTAQVTLLCRYQRKEGTA"
FT   CDS             complement(315887..316246)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16531"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA86"
FT                   /protein_id="CBL16531.1"
FT                   /translation="MNQEKARSILRMFSGVADVKSLDPLLDEATAQVERMLLPDADRER
FT                   PQLDYLCAALANLRHSQMLAAQSQLTYTYAGTVAKESDRGQKVPFAQALAEEYLKACAD
FT                   LLTCPASPLMQTGGQ"
FT   CDS             complement(316255..317100)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16532"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA87"
FT                   /protein_id="CBL16532.1"
FT                   /translation="MEQSKLLEQLNRFTRRKHTAQEVYMFDVILCDNEVDRDGECFTKQ
FT                   ALETLCRRFEGVTGIFDHDPKGSRQTARIFATELVEDPARRTAYGAAYTYLKACAYMIR
FT                   TDSNQDLIREIDGGIKKEVSVSCAAKTSRCSVCGSTGACAHEKGKVYGGRLCYRELEDI
FT                   SDVYEWSFVAVPAQVHAGVTKQYGASGGEDPVRKALQAQLNAQQQAVALARQDARKQIR
FT                   QLLAATHSKSAAEAVMQSLEGMELARLYQYKDALRRDFSRQCAAQLQPGEHAPLDSFRM
FT                   "
FT   CDS             complement(317175..318149)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02900"
FT                   /product="Phage capsid family."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16533"
FT                   /db_xref="InterPro:IPR006444"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA88"
FT                   /protein_id="CBL16533.1"
FT                   /translation="MYDTIKLEKSMYNLTGKSFSQALEEMDPTASYADSPLGKLDAFER
FT                   QLKRFDIHLNGPDCDRVEKFFTTTESAVLFPEFIRRAILAGMRDSILTELVAVETKTTA
FT                   PSYTPFSISDGNSGFSTTTDEGAKLPATAITLASTAVSMTKFGRLITASYEVIRQQKLD
FT                   VFAVTLRSIGMRLANAVTKQALDTLYNGTTPAGLASTSTGFGYGDLAALYGKFTDYDLT
FT                   TVITTPELLSKILAMSQMENQRQGKQGELLLPFGAKLVKSSQLSGNKIIGIDKRFALEQ
FT                   ISCGDIILETDKLIDCQLDRIAVSVSVGFRTLMGDAVKSISWT"
FT   CDS             complement(319347..320645)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02920"
FT                   /product="phage terminase, large subunit, PBSX family"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16534"
FT                   /db_xref="GOA:D4LA89"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR006437"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA89"
FT                   /protein_id="CBL16534.1"
FT                   /translation="MEFKPFSKKQSLAAGWWSRRETSGYDAIICDGAVRSGKTTAMSLG
FT                   FVSWAMTTFTRQSFAICGRTVTALRRNVVVPLVEMLGNLGFTCIEKLSKNYIDISMQGR
FT                   CNRFYLFGGKDESSAALIQGITLGGIFLDEVALMPRSFVEQAIARCSISGSRLWFNCNP
FT                   DHPYHWFYREWICKAAEKNALYLHFTMEDNLSLTPRIRARYRRLYAGVFYDRFILGKWT
FT                   ASSGLVYPMFRKDTHLFTEPPACSRFVVSCDYGTVNPTSMGLWGESGGVWYRLGEYYYA
FT                   SRQTGISRTDEEHYTALEQLCSGRTIDCVVIDPSAASFMECIRRHGRFRVIPAKNDVLS
FT                   GIRRVSDALKSGRIRIHASCKDCIREFSLYQWNEKAGGDVPLKEHDHAMDDLRYFVSTI
FT                   LAKEEKSPFFVASLTRDRGMFHVEHSGEVCETT"
FT   CDS             complement(320635..321120)
FT                   /transl_table=11
FT                   /locus_tag="RUM_02930"
FT                   /product="Terminase small subunit."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16535"
FT                   /db_xref="GOA:D4LA90"
FT                   /db_xref="InterPro:IPR005335"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA90"
FT                   /protein_id="CBL16535.1"
FT                   /translation="MTEQTKRMRRQFCSLYAMLGNVSEAALRAGFDPDTAFQSGLEILG
FT                   MPAYQRLVHRLTRMPRIDPKQQVHVGLERLAFGTANDALTLLLSEESLSGEQLSRLDLF
FT                   NVSEIKKVKGGGLEIKFFDRQKALERMYEYASSADSGATARSLLAALAGGGDGEDGV"
FT   CDS             321390..321524
FT                   /transl_table=11
FT                   /locus_tag="RUM_02940"
FT                   /product="LSU ribosomal protein L34P"
FT                   /function="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16536"
FT                   /db_xref="GOA:D4LA91"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA91"
FT                   /protein_id="CBL16536.1"
FT                   /translation="MKRTYQPKKLHRKKEHGFMKRMATRAGRKVLARRRAKGRAKLTY"
FT   CDS             321648..321992
FT                   /transl_table=11
FT                   /locus_tag="RUM_02950"
FT                   /product="ribonuclease P protein component, eubacterial"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16537"
FT                   /db_xref="GOA:D4LA92"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA92"
FT                   /protein_id="CBL16537.1"
FT                   /translation="MLNQNKDFLALYKRGVCIPLRHVVLYVRRNRFGFNRLGVTAGKKL
FT                   GNAVCRNRAKRLIRQAYRETEALLPCGVDLVIVARSSILQIKSPELTALLAGKGLRQLQ
FT                   AAAARDPQKQ"
FT   CDS             321989..322255
FT                   /transl_table=11
FT                   /locus_tag="RUM_02960"
FT                   /product="conserved hypothetical protein TIGR00278"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16538"
FT                   /db_xref="GOA:D4LA93"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA93"
FT                   /protein_id="CBL16538.1"
FT                   /translation="MKQTAMLLIRFYRKVISPLLPRCCKYYPSCSAYALGVLERFGFLR
FT                   GSWLAIWRLLRCNPWSKGGFDPVPQKFDILGRHTPADFPQDDE"
FT   CDS             323530..324501
FT                   /transl_table=11
FT                   /locus_tag="RUM_02980"
FT                   /product="Predicted RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16539"
FT                   /db_xref="GOA:D4LA94"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA94"
FT                   /protein_id="CBL16539.1"
FT                   /translation="MIEIFTAKTVEEAQEQAVSAFGAPASQIRFEILEQPRRGLFGKLK
FT                   GEARVKAEYEPMMQQTPVREAPAAPAAPVPQQPAAPAEEPAVQPDAVPVAETVPETPEA
FT                   VPAEEAAPAELTEEQAAKAEHARSYVASILRSMGLSDASTMTVTESGVTLTFDGDGSGT
FT                   IIGRRGETLDALQYLASMVSNKGDKEYFRITIDSCGYREKRRKTLIELAKKISKSVLRT
FT                   GRSTTLEPMNPYERRIIHSAVSEIEGVTSHSTGEEPYRKVIISSTNPRKGGERRGRNDR
FT                   DRRRRNPEGPRKLDLATSFEKDYKRPKPEDELNAGLYGKIEF"
FT   CDS             324566..325930
FT                   /transl_table=11
FT                   /locus_tag="RUM_02990"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_02990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16540"
FT                   /db_xref="GOA:D4LA95"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA95"
FT                   /protein_id="CBL16540.1"
FT                   /translation="MSTIAAISTPNAVGGIAVIRVSGPDALTVAARVFTPANGKPVSGM
FT                   AGYTCAYGTVLDQDGNPVDDVVLTVFRAPHSYTGEDTAELSCHGGLFLSRQVLRLCFAA
FT                   GAEPAQPGEFTKRAFLAGKLSLTQAESVMDLISAQGDAQLRCARSLREGAVFRRIHSCT
FT                   DQLVVLLSDLAAWVDYPEEDIPSVEPDALDASLTALHADLSAIASTYDYGRILREGINT
FT                   VIVGRPNVGKSTLMNRLSGFERSIVTDIAGTTRDVVEESVRLGDLTLRLSDTAGLRDTP
FT                   DRIEQLGVEIAYRRLEEAELILAVFDSTAPLLPQDRELISRIGKRRAVAICNKSDAGSS
FT                   LTPDELSAHFAYVIPISAKTGEGMEQLSSALHALFLSDAPDPQAGVLSNERQKLCVERA
FT                   MEHISAAIAAVRSGEPLDCVTVLLDDAANTLLELTGERATEAVVEQVFARFCVGK"
FT   CDS             325990..327942
FT                   /transl_table=11
FT                   /locus_tag="RUM_03000"
FT                   /product="glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16541"
FT                   /db_xref="GOA:D4LA96"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA96"
FT                   /protein_id="CBL16541.1"
FT                   /translation="MENKIKKCSTWNISQFGVENMEEPLGCYEVIVIGAGHAGVEAALA
FT                   SARLGCRTAMFTISLDQIANMPCNPSIGGTAKGHLVREIDALGGEMGKAADATFIQSRM
FT                   LNRGKGPAVHSLRVQADRVAYHCYMKQVCEQEPNLDIKQGEVVEILTENGAVCGIRTRL
FT                   GTVYATRAVVISTGTYLRGLIHVGEASYQSGPDAALPSIQLSESLRALHVPLRRFKTGT
FT                   PCRVHRRSIDFDKLERQDGDPDIVPFSFASDASRMQNRVSCYIAYTNAQTHAVIRANLH
FT                   RSPMYSGRIEGVGPRYCPSIEDKIVRFPDKERHQLFVEPMGLNTDEYYLQGMSSSLPEE
FT                   VQLAFLRTIVGLEHVEIMRPAYAIEYDCCDPTALSPSLEFRGLHGLFGAGQFNGSSGYE
FT                   EAAAQGLMAGINAARLVQGKEPVILDRGTAYIGTLIDDLVTKGCNEPYRMMTSRSEYRL
FT                   ILRQDNADQRLSRIGHSIGLLSEERYAALRAKETAISREIKRVQHCNIAPSDAFADFLT
FT                   NHGTTPLTTGCKLADLIRRPQLGYSMLAPFDPDRPVLPEDVGQQVELEIKYAGYIEKQL
FT                   AQVAQMRGLEEKLLPNDADYSQVRGLRLEAAEKLNRQRPINIGQASRISGVSPADISVL
FT                   LVWLSQRGKQNAAEV"
FT   CDS             327926..328633
FT                   /transl_table=11
FT                   /locus_tag="RUM_03010"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /function="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.-.-"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16542"
FT                   /db_xref="GOA:D4LA97"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA97"
FT                   /protein_id="CBL16542.1"
FT                   /translation="MLPKYEHAKTLFEGYELELTPECYEKLDCYASFLVEYNEKVNLTA
FT                   LTAPEDVLIKHFLDSMLLTKYIEIPLGAALIDVGTGAGFPSVPVLLLRQDLHVTLLDSL
FT                   NKRIVFLQLLAEKLGLEVRCIHGRAEEAARKPELREKFDVATARAVAALPTLAEYCLPF
FT                   VKPGGMMIAMKGPSEHASDGARAAQLLGGESPRAVDYTLQEDARRLICIRKISQTSTKY
FT                   PRNSGQIKAKPLI"
FT   CDS             328695..329564
FT                   /transl_table=11
FT                   /locus_tag="RUM_03020"
FT                   /product="ParB-like partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16543"
FT                   /db_xref="GOA:D4LA98"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA98"
FT                   /protein_id="CBL16543.1"
FT                   /translation="MGHIFCYNWLTDNRGKEQKMGTFLGFTREKNTTRVIQVAPEEILP
FT                   NPHQPRTEFEEVEILSLAESIQQNGLLQPLSVRKLPDGYELIAGERRLRAARELGLPTV
FT                   PCIVFDVSDRTSAILSLVENIQRQNLNFFDEAAAIQRLIASYGMTQEDAAVKLGRAQST
FT                   VANKLRLLKISEPHRALILKYGLTERHARALLKLSSLEDRETVLQQVIKRNLNVEKTEQ
FT                   LIADLLHQQKERESYRQRSPFFQNVRIFVNTIQKAVETMQAAGIQADARKIQHDDFVEY
FT                   RVYIPVVK"
FT   CDS             329701..330498
FT                   /transl_table=11
FT                   /locus_tag="RUM_03030"
FT                   /product="chromosome segregation ATPase"
FT                   /function="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16544"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LA99"
FT                   /protein_id="CBL16544.1"
FT                   /translation="MARIFAVANQKGGVGKTTTVVNLAAYLGSRGKKVLCVDIDAQGNT
FT                   TTGFGIQKKGLEVSSYDVLLGKARIQEAILDSEFSNVSVVPAVSALAGAEIEMIELDNR
FT                   MNRLKMQLLTCRTDYDFVFIDCPPSLSLMTLNGLVACDKLIIPMEAEFFALEGLSQLSD
FT                   TMRIVRSRYNPGLDIQGILFTMFDARLNLSNQVVDEVERYFPGKVFQTKIPRNVRLSEA
FT                   PSHGKPVMYYDKSSKGAEAYELLGHEILGEPLVIQQKRRLFGR"
FT   CDS             330512..331345
FT                   /transl_table=11
FT                   /locus_tag="RUM_03040"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /function="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16545"
FT                   /db_xref="GOA:D4LAA0"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR013741"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAA0"
FT                   /protein_id="CBL16545.1"
FT                   /translation="MAKGGLGRGYETLFSDNTTEVHNLSTLRVAEIEPNREQPRKSFDD
FT                   GAIAALADSIREHGMIQPILVRPLENGSYQIVAGERRWRAARMLGLEEVPVTIRAMSDQ
FT                   ETMQIALIENLQRENLNPIEEAQGYQELLDQFGMTQECIAQIVGRSRSAVANSLRLLQL
FT                   PGQIQQYLQEGSITTGHAKALAGFADEEAMLACAARAADGQLTVRAIEKLAAAPKEHLL
FT                   QPDRRRDSYYKEMELSLSSSLGRKVKVDQGRKKGMLILEYYDKDDLATLAKKLTE"
FT   CDS             331425..332705
FT                   /transl_table=11
FT                   /locus_tag="RUM_03050"
FT                   /product="seryl-tRNA synthetase"
FT                   /function="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16546"
FT                   /db_xref="GOA:D4LAA1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAA1"
FT                   /protein_id="CBL16546.1"
FT                   /translation="MIDIKLIRTNPELVKENIKKKFQDEKLPLVDEVVELDKQYRETKV
FT                   KSDALRNQRKTISKAIGGLMAKGQKEEAEARKAEVAELAKELSESEAMENDLEARIRKI
FT                   MLVIPNIIDDTVPIGRDDSENVEVERFGDPFVPEFEVPYHVDIMEKLHGIDIDSARKTS
FT                   GNGFYYLCGDIARLHSAILSYARDFMIDRGFTYFIPPYMIRSDVVTGVMSFAEMEGMMY
FT                   KIEGEDLYLIGTSEHSMIGRFIDTILPEESLPQTLTSYSPCFRKEVGAHGIEERGVYRI
FT                   HQFEKQEMIVVCKPEDSKAWFVKLYQNTVDFFRSLDIPVRTLECCSGDLADLKVKSIDV
FT                   EAWSPRQKKYFEVGSCSNLGDAQARRLGIRVKGADGEKYLAHTLNNTVVAPPRMLIAFL
FT                   ENNLNADGSVRIPEPLRMYMGGKDVIR"
FT   tRNA            332825..332900
FT                   /locus_tag="RUM_T_24270"
FT                   /product="transfer RNA"
FT   tRNA            332918..333002
FT                   /locus_tag="RUM_T_24280"
FT                   /product="transfer RNA"
FT   CDS             333062..333460
FT                   /transl_table=11
FT                   /locus_tag="RUM_03060"
FT                   /product="Protein of unknown function (DUF2500)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16547"
FT                   /db_xref="InterPro:IPR019635"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAA2"
FT                   /protein_id="CBL16547.1"
FT                   /translation="MHLPVTPCLIAWGSLIPLLVVLLFGCFLAGSLILSRRREKRRIPA
FT                   PPASHASGEPESLHAVVIGMRCGVLKTGTAQSPDHLNAFEAEFLLDNGTKRVLFVDEDT
FT                   YEGLQEGLSGTLVIQNGYFLGFEPDWFM"
FT   CDS             333585..335405
FT                   /transl_table=11
FT                   /locus_tag="RUM_03070"
FT                   /product="GTP-binding protein TypA/BipA"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16548"
FT                   /db_xref="GOA:D4LAA3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAA3"
FT                   /protein_id="CBL16548.1"
FT                   /translation="MVRNDLRNIAIIAHVDHGKTTLVDEMLKQGGAFRENQNVAERVMD
FT                   SNDLERERGITILAKNTSVCYNGIKINIIDTPGHADFGGEVERVLNMVDGVLLLVDAAE
FT                   GPMPQTRFVLSKALEMGHKIIIVVNKIDRPDARLDEIGDEVLELLLELDANDEQLESPI
FT                   LFCSGRAGTASLSQYEEGEDLTPLFDTIVNYIEPPQGDENAPLQMLISSIDYNEYVGRI
FT                   GIGRIERGTARVGQAITVGDYHESRKPYNAKLVTLMQIQELKRVPVETATVGDIVWVSG
FT                   IENITIGDTVCENGAFEPLPFTKISEPTVEMTFSVNDSPLAGRDGKFVTSRQLRDRLFK
FT                   ELLKDVSLRVSETDSTDSFLVAGRGEMHLSILIENMRREGYELAVSTPRVLFRDDHGKK
FT                   MEPIERLVIDVPEESVGSVMEKMGTRKAELQSMHPQGSRMRLEFLIPARGLFGYKSEFL
FT                   TDTKGEGIMSSVFEGYEPYKGDIPRRSVGSLVSFETGDSVTYGLYNAQERGNLFIGAGV
FT                   PVYEGMVVGQSPKGEDIVVNVCKRKHLTNTRASGSDDALRLVPPINLSLEDCLEFLADD
FT                   ELLEVTPKNLRIRKRILSNTQRAKNRAKVI"
FT   CDS             complement(336160..336744)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16549"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAA4"
FT                   /protein_id="CBL16549.1"
FT                   /translation="MKRGMLAAVLAAALLLGGCGGGSSDSTPATTEAAEQMQVLYDKET
FT                   LDPDCAAVTERYFQAIQDQDFDAYKACIFPVYYEHMEQMLQTNYQYGMEQSFRKRCAGF
FT                   LGEGHASYQITSLQMEYAAEESLDSYFSSMEGIFGAEFQKDIQDAMEENHVILFTLKVR
FT                   FDNAGEEQTLVQDNELILAKAKADGTYYVFG"
FT   CDS             complement(336757..337338)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16550"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAA5"
FT                   /protein_id="CBL16550.1"
FT                   /translation="MKGKFVRAMAVALCCAMLAGCGKKEEGGSLEYQGIAVTFDQSKIV
FT                   PEAAKQVAGVYYAVEKKDAALYKSLLCNEYLAYTEQYWQQTGYTYDMLLSALYSQTADL
FT                   VGGDYKVTKVDITQVACDEAAKAVAEKLDQVSNQLWNKRASAYWVSYATVYSNVTIEAL
FT                   EGGRSYTMKNNAVYVIQNGDSYLLALEWGS"
FT   CDS             complement(337349..338008)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16551"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAA6"
FT                   /protein_id="CBL16551.1"
FT                   /translation="MRNMKRAAALGAALVLCVSCFAGCGSKDSSGNTSNPTSRTAMEDL
FT                   DYGATLRIDKKAYGVPMQYDKRFFEDEASLQVIGNYYRSIAENDSALFEQVQLPAYLDY
FT                   TIKTVHKSEFTTAELVQATHDSWKEHMDGDFAISLVDIVGCEVSRTYTGITTILDMLDS
FT                   IQEGISGKIDVIYELTVDVYLTPADSGIVGLETQTKKDGQVLFLFHVDDQWYLIYN"
FT   CDS             complement(338108..339040)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03120"
FT                   /product="GDP-D-mannose dehydratase"
FT                   /EC_number="4.2.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16552"
FT                   /db_xref="GOA:D4LAA7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR008089"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAA7"
FT                   /protein_id="CBL16552.1"
FT                   /translation="MNTLVIGGGGFVGAYLIAELNAGGHRVHATKLPGEEIRGTCTIHD
FT                   LDILQPEAVSALLEQLKPDWIFHLAAQSSVALSWKRPQLTVDVNVKGTLNLLEAVRRLA
FT                   HQPRVLLIGSGEEYGPVHCCPVGEDTPLHPGNVYAATKACQGMLGEIYAKAYGMDLLCV
FT                   RAFNHVGPGQAPMFVVSDFCRQTAAIELGQQEPVIRIGNLSAKRDFTDVRDVVRAYVLL
FT                   AEKGIAGRVYNVGSGKAVEIRGILDLILAQSGAKIQAETDPAKLRPVDVPVVEADIRRL
FT                   QEDTGWQRQIPLEQTIRDTLAYWRTELAK"
FT   CDS             complement(339037..340182)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03130"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16553"
FT                   /db_xref="GOA:D4LAA8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAA8"
FT                   /protein_id="CBL16553.1"
FT                   /translation="MAGLRILQVNKFYPPHIGGIETVVQQVSEGLKDRAQVSVLVCQPR
FT                   GKGIREEYGGVSVTRCSTWRTVASCPVSFSFFRAFRRMAKEADVIECHLPFPPADLACL
FT                   LSRTRKRVVIAWHSDVVKQKRLLTLYKPILRRFLRRADAIIVATQGHIDSSAFLQPYRD
FT                   KCVVIPYGIDTAAYLHAPAAPILTEKLQGKPLKKLLFVGRLVYYKGVDVLLRAFARTEG
FT                   CALFLAGEGVLEPQLRQEAQELGVADRVFFLGRLSNSDLRAAFRDCDLFVLPSVANSEA
FT                   FGIVQLEAMVYGKPVINTALPTGVPLVSLDGETGLTVPPGDENALADAIRTLAEDDDRR
FT                   EAYGAAAQRRVLEEFELHSMIDRVYRVLADHIETEERGMDK"
FT   CDS             complement(341348..342379)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03150"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /EC_number="4.2.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16554"
FT                   /db_xref="GOA:D4LAA9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAA9"
FT                   /protein_id="CBL16554.1"
FT                   /translation="MKNALITGITGQDGSYLAELLLEKGYNVYGIMRRKSVVDYGNVDH
FT                   IKDKLHFIYADMTDEISLINAMRISQADEVYNLAAQSFVATSWEQPLATAEIDAIGVTN
FT                   MLEAIRTVKPSCRFYQASTSEMFGLVQAVPQCETTPFYPRSPYGVAKLYGHWITKNYRE
FT                   SYGLFACSGILFNHESERRGKEFVTRKITDAVARIKQGVLDHVELGNMDAKRDWGHSKD
FT                   YVRAMWLMLQQDAPDDYVIATNETRTVREFVEIAFAQAGIQVQWQGTGVDEIGIDKATG
FT                   KTIVKVNKDFFRPAEVQLLLGNPAKAEEKLGWKREISFAELVQRMVDNDMALVEKELKV
FT                   AAL"
FT   CDS             complement(342400..343476)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03160"
FT                   /product="Mannose-1-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.22"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16555"
FT                   /db_xref="GOA:D4LAB0"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAB0"
FT                   /protein_id="CBL16555.1"
FT                   /translation="MKTTAVIMAGGRGERFWPKSRTNLPKQFLSLTSDGETMIQKTIKR
FT                   LAPLVETEDIFVVTNAAYKQLVHEQLPQLPQENILAEPMARNTAPCIALAAAVIRKKYE
FT                   DAVMLVLPSDHLIQYEEMYTDTLKQAIRVAEQGDNLVTIGITPTYPETGYGYIKFQRGG
FT                   EDLPGGVYQVDCFVEKPDLDTAKSYLASRKYLWNSGMFVWKISTITENFRKLMPELYTG
FT                   MDAMTEAYGTPSFDQVLHDQFAAFPSESIDFGVMEKAEHIYTLSASFGWDDVGNWLALE
FT                   RINQTNEYGNYVTGDVITINTSRSTICGSKRLIAAVGIEDLIVVDTDDAVLICAKDSTQ
FT                   DVKKVIENLRICNRRELI"
FT   CDS             complement(343557..344936)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03170"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16556"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAB1"
FT                   /protein_id="CBL16556.1"
FT                   /translation="MNNREQYKRIVYFFSTLIIVALLTLEFAFTWYTAYSDVIALPFYR
FT                   RGNWVLVLIYAVLFLIILKASGGYKVGYLKRGDMLYSQILSLGFVNTITYFQISLIGRH
FT                   LMPVKPLLWMTLIDLVLLICWAVLSNRFYFWLYPPRRLIIVYGSQSAAQLVMKMSERVD
FT                   KYMICESINIEAGLDRIKQEMRRFEGVIICDIAGAERNDLVKYCFETSTRAYIAPKISD
FT                   IILRGAEDIRLFDSPLLLCRNYGLTFEQRLAKRTFDICASLAGLILLSPVMLVCALAVK
FT                   CYDGGSIFYAQTRLTKDGKPFRVLKFRSMIADAEKDGKPRLAGEDDDRITPVGKFLRKC
FT                   RLDELPQLINILKGEMSVVGPRPERPELTEEYCRDMPEFRYRLKVKAGLTGYAQVTGVY
FT                   DTVPFDKLKMDLMYIEHYSMLMDLRIILMTIKTMILPGNTNEKRHILPARDAHKTDREQ
FT                   Q"
FT   gap             345362..345756
FT                   /estimated_length=395
FT   CDS             complement(346092..346328)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03180"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16557"
FT                   /db_xref="InterPro:IPR007211"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAB2"
FT                   /protein_id="CBL16557.1"
FT                   /translation="MRNEVFKRMWDKLALILLIIGGVNWGLVGIFEFDLVAWLFGGAAS
FT                   LVSRAIYILVAISAVWCITLLFRNDQKLVEVEA"
FT   CDS             complement(346452..347408)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03190"
FT                   /product="ROK family protein (putative glucokinase)"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16558"
FT                   /db_xref="GOA:D4LAB3"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAB3"
FT                   /protein_id="CBL16558.1"
FT                   /translation="MKYYVGIDLGGTNIVAGVVDEQYNILAKASTKTNCPRPDREIARD
FT                   MAKMAIQAVENAKLTMEQIEWIGIGTPGIANSRDGIIEYSNNLGFVNTPMVKYIQEDID
FT                   KPVFVENDANAAAYGEFVAGAAKGANNAVCITLGTGVGGGIIIDGKIYAGSNFAGAEIG
FT                   HTVISVDGPQCTCGRKGCFEVFSSATGLIRMTKESMAKNPDSSMHKLVAERSGKVSARI
FT                   AFDAMRMGDAAAKAVVDDYIKYLAAGITNTINTFQPDILCIGGGVCNEGDALLLPVKDL
FT                   VAKEVYTRNSKQNAQIVIAKLGNDAGIIGAAFLGNAQ"
FT   CDS             complement(347434..348381)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03200"
FT                   /product="mannose-6-phosphate isomerase, type 1"
FT                   /function="mannose-6-phosphate isomerase, type 1"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16559"
FT                   /db_xref="GOA:D4LAB4"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAB4"
FT                   /protein_id="CBL16559.1"
FT                   /translation="MQLIAPCKDYLWGGTRLREEFGKTSDKEKIAESWELSCHKDGVSR
FT                   IANGKYAGMLLTEYLEHAGKAVLGTRGAAFRYFPVLIKLIDAKDNLSVQVHPDNEYALR
FT                   VEGEYGKTEMWYIVDCEPGAKLIYGFAQEITKEEFRRRIADNTLLEAVHQVPVHKGDVF
FT                   FIAAGTLHAIGAGILIAEIQQNSNTTYRVYDYGRVGADGKPRALHIDKAAEVTRLAPAK
FT                   PYPASPPREHAGYTETLLAGCEYFTARRLDLHGAAKLDADQASFHHILLTEGHAVLTAG
FT                   EDTLTLEKGASVFLPAGLGTYTLDGTGQAILTTV"
FT   CDS             complement(348402..349184)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03210"
FT                   /product="Lyzozyme M1 (1,4-beta-N-acetylmuramidase)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16560"
FT                   /db_xref="GOA:D4LAB5"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAB5"
FT                   /protein_id="CBL16560.1"
FT                   /translation="MGRISRKKRILLIGLILLVLLAGTGVGGWLVYTGRIRLNHPSPEK
FT                   YPVRGVDVSHYQGAIDWQVLSAQSIQFAYIKATEGSSLVDEYFAQNWQDAHQTALYVGA
FT                   YHFFSFDSPGQSQAENFIRTVPETDNALPPVIDLEYYGDKASDPPERDGVRRELDALIR
FT                   ALKEQYGKTPVIYTTYTCYREYLKGDMPDCPIWYRSVYAPPLVGPDWVFWQYRCDAQLP
FT                   GYAGNHWEQKNIDLNVYRGSYAEFLEEFGLTEKHTTTE"
FT   CDS             complement(349184..351367)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03220"
FT                   /product="BNR/Asp-box repeat."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16561"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAB6"
FT                   /protein_id="CBL16561.1"
FT                   /translation="MKQKKRAAALSLTLGMLAGLSACDGKQGDASLSYRWGNVAIGGGG
FT                   YVTGITYNPTEEGLMYARTDMGGAYRWKSGDNQWVCITDHLGGVNSDSWNLNGVESLAT
FT                   DPVEPNRVYMSCGTYMGQPGAILCSDDYGNNWKQVDIGVTFGANNSGRGAGERMMVDPK
FT                   HNSTVYLGTRSDGLWRSKDYGANWEQVSSFPVKGNYSQEGISMGILWVEFDPVSGDIYV
FT                   CAAMKDGQCIYTSSDQGESWEALPANEKGMYPTQAGISSNGYLYLSYSDTCGPNTSCKN
FT                   GKVYRWSLADKKYEDITPQVGDNHYGGYGGVSIDAKDPDTVVVSSLCFWDGKGENLYRT
FT                   TDGGKTWKALYDESGSHYQMDVTDAQWLNWGREQPQTGWWVSDIEINPFNSDEVTYGTG
FT                   ATVYTTVNMTALDNGGDVTIKFNAYGLEENAVFKMVSPPHADGSTPQLYSIMGDLTGFS
FT                   HMDVNVRPDDAHFMKEGVPQDVDCAWLNPNVAAYTSDNGKMPVRITLDGGKTWNACTAL
FT                   GTGGASGTVALSANGSTMLWAPNSTKAETYVSNDNGKTWYVANGLGFQPKMAADKVNPS
FT                   KIYAACGGQVFASEDGGFNFAPTGALVSDTTTLYTVDGREGHVWALSGSIIMFSQDGGK
FT                   TFENLKNFNARAMGFGAPKNAGDYSVLYAMGSSDNVNGIFRSADQGKTWQRINDDKHQF
FT                   GNITPYICGDGSVYGKVYFATNGRGIVMGDIAE"
FT   CDS             complement(351364..353562)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03230"
FT                   /product="Alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16562"
FT                   /db_xref="GOA:D4LAB7"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAB7"
FT                   /protein_id="CBL16562.1"
FT                   /translation="MHITYDETLKLFRLTAGDMLYAMGITDGAYLAHIYFGKNLPDADL
FT                   TELLRLDEPPFTPSVNNRDKACYMDTLPFECPCFGLGDYREHAVEILDGAGMSTCDFRY
FT                   VSHRIIPGKPGLPGLPATFGTEQQAMTLCILCRDEHADLELELRYSVFEQMHTIVRSAI
FT                   VRNTGRADCRLKRLLSATLTLDGDGYDMLTLNGSWARERHVERCRLHMGKQRIDSMRGE
FT                   SSHQHNPFFALAEQGADEDRGVCYGLNLIYSGNFMAQAEVDQHHTTRAQIGINPTDFTW
FT                   LLPPGEAFAAPEAVLVWSEEGLGGMSRTFHDLYRQHLIRSKYRALPRPVLINNWEATYF
FT                   DFNEEKLLSIAREAAKLGIEMLVMDDGWFGHRDKDNSSLGDWYVYEKKLPGGLKSLVDK
FT                   VRAMGLKFGIWFEPEMVSPDSDLYRAHPDWAIQVPGRELTLCREQYVLDYSRQDVREYV
FT                   YGMLRDILTSADISYVKWDMNRQLTEVGSRMLPADRQRELWHRYVLGVYEMMERLVTEF
FT                   PDLLLENCSGGGARFDPGMLYYSPQIWASDDTDAMERLKIQYGTSLCYPVSAMGAHVSD
FT                   CPNHTVGRTTPFQTRGHVAMAGTFGYELDITKISPEDRGQIPGQIADYKRYSHIMRNGD
FT                   QYRIGDPFGTAGYDAWIFVAKDKGEALFTYVQTLSRPNVRSRRIRLKGLNPESWYRCSE
FT                   NGKTYSGAYLMQAGLRMPNLWGDFQSRQIYLNKMEERA"
FT   CDS             complement(353565..355619)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03240"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16563"
FT                   /db_xref="GOA:D4LAB8"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAB8"
FT                   /protein_id="CBL16563.1"
FT                   /translation="MRKEANIKLNCLLHGADYNPEQWLDTPEVLEEDIRLMQQAGINCV
FT                   SVGIFSWTALEPAEGVYTFQWLDQVIEHLYENGIYTVLATPSGAKPGWMAKKYPEILRV
FT                   EADRRRNLQGGRHNHCYTSPVYREMVTRMNTRLARRYAHHPGVILWHVSNEIQGECHCP
FT                   LCQAAFRNWLKEKYGSLEKLNRAYWTAFWSHTYTDWEEIESPAPQGETNVHGLVLDWRR
FT                   FCTAQTVDFFRVETAPLRAENPEIPVTMNMMGFYDGIDYWQFLPELDIISWDSYPGWHN
FT                   GDGNEGGNAVWNGAYCDAMRAMKHKPWLLMENSPSTTNWIGASRHKRPGFHRLTAIQNL
FT                   AHGSDSIQYFQWRQSRGSCEKFHSAVVSHNSSPEVRIFREVAGVGAMLKKLKEIRGSHV
FT                   PAKAAIIYDVQNGWAIGESKGPRNIGEGYLDLILRIYEGFWRRGIPVDLVNMDAPLDGY
FT                   RFVAAPMLYMLRGDIAQRLRRFAEQGGTLLTSYLTGLVDETDLCYLGQTPACGLTEVLG
FT                   LWAEEIDGLWDHQHNGIVMQDAPGMQNRYEASRLCEVVHPTTAETLGVYESDYYQGMPA
FT                   VTVNRFGKGRVYYVGTFGESQFYYDLLGRIAPEAGLSPALDTELPYGVTVGIRQSDTET
FT                   YYFLQNFNKDSRELMLPFPLEDLETGEIYAGTITLAGYGGMVCTRAKEA"
FT   gap             355649..355917
FT                   /estimated_length=269
FT   CDS             complement(356008..357423)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16564"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAB9"
FT                   /protein_id="CBL16564.1"
FT                   /translation="MKNLKRTLAMLLALSLSAAATACGGNSSSESEGRTKSQDDVSIDT
FT                   ADSAINAGDPDIKGQTIYYLGIYDLNPTANQDRTVALTLFEDVYGAKIETIKTTSETLF
FT                   TDLANRINGGDPVDMFDYQWDSVPNGVEKGQYEYLDSYIDLSDPIWDGMKDLIEKYKYK
FT                   GHYYVVPYSVSDYIAITYSRTLIEEEGLTDPYKLYQEGKWDWDAFMSSMKTFVANAEDG
FT                   ETRYGCAGWFGQAIVQSTGESIINYDGKKFSSNVMNEKIEKAELLEEELTRLSLFDPTW
FT                   YGTYPNDGSILYYGMAPWHLGQSNVMNPDGDLFLVPFPKMPGSDKYYLCGNAAAKMLVK
FT                   NSDKGDAVAAYIKCERLAATQAEYKQAAKEKALIETKTAAGKVTSYLTEEQYDFMQTWY
FT                   SSEDIVPMFDFGYGMGTRMSNETYAYETRGVMNNFMDGLLQKYEGTPGTWAEMRSAWQG
FT                   VVDEVVDEFNAKQ"
FT   CDS             complement(357441..357548)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16565"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAC0"
FT                   /protein_id="CBL16565.1"
FT                   /translation="MYNKVGMHIDSAPQEYGGCLWNRASAIPEQAFRND"
FT   CDS             357704..358138
FT                   /transl_table=11
FT                   /locus_tag="RUM_03270"
FT                   /product="RNase HI"
FT                   /function="RNase HI"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16566"
FT                   /db_xref="GOA:D4LAC1"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAC1"
FT                   /protein_id="CBL16566.1"
FT                   /translation="MKHVDIFTDGACSGNPGPGGYGVVLRFGTVEKELSGGEPNTTNNR
FT                   MELMGVITGLSALKEPCDVTLTTDSKYVVDSITKGWVYGWKRKGWIKSDKKPALNVDLW
FT                   ERLLPLLERHQVQFVWVKGHAGHPENERCDALAVAQRDRF"
FT   CDS             358247..359446
FT                   /transl_table=11
FT                   /locus_tag="RUM_03280"
FT                   /product="cysteine desulfurase NifS"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16567"
FT                   /db_xref="GOA:D4LAC2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAC2"
FT                   /protein_id="CBL16567.1"
FT                   /translation="MEKRIIYADNAATTQVSKPVLEAMLPYLTGQYGNPSSIYALGRHA
FT                   QRDIELARQQVAEALGCEPGEIFFTGCGTESDNWAIRSTAARLGAKGKRHIVTSVFEHH
FT                   AVLHTCAALEKEGFEVTYLPVSREGLLTAQQVADAIRPDTALVSIMYANNEIGTIQPIS
FT                   EIAAVCREKDVLFHTDAVQAVGHVPINVREQGIDMLSLSGHKLHAQKGIGALYVRKGVP
FT                   LPNLLYGGAQERSRRPGTENVPAIVGLGTAITLAVENLEEKMERVTALRNRLIDGILDI
FT                   PRTRLNGDRVHRVPGNCNISILGIEGEFLLLALDQLGVMASSGSACTSGSLDPSHVLLS
FT                   LGLCHEVAHGSLRLSISDETSREDVEYIIWAVHQAAERGRAMSPLWEAIQAGKVDYPDI
FT                   "
FT   CDS             359462..359893
FT                   /transl_table=11
FT                   /locus_tag="RUM_03290"
FT                   /product="FeS cluster assembly scaffold protein NifU,
FT                   Clostridium type"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16568"
FT                   /db_xref="GOA:D4LAC3"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR017787"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAC3"
FT                   /protein_id="CBL16568.1"
FT                   /translation="MLYSEKVMDHFTNPRNVGEIPDADGVGEVGNAKCGDIMKMYIKVQ
FT                   NGVLTDVKFKTFGCGAAVATSSMATELIKGKPIEEALQLTNKAVVEALDGLPAVKLHCS
FT                   VLAEQAIKAALSDYYRRQGIDPGPLVGEVHECEGCCEGH"
FT   CDS             complement(359966..361717)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03300"
FT                   /product="Na+/phosphate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16569"
FT                   /db_xref="GOA:D4LAC4"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAC4"
FT                   /protein_id="CBL16569.1"
FT                   /translation="MNIFSVFTLLGGLAFFLYGMTVMSNGLEKLAGGKLERALKQMTSS
FT                   KWKSLGLGAGITIAIQSSSALTVMLVGLVNSGIMQLPQTVGVIMGSNIGTTLTAWILSL
FT                   AGVEGDGFFINMLKPTSFSPLVALVGIILIMMAKSTKKKDIGSICVGFAVLMYGMTLMS
FT                   DSVSPLADMPEFASLLTAFRNPILGVIVGAAFTGIIQSSAASVAILQSLSATGGITFGM
FT                   AIPIIMGQNIGTCVTSLISSIGVTKNAKRVAVVHISFNIIGTIVLLILYYGLDAILGFP
FT                   FTDQPIDQLGIAICHSVFNVFTTVILLPMQKQLVKIAEFVVRDDPKDKETYAFLDERLL
FT                   NTPSFAISECTNQTTGMCRIARDSILEAISLGEGFDEKKVEFIREHENQLDLYEDKLGT
FT                   FLVKLSSNDLSDEDTRKVSLLLHTIGDFERIGDHALNLVKSAEEMDEKQIQFSPAAQKE
FT                   LTVVANALKEIISITTKAFERNDLELAGRVEPLEQVIDGLILDIKTNHIDRLQNGACTI
FT                   ELGFILSDLLTNYERVSDHCSNIAVAMIEVAHSSFDTHEYLNTLKNMDNPQFQQRYEEY
FT                   KTMYALS"
FT   CDS             complement(361904..362281)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16570"
FT                   /db_xref="InterPro:IPR025373"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAC5"
FT                   /protein_id="CBL16570.1"
FT                   /translation="MSRIRLSGCILAAIVSICIFSAVYVRRSCLELLDILARVQVHTEQ
FT                   ADYAAAAQAAVELNQAWSHATPRLNMLVSSDKLTQIGGALSRLIPLIDTENDELGAEIA
FT                   TSRTLLEQLYYGEIPVLNRLF"
FT   CDS             complement(362263..362946)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03320"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16571"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAC6"
FT                   /protein_id="CBL16571.1"
FT                   /translation="MAIGFLRSLILYGVVIFSVRLMGKRQIGELQPSELVITILVSNIA
FT                   TLPLENLDIPLLTGIIPILSLVCFEVLASWGTLRSRRLRRILSGSPKIIIRDGVIDQKV
FT                   LEELRFSADDLMTALRGSGVFDVTEVQFAIVETTGSVSVYPKHANRPVTNVPEQDTGDP
FT                   PDVLISDGKLIPHGLAASGLDRAWIQRVLNRRQLKIQDVFLLAARGQQDYCLIEKEGNG
FT                   CHGSG"
FT   CDS             complement(362956..363309)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03330"
FT                   /product="stage V sporulation protein AE"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16572"
FT                   /db_xref="InterPro:IPR005562"
FT                   /db_xref="InterPro:IPR014204"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAC7"
FT                   /protein_id="CBL16572.1"
FT                   /translation="MEYVWAFLVGGALCAIGQALIDYTKLTPARILVSFVVAGVILSGV
FT                   GLYPKLIELAGGGASVPLTGFGHLLAEGVRKAVDEHGFLGVFLGGLTSAAGGITAAMLF
FT                   GLLAAVCFRSKDK"
FT   CDS             complement(363311..364336)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03340"
FT                   /product="stage V sporulation protein AD"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16573"
FT                   /db_xref="GOA:D4LAC8"
FT                   /db_xref="InterPro:IPR010894"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAC8"
FT                   /protein_id="CBL16573.1"
FT                   /translation="MAKKIGTGTYLLEHAPSAAAYAAIVGQMEGEGPLGACFDYVEQDS
FT                   YFGKDSWEQAESELQRRTVGTALQKAELTAQDIDLILAGDLINQCTGTTYGLRGMGIPL
FT                   LGLYGACSTMAEGLALGSILMDSGIARHIVAATSSHFSTAERQFRFPLSYGGQRTPTAQ
FT                   WTCTASGAVVLAPCQNAPYLRAVTIGRIVDYGITDANNMGAAMAPAAADTILRFLADTG
FT                   ASPKEFDAIVTGDLGLIGSKLLCEILQKEGVDIRKQHRDCGAMMFDPEQQDTHAGGSGC
FT                   GCSASVLCGYFLPRIRTGELKNILFAATGALMSPTASQQGESIPGISHLIHISADKKGG
FT                   N"
FT   CDS             364478..367102
FT                   /transl_table=11
FT                   /locus_tag="RUM_03350"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /EC_number="3.6.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16574"
FT                   /db_xref="GOA:D4LAC9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAC9"
FT                   /protein_id="CBL16574.1"
FT                   /translation="MQIGLTEQQAQQRLAQQGENRLAAAKRKRPLSIFLGQFRDVMVLI
FT                   LLAATVISALLGEITDAVTIILIVLLNAVLGFVQEYRTERTLEALSAMTAPTARVFRDG
FT                   TLTTRPAAELVNGDVIRVEAGDRVPADCRILRCRGLFAEESVLTGESVPVGKHPGAPED
FT                   TDNAPGKDTLLYTGTGITQGAGEAVVIATGTATQMGQISSMLSQIEAGRTPLQERLGEL
FT                   GKTVAIICLAVCLIVFGAGVLRGEPVFDMLLTGITIAIAAIPEGLPATVTIALALAVNR
FT                   MLRANALVNRLHAVETLGCTSVICSDKTGTITENRMTVTRLFAGGELYEVRGSGYRITG
FT                   EIRLGKEICNPAAKPDLTALLRCGVLCSNAAIRTDREIRCRQRGSISAAGDWQVQGDPT
FT                   EIALLVAASKAGVTARSLSGWKRMEEEPFDSDTRCMTVLARSGSRCTAFCKGAADVLLP
FT                   RCAFYMQNGIPQPMTPAMRQSLTAQAQLLSGRALRVLALTEKDCDSLSAAEYGLTFLGF
FT                   SGMEDPVRQEAKEAIRRCRSAQIRTVMITGDHPATAKAVAAQAGLLRGRQVLTGAELDD
FT                   MPEETLRRQLDRYSVFARVSPAHKLRLVRAYRSRGEIVTMTGDGVNDAPAIKEADVGVA
FT                   MGLTGTDVAKQAADVILLDDNFATLVGAVEQGRCIYANIRKFVRYLLSCNIGEVLTMFL
FT                   GILMGMPMVLLPVQLLLVNLVTDGLPAIALGLEPPERGNMEKPPRRPEESFFSGGLLGT
FT                   ILLRGVLIGLSTLACFSLLLHMGCGVAGARTGALTTLVLSQLLHVFECKSEQKNIFTVP
FT                   YLNNGKLVLAVLASLLCLFGAIYVPALQTVFSTVALSGAALLRAVGLSLAVPLVAALIP
FT                   KGR"
FT   gap             367264..367576
FT                   /estimated_length=313
FT   CDS             368104..368847
FT                   /transl_table=11
FT                   /locus_tag="RUM_03360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16575"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAD0"
FT                   /protein_id="CBL16575.1"
FT                   /translation="MYTGTYRIAGRSIAIESQYPDVHAYCAAYRHAGEPDFTIRITPAD
FT                   IDRERDKSAREDQRQGIAPRAFPEGYLEELAVYRQIADRMPAYDTLLIHGSAIALDGAA
FT                   YLFTARSGTGKSTHTRFWRQTFGSRAVMINDDKPLVGLTDAGAVIYGTPYNGKHRLGEN
FT                   LSAPLQAICILERGAENTIRPISSGEAYPLLLQQVYRPGDPAALGLTLKLVDRLLTQVR
FT                   LYRLACNLDPAAAQVAYDGMKGCIS"
FT   CDS             368844..369104
FT                   /transl_table=11
FT                   /locus_tag="RUM_03370"
FT                   /product="Coenzyme PQQ synthesis protein D (PqqD)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16576"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAD1"
FT                   /protein_id="CBL16576.1"
FT                   /translation="MKLSKDFLLHHNGEECLVVSTGNAAFAGLVRTNKTAARILDCLAK
FT                   GADRAQIIENLTARYDAPREQIAGDVDHILEQLRRIGAIDD"
FT   CDS             369097..369537
FT                   /transl_table=11
FT                   /locus_tag="RUM_03380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16577"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAD2"
FT                   /protein_id="CBL16577.1"
FT                   /translation="MTESSIRRELAAHGSLVYTNVGVSMRPLIRQGRDLLVIRTCTGRL
FT                   RKYDIPLYQRPSGQYVLHRIVRVLPDGYVLCGDNCTQLEHVTDDQILGVLTALERDGRT
FT                   IPMTAPSMRLYGRLWVGLYPLRLPVLRLRDWLRRKKRHLQGG"
FT   CDS             369541..370710
FT                   /transl_table=11
FT                   /locus_tag="RUM_03390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16578"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAD3"
FT                   /protein_id="CBL16578.1"
FT                   /translation="MEQTITAARDLFYLFSCRLRDIPCDPARLEQMQLRPMLSLAQQHT
FT                   LGAMTCMSFEHAGLLERLSPEDAAALKTIRDKAVRKVLLLDAGRQELFRFLDANHIWHM
FT                   PLKGVILKDCYPVLGMRQMSDNDILYDSACQQQVRDFMISRGYTAVKVGKSHEDVYQKP
FT                   PVYHYELHTRLFDPHSTYAYAYYGDMLRRCSRQGYLYAMTQEDFYLYFLAHAYKHYSGG
FT                   GTGLRHLLDCWVFLQKHGDALDWAYIRRELKLLGLTDFEAESRSLSLALLDAPQRTLTE
FT                   EESRQLAYFISSGTYGTRQRWGENMTAARMQQMHMDPAAPDKKRYLWHRLFPGEAYYRT
FT                   YAPFCVRHVWARPFFGVYRLFRMLLDPRRRRRVQQETKTLQKQSSQKRD"
FT   CDS             complement(370788..372689)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03400"
FT                   /product="Beta-1,4-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16579"
FT                   /db_xref="GOA:D4LAD4"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAD4"
FT                   /protein_id="CBL16579.1"
FT                   /translation="MSKAITKKLLAGLTSAAMLATATAVNLTAVPAATAADAKVIYSTD
FT                   FEGDSFDFTRRGEDETLELTTEQAHGGSQSLCVSTRAKNWNGPQLALDNLIEANTEYVV
FT                   NAYAMTPWYATLTLSMQYTDADGNIHYGNILGQVSQGEWTAYENVKFSFPADTTDWYLY
FT                   FEASDASVNIYVDDFTITEAPEVELEDIASLADVYRPYFKIGTAIGSSNLASKPFMGLV
FT                   ERHFNESITFGNELKPDFVLDKAATLAYMEANDGDQTNPQISLTNAKALLNYCRDNNIP
FT                   VRGHTLVWHSQTPDWFFKENFSDDGDWVSKEVMIQRMENYIKNVMEALAEQYPTVDFYA
FT                   WDVVNEAWTDGGQPRTAGSNNTTTGNSAWVQVFGDNSFIEYAFKFARQYAPEGCKLYYN
FT                   DYNEYIDGKTNAICEMATDLKAKGLIDGIGMQSHLATNFPSAAQYKKALAKFAALGLDI
FT                   QVTELDITTSDTSEAGLETQAQVYSDIMDALVEYSDSISAVIFWGVTDDQSWRASQLPL
FT                   LFDKDFKAKPAYYSIVDGLEPVTTAPQDTTTTTTTTTTTAATTAPSGDFLAGDVDCNGV
FT                   VEINDAVLLARYVAQDDTVKITVQGVANGDYNQDGSVDSTDITAVCRQLAHLTDEDA"
FT   CDS             complement(372964..373989)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03410"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /function="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16580"
FT                   /db_xref="GOA:D4LAD5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAD5"
FT                   /protein_id="CBL16580.1"
FT                   /translation="MYILGIESSCDETAASVAVDGRDIRSNVVSSQIEEHKLYGGVVPE
FT                   IASRRHCENVLGVVRQALRDAEVTLEQIDAIAVTYAPGLIGALLVGVSFAKGLAMATGK
FT                   PLVPVHHISGHIAANYIAHPSLEPPYLCLVASGGHSHIIEVRSHTEFRVIGRTRDDAAG
FT                   ECFDKCARVLGFPYPGGVHIDRAAREGNPEGYALPRPTVAGSAYDMSFSGLKTAVINLA
FT                   HNARQKGESLRSADLAASVQHRIAGMLTEKTMAAARDLGYRAIAAAGGVCANTGVRQAL
FT                   TEACDKAGYTLYMPPLSLCGDNGAMIACQGYFNYLAGMRGGPELNAIATLSIEDIGERL
FT                   K"
FT   CDS             complement(373996..374451)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03420"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16581"
FT                   /db_xref="GOA:D4LAD6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAD6"
FT                   /protein_id="CBL16581.1"
FT                   /translation="MPQRDETILLMEACHVAQVAAIEQACFSEPWSEAAFRSELTNPQA
FT                   LTLVALREGQVAGFVNIAFAAETADINTVAVGAAYRRQGIGKRLLLAMEAWMEGQVSSY
FT                   FLEVRQSNAPAIALYQSLGYRQVGVRPRYYHKPDEDGLLMRKDVEKG"
FT   CDS             complement(374435..376990)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03430"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16582"
FT                   /db_xref="GOA:D4LAD7"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAD7"
FT                   /protein_id="CBL16582.1"
FT                   /translation="MTLLAIDGNSILNRAFYGIRMLTSSKGVPTNALFGFFNIYLKEAA
FT                   QVQPDGVAVAFDLRSPTFRHKAVASYKANRKGMPEELAQQLAPVKELLRGMGVTVLEAE
FT                   GFEADDILGTLARICTEHGEDCVILTGDRDSLQLVGEHVRVDLATNKETIPYTEERFRE
FT                   EYGFAPVHLIDLKALMGDSSDNIKGVPGIGPKTATGLIQTYGTIEELYAHLDEAGLTKG
FT                   AYAKLSGGKASAEESKWLASIVKDAPIPQDPAAYRLKEPDKESVSALLTELELFKLLDK
FT                   LKLEAAPVQSKPEPDAPAISLCKVVQPFDRSMLDGLTDREQPVDFLLREDTLYIHTGTC
FT                   ICTTREQGLILAFLASGCKKRSFDAKPVYRYAFAADSGLTGLCFDGAIAAYLHEATKAS
FT                   YEIPALCRSFHLPYEEDMGDTADIAALPGLCDALANKLEAEGLTRLMEEIELPLVEVLA
FT                   SMEHTGVLVDQDGVRRFGDALSGEIRQLEEEIYTLAGKQFNIASPKQLGQVLFEDLEIP
FT                   HPQGKKKTKTGSFSTNAEVLEKLRGAYPIVSLILRYRQLTKLNSTYVAGLLKTVAPDGR
FT                   IHTCFKQTETRTGRISSTEPNMQNIPVRTELGKEMRKFFVAPRGRILLDADYSQIELRI
FT                   LANLCEDANMQQAFLSGADIHASTAAQVFGVPREAVTPQMRSAAKAVNFGIIYGIGAYS
FT                   LSQDIGVSVREADRYIKRYLENFPRVEQFMTRIVEDAERTGFVSTLFGRRREVPELKSH
FT                   NKIQQAAGRRIAMNTPIQGTAADIIKIAMIRVYRRLAREQLDARLILQVHDELIVEAAV
FT                   QDADRAAVILREEMEHAWDMAVPLTAEVGKGESWYAAKG"
FT   CDS             complement(377089..377616)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03440"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16583"
FT                   /db_xref="GOA:D4LAD8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAD8"
FT                   /protein_id="CBL16583.1"
FT                   /translation="MVRLKELNPEPIRQCTIIKQKGRCSPVEVESLEVEWIAVLDRFNK
FT                   LNARYKVEGLPRPEFMLLHLIAKSPSGAVKISELAAALEVTTPAVSKLLKSLEEKCAVS
FT                   RVSDITDRRITYITMTKAGRQLYDRALQARRRIGLSVMERIGEQAYKQLFEQMQILYQA
FT                   FEDALTDQDSDI"
FT   CDS             377820..378851
FT                   /transl_table=11
FT                   /locus_tag="RUM_03450"
FT                   /product="heat shock gene repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16584"
FT                   /db_xref="GOA:D4LAD9"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAD9"
FT                   /protein_id="CBL16584.1"
FT                   /translation="MDDRKLKILAAVVDEYVQTGEPVGSKTIAALPHINVSAATVRNDM
FT                   AVLEQLGLLEQPHTSAGRIPTFNGYRLYIDKLMTTEALSEKERQRLDDMLEAQGALTEE
FT                   LLIQSAGTALAELTQCAAVVTNAAPKFSIISKVEVIPTGKRLYVILLITSNGSIKNKAC
FT                   RLEFDLSNEQLEFFTHYMEENLEGVSVEDLSEQRLQDLIAALGAYMTTLSPLVQGLYEL
FT                   SRDLKQKEVTVSGARNLLTCSELEKMDIVQFMEHTDTVIPLLDDAFSGVQVLFSQESNN
FT                   FVIGNSSMIVSKYQKGNQPAGALGVIGPMRINYAKIIPYIEYFTQKLTDLISDEDEHEP
FT                   GQH"
FT   CDS             378871..379461
FT                   /transl_table=11
FT                   /locus_tag="RUM_03460"
FT                   /product="Molecular chaperone GrpE (heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16585"
FT                   /db_xref="GOA:D4LAE0"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAE0"
FT                   /protein_id="CBL16585.1"
FT                   /translation="MKKEQDLTEETTAGQEPEEAAKAAESEAAAAQEAESASQPEQAEQ
FT                   PEIKQTRTEPDPAEQLAAEKDKYLRLYAEYDNYRKRTAKEKTETYSHATAAAVETLLPA
FT                   LDSFSLALEAACTDEAYKTGMEKIYTQLNEALKKLGVREMEALGTPFDPNFHHAIKQAA
FT                   DTEYEEGMVCQVFQKGYLIGDRVIRHAMVAVAQ"
FT   CDS             379534..381390
FT                   /transl_table=11
FT                   /locus_tag="RUM_03470"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16586"
FT                   /db_xref="GOA:D4LAE1"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAE1"
FT                   /protein_id="CBL16586.1"
FT                   /translation="MAKIIGIDLGTTNSCVAVMEGGNAVVIPNAEGARTTPSVVAFSKN
FT                   GERLVGQVAKRQAITNPDKTVSSIKRHMGSNYKVEIEGKSYTPQEISAMILQKLKADAE
FT                   AYLGEKVSEAVITVPAYFTDSQRQATKDAGQIAGLTVKRIINEPTAAALSYGIDKEEEQ
FT                   KIMVFDLGGGTFDVSIIDMGDGVTEVLATAGNNHLGGDDFDQRIIDWMTSEFKKAEGID
FT                   LTGDKMAMQRLKEAAEKAKIELSSTPSSNINLPFITADATGPKHLDLTLSQAKFNELTA
FT                   DLVQATMGPVDQALHDSGLKASDLDKVLLVGGSSRIPAVQEAVKQKIGKDPFKGINPDE
FT                   CVALGAAYQGGVLGGDVKEGLLLLDVTPLSLGIETAGGVCTKMIPRNTTIPTKKTQVFS
FT                   TYADNQPAVDINVLQGEREFARDNKQLGTFRLDGIAPAPRGIPQIEVTFDIDANGIVHV
FT                   SAKDLGTGKEQNISITASTNMSEADIDKAVKDAEKYAEEDKKRREAVDAKNNGENLVFQ
FT                   CEKAMTDFGDKVTDADKAPITEKCNALKEALKTDNTEEIKAKTEELQKAFYDLSGKVYQ
FT                   QAGAAQGQPDMGNMGNMGGMNGGSSNPGGDDGDVVDADFTEA"
FT   CDS             381538..382695
FT                   /transl_table=11
FT                   /locus_tag="RUM_03480"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16587"
FT                   /db_xref="GOA:D4LAE2"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAE2"
FT                   /protein_id="CBL16587.1"
FT                   /translation="MTGIMAEKRDYYEVLGVQKDADEEAIKKAYRAMARKYHPDLHPGD
FT                   KECEEKFKEVTEAYEVLSDPEKRQKYDQFGHAGVDPSYGGMGGMGGMQGGFADMGDIFE
FT                   NLFGGVFGGSRSSSANVPRQGKDVNVGLNIDFMQACKGMRAEVKVQRMERCADCAGTGA
FT                   AAGSSPEVCPDCHGRGTVKINQRTPFGMIAQTKTCPHCGGKGKVISNPCSKCKGAGRVR
FT                   VAKTINVDVPAGIDNGQTLRVSGQGDAGINGGPSGNLNVVINVRPHPLFVRDGYDVHCE
FT                   IPITYTQAVMGDDITVPTIDGHVKYHVGEGTQTGTVFRLRGKGVRRLHRTDNGDQYVKV
FT                   VVEVPKNLTKKQKDLLKAFEDSLSDKNYAKRQSFFEKLKGLFDAK"
FT   gap             382881..383309
FT                   /estimated_length=429
FT   CDS             383319..383459
FT                   /transl_table=11
FT                   /locus_tag="RUM_03490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16588"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAE3"
FT                   /protein_id="CBL16588.1"
FT                   /translation="MIHKQMVTISKPAKLSRHAEHKEPHEKIFTKSQTAKRAAPGDSVI
FT                   L"
FT   CDS             complement(383454..383960)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03500"
FT                   /product="acetolactate synthase, small subunit"
FT                   /function="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16589"
FT                   /db_xref="GOA:D4LAE4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAE4"
FT                   /protein_id="CBL16589.1"
FT                   /translation="MGQFVIAALVSNQSGVLTRVSGMFTRRGFNIDSLTVGETENPALS
FT                   RITIAMRGDAHDLDQILKQLRKLHDVTEVRALPHSDTVFRELLLIKVRNDAQTRQEILA
FT                   AVDIFRSKIVDYATDALCIELTGESSKIDAFIELLTPFGILEMCRTGIVALERGRNCLK
FT                   GETLL"
FT   CDS             complement(383960..385657)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03510"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16590"
FT                   /db_xref="GOA:D4LAE5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAE5"
FT                   /protein_id="CBL16590.1"
FT                   /translation="MRLTGAQIVTQVLLEQGCDTVFGYPGGQVLALYDALYQKRRQIRH
FT                   IRTAHEQGAAHAADGYARATGKPGVVIATSGPGATNLVTGIATAYLDSVPMVAITGNVP
FT                   CDRIGLDCFQEVDITGITIPITKHNFMVKDIRRLADTLREAFTIAKSGRPGPVLVDIPS
FT                   DIQKTRWEYTPAGEAPMLPTKHAAAEQLEEAVRQLTAAQRPYISCGGGVIRAKAAPLVQ
FT                   ELARRLDCGVGATLMGLSAMPGEDPRFLGMQGLHGHYAAAMAQREADLILVAGARFSDR
FT                   AVGEHANFAPDAKILHIDIDAAELEKTMPVYLGIEGDIRDALERLLERIPQQSHPAWQQ
FT                   RLAQLKQQEAEQMPTQEGFHPAGIIRMLSDRAGDAYIATDVGEHQMWTAQHFSFRTPGS
FT                   FLTSGGLGTMGFGMGAAIGAAIGTGKPTILITGDGSFRMNFNELATAVEQKLPLTILLL
FT                   ENHTLGMVRQSQTLYYKRRYAATDLGCSIDYPALAEACGAVGLRAESYAQLDQALTRAA
FT                   HSKKPVLILCPVDPEQMVFPMLPPGGRVEDMLLAAPESAQKHHRKEKA"
FT   CDS             386246..387436
FT                   /transl_table=11
FT                   /locus_tag="RUM_03520"
FT                   /product="Type II secretory pathway, component PulF"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16591"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAE6"
FT                   /protein_id="CBL16591.1"
FT                   /translation="MPSYTYTAKDVAGNIRKGTLSAEDEQDFLAKIHEKGLFPTEYNEA
FT                   AGVKQSTHKFSTKELAFNCRQMAAMLTSGLTLVKALDILCREQEKEASKLIWRDIYENV
FT                   QKGESFSASLEMHSGSFPQFLISMVAAGESSGSLDQIMQRMSDHYAKENKMHNTIKSAM
FT                   MYPIILVILCVAVVIGLFTFIMPTFAGLFTNEEDMPALTRVMMSISNFLRGYWYILIGF
FT                   VLIAVFGIRYAMKMPNVRLKWDRFIIKGPGFGALVVKIYTARFARTLSSLYSSGIPMVE
FT                   CLERSSAILNNSYIDEKFRTVVDEVKQGETLSASIQRTEIFESMFCSIIYVGEEAGALD
FT                   DILAKTSDYYDEEADSAVQRLVGMLEPVMIIILGIMVGLIVASVLPALYDSFENIE"
FT   CDS             387457..389052
FT                   /transl_table=11
FT                   /locus_tag="RUM_03530"
FT                   /product="Competence protein A."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16592"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAE7"
FT                   /protein_id="CBL16592.1"
FT                   /translation="MLSFDITDRNIRIIKGVESNGKIRINSAATLNLEEEIIVNGHVKD
FT                   VPRLATLINQVLKSNRMADKEAIISISSNLTIFKELHIPKAKEQDFVKMVRAEMQTQLG
FT                   IDESYSVSYVIVGEETDENNQIVQKVLATACPYEIIDCYKRVFSMLTISLRSVMIGCNC
FT                   ITKVLLSDAKIKSKMPLLAVQIDNNFISLNLYEKGQLSFSRFASISAEDYGNSDDYVFE
FT                   AVNENIFRMMQFQKSKNTGEVVENVVFYGDTHEFVRLTNALEQMGVRTSIITVPPQIHG
FT                   YENLEFSSYANAIGAMFKRNKETERINLLETDTFNNNKIKSDKSYGLLLGVSVLATAVV
FT                   MLGAWGALKIYDNGIKDEIKTYQDKIDSPETKAKLAQLEQLKKTEESVTTLLSEMTDAS
FT                   DAFKTRPYILKETYDIVEKAAEETATDQQMSDMEVTQFDYSAGVLNVKIEVDASEDPAQ
FT                   KYPAAVTAILEKETKFYYVDYKGYQVKEETDPVTEAVTKRIEYTFTVDIKGDGINLDTE
FT                   ETTENTTGEEGTGK"
FT   CDS             389049..389795
FT                   /transl_table=11
FT                   /locus_tag="RUM_03540"
FT                   /product="General secretion pathway, M protein."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16593"
FT                   /db_xref="GOA:D4LAE8"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAE8"
FT                   /protein_id="CBL16593.1"
FT                   /translation="MKLSYRDRVILIVVAIIAIIAIVAIALIRPTIKSINTDNKTLETT
FT                   KQTWTETEQKLNQIEPTKKRITEKRDNAAKLAEYFTPETLFSEQDQFLHKALDDNNMHV
FT                   TNLTMTDPEAAPLDFYYENPHELSYNLNQHADLDGSMAKALSEKLREYLALSARTAQDV
FT                   ATRTSTIECRAKKEDLMNFLADIKKMDTTVLVESVTISDYTFCPAEDADPNWTAEERAE
FT                   NVDHSTMTIVVKFYSVPVPTAADLGE"
FT   CDS             389839..392559
FT                   /transl_table=11
FT                   /locus_tag="RUM_03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16594"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAE9"
FT                   /protein_id="CBL16594.1"
FT                   /translation="MNDHEKKGKVGGSVLFTVIVVMMVLVVFLMGTLGLASAANKRAQN
FT                   SYTSSQAQYTARMAVESVLAAMQNDADVAERVYKLRANTPINVDISTDRLATAGTTGDA
FT                   YGRIQSCTIENIGKDYYYVDDKWDGRDIIKITATVQLGTQDSTVSAYILKKEKDSVVNN
FT                   TPSGGGGGLVTAGDATFGTKVSVFGGAGINLGNRWRNLDPADALRGYSFDGSANFSSQD
FT                   TTSLQWEAPYVVNGSFTADGSGAALVFPKLGSGFTFWGNFNFNNQIAITSGNPAVLNAG
FT                   SSAALNYTDIPYIYVEKTLSITNGAKGVNVNHQIPLNILCGNTCIITTDPIYANLYMMN
FT                   DNTPDSEKVEKQVYWPEFKIEKYANYINFNQGSLLSNWTYQLINGVDNPTEHVGGSIYA
FT                   QDDLCIDADNNRGVVEGSLVVDDDLLISTQEFVVEGDLVVKGRLKITNGRVKVGGKFYH
FT                   DDQAGDDYTDKVFDSTGATALTPDAYDSNLGYPYYMDREYVLGLTDETYTGKDASGKNV
FT                   TLARQFVNTLQDTMSTAMDPYKNAYYGLPTTAYGGKVDSWWQRYSVDPTSAAGMDVRAY
FT                   EPNDAVNTPNGKEIVIANTEIAVLRSGNYDGVNIRVVPDDSHPSIWLIVDDNVSFGNMN
FT                   GYRGFIFEDCGATVAEITNGTDVKLNKDGNPAYQVVSTGTYADYVKKDVADANGEFQGK
FT                   YSLNMLLRGSVRMNKAGLMTRHYVSLAETGTNFQIYNAYGKPDTGIYKAERPNVYVYSA
FT                   NYNGCDLSKDPTDPDVKDTLDKIEAQTGYRPTTKNSCPYLNVTTKDGYNMPKVNFEASA
FT                   AFLSAYFMAPFLDIDAKKVDKTFGSCTVYYNGHQVKSNAIGIIGTMIGNGVNAGSDGAW
FT                   VSLYYPSYIPPVTPPDAPEDETYMNSWALIQFENY"
FT   CDS             392572..393057
FT                   /transl_table=11
FT                   /locus_tag="RUM_03560"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16595"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAF0"
FT                   /protein_id="CBL16595.1"
FT                   /translation="MKRFLRKKPKKTAKGMTLIECIIALCVFSIAAAVMVETGIVVNRT
FT                   LQETTHLNRKVSAQSPKAETQNVSSATQEGFSVNVPAGAAKNFTRVVLEVEGTFSPVSI
FT                   LVDTYNTADSSDPDTSMDADLHFVDVDTETYGTDRNGGPLKFEEEIETPTEGEGETP"
FT   CDS             393054..393983
FT                   /transl_table=11
FT                   /locus_tag="RUM_03570"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16596"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAF1"
FT                   /protein_id="CBL16596.1"
FT                   /translation="MTQSRSKQEVESMKQKQLKGFTLVELVVVMAIFSMIMFGAMQLMD
FT                   PVSKIFQRTSNYETSAATVDNVKRYIEGSIRYADFINVYEGSYMQYDPSSGGDIAITEE
FT                   QAIDEFMKRYLDSACGVVDKKARPVTAQYLNYDVYVMEIDNTIYSTSGTEITDTSVGGI
FT                   DANRGRGRITQRIYSVNSHEAGGVYPKTLTSSGLAINETYFRDTAIDVQLGLTDADTVS
FT                   MANFTMRITNYRDVTKSGGVRTFSETATETNAAMGLVNVASNAGTNYYAFDDDGNVTVR
FT                   TRGTDVFTCKRTGSKEHIFIIYAFEHQR"
FT   CDS             complement(394035..394871)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03580"
FT                   /product="Type II secretory pathway, prepilin signal
FT                   peptidase PulO and related peptidases"
FT                   /EC_number="2.1.1.-"
FT                   /EC_number="3.4.23.43"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16597"
FT                   /db_xref="GOA:D4LAF2"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAF2"
FT                   /protein_id="CBL16597.1"
FT                   /translation="MLPILSRTIGGEFMDWQFYLLFFPIVFLYGICIGSFLNVLIYRLP
FT                   NNESLIKRSSHCMTCQAKIRKRDLIPVFSWLFLRGKCHNCGARISPQYPIVEALNGILY
FT                   IVALLVLDLNANGIICCLFFSLLIVVGFMDWNTLEIDLRILLCIALLAIPSALLTDTLT
FT                   IPQRLIGAVCVSVPFFLIGEISGAVIKRRTGEKVRGIELGDTLLMAASGLLVGPKVTAV
FT                   AALIGIFLAAVCGLAYKKITGESKFAFGPFLSIGLVIGTLFGNQIVAWYINHMILE"
FT   CDS             395009..396685
FT                   /transl_table=11
FT                   /locus_tag="RUM_03590"
FT                   /product="Type II secretory pathway, ATPase PulE/Tfp pilus
FT                   assembly pathway, ATPase PilB"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16598"
FT                   /db_xref="GOA:D4LAF3"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAF3"
FT                   /protein_id="CBL16598.1"
FT                   /translation="MRNIRIGDYLVEQGLITQEQLEKVLEAQREAQGTKRFGDVIVELG
FT                   FLSETKFTQALAGKLKVAYVDLSTVDIDEEAVRKVPEALALKHTVIAINIQGRRLTVAT
FT                   DDPINFNILEDIKVSTGMDTVPVLATKTAIKKMIGKHYSMQNVDSVLEGVSALNPVEDE
FT                   DDDGSKDRVDSAPIVKLATTIVENSFRADATDIHIEPFKTYTRIRIRVNGDLVELMNVA
FT                   NQVHNSLTTRLKLISGMNIAEKRVPQDGRFTQVVDGTTPLDVRVSSLPTVNGEKIVIRI
FT                   LSTGQIALRKITDLGMSDYNYRMFESMIKCPHGVMLVTGPTGSGKTTTLYAALGELAKP
FT                   NVNVITVEDPVEKQIDGINQVQVNAKAGMTFAAALRSILRQDPDIVMIGEMRDSETAEI
FT                   GIRAAITGHLVLSTLHTNDAASTIVRLVDMGIPPYMVASSLIGVIAQRLVKVLCPKCKT
FT                   ARMSTPDENKLMKLDHSVPIYESRGCPECNNTGYKGRTAIHEIIHCSAGISTLIADNAS
FT                   KEELEICAKKNGTKLLRENVSELVQQGVTSIDELVRVTYAV"
FT   CDS             396704..397771
FT                   /transl_table=11
FT                   /locus_tag="RUM_03600"
FT                   /product="pilus retraction protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16599"
FT                   /db_xref="GOA:D4LAF4"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAF4"
FT                   /protein_id="CBL16599.1"
FT                   /translation="MAILINKILDEVRVLGCSDLHFTNGINPVVRLNGQLRKMSGYEEM
FT                   NEEGILEIVEQMTNEQQRRSIAQHKDTDFSFTTRSGYRHRVNVFFQRGFTAIAIRLLRN
FT                   DIPTLEDLFLPPILGEFAMRPRGLVLVTGPTGSGKSTTLAGMIDYINVSRSAHVITIED
FT                   PIEYVHEHKRCMVNQREVGMDVPDFASALRAALREDPDVILVGEMRDFETVSAAVTAAE
FT                   TGHLVLSTLHTTSAPDTINRIIDVYPEHQQVQIRTQLANTLVGVISQTLLPKRDGSGRI
FT                   AAMEILNVTDACAAMIRDNKVHLIQSAIQTGKQNGMMCLDQELARMAKQGIVYEADALE
FT                   RCQDKAEFYRYFNAM"
FT   CDS             398088..398555
FT                   /transl_table=11
FT                   /locus_tag="RUM_03610"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16600"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAF5"
FT                   /protein_id="CBL16600.1"
FT                   /translation="MKTTKAKGFTLIELIVVIAIIGVLAAILVPTMLGYVTKSRCSSAN
FT                   ANAKSFYNAINSALVDLDSEGQDTSTFDAPDGASLTGDLATKVGNYFADYTKLTAYHYC
FT                   IANGTCTAVTIQNGAYWGSYPNPTTVDAPGAGSTGVSTQCKTQPTLAQAGA"
FT   CDS             398923..399534
FT                   /transl_table=11
FT                   /locus_tag="RUM_03620"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16601"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAF6"
FT                   /protein_id="CBL16601.1"
FT                   /translation="MKQHKVKGFTLIELMVVIGIIGVLSAVLIPSMNAYYTRSRIKTTN
FT                   SNAKVLFNAAQTAAQEFQFRERSVSDHSFNSTGDGVVVIRADRGQVVSVNDTAIGSIGA
FT                   VPDPSDPSVELISAADRQAAYTNFVRRIANTFGDSTETCWVVYVDNYIVRSAICARTDS
FT                   DRYLGAYPNPTDDKSDNTISDLTRATILSDFVEPYWGSGS"
FT   tRNA            399657..399733
FT                   /locus_tag="RUM_T_24290"
FT                   /product="transfer RNA"
FT   CDS             400041..400646
FT                   /transl_table=11
FT                   /locus_tag="RUM_03630"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16602"
FT                   /db_xref="GOA:D4LAF7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAF7"
FT                   /protein_id="CBL16602.1"
FT                   /translation="MFWDRVAWVYDVFANIINRSANQRLCKAVGNMICPSDEVLECACG
FT                   TGLLTGVIAKKCKSLIATDFSAKMLKRAKKKYGSRGNVRFEQTDILHLPYPDACFDAVV
FT                   AANVIHLLDEPDQALHELERVCRQGGRIIIPTYMNRTNKGTTNSVSGAIGKAGADFKRE
FT                   FTIDTYKRFFKEAGYPDAAYTMCYGRIPCAVAVLRKIN"
FT   CDS             400694..401299
FT                   /transl_table=11
FT                   /locus_tag="RUM_03640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16603"
FT                   /db_xref="InterPro:IPR026002"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAF8"
FT                   /protein_id="CBL16603.1"
FT                   /translation="MWALFAGSFRKQLTEVFGYDADTARAITKQAKPKYREIIHSLPEF
FT                   EQGDRFQMNLVNAAMIGAFILSMPERPDVERLTVYYANAMMTKPVWWFCRKSGKNKFTE
FT                   KDIAGMQATAQLKAADRNPYSWNMEFYEYPDGSGYEGRFTKCGICVLMQKLGLYDLTPA
FT                   LCHLDYTMSEAGGVTDFVRQYTLASGGPYCDCGYKKKK"
FT   CDS             401392..402246
FT                   /transl_table=11
FT                   /locus_tag="RUM_03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16604"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAF9"
FT                   /protein_id="CBL16604.1"
FT                   /translation="MLFSEKLKQFEVAHPCENITVDGAQYRYILSGRDTDRTLVFLNGG
FT                   MNTLEMWMDYVDGLSGDYRVLLFDYPQELRTNQALVTGMHGFFQKLGIEAPVFIGASDG
FT                   GMVAQIYVQKYPGEAGGLILISTGGMDANTLKSLKKKYCIAPLLLWYMKHCNYEKLKPK
FT                   LIKAGMRHIRNESAEEIAYARDLFETIFKDYKQEKDVHISGLLADLMNQKPVTEADFAA
FT                   LAGKILLILPDQDFFSGTMQEDLIKLMHNPQISYVSGSHLSTVVKAEDYIRAIRAFLNQ
FT                   SMK"
FT   gap             402278..404296
FT                   /estimated_length=2019
FT   CDS             404433..405137
FT                   /transl_table=11
FT                   /locus_tag="RUM_03660"
FT                   /product="nicotinamide mononucleotide transporter PnuC"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16605"
FT                   /db_xref="GOA:D4LAG0"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAG0"
FT                   /protein_id="CBL16605.1"
FT                   /translation="MKQSIAAYFSKGEWLLWGGSVCGILLAFLAFDRESWMTLAASLIG
FT                   VTSLIFNAKGNPAGQALIILFSLLYGAISYSFAYYGEMITYLGMSASMAVFALISWLRH
FT                   PYQGNRSQVQVNQITRNEVLCMLLLTGAVTLLFYFILRYFHTANLLPSTISVTTSFLAV
FT                   YLTFRRSPWFALAYGANDAVLIVLWTLAARQDPSYLSVVVCFVMFLVNDLYGFYSWCRM
FT                   AKRQAEATPDAA"
FT   CDS             405229..405954
FT                   /transl_table=11
FT                   /locus_tag="RUM_03670"
FT                   /product="transcriptional regulator, MerR family"
FT                   /function="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16606"
FT                   /db_xref="GOA:D4LAG1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAG1"
FT                   /protein_id="CBL16606.1"
FT                   /translation="MMTVHQVSQRTGVSIRTLQYYDRIGLLPPTAYSEAGYRLYDEGAL
FT                   EHLQQILLFRELEFSLKEIRRILQSPDFDRELALQQQIRLLTLKREHLDHLITFARGLQ
FT                   STGGRNMDFTAFDTAKLDAYAKQAKEQWQDTAAYQEFSEKSKGRSKETEQGLAQGLMDI
FT                   FREFGTCRDQDPGAEAPQALVQRLQGYISEHYYTCTREILGSLGEMYGAGGAFTGNIDK
FT                   AGGKGTASFAREAIRIFCG"
FT   CDS             406091..406357
FT                   /transl_table=11
FT                   /locus_tag="RUM_03680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16607"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAG2"
FT                   /protein_id="CBL16607.1"
FT                   /translation="MIEVHVINGDLSEPEIDAYIAYGREKYPDREICGVDIRLDGEFVD
FT                   LKYYFRPRFQHVYRATDYLVKTLDVLNDAKRAEYRDKVMHPVY"
FT   CDS             complement(406424..407281)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03690"
FT                   /product="Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16608"
FT                   /db_xref="GOA:D4LAG3"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAG3"
FT                   /protein_id="CBL16608.1"
FT                   /translation="MKRATTGRILKIGLLISLISATVCTSLYACMSMNGYTSTVDLSKV
FT                   DLVQLEEPEPEDPVAVIRTSMGDISVRLFPEEAPNAVKNFEELANAGFYDDTYVFQLEP
FT                   KVYFAAGSKTPDGELGDAYQEEHESIEREISDNLWPFRGALCALTTKSDTGFWKMFLDK
FT                   VKYYNGSRFILVDSIEFTDDLIKEMYGDNPDNKVARAFEQLGGVPNYSQQMTVFGQTYA
FT                   GFDVLDAITEAATTGEENHKTPAEEIRIRTVEITTYEKAPAPVTTGTDAPGSTTATTTT
FT                   TAAE"
FT   CDS             complement(407297..408691)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03700"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /function="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16609"
FT                   /db_xref="GOA:D4LAG4"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAG4"
FT                   /protein_id="CBL16609.1"
FT                   /translation="MYLYNTMSRKKEELLPQQGKQVNIYACGPTVYNFIHIGNARPICA
FT                   FDVLRRYLTWRGYTVKYVQNFTDVDDKIIKRANEEGSSAAQVAEKYIAEYKTDAHGLNV
FT                   MDADVHPQVTTCMQDIIDFVKALVDSGHAYEADGDVYFRTASFPEYGKLSKNSMEDLQA
FT                   GARIGVDERKESALDFAVWKAAKPGEPYWDSPWGKGRPGWHIECSAMSRKYLGDTLDIH
FT                   CGGQDLIFPHHENEIAQSESVTGKPLANLWMHNGYINVDNKKMSKSLGNFFTAREVAEK
FT                   YGYEVVRYMMVQAHYRSPINYCVELLDACKASLERLYTCRDTLDRAIANAPAGAADPDS
FT                   LALFDQRKQAFITAMDDDLNTADGVSVLFDLVRDLNTRSNDPATTKDTLTAGARLFDEL
FT                   TGVLGLLYNRKQGNEIPAQVQELVDARTVARKAKDFAEADRLRDEIAALGYAVKETRQG
FT                   VEITKL"
FT   CDS             complement(409651..410238)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03720"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16610"
FT                   /db_xref="GOA:D4LAG5"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAG5"
FT                   /protein_id="CBL16610.1"
FT                   /translation="MNLPNKLTLMRVLLIPVFLVFFLIPGIPCHYLLAMIVFIAASITD
FT                   ALDGHLARKHNLVTNFGKFLDPLADKVLVMTALACFVDNQMIGVIPFLIIMMREFMVSG
FT                   LRLVAANSGTVIAAGFWGKLKTAFTMVTIIAILVYLSFSGDFNSFSLACADTIDRVCGW
FT                   ILTGLVWISAGLTVISGWIYLRGYWKFIDPEA"
FT   CDS             complement(410222..411565)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03730"
FT                   /product="SSU ribosomal protein S12P methylthiotransferase"
FT                   /function="SSU ribosomal protein S12P
FT                   methylthiotransferase"
FT                   /EC_number="1.3.1.74"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16611"
FT                   /db_xref="GOA:D4LAG6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023970"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAG6"
FT                   /protein_id="CBL16611.1"
FT                   /translation="MSIKVGMVSLGCAKNLVDSERMLHLIRQRGYELVTEPGDADVVVV
FT                   NTCGFIQSAKEEAIDTILELCQLKAEGSIRKIIMTGCLAERYRQEAADEFPEVDAVIGI
FT                   GDQGQIIDVIDHVLANERMVHFCSKLDVPMSGRRVLSTLPFFAYLKIAEGCNNCCTYCA
FT                   IPMIRGGFRSVPMEDVLEEARWLTEHGVTELTVIAQDTTRYGEDLYGESRLPELLEQLC
FT                   RIQGIRWIRVLYCYPERITDKLLEVMAREEKLVKYLDIPIQHCNGDILRRMNRQGDAGT
FT                   LAALLNKIRQMIPDITLRTTLITGFPGETEAQFTELAEFIQAQRFDRLGCFAYSQEEGT
FT                   RAAEFPDQVPEDVRQHRADILMEQQQLIVEEKNNARLGQVCTAVIEGYDRWAECWFGRT
FT                   AADAPDIDGKVFIRSETPLHIGDYVTVRLDEVLDYDFVGEVVTDESAQ"
FT   CDS             complement(411616..412230)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03740"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16612"
FT                   /db_xref="GOA:D4LAG7"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAG7"
FT                   /protein_id="CBL16612.1"
FT                   /translation="MKITDITPYKGSVLQIDLEGADPLFIHRDIAADFHLAPGLELPEG
FT                   AVEQIHIASQRRRAYERALYLLDVRAYGFAELFEKLEQNYEEDVCYHVLRRLVRLGMIN
FT                   DRRYAASLAEKYVTIKHYGLYRAKQEMRRKGLDDELIDEALADYEEETDAQLAALLERK
FT                   YAADLQDPTDQKRINRVKAALVRRGYGYDAIRCALEDYFSE"
FT   CDS             complement(412236..413471)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03750"
FT                   /product="RecA protein"
FT                   /function="RecA protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16613"
FT                   /db_xref="GOA:D4LAG8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAG8"
FT                   /protein_id="CBL16613.1"
FT                   /translation="MAKAELKKKSVAAPVKLTTAEEKKKALASAIAHIEKMYGAGAVMK
FT                   LGQTKALNVDAIPTGSMTLDLALGIGGVPRGRIVELYGPESSGKTTVALHIIAEAQKLG
FT                   GEVAFIDVEHALDPVYAEKLGVNINNLLVSQPDSGEQALEIAEALVRSGAIDVIVLDSV
FT                   AAMTTKAEIDGDMGDNHVGQLARLMSQAMRKLTSVIAKSNCVAIFINQIREKIGVMYGN
FT                   PETTPGGRALKFYASVRMEVRKAEAIKNGSQIIGNRTRVKIVKNKVAPPFKECEFDIMF
FT                   GQGISRVGEVLDLAVDLDIVKKGGSWFSYKDQKLGQGRDKVKEILANDPELMKEIEAQI
FT                   LEQKDKLLLVSKKSKKSADLKKAADEALADTEDIVEDAPEEAPADAAESYGADISPLVN
FT                   AEDDFEEFTPAE"
FT   CDS             complement(414336..415298)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03770"
FT                   /product="Predicted metal-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16614"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAG9"
FT                   /protein_id="CBL16614.1"
FT                   /translation="MAEETKAQKALHKSKIGGQALIEGVMMKGPLKGAMACRLPDGTID
FT                   VEIWEEKNGKNPPWYRRVPLVRGCVNFVLSMKDGYRCLMKSAEKQVEDDDEEEELNRFE
FT                   QWLTDHLGEKFMKALMVVSALISTVFAFLLFLYLPKWVVGLIDPLTGNHIVRSIAEGIV
FT                   KIAVFVGYMAVTSCMKDIRRTYEYHGAEHKTIACYEAHLPLTVEHVKKMTRFHPRCGTS
FT                   FIFIVLIVGIFAACFIPARFVVWQRVLCSLGMLPLVVGISYEFIRLAGRYTNPFTRILS
FT                   APGLQLQRITTREPDDKQIEVAIAAITPCIPQDLADDQW"
FT   CDS             complement(415310..416728)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03780"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16615"
FT                   /db_xref="GOA:D4LAH0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAH0"
FT                   /protein_id="CBL16615.1"
FT                   /translation="MARQTITKRWILNNLCVVLLVLLTVELGFIYAIQNYYYGGAQQYL
FT                   LSKMNAVSGVLSRYAEDSPASFSAEIRNTLENFSDKDKIELMAIDVRGHVVLTSSGFSP
FT                   DERVSMPDYDMAMEGDRNAYSYTVGRLRSGEHVMAVTYPIEDLSDEYTAVRMVISLTEI
FT                   DANILTFSVAMTLLCIGVFLLLALSGMYFIRSIVFPIRQISATAEKFAKGDFSVRIAAS
FT                   GKDEIGDLCTAINHMADELSATETMKNEFISSVSHELRTPLTAIKGWAETLNAGGDMET
FT                   MHKGIRVITNETERLSRMVEELLDFSRMQSGHFTMQMDKMDVLAELGEAVLIYTERARR
FT                   EHIEILYNEPEFLPIVYGDKNRIRQVFINIIDNAIKYSNPGGKVQITATQKDEGKTVCI
FT                   VVEDQGVGIKASDLPKIKTKFYKANHSRRGSGIGLGVADEIIRQHGGRLEIASAEGVGT
FT                   TVTIDIPAAGHGKA"
FT   CDS             complement(417480..418781)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16616"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAH1"
FT                   /protein_id="CBL16616.1"
FT                   /translation="MKARLLAACTAAVTLLSGCTFSTSIDGLLSPPKLSVEQEQIYEAL
FT                   RRAAGSNISLKYPKTGDYLSAFIVSDIDGDGEDEALVFYEKNLLQSEENALRLNVLDQI
FT                   NGSWRSVYDLAAGGAEVEKVMISRLGSNSRTNIIVGYSMVNRGERVLSVYDYRDGALTE
FT                   TLNSSYSLADVCDLDQNGENELLIVCGQTVSQSARAVTYVLARDGSYYESRTALNEGFT
FT                   DFANLLYGNTADGIPCVWLDGMTGSSTIQTQALTMQEGVLTLVYTDGDSGIRTSRQSGY
FT                   LTCDLDGDGIAEIPVNTLFPGYTDATESEQIRMTSWYECRGGSLMRKCSGYYSPDQQFS
FT                   FVLPRRWERKVTVKQDALAEELVFYKLGRSLEDSTLPLLRLCITDSADTLQDRLDNGYV
FT                   LLCSKNGLRYLAQVPETTDPLGLTVSEAILLFHA"
FT   CDS             complement(418796..420154)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03810"
FT                   /product="Citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /EC_number="2.3.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16617"
FT                   /db_xref="GOA:D4LAH2"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016141"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAH2"
FT                   /protein_id="CBL16617.1"
FT                   /translation="MNQQNENMMNLKPLCDKLIAGSRIDPQLYEKFHVKRGLRRSDGTG
FT                   VIAGITKICNVHGYVVNEGEIDPIPGELIYRGYQINDLVSHAEQEGRFGFEETVYLLLL
FT                   GDLPNRQELDAFTRHLSACRPLPENFVVDMILKAPSNNIMNKMARSVLALYSYDAECET
FT                   KSIENELRTAISLVAKLPVIMASAYQVKRSHFDGESMIMHPLRPEENTAQTVLSLLRND
FT                   RQYTDAEAHLLDTLMTLHAEHGGNNSTFTCRVLTSSGTDAYSAYAAAIGALKGPRHGGA
FT                   NIKVMQMLDSFKENVKNWEDEGQVADHMRKILRKEAGDGSGLIYGMGHAVYTLSDPREV
FT                   ILKRKAMELAHGKDIEAEFRLLDTIERLTPEIFRDFKTSDKAICANVDMYSGLVYKMLG
FT                   IPADLYTPMFAISRIAGWAAHRMEETITGKRIIRPAYKAIAKERAYVPLDDRD"
FT   CDS             420391..421008
FT                   /transl_table=11
FT                   /locus_tag="RUM_03820"
FT                   /product="Nuclease-related domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16618"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAH3"
FT                   /protein_id="CBL16618.1"
FT                   /translation="MPGLQMAAWIAAGLVGLFLLLWMGNRCAKHRGRVGERMVAAQLRR
FT                   FARKHGGKVCSNVYLPLYAGTCEIDHLLFGSFGVLVVETKHVGGEISGNGSQLRQVMGS
FT                   KTHQLYNPQLQNKTHVDNVRHHLRKAGLERIPVQGLVVFSNPRAVLHTQAGIPLSRLQD
FT                   TLCRLPDARQPWKQAYAALRAVQVRNPLRQLWHDWKPHRKKR"
FT   CDS             complement(421057..424047)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03830"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16619"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAH4"
FT                   /protein_id="CBL16619.1"
FT                   /translation="MSSKPSKAKRKQMAAKQHAPQAEPKAEAQAQAAPQPEQTQGDKPM
FT                   KAAPKTQVKLPPLGKIGFFERLQCWCARNYIYILAFFIPVALTYLAYALFGMYPFGPES
FT                   VLCLDLNGQYVYYFEAIRDAFWGDGSIFYNWSRNLSGEFFGIIGYYLASPFTLIVILLP
FT                   RTMILGSLLIMQLCKLGTAAVTFCYFLQKSRKLKPLHALLFSMMYAMMAYAITQLIDPM
FT                   WLDGLVFLPLICLGVEYLIDDGRKINYIIPLALMCFANFYIGFMICIFTALYFAYYLFA
FT                   GSDKLKHFRMKSKDLKAYGYSILRMFLCTVVALMIAAVLVLPVYNALALGKFNFTANPD
FT                   YSFKLQFTPIDFFAQIASVAQYNSVNVQGMPEIYCGLITALLLPLFFLNSKIPLRKKIG
FT                   MGLLAAALFTSMYIRPVDMMWHGGQMPNWLPFRYSFIFSFVILTMAAMAFKELKETKPA
FT                   AIYGSFFVWFMFLMLVLYEKNKHGEFDYLDTKGAIWVSVGLFGAYTILLFIQQKKNSKK
FT                   VLPILIMLLIGGELTYNALDTMKSTDKEVAYSERRTYISYIQSGREITDRLYDYDKSFY
FT                   RADKTYHRMVNDDLAFGLRGITHSSSVMNTRIIKFIEAMGYTCHSYYTKYNGSTPISDS
FT                   LLGIKYVLDQSDNVNEGYHEVFSQMCKKQDQKEQLVTVYENPNAMSIGYMVSNTARRIT
FT                   GLGNDNPFNSQNVMMSTICGSTTFDPTTGAITGNTEYFYPIPQEGEPILNNLTARPYGV
FT                   QTCYDVSGEGDHTIDMKFKALSDDPIYFFFKTENQRQVNLWYSPFWNKEGEFLDGEFLT
FT                   YYFEGDDYRIVSLGSLPAGQEFTIRMTVTKEYTIFQNAFFYHFNQAKFEEDIAKLKQQQ
FT                   WEITDHSERWFKGTITAQEGQVMMTSIPYEEGWTVKVDGKKVEPIVLFNAMIGVQLSPG
FT                   THEVEMSFLPNGFTQGLMLMLLGIAACVGLGLYDHKHNKALLAAVAARRQAQAEYITKR
FT                   RAKRRTK"
FT   CDS             424998..426254
FT                   /transl_table=11
FT                   /locus_tag="RUM_03850"
FT                   /product="Chloride channel protein EriC"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16620"
FT                   /db_xref="GOA:D4LAH5"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAH5"
FT                   /protein_id="CBL16620.1"
FT                   /translation="METQNRTWLSHSLFSARCFCKWGLLGLAMGGVVGLVGTGFSWAVD
FT                   SVTALRQVHSWLLYLLPVAGVLIVGLYHLFGIYTDKGTNLVLLAVREHGKMDLRNMICI
FT                   FTASVLTHLCGGSSGREGAALQIGGSMGATFSKVLKLDEADSRILVMSGMSACFAALFG
FT                   TPVSAAFFAMEVISIGVLHYSALLPCMTAAVTGSAVSRFFGMGPMSPQVLVPGFSWLSF
FT                   GKAAAVALVCGLLSFVFCAGIHWAAKGYQRFLKNPYLRAAAGGGLVVLCSLLLGTRMYN
FT                   GAGTETILAAFTQQQAWYVFLLKLLLTALTLGAGFKGGEIVPVFFVGSTCGSALSGLLG
FT                   LDPSFAAAIGMISLFCGVTNCPLTTLFLSVELFGGEGAPFYGAAVAVAYISSGYAGLYS
FT                   EQKILYSKFKPQFIDKKVG"
FT   CDS             complement(426675..428324)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03860"
FT                   /product="PAS domain S-box"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16621"
FT                   /db_xref="GOA:D4LAH6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAH6"
FT                   /protein_id="CBL16621.1"
FT                   /translation="MTRRIFLSIMTAAGVALLAALLLILGVIQSAFTQRYRQQFRDEAA
FT                   YAAAGLETGGVEFLRSLSSASSRITLIDQDGTVLYDSAGTEHAENHSQRQEVQQALENG
FT                   SGESSRYSATLSERTYNYALRLEDGRVLRISAGDFTMISVLRTLAKPLILIVVTVVLLS
FT                   LFLASKLTRSIVRPINQMDPEHPDKTKIYTELTPLLDRLSSQSGQIDEQIRELRRKQQE
FT                   FAAITENMQEGFLILDRDTNVLSYNTSALRLLGADDAVLGQSVLKLNASRSFRHAVERS
FT                   IAGEHYERTMNHDDCHYHLIANPVHQEEEIIGAVLIILDVTEKDQRENLRREFTANVSH
FT                   ELKTPLTSISGFAEIILSGLAKPEDITHFASNIYAEAQRLITLVGDIIKLSQMDENSIP
FT                   VGKEPVDLREIADSVRERLAHEAAKKHITLAVHGSHETVSGVPQILDEMVLNLCDNAIK
FT                   YNVEGGRVDITVSRDPRGAVFLSVADTGIGIPQSDRERVFERFYRVDKSHSKEIGGTGL
FT                   GLSIVKHGAAYHGATLALESELDKGTTITMTF"
FT   CDS             complement(428321..429004)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03870"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16622"
FT                   /db_xref="GOA:D4LAH7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAH7"
FT                   /protein_id="CBL16622.1"
FT                   /translation="MIYLLEDDNSIRELVTYSLNNSGLETRGFEKPSDFWRGMEQEQPD
FT                   LVLLDIMLPEEDGLSILKKLRSNPPTRKLPILMLTAKGSEYDKVIGLDCGADDYVPKPF
FT                   GMMELIARVKALLRRTERKDPQPEHTIRGLYVCPAKHIVTVDGEPVSLTLKEFEMLCVF
FT                   LENRNVVLTRDQLLNKVWGYAFDGESRTVDVHIRSLRQKLGEYADVIETVRGIGYKLSE
FT                   PEGAR"
FT   CDS             complement(429019..430437)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03880"
FT                   /product="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16623"
FT                   /db_xref="GOA:D4LAH8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAH8"
FT                   /protein_id="CBL16623.1"
FT                   /translation="MDKYKTLALNTVIFAVGSFGSKILLFFLTRLYTGNIISDNLNTKE
FT                   MLEITANFLIPVFTFSIAEAVIRYGIDRAYDKRQVFSNAVVTELGGLVLLLLCTPLIGL
FT                   FSFTDGFLALLIVYICTSSFRQLCAQFVRARGLLKLYSVDGILTALTLYLFNVIFISVL
FT                   GMGVRGFMLSVICSDFCSGVFLCIVSGIPRFFSFRYVDKKLLRRMLAFSVPLIPTAVLW
FT                   IFTGFADRFFIGIMQGPEGLVGKSAAGVYGAASKIPNLISMVSTIFFQAWNISAITEND
FT                   SAGRNQFYQRIFGAYQSILCIAAAFLIALVQPLSNVLISNKLDTAYEAAFRYTPVLVVS
FT                   VLLMCFNQFLSSIYTATQHTRNSFWTSLIAAGANLPLNLLMIPKWGVYGAIAATYISYL
FT                   LCYIVRIVDARRYVPFRVNHLLFAANNVILLGMSTAIIKMPQRYVLYLVCGVGLILALN
FT                   YEAIIVTAKKILKR"
FT   CDS             complement(430557..432761)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03890"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16624"
FT                   /db_xref="GOA:D4LAH9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAH9"
FT                   /protein_id="CBL16624.1"
FT                   /translation="MKKREFKQEKQIRSKAGNAKARSGKHAGKEKFDAAYYTEKIRAAL
FT                   TRCGKKPIGAKELAAKCRSQRGASDAYAAALGALVASGEVVERKHTYVGAAESGCFKAE
FT                   VTRLSRTFGFCKRLEDETEFFVPGKFLLGAMPGDQVLMRPIPSRTGEPEGEVVSILVES
FT                   PAQLTGMIVEEDKHCYLLPDTMSKSRISIAHSGNCAFAPGDKVLAQISHRGTRHAEHRA
FT                   RILFSYGCAQQAASCAEAVIAVSGIPTEFPEEVITQAEKLALAGVQPADLVHRMDLREE
FT                   CIFTIDSAESKDLDDAVSIQRRGEGYRLGVHIADVSHYVRGNTPLDMEALHRGTSVYYA
FT                   DKVIPMLPKCLSNGICSLNPGEDRLAFSAIMDLDKEGQLRAYSFHKSVIRSRVKGVYKE
FT                   INTILAGTQTPEIAEKYAEVTESLLLMNELADKRLADRDRRGAPSLDAPESKLILNEDG
FT                   VCVDVQPRTRGRSELLIEEFMLLANESAARVAREKSIPFVYRIHENPSPEKLERLEEVL
FT                   NRMNIPHPVLDEVRPCHFAQILKNAKDSPLLPALNNLLLRSMAKAKYAPTPVGHFGLAL
FT                   ADYTHFTSPIRRYPDLAIHRILSDVVLGYSKDWFDKRYAAFVQHASERSSAAELRAMTA
FT                   ERDCEDCYKAEYMLAHIGEEFDAVIASVTDFGFYVELPSTVQGLVHVGSLPEGEYTCDG
FT                   AIHLTEQRSNTVYTVGQAVRVRCDKADVNSGNIDFSLVTD"
FT   CDS             complement(433028..433288)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03900"
FT                   /product="protein translocase, SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16625"
FT                   /db_xref="GOA:D4LAI0"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAI0"
FT                   /protein_id="CBL16625.1"
FT                   /translation="MNILELIGGILLLITVVLATVLCMMQDQNQDQNMTSAITGASNDS
FT                   FYGKNAGRTKEAILSRFTWVLLIIFFVATLLVNILPVYIKF"
FT   CDS             433583..434413
FT                   /transl_table=11
FT                   /locus_tag="RUM_03910"
FT                   /product="Uncharacterized protein with SCP/PR1 domains"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16626"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAI1"
FT                   /protein_id="CBL16626.1"
FT                   /translation="MMGLQKGLAAGLALLLLTAAGCGAMDNRKQTAQVSPPVSVAQARA
FT                   ENTGVYRAPRAPAATAAATEAPLQTTAPVQITTARITTTALPPETTAPAEEETTAPPPA
FT                   ETQPPRTARREPVKTMAAPEPEPVPVTKPPQTSVTQPEPEPGPEPETPVNVPTYASQIL
FT                   EFVNQERAEYGLAPLELHTELLKAADIRAREIAQVFSHNRPDGSSCFTVLEECDLAYMT
FT                   AGENIAQGYTSPQEVMNGWMSSEGHRANILNGGFSMLGVGYDSATRSWVQVFAG"
FT   CDS             434664..435755
FT                   /transl_table=11
FT                   /locus_tag="RUM_03920"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16627"
FT                   /db_xref="GOA:D4LAI2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAI2"
FT                   /protein_id="CBL16627.1"
FT                   /translation="MSRVYNFSAGPATLPEEVLKRAADELLEYGDSGQSVMEMSHRSKE
FT                   YQAIIDDCEARLRKVMSIPDNYKVLFLQGGASSQFAMIPLNLMNKTGKADFVITGQWAN
FT                   KAYSEAAKLCGAENCNIVASSKDKTFSYIPELDKSKFNPTADYFHICQNNTIYGTRFAE
FT                   LPDTGNVPLVADLSSCILSEPVDVSKYGMIYAGAQKNMGPAGLTVVIIREDLIGNAKEG
FT                   TPTMFDYKTHADNGSMYNTPPTYGIYILKLVLEWIEKMGGLTAMKEHNEKKAAILYSFL
FT                   DSSKLFKPTVQGKDRSLMNVPFVTGDADLDAKFVAEAKKNGFINIKGHRSVGGMRASIY
FT                   NAMPIEGVEKLVAFMKKFEAENA"
FT   CDS             435782..436945
FT                   /transl_table=11
FT                   /locus_tag="RUM_03930"
FT                   /product="Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16628"
FT                   /db_xref="GOA:D4LAI3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAI3"
FT                   /protein_id="CBL16628.1"
FT                   /translation="MFQIQTLNKISKVGTCRLDAAKYAIADAPENPDAIMVRSAAMHDM
FT                   EFGSNLLAIARAGAGVNNIPVDKCAEQGIVVFNTPGANANAVKELVVAGLLLSSRKISE
FT                   AMAWVPSLKEEGDNVGKLVEKGKSQFAGPEIKGKTLGIIGLGAIGALVANVAIDLGMKV
FT                   IGTDPFLSVGAALRLSPAVQVAKSADEVLAAADYLTLHVPCNADTKGFINAAAIAKMKD
FT                   GARVLNFARGELVNDADMIAALEAGKIACYVTDFPNANTIGVKNIIAIPHLGASTPESE
FT                   DNCAMMAADELSAYLEQGNIINSVNFPNAEMHANGTKLCVLHKNVPTIIAQITSALGDA
FT                   GKNIDNMVNASKKDNAYTMIDVAGDVADSIVDTVKAIDGVIRVRVIA"
FT   CDS             complement(437013..439733)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03940"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16629"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAI4"
FT                   /protein_id="CBL16629.1"
FT                   /translation="MIFDLSKHASSPTDHDWEIFQKLFPYMGAFLYIHTTREAYLDDNT
FT                   FRILHIQKEHANGLLSHDRFTQVMQDITRNPVARQNQVYQYNVGSEQLQLRLSFVERDA
FT                   QSWMGFVQDITHYNDGFCPMYQDAGEYDPLTHLYHRSAFIRRTEQCMRECPGAGYLAIL
FT                   HVHGIEQIAQQYGYSQNDRCVIAISQALRSFSSPQVIIGMRSYKEFMVYVGGSAAEQAG
FT                   TIFQRMRAAISGCVITDDFGEVLKIDASDALTISLGYSVRTAGSHDLDALINHANFSVF
FT                   EAMNERKDICAFNKARYEADKTQFRELQLFRRLVSDNAFTYHFQPIVSAKTGEIFAFEI
FT                   LMRAGDLPLTATQILRIAEQNKRLYAVEHATLFNAMHAFTEHQEALSDKKLFINGIPDH
FT                   LLTETDFDLLHTTYGELLENIVIEVTEQSDVDSDLVDTLKARCTTLGCQFAIDDYGAGY
FT                   SNTSGLLLMMPDYVKIDRALISGIENDSKKQRLVSDIISFAHENGISVIAECVETRQEL
FT                   RTVIQLGADLIQGFYTSRPKPVLLRQISKTVQNEIISFNLETRTFASRSYTAKSDESVE
FT                   LIRLALEHYTDILIREQCLTIVGEAAHTSNMVLKIEDGLDCTLTLQDVNLRGVDSPCIQ
FT                   LGEMCSLTLVLEGTNTLEHIGIYVPEGSSITIVGDGDLTINTDRSNSFGIGNDLEHGYG
FT                   NITLATGGKVTLNTNGEQCVGIGGGLNESGSRIRLLSGEISIITSGIAGICVGSREGNA
FT                   QVEVSDCDLALTADAASAVGIGSFRGSVDIAVNARVDFRGTGNKSVGIGSLEKGVGSID
FT                   IRDASVSMAINARFCSAIGTIDGSINTVVDGANIALNCEGSEIAGIGDPKGAGSILLKD
FT                   AELDMTMLAASVIDVGTRSGSVSTQGGRKSVRINP"
FT   CDS             439955..441013
FT                   /transl_table=11
FT                   /locus_tag="RUM_03950"
FT                   /product="Endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16630"
FT                   /db_xref="GOA:D4LAI5"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAI5"
FT                   /protein_id="CBL16630.1"
FT                   /translation="MNKQNPPCTGAQAAARMHIGWNLGNTLDSFAPDKGLAAETAWFNP
FT                   PVTRQVLQAVADAGFDVIRIPVTWSGHFGAAPGYKLEEAWLERVEQVLRWAMELDVYVI
FT                   LDMHHDGSAMPSPHAWLVPDAAHIEGVLPVFTALWKQLAERFGAYGDKLIFEGMNEPHC
FT                   GSDWVGNPERYQAVNRLNDAFVRTVRASGGINQTRKLLLPTYAASPKQAAIGALVLPED
FT                   PYLLASVHAYIPTEFCFPAREVNWAAPRIQWGTPADHAQLTDLFDRLAKRFPERGIPLL
FT                   LGEFAAVSKPDDAQRLAWAEYYVREAARRGIRCLWWDDTSGREECMGLLDRNTCQWRYP
FT                   ELVQTLIRAAYA"
FT   CDS             complement(441257..442381)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03960"
FT                   /product="CAAX amino terminal protease family."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16631"
FT                   /db_xref="GOA:D4LAI6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAI6"
FT                   /protein_id="CBL16631.1"
FT                   /translation="MQEPQTTSPSGLDPRNPFDNPTENRDYNLDYSDILPPITAPGYEL
FT                   PVLPAKLERANIRRFYNLGGGILLLHLVATNVIATILYTIFPLVLSGVDRHLNGTLPDN
FT                   YDSIVSSYISNSSLSMALNAFVFLLGNTGLFLLGCRWANIPMGSLFQTKKLTVPTMLRY
FT                   MGLGLFLQLASALLATFVDDLLVKGGYGTYTPDFSLSGSKLQLAAMILSTCLVAPITEE
FT                   LLYRGFFLKVMSRVSQRFGIFMSALFFSLAHENIAQGILTFLVGILLGYIATKHDSIIP
FT                   CIVVHFTINSYSMLTSLLNEFDQELANVFSGLTAIIILVGGAVLFVYTLIKERLPDNTP
FT                   RQSLRCGRIAIGAWPLVLTAAIHIGAALLYMNVN"
FT   CDS             complement(442492..443964)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03970"
FT                   /product="stage IV sporulation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16632"
FT                   /db_xref="GOA:D4LAI7"
FT                   /db_xref="InterPro:IPR014201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAI7"
FT                   /protein_id="CBL16632.1"
FT                   /translation="MAQDIYADIAGRTDGDIYIGVVGPVRTGKSTFIKRFMETLVIPNI
FT                   QGEYKRERAMDELPQSAAGKTIMTTEPKFIPEDAVEITPEEGARLRVRLIDCVGYIVPS
FT                   SLGYIENENPRMVATPWFEEEVPFNMAAEVGTRKVISEHSTIGLVVTTDGSISDIPRSE
FT                   YAECEQRVIRELQELGKPFVVLLNCTDPESEDALALCEQMRQAYGAAVIPVSCLELTET
FT                   DIRSIITQILYAFPVKEIRVEMPGWITELAPDHWLRESVFGAIRTAASELVTVRDARGL
FT                   CERISCPQITDAKVRDIDLGCGSVTVGVRLEPGLFYQILGETTGLDIGSESDLLPVLLE
FT                   LSRVKKAYGRLESALAEVEATGYGIVMPDITELSLEEPKIIRQGGKYGVRLKASAPSLH
FT                   LMRADINTTISPIVGSEAQSKELVDYLLQEFEENPTKLWESNIFGKSLHDLMNEGLQNK
FT                   LYKMPVEARMKLQEALERVINEGCNGLICFIL"
FT   CDS             complement(443969..445510)
FT                   /transl_table=11
FT                   /locus_tag="RUM_03980"
FT                   /product="LysM domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16633"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAI8"
FT                   /protein_id="CBL16633.1"
FT                   /translation="MELKVNREVITVCEELYSGVQEQSTELDYILPDYFPEIFRIIQAR
FT                   MEPRIESYAISDGVLTYELCVEICVLYCAQDSPAVHCVRQKLCYTRTVELGRQCEGIAA
FT                   ELIPKPDYVNCRAVNQRRIDLRGVVSVRIRATCGSQQEVIGDIFGLHAQTRKEPVTYTA
FT                   RRLHGVRTFTLSEVAELGEAKPAALQILRTDVQLLGGDARIIAGKLAAKGDAVVRLLYS
FT                   CEGGMESMQFTLPYSQIVDLEGIDDAFSCTVRPELAGCEITPAAKNDGEARSIQCELRI
FT                   RLVCTAVKTAVTELVTDVFSTLHPCSYTAAPVRLSGCGAPVSDSGAERCTLVSKEGEIR
FT                   RVYDVWCTPRNMGARVLPESGSIEVSGMLACSVLAQSDSTAPVMLEQEFPFTRMLPAPE
FT                   DCTAAQVQVQIPACSYTLTGSDTVVLQPELRILADTQVLRSMPLLTEVHIDQEERIAPK
FT                   DNCALLLYYGTAGETVWDIAKKYSTSIQAIVEENDLTQERLTENGMLLIPLVDRR"
FT   CDS             445861..448197
FT                   /transl_table=11
FT                   /locus_tag="RUM_03990"
FT                   /product="Alpha-glucosidases, family 31 of glycosyl
FT                   hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_03990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16634"
FT                   /db_xref="GOA:D4LAI9"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAI9"
FT                   /protein_id="CBL16634.1"
FT                   /translation="MKFSDGFWLNQRGYEVDYAVQAYEVTTTDHSITLLVTPQTIYNRA
FT                   MTLGGVTLEITYSSTQENVIRVSIQHFKGALHNEPKFELHADQGYTPKITNEQDYAELI
FT                   SGDTVLRISKGQSWDVSYTYKGKRLTGGAWRSTSYIQENRFRAENRCHAKCDDTFWSDP
FT                   ADPRSTYIREQLTLSVGECIYGFGEKFTTFVKNGQTVDIWNADGGTCSEQSYKSIPFYI
FT                   SSRGYGVFVNSPDRISYEVASDTVSKVSITKPGEFLEYFLIGGENLQQVLSNYTTLTGK
FT                   PALPPANTFGLWLSTSFTTTYDEETVTSFIDGMAQRDIPLQMFHFDCFWMKEYEWTSFR
FT                   WDTTQFPDPPAMLKRLKDRGLGICVWINPYIAQRSCLFDEGVEKGYFIKNPDGSVFQTD
FT                   MWQPGMAIVDFTNPAACDWFAAGIRSLCEMGVTAIKTDFGERIPTNVVYYDGSAPIPMH
FT                   NYYTYLYNKTVFNVLKDYYGENKACLFARSATAGGQQFPVHWGGDCSAEYSSMAETIRG
FT                   GLSLCASGFGFFSHDIGGFEATASPDVYKRWCAFGLMSTHSRLHGSTSYRVPWLFDEES
FT                   VDVLRFFTKLKGRLMPYLYAQAVKTAAVGVPMMRAMVIDYAEDPACLYLDRQYMLGDNL
FT                   LCAPVLNEEGTAEFYLPEGVWTDIITGEEIQGGRYVRRTCSYLEMPVLARPNSIITYGA
FT                   FQSDFEYDYLTDATVTIYQLSDGASAQTSVYDKEANKLMDLTAERAGSTITVTYTKTTQ
FT                   TFKIAVAGTDKCVTADGSGSVTITL"
FT   CDS             448243..448671
FT                   /transl_table=11
FT                   /locus_tag="RUM_04000"
FT                   /product="Bacterial membrane flanked domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16635"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAJ0"
FT                   /protein_id="CBL16635.1"
FT                   /translation="MAKEEIQYVWSDKKRTLFGLPLSFTRYFLTETKFITRKGFLSLEE
FT                   DELELYKVVDKKMQLPFGQRLFGCGTIVLYVKDTDTPVKEVLSVKAPRRVAQLIDKYVD
FT                   QQRDRFHIRGRDMMGATHRDYLDESDDMEDEVEYDDAE"
FT   CDS             448661..449752
FT                   /transl_table=11
FT                   /locus_tag="RUM_04010"
FT                   /product="methyltransferase, FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16636"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAJ1"
FT                   /protein_id="CBL16636.1"
FT                   /translation="MQNNQQTGAVLPFIQETRSSWDKLKEEQRPIFIYGMGDGAIKIMT
FT                   AMKSYGIPLAGIFASDEFVRGHSFEGYRVHKLSEVEEAVEDFVIVLAFAAGFQSLVDKI
FT                   VALSQEHTLIVPDVPVTGGGLFTYEYCLEHAEELQQVYDLLADDASRRVYAGILNFKIS
FT                   GNIDYLTPATTPKAEIYKELIRPTTNEIFVDLGAYNGDSIRELLEFSRGKFNRIIAFEP
FT                   DKKNFKKLTKFIGHTPAIDAYNCVAWCVDTELPFATKAGRQSAISSDGNMTQARSVDSI
FT                   LDGERATIIKMDVEGAEREAIWGASRTIARYSPRLMVSLYHRNEDIFELPLLIQRINPK
FT                   YKLYIRHQLYIPAWETNLYATVE"
FT   CDS             449891..450304
FT                   /transl_table=11
FT                   /locus_tag="RUM_04020"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16637"
FT                   /db_xref="GOA:D4LAJ2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAJ2"
FT                   /protein_id="CBL16637.1"
FT                   /translation="MLHEKSCGAIVYRKSHGNIEILLIKHVNSGHWSFPKGHVEGNETE
FT                   VETAEREIREETGIEVNIDPTFRETVSYSPKRDTQKVVVYFLAKAKTFNFVPQEEEIAE
FT                   IRWVDIVHAGHVLTYENDKTIVTKARACIKETG"
FT   CDS             450464..450661
FT                   /transl_table=11
FT                   /locus_tag="RUM_04030"
FT                   /product="TM2 domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16638"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAJ3"
FT                   /protein_id="CBL16638.1"
FT                   /translation="MKSKTTAIILSVLVGSLGVDRFYLGYTGLGILKLLTCGGLGIWTL
FT                   IDLIRICTGSLKAADGSELQ"
FT   CDS             complement(450751..453357)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04040"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16639"
FT                   /db_xref="GOA:D4LAJ4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAJ4"
FT                   /protein_id="CBL16639.1"
FT                   /translation="MNTEKLTQKSMEAIRSANSLAVEYGNQQIDQAHLFLALLSQQDGL
FT                   IPQIIPQMGTDLQMLQTEAQRLVDQLPKVSGSGREPDKVYVTPGTDKALNAAEKAAQRM
FT                   QDEYVSVEHLFLGLIQTAEGKLAQLLKSHDLTEQKLLTVLQTVRGSTKVTSDNPEGTYN
FT                   VLKKYGQDLVELAKNNKLDPVIGRDEEIRNVIRILSRKTKNNPVLIGEPGVGKTAIAEG
FT                   LALRIVRGDVPGSLKDHRIFSLDMGALVAGAKYRGEFEERLKAVLQEIRKTEGKTILFI
FT                   DELHLIVGAGKTDGAMDAGNILKPMLARGELHCIGATTLNEYRQYIEKDAALERRFQPV
FT                   MVNEPTVEDTISILRGLKERYEVFHGVKIQDQALIAAATLSNRYITDRFLPDKAIDLVD
FT                   EACAMIKTEMESMPTEMDELSRRIMQHEIEETALKKETDNLSKEHLEQIQKELAEMRSR
FT                   FDEMKAKWQNEKNAITKVQSLRAEVESVKGEIEQATRNADYNKAAELQYSKLPQLQKEL
FT                   EEEEKIANAKKDASLLRDKVTEQEIARIICRWTGIPVAKLMEGERQKLLGMESILHQRV
FT                   IGQDEAVEKVSEAILRSRAGIQDPDRPIGSFLFLGPTGVGKTELAKALAEALFDDERNI
FT                   VRIDMSEYMEKYSVSRLIGAPPGYVGYDEGGQLTEAVRRKPYSVVLFDEIEKAHPDVFN
FT                   ILLQVLDDGRITDSQGRTVDFKNTIIILTSNLGSDAILNGITADNQISPEAREQVEALL
FT                   KRQFRPEFLNRLDEIVFYKPLAKAEIGAIVDLMLKDLEKRLADKQITLRVTDKAKDHII
FT                   ECGYDPLYGARPLKRYIQQKLETLIARAIIGDQLRTSGVAVVDYDGNQLTLTQQEA"
FT   CDS             complement(453570..454235)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16640"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAJ5"
FT                   /protein_id="CBL16640.1"
FT                   /translation="MSKHVYSLVLMDEVVEAIDRLAYQQNTSRSNLINQILAEKVCCTT
FT                   PQMRMNDIFNTISSRMTGDCFQVQPQPSDAMLSIRSALKYKYKPTIRYSLELVHSPGRT
FT                   LGVLKVSFRTQSAQLLSELTVFYKLWAALEHQFLLPGMPEGIHYQIEAGRFIRTFQLPP
FT                   DQAELSTDQIGEYIAGYIRLFDHILKVYFAALPQGQDAALEAATAAYRKLLPKKIVHI"
FT   CDS             complement(454384..455553)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04060"
FT                   /product="Fucose permease"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16641"
FT                   /db_xref="GOA:D4LAJ6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAJ6"
FT                   /protein_id="CBL16641.1"
FT                   /translation="MTESRLQKCIVTVYCVLMMFVLGASDALRGVFLPVFRDSFSLSQS
FT                   QSSAIIMCSYIGNLLFLCIGGRLVDRISRKKFMYGVMLLWMGALTAYLLTANYYALLVF
FT                   MIFSLGASTMLSTTVNLLTPLVYAAPAFFVNFFNFLQGAGISTAQNVGGRFASSLSAWK
FT                   GANLILLACGCLGLVLLWFVKLPQPKPDAGSAGGYGAVIRNPACKYLFLLCGFYCITEH
FT                   GLQNWLVTYGSDYLGYTVPQAARYLSFFFGGIMAGRLLFAPLVQKCGIMRSMRVFVAAA
FT                   GVLYVSGMLLERRGMLLLCGSGLAFSILWPTIVLLIGRYYDPGLAGTATGFITGFATLF
FT                   DVAFNACFGKIIDWLGFGTAIQILPVSMFLLCLSFFLLRIRVPKSKEIL"
FT   CDS             455826..456533
FT                   /transl_table=11
FT                   /locus_tag="RUM_04070"
FT                   /product="Fructose-2,6-bisphosphatase"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16642"
FT                   /db_xref="GOA:D4LAJ7"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAJ7"
FT                   /protein_id="CBL16642.1"
FT                   /translation="MRLIFIRHGDPDYVRDSLTEKGWREADCLAERVARWDVTRVYCSP
FT                   LGRARDTASRSLEKLGMEAEILPWLEEFSLPVPDPAGGTRIPWDLFPSEWTREEQMFDR
FT                   NRFTEAPQYASSPLPQAYAAVCAGLDGLLAAHGYVRDGGFYRAVRPNGDTLVFFCHFGI
FT                   TMTLMGHLLNLSPVPLWHGMFMAPTGVTILASEERHGDEAYFRCQVMGDTQHLTAAGEP
FT                   VSPSGYFTDVFSK"
FT   CDS             456541..457146
FT                   /transl_table=11
FT                   /locus_tag="RUM_04080"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16643"
FT                   /db_xref="GOA:D4LAJ8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAJ8"
FT                   /protein_id="CBL16643.1"
FT                   /translation="MEFHEKLQELRKQRGMTQEELATALYVSRTAVSKWESGRGYPSID
FT                   SLKAISGFFGVSLDQLLSSEAVLTLVEEDSKKQESRTRSLVFGALDCCTGMLLFLPLFG
FT                   QRDREPIRQVSLLSLTGVAPYMKGAYLGILAALVLWGMLTLAFQTGTHPLWLRLRHRVS
FT                   LGLSAAATLIFMASLQPYPAIFAFLFLVIKGVMLIKCR"
FT   CDS             457253..457909
FT                   /transl_table=11
FT                   /locus_tag="RUM_04090"
FT                   /product="PAP2 superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16644"
FT                   /db_xref="GOA:D4LAJ9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAJ9"
FT                   /protein_id="CBL16644.1"
FT                   /translation="MGKRRRITIWAGLGSLAAFALWTWAVCRIGVQPIGPNGSRVGFGE
FT                   MNHWFHQLTGVHMGLYTVTDWLGLVPVCFVLGFGLLGLVQLIRRRSLRKVDPDILLLGG
FT                   FYILVLGAYLLFEALAVNYRPILIDGYLEASYPSSTTLLALCVIPTGMLQLHARLQSRM
FT                   LRRSLLVLLGAFTGFMVIGRLLSGAHWLTDIIGGVLLSAGLVLLYQGLSGQSLAR"
FT   CDS             458014..458319
FT                   /transl_table=11
FT                   /locus_tag="RUM_04100"
FT                   /product="Stress responsive A/B Barrel Domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16645"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAK0"
FT                   /protein_id="CBL16645.1"
FT                   /translation="MIKHIVMFKLLPQAQSRTAAENAALALSMLEQFPAQIPTLREFRA
FT                   VVNAPDAPADNCELALICTFEDMEGLNAYQIHPTHKNFGAFISQVRASRACIDYEA"
FT   CDS             458338..459447
FT                   /transl_table=11
FT                   /locus_tag="RUM_04110"
FT                   /product="Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16646"
FT                   /db_xref="GOA:D4LAK1"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAK1"
FT                   /protein_id="CBL16646.1"
FT                   /translation="MIPAMILLILLLAGLIGVYYHFFLGRLFRAFSLPEKAKWVRCLLM
FT                   VALTGCSLMVFSTFGLLMLHFTVFSAVTDLLAHLYRRIRRSSAPERPNRILACGLVPLA
FT                   LVACVLSYGYWNMNHVVETTYQIPTDKQLSQPYRAVLIADLHYGNGITGEKLAEQCDRI
FT                   SAQNPDFVLLDGDIVDENTSRTGMQEACALLGGIRTRYGIYYVYGNHDQNNYSSDPAYT
FT                   SQELYETLTGQGIRVLSEDTAVINGDITLIGRSDPGFWPENRTEIRELLEKTHADPDTF
FT                   WLVEDHQPLGLAKNAAAGVDLTVSGHTHAGQIFPIGLLDRLVQFNEMNYGCREQNGMYA
FT                   VVTSGICGWGYPIRTEAHSEYVWLEIGGA"
FT   CDS             complement(459495..460730)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04120"
FT                   /product="Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16647"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAK2"
FT                   /protein_id="CBL16647.1"
FT                   /translation="MKKVCALLLGVLVFAGCSGCGQTASSQAESAAPARQPTKFDQYVS
FT                   NTVIATGNNKCIDEADGVTYRGYFPLEAYGTFDYSFYFSNTVDSTWDDGRLGYGGQPGG
FT                   AYSIAGAAVYDGGQIQPDGSALMTGEVLLAEITFDGSKSRQVAPGETFWSDPVSLTLPE
FT                   DHYLIWEWTITGKEIPCICMSGLTPAFYSTGGQFIYANEVPMPVLIGCDRKVGTKIAAF
FT                   GDSITQGCQTTANGRKFWAAQIAATLGEDYALWNLGLGYARASDAARGGDWLERAKAYE
FT                   MVLVAFGTNDIISGRYGGTGADSPEQIEASVRSIVSALREAGCRVVLFNAPPFDLKPEA
FT                   EAIRTAYNAAVPKIAEELGAEYFDFAACLADPADPAKALYGGHPNDTGCAKAADAFLNQ
FT                   YRTLIDSTIQKP"
FT   CDS             complement(460817..461719)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04130"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16648"
FT                   /db_xref="GOA:D4LAK3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAK3"
FT                   /protein_id="CBL16648.1"
FT                   /translation="MYISYDYYRVFYYVARYGNVSQAARLLLNNQPNLTRTIKKLEAEL
FT                   GCPLFSRSRKGMKLTPEGEHLFEHIRIAMEHISAGEAEITEQRSLQSGTVYIAASEVAL
FT                   RCMLLPVLKKYRLLYPGIHIRISNHSTPQAISALKEGTADIAVVTTPTVQAASLTETLV
FT                   KPITEVAVCSPYFTALTGRQVSLADLVHFPLISLGKDTKSFAFFSGLFTEHGLPYQPDI
FT                   EAFTADQILPMVQADLGVGFVPEEFLQDSSGVCKIDLKESIPKRHIALIKRKEQPLSVA
FT                   ARELVHMILEQSESDALAV"
FT   CDS             461885..462160
FT                   /transl_table=11
FT                   /locus_tag="RUM_04140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16649"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAK4"
FT                   /protein_id="CBL16649.1"
FT                   /translation="MELVLEALMCVMFDGAMGFLIPRSLQCAHTEKRRYRIADGIFALG
FT                   FLLGLAAKCLAGGSWIVLTLLALGFMLSYTAFVLTFPEKRKHCEGR"
FT   CDS             462177..462818
FT                   /transl_table=11
FT                   /locus_tag="RUM_04150"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16650"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAK5"
FT                   /protein_id="CBL16650.1"
FT                   /translation="MSDSFRAAFFIILSGGFQDAYTYTCRGEVFANAQTGNIVLLSTAL
FT                   FQREWQTMLKYLIPVLAFLIGTAVAEWIHIRLKCYEKIHWRQIILLCEVVLLLAVGFLP
FT                   PVFEPLANALVSFVCAMQVQTFHKVRGHAYASTMCIGNLRAGTEALCAYFRVRDKEILQ
FT                   KALTYFSVILVFGVGAGLGSILTLTLGCRAIWICCLLLSVSFGMMFVPEK"
FT   CDS             463039..464745
FT                   /transl_table=11
FT                   /locus_tag="RUM_04160"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16651"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAK6"
FT                   /protein_id="CBL16651.1"
FT                   /translation="MNTRYTHRFFFVAYLVMLACTLLLSGINARRTTGEESPYWGRSAQ
FT                   SFSQGWQDEQGDAVDPGQLNVEKDHPRSEWYEIHAELPQVLPADATLSFRSLYLRFTVI
FT                   IGEHEIYSYGMEPSHVFGNSPGTCWHHIPLSGTYAGQTLTIRYATSYNASNECFADMEL
FT                   AGGAQLIVDAVRQGLPGLIASGLLLFLGVVFMLVDLPANRIMHRPNHGLLYLGILAVVV
FT                   GLWSFTETHVPDLFVTSQQALNVFSLMLLSLTPIPIGLFLFECLMIWKERLFYIGFGLS
FT                   VLEFVVCLILYMSGVTDYMRTLFITQGLILYFLILIVYTVAINIRDRERSRMEKGLILS
FT                   GISIMGVCVGADLILSKLSYHLDNARFTRVGMILFILLFGVLNILQAMTQVKENSQLEL
FT                   VSQLAYKDGLTGIGNRTAFNERLAGLETMRQQIDPVSLVMLDVNNLKTANDKFGHQQGD
FT                   ILIKGASGVIHGAFAGLGTTYRIGGDEFAVVISSSTGREGIESALRIMQKDTDRFNENE
FT                   ICAVPLSIAWGYACAQSPEDPISRIMEEADEAMYARKREMKQKMGQAPVVR"
FT   CDS             464975..465544
FT                   /transl_table=11
FT                   /locus_tag="RUM_04170"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16652"
FT                   /db_xref="GOA:D4LAK7"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAK7"
FT                   /protein_id="CBL16652.1"
FT                   /translation="MGFVELFLIGVGLSMDAFAVSVCKGLNMKTLNRKHALVIGLFFGG
FT                   FQGIMPLLGWLLGKQFERYITAFDHWIAFVLLAFIGGKMVWEALHEDPEEVCPQPRLDL
FT                   KELFMLAVATSIDALAVGITFAFLQVNIWGAVSLIAAITFVLSVIGVWVGNRFGSRFQT
FT                   KAEIAGGVILVLIGLKILLEHLGVLG"
FT   CDS             complement(465583..465813)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04180"
FT                   /product="Smr domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16653"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAK8"
FT                   /protein_id="CBL16653.1"
FT                   /translation="MYSRTIDLHGMTVAEARRAMLALLKSCPASVREIEVIHGSHSGQA
FT                   LLRYVRVELKHPRISRKILGLNNGVTILELK"
FT   CDS             complement(465794..466804)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04190"
FT                   /product="tRNA-U20-dihydrouridine synthase"
FT                   /function="tRNA-U20-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16654"
FT                   /db_xref="GOA:D4LAK9"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAK9"
FT                   /protein_id="CBL16654.1"
FT                   /translation="MNRVTIAGLELPRTAALAPMASVADRAYRQLCRSFGACMVTSELI
FT                   SAKGMCYNDSKTAELCTITPEERPMALQLFGSEPKFIQQAVKLLLPFQPDVIDLNMGCP
FT                   VPKVVNTGAGSALMQDLNTAADLVAAARMASDVPVTVKIRRGWSEDTVNCVEFACRMAE
FT                   AGAQAIAIHGRTRSQMYSGKADWSCIRAVKQAVSVPVIGNGDVCSGADCLNMYRETGCD
FT                   LVMVGRASYGNPWIFQEIDAACRGIPYTPPTVEERMETMLLHIRMILETGRGKPEPQRM
FT                   KEARKHAAWYLHGLRGAAGFRSRCYGLDSYQQAEQLARDVLAMQEQEDAHVQQNH"
FT   CDS             complement(466801..467283)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04200"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16655"
FT                   /db_xref="GOA:D4LAL0"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAL0"
FT                   /protein_id="CBL16655.1"
FT                   /translation="MLKLIEKILSFLPKPLQELYHKYEEQLLYVLFGGLTTLISIVTKL
FT                   AVFALVPDQGQPWRTTLAVTLSWIFAVTFAFFTNKAYVFKNQTKGAKEFFRVFASFYGA
FT                   RLLTFVLEEGIFLLCCDLMHWNETVITFVSQVLIFVANYVLSKLLVFRKKEKGEAE"
FT   CDS             467617..468867
FT                   /transl_table=11
FT                   /locus_tag="RUM_04210"
FT                   /product="Hemolysins and related proteins containing CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16656"
FT                   /db_xref="GOA:D4LAL1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAL1"
FT                   /protein_id="CBL16656.1"
FT                   /translation="MTEIIIIVLLIAMSAFFSGSETAFSTVNKIRLKNYAAQGNKRAAR
FT                   ALEVADHFDAALTAILIGNNVVNILSASLATVVFTRYLGASAVGVSTAVMTVLVLLFGE
FT                   ITPKAYAKAHAESCALLMNRPILALMWIFRPVNWVFQKIRGLKKSGEQAPSVTEDELKV
FT                   IIDEIEEQGVLEEQESDLVRSALEFDEIQVAQILIPRVNVVAVERWEDVTRIKELFFTE
FT                   MYSRLPVYDKSIDNIVGVITSKDFFRMLDQGGQDIGTIMQDVLRISEFKRISEVLRSMQ
FT                   RTKLHLAVVLDQYGGTAGIVTMEDIIEELVGEIYDENDEVESPVTQIGENTYEVSGELS
FT                   TSDLCEKLSLPENAIESASVSVGGWAMELFGHMPQPGEQITSGRFELTVLKMTDQKIQS
FT                   VRLRIAPEPAVREDEEA"
FT   CDS             468864..469409
FT                   /transl_table=11
FT                   /locus_tag="RUM_04220"
FT                   /product="NfeD-like."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16657"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAL2"
FT                   /protein_id="CBL16657.1"
FT                   /translation="MTTVFEVCFWVGVSVTVINALLGAFFDIIDFGIDFDLDFDLGGLH
FT                   LDPGNFLPLSPSLLFMFLTIFGGTGMILQGRIPLWLVIVLGIALGLLVSFLVNRFVVRP
FT                   LKRISEKESGGEADFIGMNATVTERIFPQGFGRISFVYEGNSISEPARSEDGKEIPTGT
FT                   SVVVLEIRDKVYIVQPLR"
FT   CDS             469461..471023
FT                   /transl_table=11
FT                   /locus_tag="RUM_04230"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16658"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAL3"
FT                   /protein_id="CBL16658.1"
FT                   /translation="MEEIWNSLGSTGHIVVIVLLVIALVVIGFLTMWKKVPQDKAMVIT
FT                   GMRKRVISGGGGFVVPLLERADYISLENIKVEVQVKDALSMLGVGITASGVAVIKVRND
FT                   RESILAAVEQFNTGNQQKTIVNIKDTGSDVLEGKLREIVSKLTVEEIYRDREKFASKVQ
FT                   EVAAIDLAEMGLEMKVFTIRDISDRNGYLEALGAEKIAQVKKDANIAKAEAQMESDIKT
FT                   AEAVRLGEAAKIESLTRIEECNKNKELKVQEYKKQSESAKANADLAYQIQENITQKEVI
FT                   ETAMAAKILEKQREKELVDEQMRIEILKKQKEIELAENEVLKKEKELDAGVKKQAEADK
FT                   FQSEKQSEAEKYREIAQAEAAATSIELEAKAKAEAVRIQGLAEAEIIRAKGAAEIEIVK
FT                   AKGEAEANVMKEKAQAFRLYNDAAMAQMIVDRMPEIAQAIAAPLAKTEKIVIVDNGSTN
FT                   GEGARGASKVTNYVTDIIGQLPETVEALTGYNLMDVFKKKGQSAQTPAADTVEAAQEAE
FT                   PAE"
FT   CDS             471060..472007
FT                   /transl_table=11
FT                   /locus_tag="RUM_04240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16659"
FT                   /db_xref="GOA:D4LAL4"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAL4"
FT                   /protein_id="CBL16659.1"
FT                   /translation="MYLIKQANMLKCTLEPGDRLSETQLMEITSGGHSSLLPCQRAQIN
FT                   GVMTLVYDTHAYNTMESSAAHMTPQQMRQTILELLHALRQLERQSELSGLRMGNLCVEF
FT                   DKVYLNGETLRPAFVYVPLETAREFPETELRHEIMETIQSNECVRDEGNEMLLRYLQDP
FT                   GNDLYDLIDRIPKIEQEASRPAPAPERGEAFHQLQAENRRLRQRMLLFGGAAVLLIVIV
FT                   VLLVLFSRGDEEPVGAATEAPTTQAVTTEAALMPGDLNGDGKITREDRDLLIGSVNGEI
FT                   LLSPAQWKAADLNGDGKVDMDDCAELTMLEREGE"
FT   CDS             472010..473077
FT                   /transl_table=11
FT                   /locus_tag="RUM_04250"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16660"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAL5"
FT                   /protein_id="CBL16660.1"
FT                   /translation="MMQLVLAASSEDYLMQLQTLLLEQCGQLNLEIISDYSYLESYFQE
FT                   DRKPDLLLISEGYYNRMRKNGTLGAAGRLPATRVFLLSKEGTRPEGLPYGVRVPRDCAA
FT                   HLPALVRQLYATKPKPEAARLATRLITVHSPLGRSGKTTVAMGLAYTLAEKGAKTLFLS
FT                   MDRLQSCNWLLGESRYLPDDHLRTFTPDNAGIADDLESLVRRHGFYYIPPFSSPGLSLR
FT                   IPKETYLHMATKLVEAHAYDCIVMDASCEFSSTVCKLMQASHNNVVIALQDANSSYKLN
FT                   RMLVCLEDPFQEKFSYLCNLYRENVEDSRSTLMKKTIGERIIPYNPRLDGEQIIKAAAD
FT                   PAFAHVMQELTGTMY"
FT   CDS             complement(473245..474096)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04260"
FT                   /product="CAAX amino terminal protease family."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16661"
FT                   /db_xref="GOA:D4LAL6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAL6"
FT                   /protein_id="CBL16661.1"
FT                   /translation="MTEKKLAAKRLLLFLVLAFGIAWIPALILNRVFGYHAWFETNRMP
FT                   LFALPVLYAPALANVLTRKLTHEGWEHSLLRLRLKGNLKYYLTSLLLVSVLSLPSGALA
FT                   VLISGGDWGTNGLTGTELASALLSTFATAPLLGFLTFGEEFGWRGYMNQKLECLLGTTG
FT                   TVLAGGILWGLWHAVLTVQGHNFGTEYPGFPYVGIGAMCLLCIANGSILMWLTKKTNSI
FT                   YPAAIYHAMFNNGGVLPGQLLSGKVQALTIPQQLLCQIPLYVAGLVCLLRMVHAKRQNA
FT                   TK"
FT   CDS             complement(475672..476550)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04280"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16662"
FT                   /db_xref="GOA:D4LAL7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAL7"
FT                   /protein_id="CBL16662.1"
FT                   /translation="MTEYEYAISVQDVGKRYDRFALEHISFTVPKGSIMGFIGQNGAGK
FT                   TTTIRSMLHITSIDQGEIRLLGMDHIRQEQAIKERLAVVFDELPFHGVLTPKDMARIFA
FT                   GLYPDWDNAAYSRYLEQFQLPVKKKIGQFSKGMKMKLQIACALSHNAELLIMDEPTTGL
FT                   DPVVRDEILHLFMEYIRDGERSILMSSHITSDLEKIADCVTFIDNGRILLTGYKDEILE
FT                   SHGILKCSLEEAAAMDPADIISVRTNAYGAEVLVPDRESARYKYRNAILDPASIDDVML
FT                   FYVHKGERAWC"
FT   CDS             complement(476552..476926)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04290"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16663"
FT                   /db_xref="GOA:D4LAL8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAL8"
FT                   /protein_id="CBL16663.1"
FT                   /translation="MNINISNASGEPIYLQIASQIKTMILEGKLRAGEMLPSMRNLALE
FT                   LRISFMTTKRAYEELERQGFIESYTGKGSFVKAQNLELFREEQLKQIEALLAEAGQKAQ
FT                   QCGVTMEELHELLDLVNGGE"
FT   CDS             complement(477091..478416)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04300"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16664"
FT                   /db_xref="GOA:D4LAL9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAL9"
FT                   /protein_id="CBL16664.1"
FT                   /translation="MANKVVKFGGSSLADAAQFRKVAAIIHAEDARRYVVPSAPGKRNS
FT                   ADTKVTDMLYACHELAQKGQEFSQDLNRIHSRYQGIIDDPGLAFSLDDAFARIAADLKQ
FT                   GASRDYAASRGEYLNGMLLANYLGYAFLDAAEVIRFDQNGAFQLDETIALLRQRLSGMD
FT                   RVVLPGFYGATADGHVRTFSRGGSDVTGSILARAVKADIYENWTDVSGFLIADPRVVND
FT                   PKVISTITYEELRELSYMGATVLHEDAIFPVRTAGIPINIRNTNCPDAPGTMIVSDDND
FT                   EVSGYTITGIAGKKGFCAINMQKAMMNSELGFCRKVLGVLEDNGVNFEHMPSGIDTMSI
FT                   IISEADMEGKEQQVLSQIRKAVNPDHIEVEHGIALLAVVGRGMRRTRGTAARIFAALAH
FT                   ARINIKMIDQGSSELNVIVGISESDFAEATRRIYDMFINSVE"
FT   CDS             478722..479198
FT                   /transl_table=11
FT                   /locus_tag="RUM_04320"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16665"
FT                   /db_xref="GOA:D4LAM0"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAM0"
FT                   /protein_id="CBL16665.1"
FT                   /translation="MKLKKNGATEQKVYALAAPLAESLGLVIWDVRFEKEGASWYLRVF
FT                   IDKDEGISIDDCEAMSRPLSDLLDEADPIDQQYFLEVGSAGLERDLVRESHFAASIGAV
FT                   VRMRLIRPDETGQKEYVGALESFDKEQVRLVLEDDTTVTAPFANIAHIKWHEDF"
FT   CDS             479226..480287
FT                   /transl_table=11
FT                   /locus_tag="RUM_04330"
FT                   /product="transcription termination factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16666"
FT                   /db_xref="GOA:D4LAM1"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAM1"
FT                   /protein_id="CBL16666.1"
FT                   /translation="MNNDFFAALSLLGAENSVETDLLVEKVKSAMTKAIHRAYPDSGDN
FT                   VRVDIDPVTKTFDLCIIKTVVDDEPLDDNEINIDQARLIDPSAVVGGTVECKLDTASLS
FT                   RNAAQSAKQSIRGDLREISRENLLTKFQDKENECITATVSQVEPGRGTVTLIYDKTELY
FT                   LFRNEQIPGEVLKEGQSVKVYITGIANKQKKPIIKISRAHRDLVKRLFELEVPEIYDGT
FT                   VEVMAISREAGARTKIAVQSHDPNVDAVGACIGPKRSRITAVVNELNGEKIDIINYSDK
FT                   PEEFIAKALAPAEVLSVTITDPENRSCTVVVPNNQLSLAIGNRGQNAKLAAKLTGYKID
FT                   IKPEFENPIQGLE"
FT   CDS             480348..480626
FT                   /transl_table=11
FT                   /locus_tag="RUM_04340"
FT                   /product="Predicted nucleic-acid-binding protein implicated
FT                   in transcription termination"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16667"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAM2"
FT                   /protein_id="CBL16667.1"
FT                   /translation="MRLCLGCGEMKPKRELIRVVKAPDGEISLDTTGKKSGRGAYICPD
FT                   PGCLEKAQKARRLERSFSCRVEGDVYDALQQQLAAATGSGDHLPEGG"
FT   CDS             480950..483532
FT                   /transl_table=11
FT                   /locus_tag="RUM_04360"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /function="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16668"
FT                   /db_xref="GOA:D4LAM3"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAM3"
FT                   /protein_id="CBL16668.1"
FT                   /translation="MTKKIKLSDLAKDLNVPSQELIEALTKLDETKKKTGSSLTDQEVN
FT                   YLLERYSQGNQVESFDAYYESRNDKPAEKPAPKLEEKPKRAAKSEPKKAAKPAPKPEAK
FT                   PAAKQESKPAPKSEAKPAVKQENKPAPKSEAKPAAKQESKPAQKAKSVPDEARYAAAKE
FT                   KTMSEAKPQKQQKPQKLQKSQPQQGQKIGSMSSESVIEKKQRTVDTRGSYVELDKYNER
FT                   YEQIAPQNKHKENYSTKKQKINQKSQQRQKQQYSNKRETEAEKLRRLELERARKQQLKV
FT                   MIPDSIMVSELATRLKVTVTDVIKKLMGLGVMATINQEIDFDTAALVAEELGAKVEKEV
FT                   IVTIEERLIVDDEDDEGDLQERSPVVVVMGHVDHGKTSILDRIRHANVTASEAGGITQH
FT                   IGAYQVNHGGKTITFLDTPGHEAFTAMRARGANITDIAILVVAADDGIMPQTVESINHA
FT                   KAAGVSIIVAINKIDKEGADPERIKQELTEHELVCEEWGGDVICVPVSAKTGQGIDELL
FT                   ENILLVAEVKELKANPNRRAKGTVIEGRLDKGRGPIATLLVQNGTLHTGDVIIAGTAVG
FT                   RVRVMTNFRGKVVKSAGPSVPVEITGLAEVPSAGDIFNAVADERLARELVEQRKHAAKE
FT                   EQFKAYHKVTLDSLFSQIAEGEIKELPIIVKADVQGSVEAVKQSLEKLSNDEVRVKVIH
FT                   GAVGAVSEGDVMLASASNAIIVGFNVRPDPVAAESAARDGVDIRLYRIIYDAIEEITTA
FT                   MKGMLAPKFREVELGRAEVRQVYKISNVGTVAGCYVLSGKLTRNCEIRVVRDGIIVADD
FT                   KIGSLKRFKDDAKEVTSGYECGVTLEKFADVKTGDIFEAFTMEEYRED"
FT   CDS             483578..483814
FT                   /transl_table=11
FT                   /locus_tag="RUM_04370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16669"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAM4"
FT                   /protein_id="CBL16669.1"
FT                   /translation="MEISRMSNSDMIQYCNEALAWEELGPVDIHFFESVKRIVTGECKV
FT                   DEPEDIFDEEGFFTEQKGTENYYNPGGEDFIHV"
FT   CDS             483829..484224
FT                   /transl_table=11
FT                   /locus_tag="RUM_04380"
FT                   /product="ribosome-binding factor A"
FT                   /function="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16670"
FT                   /db_xref="GOA:D4LAM5"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAM5"
FT                   /protein_id="CBL16670.1"
FT                   /translation="MFRKGGVLPAQRRGTIDTMASYKSDRLAEDVKRELTAILRELKDP
FT                   RIGQMLSIVRVDLSNDLSHCKVYVSSFEGLAVAQQSVEGLRSAEGFIRRELFHRLKMRK
FT                   APAMHFVADDSIAHAAEINQKLRDLEG"
FT   CDS             484244..485197
FT                   /transl_table=11
FT                   /locus_tag="RUM_04390"
FT                   /product="Exopolyphosphatase-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16671"
FT                   /db_xref="GOA:D4LAM6"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAM6"
FT                   /protein_id="CBL16671.1"
FT                   /translation="MRIEIAQAAECLKQCEDVYILIHQSPDGDCVGAGFALMQLLHAMG
FT                   KRAKVLCPEPIPARYGFLTAPDSGEFPAKYVIGVDVADLQLLGNLRSTYEGHVDLCIDH
FT                   HISNTDYADRVCVDPDASAACQVLYEIIQALGIPLTDSMAACIYTGIATDTGCFKYENA
FT                   TARAHEIVAKLKREHALPYARINRNMFDVKSLGRLKMERAVMEIMEFYLDGRCTMICVT
FT                   QDILRQMQVEEAELDGIAGLPLQVEGVEVGVTLKEKEPGFYKISMRSADRANVSRICGQ
FT                   LGGGGHVKAAGCALRGTLSQVKEILVRAVEQELALL"
FT   CDS             485194..486096
FT                   /transl_table=11
FT                   /locus_tag="RUM_04400"
FT                   /product="tRNA pseudouridine 55 synthase"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16672"
FT                   /db_xref="GOA:D4LAM7"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAM7"
FT                   /protein_id="CBL16672.1"
FT                   /translation="MNGILCMYKPEGFTSFDVIAKLRGILQMRRLGHAGTLDPMATGVL
FT                   PVFVGGATRACDILPNQEKSYLARFALGYETDTQDSTGTVTNRYDRQVTRQQLLELLPR
FT                   FTGRISQIPPMYSAVSVDGRRLYELARQGVEVERKPRTVTMDRLELRQFDEASQTGTLF
FT                   LACSKGTYVRTILHDLGRALGCGGVMTGLERQSSCGLTLEDCVTFAQVEAARDAGTLSE
FT                   LLLPVDRMFAAYPALHLNPAQSRMYRNGVKLSLDRLTLPEQSEKYRIYGDTGCFFGIGR
FT                   TEEGLLRVDKNLTAGEDAS"
FT   CDS             487019..488464
FT                   /transl_table=11
FT                   /locus_tag="RUM_04420"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /function="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16673"
FT                   /db_xref="GOA:D4LAM8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAM8"
FT                   /protein_id="CBL16673.1"
FT                   /translation="MSKRVRTRFAPSPTGYMHIGNLRTALYTYFIARKNGGDFILRIED
FT                   TDQERYVEGAVDVIYRTLRMAGITWDEGPDIGGPVGPYVQSERMGMFKDYALKLVEQGD
FT                   AYYCFCDKERLASLHEADGVGAMYDGHCRNLSPEEVQQKLDAGVPYVIRQKMPKEGTTT
FT                   FHDEIYGDITVENASLDDQILIKTDGMPTYNFANVVDDHTMGITHVVRGNEYLSSTPKY
FT                   NLLYQAFGWEVPHYIHCAPVMKDAHNKLSKRNGDASFEDLIAKGFLPEAVVNYIALLGW
FT                   APKGENEIYTLPELIAEFDLSGISKAPAIFDPLKLKAINAEHIRRMSPAQFAESIRPYL
FT                   DKTLTRRDYDLAVLAKVLQPRTEQMTDVIDQVDFIDSLPEYDNAMYCHKKMKTTEESAL
FT                   QALRMVLPVLEALPEWTESAIHDALMGLAAEQGVKNGWLLWPVRTAVSGKQVSPGGGVE
FT                   LCAILGREDTLARIRKGIEKLGG"
FT   CDS             488580..489569
FT                   /transl_table=11
FT                   /locus_tag="RUM_04430"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16674"
FT                   /db_xref="GOA:D4LAM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAM9"
FT                   /protein_id="CBL16674.1"
FT                   /translation="MIEVKNLTKRYGDKLAVNDISFSVEDGEILGFLGPNGAGKSTTMN
FT                   MLTGYISSTSGQALINGVDILEDPIKAKENIGYLPELPPLYQDMTVKGYLNFVYDLKKC
FT                   KLPRKAHLRDVCDLCKVTDVQDRIIKHLSKGYRQRVGMAQALVGNPKVLILDEPTVGLD
FT                   PKQILEIRTLIKKLGKNHTVILSSHILPEIQAVCDRIIIINKGVVVADDTTDNLSRNIT
FT                   TDHRLTLRVEGKKDEIVKALRNIEGIKYVRADMEREPGVFEYELEAAAGMDIRREVNRI
FT                   LREHDWPILMMRASDMTLEDIFLKITMGDAVAIHTKPADAKTSEGGAR"
FT   CDS             489569..490273
FT                   /transl_table=11
FT                   /locus_tag="RUM_04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16675"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAN0"
FT                   /protein_id="CBL16675.1"
FT                   /translation="MGAIYRREIGAFFSSGIAYIFLAVFYLFAGYFFYASSLYSATTDM
FT                   SGMFSSLFMVIVFLIPILTMRLFSEELKQKTDQGLLTAPVSLPGIVLGKYFAALTLYTI
FT                   GIAIVMLYGMILSFFGEVAWGIVFANFLALFLLGAAFIAVGLFVSALTENQIIAAVGGF
FT                   VALMLLYMIDVVASYVKVEAVAHVLTSLSFYTRYYEFTCGLFNLPSVLFYISTAVIFNF
FT                   LTVRVFERRRWA"
FT   CDS             490289..491968
FT                   /transl_table=11
FT                   /locus_tag="RUM_04450"
FT                   /product="ABC-type uncharacterized transport system."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16676"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAN1"
FT                   /protein_id="CBL16676.1"
FT                   /translation="MSNEKKDLEKQQDTKPAKESKQDAPKDAKPEQAKKPKNRKKLKYG
FT                   ALATGITAVFIAAVVLVNVVVSVVMDRYPLKVDLTSSKLYEISQDSIDYVKNLSKDVKI
FT                   LVLAEESYFTTNNYMKIVPETLDKYRQNSNGHISVEFYNMVNHPEITSEYKQYYSGEFQ
FT                   EGDVIVACGDRVKVLDFGDIIQTEQTPDYTTYTYKTSYTFVGEQSLTSAIMSVTDANPK
FT                   KVAFVQTAGTNSIYADTNKYSVAALHDLLDKNGYDITDVDLLNDNILPADYDLVVLPAP
FT                   YNDLTEAMVTKLSDFLYNEGGLNKDMFYIADVKQGNTPNLDAFLAEWGVSVGDAIVYEG
FT                   NSSQAQYVSTALGTLTAPNVVMAESDYGAQLSNTSRPIVAPLARPIRLLFESNTDRQTL
FT                   ALLQTSETAFLYPLNTKQDTASDSTDVPAASQEAASTTATSFDIENAEKGVQNLMTITT
FT                   KSNAVNEDVNSSQLMVMSSCSMLDYYVAQSASYNNAEYVVSAINVMVGKENGIVIANKA
FT                   LEQTNITITEGQLSGLRTLVIVVIPLIVVVIGLVVFVRRRNR"
FT   CDS             491965..493443
FT                   /transl_table=11
FT                   /locus_tag="RUM_04460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16677"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAN2"
FT                   /protein_id="CBL16677.1"
FT                   /translation="MNKTAKGILIGAGVLVLLSGALVALKLTEPDSGTASGSSLSSQED
FT                   HSTLLWELDEKDIKSVAVTFGTDSYTILPEAPTQDDDGNTVYNYTLENTAGLNVDTVLL
FT                   RTVASRAVAVTAVNTVEEHTSDLAQYGLDNPRATVTLTMQDGTVKACSIGNASPLSSQT
FT                   YFALKGEDTVYTVASDKLSPFLKGEGEYLSKEIVPERAEDDNTILEEILIQRKDLDYDI
FT                   RLKYDSFYANVENGGTTATHIMTQPVPCNVNPDRGSKITVGMYGLTASGVVKVHPTQAD
FT                   LEAYGLEDPFCTMTVTTDAGVIQTLKIGKSFQLEGDDTVYYYGYYDGVDVAYSFTTETA
FT                   PCISVQPRDISSGLVFTTYVWDIGKLTVTAKDRETMTFTGSGTSKDDYQVQLNGKEADP
FT                   ERFRKFYVFLLKTAAEDLCLNGETVQGAPLATITLERQDGKKTQTVSFYEAEGRKVYIE
FT                   VDGVCAFMCRRSFVDTLFKNMDLYDTDQDFILNW"
FT   CDS             493529..493810
FT                   /transl_table=11
FT                   /locus_tag="RUM_04470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16678"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAN3"
FT                   /protein_id="CBL16678.1"
FT                   /translation="MSFFTYKGYPLVRKDKELYFGNMYDEYVVWMQIQETRKLQDLDVA
FT                   SKIKIYLMRTDEKLNPMEAIVKTGERESLYDALDLAKAWLDRAERETA"
FT   CDS             493847..493912
FT                   /transl_table=11
FT                   /locus_tag="RUM_04480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16679"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAN4"
FT                   /protein_id="CBL16679.1"
FT                   /translation="MKPQGESCGFFGRGEIFSENP"
FT   CDS             494026..496656
FT                   /transl_table=11
FT                   /locus_tag="RUM_04490"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16680"
FT                   /db_xref="GOA:D4LAN5"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAN5"
FT                   /protein_id="CBL16680.1"
FT                   /translation="MANKWVYMFSEGDMTMRNLLGGKGANLAEMTSIGLPVPQGFTITT
FT                   EACTQYYEDGRKINDEIMAQAMEGVKKMEEINGKKFGDLKNPLLVSVRSGARASMPGMM
FT                   DTILNLGLNDDVVDAMIKGNPDPAFERFVYDSYRRFIQMFSDVVMEVGKKYFEQLIDKM
FT                   KAEKGVQFDVDLTAQDLKTLAEQFKAEYKQQLGTDFPSDPVEQLKLAIEAVFRSWDNPR
FT                   ANVYRRDNDIPYSWGTAVNVMPMVFGNLNNESGTGVAFTRDPATGEKKLMGEFLINAQG
FT                   EDVVAGVRTPMPIAKMEQEFPEAYAEFIKVCETLEDHYRDMQDMEFTVENKKLYMLQCR
FT                   NGKRTAQAALKIACDLVDEGMIDEKKAVLMIDPRNLDTLLHPQFDAKALKAATPIGKGL
FT                   GASPGAACGKVVFTADDAEAWNAKGEKVVLVRLETSPEDITGMKASQGILTVRGGMTSH
FT                   AAVVARGMGTCCVSGCGDIKMDEENKKFELAGKTFKEGDFISIDGSTGNIYDGIIPTVD
FT                   ATIAGEFGRIMGWADKYRVLKVRTNADTPTDAKKARELGAEGIGLCRTEHMFFEPSRIA
FT                   AFREMICSDTVEEREAALAKIEPMQQADFEALYEALEGNPVTIRFLDPPLHEFVPTDEA
FT                   DIKALADAQGKSVETIKAIIASLHEFNPMMGHRGCRLAVTYPEIAKMQTRAVIKAAINV
FT                   KKAHPDWTIVPEIMIPLVGEVKELKFVKDIVVAVADEEIAKAGADLKYEVGTMIEIPRA
FT                   ALTADEIAKEAEFFCFGTNDLTQMTYGFSRDDAGKFLNAYYDAKIFENDPFAKLDQVGV
FT                   GKLMEMAIKLGKQTRPDMHVGICGEHGGDPTSVEFCHKLGLTYVSCSPFRVPIARLAAA
FT                   QAALR"
FT   CDS             complement(496700..496882)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16681"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAN6"
FT                   /protein_id="CBL16681.1"
FT                   /translation="MESGRLESDRNINGRSFRFIPPKRLRMVPFHSVTSDLIYDEFSLN
FT                   WAKITVTLPMGNVTV"
FT   CDS             complement(496883..497521)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04510"
FT                   /product="Chloramphenicol O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16682"
FT                   /db_xref="GOA:D4LAN7"
FT                   /db_xref="InterPro:IPR001707"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAN7"
FT                   /protein_id="CBL16682.1"
FT                   /translation="MKPTVIDPKLTTRASAFDLWMHAPNPMVTFFKTMDVTPLIRLSRK
FT                   RGYKFNMLLCWCIGKAASQVREFYLLPVGCELLQYDSIAVNTIVKNKTGQVSSCDVPFS
FT                   DSLAGFNVDYLRLTCQVAERCENHDLTDSMVIGTSAIVDTEIDGAVGMNSGIFNNPFII
FT                   WGKYHRGLFRTTLKLSFQFHHTQMDGAHAGRFLQGLQEIIFALEGYRGI"
FT   CDS             complement(497518..498147)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04520"
FT                   /product="Acetyltransferase (isoleucine patch superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16683"
FT                   /db_xref="GOA:D4LAN8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAN8"
FT                   /protein_id="CBL16683.1"
FT                   /translation="MKNKVYPRPHDKQIVYLKDVITKPNIEVGDYTIYNDFVHDPCDFE
FT                   KNNVLYHYPVNGDKLKIGKFCSIACGAKFLFTSGNHSMQSLSTYTFPIFFDEWDLDAKN
FT                   ICAAWDNKGDTIIGNDVWIGYEAVIMPGVKIGDGAIIGTHAVVTKDVPPYTIVGGVPAK
FT                   PIRKRFDDATIEKLEALRWWDWNEKKIKRNISAIQSGDLAALERAE"
FT   CDS             complement(498164..498790)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04530"
FT                   /product="Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16684"
FT                   /db_xref="GOA:D4LAN9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAN9"
FT                   /protein_id="CBL16684.1"
FT                   /translation="MSQKNITICLETEGDYKAVENLTREAFWNVYRPGCMEHYVLHCYR
FT                   NDPAFVPELDFVMELDGELIGQIIYVRSEIDCDDGRKVPIMTFGPIGIAPAYKRQGFGK
FT                   QLLDYSMEKAREMGAGALAITGNILFYGKSGFVPAKTKGVRYADDPEADYFLIKELTPG
FT                   FLEGISGTYKDPEGYFVCEKNPEAFEQFEATFPKKEKLTLPGQLF"
FT   CDS             complement(498867..499508)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04540"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16685"
FT                   /db_xref="GOA:D4LAP0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAP0"
FT                   /protein_id="CBL16685.1"
FT                   /translation="MKQEDTTQRIWDKALELFSTQGYDSVSVGEIAKAVGIKAPSLYNH
FT                   FPSKQAIFDAIVKSTAAQYEADTDKIHIHVQNVQRDIPVFTEITEDALFEKVRQIFEYS
FT                   LHNDTISRFRRMMTIEQFRSPELAALYSKRYVERILHYHAGIFRALIATGEIAAEDPDA
FT                   LAMMYVAPVITLIGVCDRQPEREPECLEMLQSHVRLFFRMVHGGGSQRSV"
FT   CDS             complement(499685..500095)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16686"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAP1"
FT                   /protein_id="CBL16686.1"
FT                   /translation="MKLYFGNAVTTATTLMILALLGFIGYSIFHRVNIQYWGRRSVILL
FT                   VFGLVICCFASARDGLDKTIQHAIDGSCAPGLFPLISIPTIVGCIGAFLIIVAAIATPI
FT                   AKTQQARQVWFYVMSGGAMLKIVTMEIARIIL"
FT   CDS             complement(500092..500328)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16687"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAP2"
FT                   /protein_id="CBL16687.1"
FT                   /translation="MLCPKCGKEMRKGYLFSSKDGAFSFANEVPGALENAKHAEGFVKL
FT                   TGLKVGGRTSVPACCCDACRVVILQYRKEAEEL"
FT   CDS             complement(500412..501044)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04570"
FT                   /product="transcriptional regulator, TetR family"
FT                   /function="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16688"
FT                   /db_xref="GOA:D4LAP3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAP3"
FT                   /protein_id="CBL16688.1"
FT                   /translation="MAGDTKERILETALALFAQSGYLGTSMHDIAKELGITKGALYKHY
FT                   ASKQEILDSIVERMNKMDYERAEAYEMPETEPDGFAEAYLHTPIAKIRTYSMAQFDHWT
FT                   KEPFSSNFRKMLTLEQYRDPKLAQLYHDYLATGPTKYMAAIFRKLTDSDDAAMQLALEF
FT                   YGPMFLLYSVYDGANEKESVAPMLCAHIDRFIAKIESGYRKPHAEGA"
FT   CDS             complement(501204..501851)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04580"
FT                   /product="Sortase (surface protein transpeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16689"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAP4"
FT                   /protein_id="CBL16689.1"
FT                   /translation="MKHKRAGRLCMLAGALCILLGAGLTGYNLYTDQAAEEQSEQVLAQ
FT                   LRTSCSLPALEEPVSGVTEPAEPMEIYPAQEEASLVIDGERYIGVLQIPALGVELPVRQ
FT                   ELSKQGLKKTPCRYKGSAESRDLLIAAHNYSRHFGRIGQLVSDDIIRFIDLSGRVYIYQ
FT                   VDQTQIIDGYDMEEMFAGQWDMTLFTCTLGGKSRVTVRCSLLCRVTPWGDTI"
FT   CDS             complement(501914..502813)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16690"
FT                   /db_xref="InterPro:IPR008970"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAP5"
FT                   /protein_id="CBL16690.1"
FT                   /translation="MTGVHAAAKGRLTIDSKSANIPVTDMYWQVFRVADVPKGDTLELT
FT                   GAFAGLPVKPDLSTEDGARTAASTLEAYAVAYGITPDFSAVASSDGTVTAENLETGYYL
FT                   VLGEPLKDENGMYLSVPTLLCIADGGQYDNPDWSLDRTIVPKIRLISGAEYHSQTDRTV
FT                   QKIWVNADKTPEIRVRLYRGGTLYDTQTLNDANNWEYTWSKLDNTSRWTVIEEQVPGDC
FT                   TVSYTQQQVKSGKTYKEAFTVTNTGSTTVVTTSRNTGSNNTGKLPQTGQLWWPIPLLVL
FT                   GGSGLLALGWRITRKKRS"
FT   CDS             complement(503886..505445)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04610"
FT                   /product="Cna protein B-type domain./Gram positive anchor."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16691"
FT                   /db_xref="GOA:D4LAP6"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAP6"
FT                   /protein_id="CBL16691.1"
FT                   /translation="MKKSSKFAAIALAACMVAPMAMVAVPFTASAASIEITGIGAEQHD
FT                   FEIYQIFKGDLVNGKLSNLVWADGITAYNSAAVTAGAKVDDAIVSAMSGTDARSIVSMI
FT                   TLGTACKTVSSSSPNLTIDGLEDGYYVVKDVTNLDDKDDANSAWIVQVAGEAHVAVKTA
FT                   KPTVDKQIQDEAADKDTNSTDAEGWGETADHAINEQFQFKLTAKIPANDQIKAYDAYKL
FT                   VFHDSMSAGVTFDSIASVTVAGNPVTAYTETATGAADKAGLSWELTINDVKPLVPSSIT
FT                   WGEQEIVVEVVYNAHLNENAIVSKSDVTDGDKDHVNNNKVYLEYSNNPDSTGTGTSQTG
FT                   KTPEDYVWAFTYGVDNTKYKNEALAGNELQNAGFRLYDAAGTTEIGLIFDTTKNAYRPI
FT                   KSGEAAAEMKSAADGKFNIIGLDAGTYTLRETTTPTGYNTCADVQIVIAAAHNESASGT
FT                   AANLALTGSKNMDNDIVNKEGSTLPSTGGIGTTIFYGLGGVLVLGSGVALITKKRMKKD
FT                   EE"
FT   CDS             complement(505507..508005)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16692"
FT                   /db_xref="InterPro:IPR008970"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAP7"
FT                   /protein_id="CBL16692.1"
FT                   /translation="MRKQSQQVTEILHTHRNQARYFAVFLMLSALVISFVCSALMMPAV
FT                   SMTGGDPKYDKAYTIENILSSYNLFIENDLTTHNHVVGAMAVGNDYTGKSASGDAAKAP
FT                   SYAKNIIEAYNYSCGAYLDEADKENLAFYYQTKEDNVFLGTNYVQVTDPYIDFAQAFQN
FT                   IRAWSQAKATETGSHVWVVQASDLTQTYNHTSGKKLDIDVSTVTATDIIIPKNIYDQIG
FT                   LINFTSSTGATTEKIVDGMARNGYTITIPDVTDTYFTFEYSNVDKFVTVNEQQSSNMFK
FT                   GLSGAIHGGEANLDGANLIWNFPDATDVSVKHLTGHLVAPNATVQINCREDGSIVTGGN
FT                   FEGNVIARNAFTGGEAHFYSYYGLKSTKPMDVSVEKQWVGDPEGTSHEGDNVRVQLYKS
FT                   QDAVEDLSQLTDAQKSGEPITLNSTNNWAYKWENVEKGYFYYVKELDVPDGYTVSYSGN
FT                   GLSTIGMIVISNTNNTTVVTTTTGTGTAATTTTASDESTTTTQTTTTTETTTTTTVQTT
FT                   TTTAPATTTTAAATTTQGIRIGIHKVWSDHATNSHDSDTVVVEIHRSTNPADVPNQEKI
FT                   TTMAVTTTTTATVTTTGKSPPSGNTVQLDNVVFGTEIDLSAFDYTNITEIALKISDLAS
FT                   GGDGQVHIHPNYKSYQFADAESDGLIHIKLTPPTSSKLIIYRYNGTGTLESVFLYFNTT
FT                   SQQGMDSIKPVLAAANGSSSPTWVQNLEIRKDTGWTATAENLPATDADGNPYYYWAVEK
FT                   DFSGYDASYLYENSPGDKYITGKDGSITVCNTPSKTTGVVMPSTGGSGTFAHRLIGISL
FT                   MTAAAGLFVLRRQKQFRSSA"
FT   CDS             complement(508021..508605)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04630"
FT                   /product="signal peptidase I, bacterial type"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16693"
FT                   /db_xref="GOA:D4LAP8"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAP8"
FT                   /protein_id="CBL16693.1"
FT                   /translation="MQEQNEARGFTVRQIEGELKRLRRKQNSRRIFRQTVFSLLVVAAV
FT                   AVLAAMLFFPIFRVTGSSMEPTLQPKEIVVCLKSSRFQSGDLVAFYYNNKVLLKRVIGT
FT                   AGDTIEIDDSGNVFVNGSQLDEPYITKKKLGQCDIDFPYQVPDNRIFVMGDNRETSVDS
FT                   RTTAVGCIADEYVIGKVFLRVWPLERLGFLD"
FT   CDS             complement(508589..508879)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16694"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAP9"
FT                   /protein_id="CBL16694.1"
FT                   /translation="MKQKELRKLRRTELLELMLQMQEEIDQLRQENQELNQKLLDRRIT
FT                   LEQTGSIAEAALKLNKVFEAAQQAAEDYLNSIQAEHPQVPKAGDDTDAGTE"
FT   CDS             509224..509640
FT                   /transl_table=11
FT                   /locus_tag="RUM_04650"
FT                   /product="Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16695"
FT                   /db_xref="GOA:D4LAQ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAQ0"
FT                   /protein_id="CBL16695.1"
FT                   /translation="MHHWTVQYNTLTAAEFIRLWESVWDGAPTREQVQLALAHTLFRVA
FT                   VYDGEQVIGMARMLGDLGMNYYIKDVVVLPAYQRQGVGRLLLEELMKYIRENGVPGTDI
FT                   FVELCAVPDKIPFYERFGFTYNEAKRLMRMCHVD"
FT   CDS             complement(509738..509794)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16696"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAQ1"
FT                   /protein_id="CBL16696.1"
FT                   /translation="MCNAFFTKLCELLKSFCG"
FT   CDS             complement(510032..510601)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04670"
FT                   /product="Predicted membrane protein (DUF2238)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16697"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAQ2"
FT                   /protein_id="CBL16697.1"
FT                   /translation="MQKQDTGKKLTVSLIVLALTVLAAIITRLTGLETTSAKLIGSFAA
FT                   VFLLTGVVWRFPFRFYCMAFGFEVLAAVLGSALNLYHYLGFYDKFVHYTSGIVLAEGGL
FT                   ILIHALAGRRHTPAEPLLCRLFSMFFAIAGAGIWEIYEFTADNLLGINMQGDNTNTMGD
FT                   IISGTLGALTWFGIHTLMHKRQQEKQ"
FT   CDS             complement(510625..511707)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04680"
FT                   /product="aspartate carbamoyltransferase"
FT                   /function="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16698"
FT                   /db_xref="GOA:D4LAQ3"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAQ3"
FT                   /protein_id="CBL16698.1"
FT                   /translation="MEASYQHLIDLNDYPVSWWNQIVALGADIKEHPQRYTHACVGKVM
FT                   ATLFYEPSTRTQMSFQAAMIRLGGSIIGFDNPATSSVSKGESLKDTTKIVSNYADILII
FT                   RHPMAGAAKAAALTTDCPVINAGDGGHLHPTQTLTDLLTLRVEKGRLDGLTVGLCGDLL
FT                   NGRTVHSLCKALSCYKNNHFVLISTPELRLPFYVKDIIKANGGTFTEVSSLDQVIGSLD
FT                   VLYMTRIQQERFTSEEAYLAQKDTYVLDAKKMSRARPDMIVLHPLPRVDEITVEVDQDP
FT                   RAMYFKQAHYGMYVRMALIMTMLENQNPSRLLKGKVHKGVCCKNPSCITQQEHYLPKSF
FT                   RGEGTTLECEYCDERLLLEH"
FT   CDS             complement(511759..512427)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04690"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16699"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAQ4"
FT                   /protein_id="CBL16699.1"
FT                   /translation="MATVVTYKYIKQKPDIMTYIRRADQALASLGFTEHSFPHVEKVAE
FT                   VAAMILTELGYDQRTAELARIAGIMHDIGNVINRTDHAQSGAVMAFRLLDKLSMPAEEI
FT                   CSIVSAIGNHDEATAQPLDPISAALIIADKTDVRRSRVRNADLLTFDIHDRVNYAVEHA
FT                   DLTFSPDKSTLLLDLQIDTKLSSVLEYFEIFLERMLLCKRACTFLNVRFSMLVNGTSVL
FT                   "
FT   CDS             complement(512430..514304)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04700"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16700"
FT                   /db_xref="GOA:D4LAQ5"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAQ5"
FT                   /protein_id="CBL16700.1"
FT                   /translation="MCGYTGFTNHIDNSNRVIEDMMDQIRHRGPDAAGRYVDGDIALGH
FT                   RRLSIIDITEQGDQPIYNEDRTKVLVFNGEIYNYQDIRKDLLAAGHVFRTQTDSEVLIH
FT                   GYEEYGPELLPRLRGMFSFVIWDTVKKELFGARDFFGIKPLYYAVMGESFLFGSEIKSF
FT                   LVHPHFKKELNETALENYLTFQYSPTEETFFKNVYKLPAAHYFTYANGKLTTRRYWEVK
FT                   FDADNKPQLEDWVNEISDIFHNSVQAHKIADVEVGSFLSSGVDSSYVAAIADVDKTFTV
FT                   GFGEDERYNEIGWAKNFSKAIGKENYSKVITPEEYWAKLPKIQYHMDEPLADPAAIALY
FT                   FVCELASRQLKVVLSGEGADEIFGGYNVYSEPNSTAYDKLPRGLRRGIGTIAGKLPAKR
FT                   GVNFFVRKGKDLEERFIGNAYMFTPAERSALLKAPGKAPDPTVITKPFYDKVKDQDDVT
FT                   KMQYLDLHLWMTGDILLKADKMSMANSLELRVPFLDKEVMGVAERIPTRYRVTRTESTD
FT                   AHTPYITKYAMRLAAKRDTPPQTAKTAAKKKLGFPVPIRVWLKEDTYFNLVKDRFTSPA
FT                   AEQFFHTEKLVSLLEDHRAGKADNSRKIWTVFMFLVWYGVYFENGVKE"
FT   CDS             514488..514619
FT                   /transl_table=11
FT                   /locus_tag="RUM_04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16701"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAQ6"
FT                   /protein_id="CBL16701.1"
FT                   /translation="MGLCIVCTDDFRQIAQKYRENTQYLFLDSVQFHKNLGTTSCVE"
FT   CDS             514644..515570
FT                   /transl_table=11
FT                   /locus_tag="RUM_04720"
FT                   /product="Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16702"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAQ7"
FT                   /protein_id="CBL16702.1"
FT                   /translation="MEGSGRTPRRRGKETEHTIHNRKRRPRLRFRFGVIVFIWVVVFAS
FT                   CFGLYMFACNLFGMDPDQESSADTTEAASDTTESAPETTEPVATEPEATETEPPATTAP
FT                   AENVNPLPERDAKSADYFDDCIFVGDSITVGLSTYQFVPATRVYATIGLNITRVMTETV
FT                   ATEYGKIPILEGIEQAQPKYVYVMLGSNGIAWLSNETMLKQYHEFTSAVQEVSPDTEIV
FT                   VMSIPPVTAGRENASESPIQNSDINTYNSELLKMANEYGYHYLDINTALKGNDGKLPEA
FT                   DASKDGMHFNKATYEVLVDYLLRHTPL"
FT   CDS             515626..516138
FT                   /transl_table=11
FT                   /locus_tag="RUM_04730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16703"
FT                   /db_xref="InterPro:IPR025648"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAQ8"
FT                   /protein_id="CBL16703.1"
FT                   /translation="MLSKKKWIVLICAAALTLSACTACGGSASSGGGNNTSSTAQASKT
FT                   PAQISKEVMDSGIEFPEMIEVNADNLKLQYSLEDGDFQEFGVYWSGNAAYADEVCVILA
FT                   ADGKADKVKDAVNQRLESQKTAFKDYVKEEYDRLCTTSVSTKGNYVYWVCTKDNAKAND
FT                   IITKAIG"
FT   CDS             complement(516209..517228)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04740"
FT                   /product="glycerol 3-phosphate dehydrogenase (NAD(P)+)"
FT                   /function="glycerol 3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16704"
FT                   /db_xref="GOA:D4LAQ9"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAQ9"
FT                   /protein_id="CBL16704.1"
FT                   /translation="MANITILGSGGFGIGLAVMLHKHGHHITVWSKFQKELDDIRKNGE
FT                   QVQKLPGVVIPPEIGLSASLECIRGSDLVLFGIPSSFVRSVAREASPYITSDMVVVNTG
FT                   KGLEEGSMKLLSEVLTEEIPQAAIVVLTGPSHAEEVGRCISTAVVAASKSAAAAAYVQE
FT                   TLSNQCFRIYENDDIVGCELGGALKNIIALCAGICDGLGYGDNTKAALMTRGIHEIARL
FT                   GVAMGARAATFSGLAGIGDLIVTCTSMHSRNRRAGILIGEGVKPEDAVKQVGTVEGYFC
FT                   CHVAYKLAQQMGVDMPITEQLYHVLFEGSDVRDALGKLMSRPSRHENEECSYLRDMMN"
FT   CDS             complement(517241..517921)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04750"
FT                   /product="conserved hypothetical integral membrane protein
FT                   TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16705"
FT                   /db_xref="GOA:D4LAR0"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAR0"
FT                   /protein_id="CBL16705.1"
FT                   /translation="MGHFILATFLAALLAYLLGSCNSAILFSKLIKGQDIRELGSHNAG
FT                   LTNTLRCFGKGMAGLVLAGDLLKGVAAVLLARLMCSLMGAGLPFPSGADTTYIGYIAGI
FT                   FAILGHVRPLYYGFRGGKGVLVGVSIFLVVDPVVFAVLIGIFSLVLWRSKYVSLGSIIA
FT                   TSFCPVVTCLLHLFVYHTSVIHTVLYVVLSAIMSAQVIFMHRSNIERLRNGTENRFSFR
FT                   SKKA"
FT   CDS             complement(517981..519309)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04760"
FT                   /product="ribosome-associated GTPase EngA"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16706"
FT                   /db_xref="GOA:D4LAR1"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAR1"
FT                   /protein_id="CBL16706.1"
FT                   /translation="MALPIVAVVGRPNVGKSTLFNKLIGQRLSIVEDTPGVTRDRIYSK
FT                   CEWRGREFMVVDTGGIEPDTDDVILAQMRRQAEVAIHRADVIVLVTDVRCGVTANDYAV
FT                   ADMLQKSGKPVVLAVNKCDTIGEPPLELYEFYNLGIGEPFPISSQHGHGTGDMLDEILK
FT                   YLPETDAEDYDEDCIKVAVIGKPNAGKSSLINKIAGEERVIVSDIAGTTRDATDTVVEN
FT                   EQGKFVFIDTAGIRKKSRITERVEHFSVLRAYMAVDRADVCIIMIDAQTGFTEQDSKVA
FT                   GYAHEQGKASIIAVNKWDLIEKDTNTMKEFQEKLEKDFSFMSYVPFVFISAKTGQRVNK
FT                   LFEMIHFVANQNAIRISTGTLNDVLAYATTRVQPPSDKGRRLKIYYMTQVSTKPPTFVT
FT                   FVNRADLFHFSYQRYIENQIRTTFGLTGTPIRFVIRERGGGDQ"
FT   CDS             complement(519417..519602)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04770"
FT                   /product="LSU ribosomal protein L32P"
FT                   /function="LSU ribosomal protein L32P"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16707"
FT                   /db_xref="GOA:D4LAR2"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAR2"
FT                   /protein_id="CBL16707.1"
FT                   /translation="MAVPKNKVSKARRNKRRSAVWKLDAPAMSKCTNCGALKAPHKVCK
FT                   ACGFYKGVEVLKLNAD"
FT   CDS             complement(519657..520112)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04780"
FT                   /product="Predicted metal-binding, possibly nucleic
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16708"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAR3"
FT                   /protein_id="CBL16708.1"
FT                   /translation="MTFQLKQLFHREGDTLPVDYEIPPQALSQIRGYRFDQPVHVTGTF
FT                   RNRAGIVTLDLTVDCVLTAECDRCLELFVRPYSFSFTHTVVLSVNRDNDEYIVAQDAQL
FT                   DVDEVAVTDLLLQLPTKLLCREDCKGLCMHCGCNLNTSSCDCQGGLA"
FT   CDS             complement(520196..520600)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16709"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAR4"
FT                   /protein_id="CBL16709.1"
FT                   /translation="MIKLITGKKGTGKTKILVDMINNAVKDTNGDLICIEKGAKLTYDI
FT                   SYKVRLVDSDRFAIEGYEAFYGFIAGMFAGNYDIKEIFIDGILKIGGPDFNELGKMLEK
FT                   LNILSGNDTQIIFTISADNNELPESVMQFV"
FT   CDS             complement(520669..522003)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04800"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /function="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16710"
FT                   /db_xref="GOA:D4LAR5"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAR5"
FT                   /protein_id="CBL16710.1"
FT                   /translation="MALKLNKKYLEGFINPDEMTGIAPQVELAAKTLQDKSGLGSDFLG
FT                   WVDLPVNYDKEEFARIQAAAKRIQETADILIVIGIGGSYLGARAAIELLKSPFYNNMKK
FT                   DTPDIYYVGNNINPTYLNEVLSICEGKDIAVNVISKSGTTTEPALAFRIFKNLVEKKYG
FT                   KEGAKSRIFCTTDAKRGTLKSLADTEGYETFVIADDIGGRFSVLTAVGLLPIAVAGCDI
FT                   AAIMQGAQKAREDFAAPFAENDCYQYAAIRNILYRKGKSVELMVSYDPSFAMMNEWYKQ
FT                   LFGESEGKDNKGLFPASVIFSTDLHSMGQYIQEGSRLMFETVVDIKQPKQDLYLEDDAE
FT                   NLDGLNFLTGQNMSVVNRKALEGTILAHTEGGVPNIVLELDDTKEESFGYMVYFFEKAC
FT                   AVSGYMLGVNPFNQPGVESYKKNMFALLGKPGYESQKAALEAKLN"
FT   CDS             complement(522207..523337)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04810"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16711"
FT                   /db_xref="GOA:D4LAR6"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAR6"
FT                   /protein_id="CBL16711.1"
FT                   /translation="MQKRALTALVTVLALVLLYLPEPGAAAGKPCRAYALLEARTGQLL
FT                   LEENSSESLPMGTMAKLMTMLLTAEALESGALSENTAVTASPAANAQKGASIWLMPGEK
FT                   MTVGDLLRGMIIGNANDAAVALAEAVSGTEEQFVMDMNARGFELGLRSTVFTCASGLSE
FT                   EGQVTTAADLGRLCCKLTEYPVLTPYMTTWRTFLRGEQTELVNENTLVRSYDGLLGMKA
FT                   GHGERTGYTLAAAAQRGDGIYVAVVLGCQEDADRFSIAKTLLSKGFGSYQVTTPAFSGE
FT                   FLKPLQVLHGTDTAVEVEAQGLTGITVPKGNAGLQTVLVLPEYVEAPVSKGQQLGTAAF
FT                   YQGDIYLYEVPLTAASSVPRLTFSRAFLRLLDNMLK"
FT   CDS             complement(523433..523663)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04820"
FT                   /product="PTS HPr component phosphorylation site."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16712"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAR7"
FT                   /protein_id="CBL16712.1"
FT                   /translation="MTTVTISLQAINDVKEFVNIVMRFDFDVDLVSGRYAIDAKSIMGI
FT                   FSLDLSKPIELHAHTDNAKEFLDAIDKFIVK"
FT   CDS             523837..525159
FT                   /transl_table=11
FT                   /locus_tag="RUM_04830"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /EC_number="1.3.1.74"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16713"
FT                   /db_xref="GOA:D4LAR8"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023970"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAR8"
FT                   /protein_id="CBL16713.1"
FT                   /translation="MTAYYLSFGCKVNQYETNALRGMLSREGIQPVEQPEDADLILVNS
FT                   CTVTASSDRKVRHALRSLRSRCPAAKIVLTGCLPQAHPDAAQLCPEADLITGTKDRAAL
FT                   IQRIRQLMESAVPWDGVTPYTPGEGYELLPPAENADRTRAFIKIQDGCNQFCSYCIIPY
FT                   ARGRCRSKPREALAQEAAQMAQAGCREAVLIGINLAFYGMEWQGDLGDAVDICCAVPGI
FT                   DRVRLGSLEPEKLSDDLLRRLAAHPQFCPQFHLSLQSGCDRTLRAMNRHYTTAEYADLA
FT                   ARIRRIFPDAALTTDVMVGFPGETEADFACSLEFVREMGFAKVHVFPYSPREGTVAARM
FT                   PEQIPSPEKRRRAALMGETAAACRRAFLRSQVGKVMPVLFERSADPAWHRGYTPNYTPV
FT                   KISAKKGEKSLRKSVFRVIIKSSEPDCCIGTLLPEASAQND"
FT   CDS             525205..528909
FT                   /transl_table=11
FT                   /locus_tag="RUM_04840"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /function="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16714"
FT                   /db_xref="GOA:D4LAR9"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAR9"
FT                   /protein_id="CBL16714.1"
FT                   /translation="MSVFRIYVEKKPEFAVEAQSLLSDIRTALRLDITSIRVINRYDAD
FT                   KITKEDFQLSVSTVFSEPAVDVTYDTLPRLANTERIFAVEYLPGQFDQRADSCEQCIQI
FT                   LTQKDRCRVQNARVYIIAGNLTDQEFDRLKAYIINPVESREASLNLVSSLDSNYEIPTT
FT                   VETLKGFCELSEAGLADFIKQYGLAMDLDDIKFCQAYFKDTERRDPTITEIRMIDTYWS
FT                   DHCRHTTFSTNIQDVQILAPYIQDTYDEYLRIRRELGRAEKPLTLMDMATLAVRKLKAD
FT                   GKLPDLDESEEINACSVKIKVDTENGDEDWILMFKNETHNHPTEIEPFGGAATCLGGAI
FT                   RDPLSGRSYVYQAMRVTGAANPLVPVEDTITGKLPQRKITVGAANGYSSYGNQIGLATG
FT                   HVAEIYHPGYVAKRMEIGAVIGAAPAENIRREAPVPGDVVILLGGKTGRDGCGGATGSS
FT                   KSHTLESLEHCGAEVQKGNPPVERKLQRLFRNPEVTRMIKRCNDFGAGGVSVAIGELTD
FT                   GLLINLNAVPKKYDGLDGTEIAISESQERMAVVIAKEDLSRFLAEARRENLEATMVADV
FT                   TDNRRLEMVWNGKTIVNLSRDFLNSNGAPKYTDIEVPDPATEIPNMLEDTPDGWEALMS
FT                   NLNVCSQKGLVEKFDSTIGAGTVLMPFGGKYQLTPNQAMAAKIPVLKGETNTCSLMGWG
FT                   FNPVISEKSPYHGAMMAVVESIAKIVAAGGTYHKCWLTFQEYFERTQNNPVRWGKPFAA
FT                   LLGAFRAQLEMGCAAIGGKDSMSGTFENIDVPPTLVSFAVCTADSRKVISPEFKAAGHT
FT                   VIRIAPEYDGNGLPVFDSVKQCFDQIESMIDSGRACAVWSVAGGGVAEGIAKMCFGNHI
FT                   GFEFSRKLSDTILFKPWYGSFIVELTGEAGYGEEIIGRTMPDYRIYGEGYTMQAEALQK
FT                   AWESKLESVFPCRIKTEFATIESYSYATKSRKGPAIKAARPRVLIPVFPGTNCEYDTAR
FT                   VFERAGADVNVMVIRNLSASDIEASVAAVAAQMKQSQIVMLPGGFSGGDEPDGSGKFIT
FT                   AFFRNPRIKNEVHALLQQRDGLMLGICNGFQALIKLGLVPFGEIVDMTEDSPTLTFNTI
FT                   ARHQSMMVTTRIASDKSPWLAGCKVGDLHTVAISHGEGRFVASDALIRRMANNGQIATQ
FT                   YVDEYGKPTMDIRYNPNTSIDAIEGITSPDGRVLGKMGHSERIGRDICKNVCGNKDQLI
FT                   FQSGVNYFK"
FT   CDS             complement(528953..529300)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16715"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAS0"
FT                   /protein_id="CBL16715.1"
FT                   /translation="MKATGYMILGSMTFSAVVLIATLSQMVRWERAAADSLAFESTIPT
FT                   RAVETTMPAGYTVRLHNGRIGVFRTGESLPYRYLDVELSLLPELDRQLLEEGIPARDDA
FT                   ELQSLLEDLRE"
FT   CDS             529641..532076
FT                   /transl_table=11
FT                   /locus_tag="RUM_04860"
FT                   /product="Membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /EC_number="3.4.-.-"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16716"
FT                   /db_xref="GOA:D4LAS1"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAS1"
FT                   /protein_id="CBL16716.1"
FT                   /translation="MTEPKKPANKTKRPAGNTQRPKRKRPAEHAAPAGAKTRRTAPKHT
FT                   APAAPRKPRKQRPAWQRGLQRAGSILLTTTLSFLLILVITCTIVGTTLVVYVLGFMEGT
FT                   SEVSIKEMEMSYSTFIYAEDKDGEIVTLHQVPSSIKRIPIEASEIPQHVRDAFTYAEDE
FT                   RFYEHEGVDYKRTAAAMANMVLHFWSANQGGSTITQQLVKNITGDNATNAERKIREIFR
FT                   AMQMEKTYTKEEILTAYLNYIGFGGSANGIEMASIKYFGKHTNELTVAEAACLAAIPKN
FT                   PEKLNPFAYYVDDETGERVNYGHEKNRERQEYVLYQMYSNGAISYDEYQAALAEHIIFT
FT                   DSEEYKELHPEEDEDTQIEPDKPTSWVVDAAINEFSEVLMDKYGISKKEARSRVNRGGY
FT                   QIYTTVDLEMQEYVEGRYQDMNNLLAGMATVQNTAHWRDLNGDGVASEDEAQFLQSGFC
FT                   AINYSGEILATVGAIGEKTASLCTSYAYEPQQPGSTIKPVTTYGYALSTDYIHWGTPLR
FT                   DYPPIKNPATGKLWPTNYSSGGGMSYTGSMKNVYYALQKSYNTIPALLCKELGRIEIYN
FT                   FATNNLGLELVQNDQDYAPLSVGALTYGVSITNLVNAYMVYGNGGYYSKAHIISKVESG
FT                   DGTLVYSGGTDYNQAVDEETSTVMNKLLQNVVKQGTATAAKITASDGTKIPIAGKTGTT
FT                   SDWCDLTFVGLCPDFVSGMWIGYEQNYQIQGHGRLKSAGIWKNIIGDYIKEHYDGNDFF
FT                   VSDSVIEAPMCTASGNIAGSSCPKGITGYWKSTNAPKCTGHGGGSSSTPVTTKPAADN"
FT   CDS             complement(533613..533915)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16717"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAS2"
FT                   /protein_id="CBL16717.1"
FT                   /translation="MFLEFMSLALSFMTLEELAHKLSEPILETLIIVIVFVLIPQYILG
FT                   AVLLARGCSACSREGRTAHAIALQCIGVILLLPMMLFVLFQPISFLVSILFIFFA"
FT   CDS             complement(533965..534549)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04900"
FT                   /product="Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16718"
FT                   /db_xref="GOA:D4LAS3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAS3"
FT                   /protein_id="CBL16718.1"
FT                   /translation="MIDLKGVRVGFVMTGSFCTFAEAFAAAEALRQAGASLLPVMSEHA
FT                   AGTDTRFGSALSHIQRLETICEKPVIRSIPEAEPIGPKHLTDILVVAPCTGNTLAKLAA
FT                   SITDTTATMAVKSHLRTGNPVVLAVATNDALAGSAKNIGQLLNLKHYRFVPFGQDQPTG
FT                   KPTSLIADFTKIPQTLADALDGKQQQPILLS"
FT   CDS             complement(534542..535420)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04910"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16719"
FT                   /db_xref="GOA:D4LAS4"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAS4"
FT                   /protein_id="CBL16719.1"
FT                   /translation="MRRPAFLVAGGDLRQLYTARALLPEGSVSVLGFDENVNLPEGLER
FT                   LDSMELSGKRADYLVLPMPVTEDGVLVHAPFARHSIPVAGLPGLVKADGAVFGGRIHPA
FT                   VRKVFDGGAAVVDYYQREELSVLNAVPTAEGAIQIAMEELATTIYGQNVLVTGFGRISK
FT                   VLVRILTAMGAHVTVTARKYQDLAWAEISGCRAVHISRLEETLPGYDLVFNTVPAVLLD
FT                   EARLWKLRSDALIIDLASKPGGVDFDTASRLGRKTVWALSLPGKVAPITAGDMIACTIR
FT                   NILKERSFADD"
FT   CDS             complement(535557..536996)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04920"
FT                   /product="Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16720"
FT                   /db_xref="GOA:D4LAS5"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAS5"
FT                   /protein_id="CBL16720.1"
FT                   /translation="MFEHNHENGKDNMNNAQNQGFNETPLDQEPVYNSYSAMRNDEPGS
FT                   YQQSYYSQPQQSIPGDSKPPKKRRILPKVAAAVAGVMVVSFASIQCYRFIDGNETLSAF
FT                   FASTNSGVSLTDSSKADSSSAADSSLADDGKNWMNLAASTGTLSTTEVVDKVMPSVVGV
FT                   ASTFSYQSSGFGGWFGAGQSQEQNVSGTGTGIIMSADGYIITNAHVIYESDYGGKASKV
FT                   SVVLSSDSGYDQTEYEATIVGYDVEADLAVLKIDAKDLVPAEFGDSDKLKVGELAIAIG
FT                   NPLGFELFGSVTCGIISALNREVTISENTMNLIQTDAAINSGNSGGPLINSSGQVIGIN
FT                   SAKLSSNYSNTTIEGLGFAIPITEAKAIINDLINFGYVTGKPQIGIGAADVSETQSRMY
FT                   NIPVGVYVSEIYEGGAADQGGIKKGDVIIAVNGETIKTYEELNGIKNKFKAGDKITLTV
FT                   TRGDQDLDIEIVLQEKKPTAD"
FT   CDS             537185..538525
FT                   /transl_table=11
FT                   /locus_tag="RUM_04930"
FT                   /product="uncharacterized domain HDIG"
FT                   /EC_number="2.7.7.21"
FT                   /EC_number="2.7.7.25"
FT                   /EC_number="3.1.4.-"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16721"
FT                   /db_xref="GOA:D4LAS6"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAS6"
FT                   /protein_id="CBL16721.1"
FT                   /translation="MHTLPPQVLTAMELLEQAGYACHIVGGCVRDMLLGRTPSDYDLTT
FT                   NALPEQMQQVFASCRTIETGIAHGTLTILLEGMSLECTTYRVDGTYSDGRHPDSVRFTP
FT                   TLEEDLARRDFTVNAMAYHPRLGLTDPFGGRDDLKRGILRCVGEPERRFTEDALRILRC
FT                   VRFASVLGFAVEPETAAAVHSMKQRLELVSAERIRSELDKLLMGEHVTEILCRYGDVVF
FT                   VPIPELAPCLGFAQHSRYHCYDVWTHVAHTVGAAPRDPLLRLTMLLHDVGKPDCFTLDP
FT                   DGTGHFKGHAPKGAVLAAKILPRLRYDKHTCEQVTELIAWHAEKLRSRASVRHALSRLG
FT                   AEQFFRLIDVMCADNSAKQPFCLEELPGLLEAADYARALLDAGVCLTLKQLAVNGRDLV
FT                   AIGAQGRQIGQVLQMLLDAVVAERASNDRAQLLELAQVCLRELQAGF"
FT   CDS             complement(538654..540282)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04940"
FT                   /product="chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16722"
FT                   /db_xref="GOA:D4LAS7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAS7"
FT                   /protein_id="CBL16722.1"
FT                   /translation="MAKQIKYGEEARKALQAGIDSLADTVKITLGPKGRNVVLDKKFGA
FT                   PLITNDGVTIAKEVELEDPFENMGAQLVKEVATKTNDAAGDGTTTATLLAQAMVREGMK
FT                   NIAAGANPMIVKKGIQKAVDAAVNAIKANSKPVEGSADIARVGTVSSADENVGKLIAEA
FT                   MEKVSTDGVITLEESKTAETYSEVVEGMQFDRGYISPYMVTDADKMEAVYDDAYILITD
FT                   KKISSIQEILPLLEQVVQAGKKLVIIAEDMEGEALTTIILNNLRGTFKCAAVKAPGFGD
FT                   RRKEMLKDIAILTGGEVITSELGLELKDTTIAQLGRAKQVVIQKENTIIVDGAGASEEI
FT                   KARISQIRSQIETTTSDFDKEKLQERLAKLSGGVAVIKVGAATEIEMKEKKLRIEDALA
FT                   ATKAAVEEGIVAGGGTALINAIPAVEKLLPSLDGDEKTGAKIILKALEEPVRQIARNAG
FT                   LEGSVIIDKIRRSRKVGYGFDAYNETYVDMIPAGIVDPTKVTRSALQNAASVAAMVLTT
FT                   ESLVADIKEENAAAAPAMPAGGMGF"
FT   CDS             complement(540314..540598)
FT                   /transl_table=11
FT                   /locus_tag="RUM_04950"
FT                   /product="Co-chaperonin GroES (HSP10)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16723"
FT                   /db_xref="GOA:D4LAS8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAS8"
FT                   /protein_id="CBL16723.1"
FT                   /translation="MTIKPLADRVVIKMMEAEETTKGGIILAASAQEKPQVAEIVAVGS
FT                   GGVVDGKEVKMYLKVGDKVLLSKYAGTEVKLDGEDYTILRQSDILAIVE"
FT   CDS             540944..541642
FT                   /transl_table=11
FT                   /locus_tag="RUM_04960"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16724"
FT                   /db_xref="GOA:D4LAS9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAS9"
FT                   /protein_id="CBL16724.1"
FT                   /translation="MALDKVLIVDDDKNICDLLRLYLEKEGYSVILSHDGEEAVVKFNA
FT                   LKPDIVLLDVMLPGLDGWQVCREIRKKSNIPILMITAKSDTFDKVLGLELGADDYIVKP
FT                   FDSKEVIARIKAVVRRTGQSPAEMEVREVRYDKLSVNMTRYELKVDGKVVDAPPKELEL
FT                   LFYLASNPNRVYTRDQLLDEVWGFEYYGDSRTIDVHIKRLREKLEGVSDKWELKTVWGV
FT                   GYKFETDEED"
FT   CDS             541754..543202
FT                   /transl_table=11
FT                   /locus_tag="RUM_04970"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16725"
FT                   /db_xref="GOA:D4LAT0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAT0"
FT                   /protein_id="CBL16725.1"
FT                   /translation="MKKSIFSRYFYLGTIITFFFAALLGSLVLLWADGRYEDEKREQAA
FT                   NMAHLMITETRENYSRYGNVDTPQIHSQFSYYALTYNVSCYLFDENGACLLRSDYADGS
FT                   IRLSDSLMNSVQRKPTFQVNQFTGLTQELSVCYIEHFQLYDTDQEHGAYLALVYPAEQL
FT                   TSFSKELFFVLVIGLMAVTVLAAIVFYFNTRHMLKPVKEITKAAERYADGDFSFKPDVA
FT                   DAGELTYLAMTMGRMADFIDSNEKNRKSFVSNVSHELRTPMTTISGFVDGILDGTIPPE
FT                   QQQGYLRRISGEVKRLSRLVSSMLNISKFEEGGMELKLVPVELTGLLISTLFMFEQKIE
FT                   ARQIQVCGLEDCPRAEVQADKDLMQQVFYNLIENAVKFTPRNGELTFSVMPQGEQCQVV
FT                   IRNTGEGLSEEELSNVFNRFYKTDESRSKDTTGVGLGLSIVSRIIRLHNGNIMVKSVKG
FT                   DYTEFVITLPVKGKKQLPPKERKD"
FT   CDS             543207..544781
FT                   /transl_table=11
FT                   /locus_tag="RUM_04980"
FT                   /product="Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_04980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16726"
FT                   /db_xref="GOA:D4LAT1"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAT1"
FT                   /protein_id="CBL16726.1"
FT                   /translation="MEENQYEHSGSQPEASPAQEPAAAGTPAQNQTSPDSQSGYQQPYG
FT                   QGYQSTYQNQQPYGQGYQRTYQNQQPYGQGYQSTYQNQQPYGQGYQRAYQNQQPYGQGY
FT                   QRTYQNQQPYGQQGYAQGYYGTPPRFAPEPAPAEPSPARINRAMLIAAIVGFVLILGFS
FT                   VYCIVRDLSHGAMQSDPGGVHISIGTQKKPDVPENYKDDTGRYTVEGIAQAVRPSIVEI
FT                   YTYGEVDSLVIGSGSGIIISEDGYIVTNEHVLNGAKTYVVHLDDDSPHPAKLVGRDAKT
FT                   DIAVLKIDAADLTVAVLGDSNETVLGEEVVAIGNPAGLSGTLTNGIVSGLNRKIRADST
FT                   GYEMTCIQTNAAISPGNSGGALVNMFGQVIGITSSKYVSSSYEGLGFAITINEALPIIE
FT                   ELIQNGYIAGRYRIGITFYSSEDTYTQRLFEKQEGYEIPEDFQGIWIEGISGDCSVAST
FT                   ALRTGDFIYAVNGKEVYDYDSLSVALEGRGPGDTVTAKCRRYGSSQSDYEDFEISFQLM
FT                   EDRSGDF"
FT   CDS             545588..546190
FT                   /transl_table=11
FT                   /locus_tag="RUM_05000"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16727"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAT2"
FT                   /protein_id="CBL16727.1"
FT                   /translation="MKGTGWIRAAKSGYIATSMLWCAAGLLLIFLPGTSVKLLCMAAGG
FT                   LLTVCGIIKIIGYFSKDLYRLAFQFDLALGLLCLLLGLILLCNPVGFTTFVHFLIGIVV
FT                   LTDSMFKLQTAFDAKRFGISNWWVIGLTSLLTGVCGVLLVLNPFDGAKLIMRLIGITAL
FT                   LEGVLNLLVAVYAVKIQKQGKVDVIETHAEIKGEDDL"
FT   CDS             546187..548259
FT                   /transl_table=11
FT                   /locus_tag="RUM_05010"
FT                   /product="Predicted exporters of the RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16728"
FT                   /db_xref="GOA:D4LAT3"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAT3"
FT                   /protein_id="CBL16728.1"
FT                   /translation="MKLGQAVVKHRVLILIITLVLLVPSVLGMMATRINYDMLNYLPDD
FT                   MDTTTGQDILMDEFGKGAFSFLIVEDMPAKDIVKLEEQLRTVEHVDTVLWYDSLLDISV
FT                   PMEMLPQKVYDAFNAGDCTMIAVFFDTSTSADETMQAIASIRDIAGKQCFVSGMSAMVT
FT                   DLKELCENEEPIYVALAVVMACIVMMLFMDSWIIPFLFLSSIGAAILINMGTNYFLGEI
FT                   SYLTKALSAVLQLAVTMDYSIFLWHSYCEQRKLQGDQYSAMATAIHETFTSVIGSSITT
FT                   IAGFIALCFMTFTLGMDLGIVMAKGVILGVIGCVTTLPALILVLDKPIEKTRHRALLPS
FT                   MNKAAKGLTRIFPVFLAVFAIAIVPAYYAYSKTNDAVYYDLGATLPEDMDYVIANTKLK
FT                   DTFNVGSTHMLLVDASLEPKQVKQMTKELEQVDGVKYVLGMESVVGSLVPQDMIPDSIR
FT                   SILESDNWELMLINSEYTTASDAVNNQIEQLNSIIKQYDQKGMLIGEAPCTKDMIDITD
FT                   RDFKVVNTISILAIFLIILFVEKSISLPVILVAVIELSIFINLGIPYLTNTSLPFIAPI
FT                   CISTIQLGATVDYAILMTTRYKKNRFDGMDKREAVSDALSMSIPSIIVSALGLFASTFG
FT                   VAVYSDVDIISSLCTLMARGAIISMLCVILILPAMFMLFDKIISKTTIGFLPKNH"
FT   CDS             548278..550368
FT                   /transl_table=11
FT                   /locus_tag="RUM_05020"
FT                   /product="X-X-X-Leu-X-X-Gly heptad repeats"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16729"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAT4"
FT                   /protein_id="CBL16729.1"
FT                   /translation="MKSNKKITAKTVSLTLCAAMACSCIGMLAYAAGEKSGESQLTAAV
FT                   TQTVDTQKTSDTSKTASKDETVYVIAGADGSAKKIIVSDWIKNTAGSSSLDDSTELKDV
FT                   TNVKGEQGYTMNGDNARIWDAAGGDIYYQGSIEKDLPVSLKVSYQLDGNPISAEDLAGK
FT                   SGKVTIRFDYKNNQYETVKIDGKDEKIYVPFVMLTGMIVDNDNFRNVEVSNGKLINDGD
FT                   HTVIAGIALPGMQDSLQLDKDTLTIPDYVEITADVTDFSLATTMTVASNEVFNNIDTSG
FT                   LDQYDDLTDAMDDLTSAMKQLLDGSSQLYDGLSTLLSKSDTLITGIDRLATGAKELASG
FT                   ASQLESGAKDLNSGASQLADGLDTLSGNSATLNGGAKQVFDTLLSTADTQIAAAGLQAD
FT                   KLTVSNYQTVLNKVIASLDSDAVQKLAYNTALKQVTAAVNAKEPEIRTGVTAAVQSKVL
FT                   EGVLAAAGQSMTAEQYQQAVEAGVVPEAMQQQVAAAVNAQMQTEAVQSQINQNVEAQKQ
FT                   KLIDQNMQSDEVTGKIQQAVASAKQGKAQLQNLLEQLNSYNTFYQGVLQYTGGVDTAAQ
FT                   GAAELESGSSKLSAGATTLSKGADALKSGIGELQTGADALVDGVSQLKDGSMQLSDGLK
FT                   EFDESGVQKLVDAVDGDLNGIITRFKAMLDVSVDYRSFGGISEDMEGSVKFIYKTDEIS
FT                   KD"
FT   CDS             550499..550780
FT                   /transl_table=11
FT                   /locus_tag="RUM_05030"
FT                   /product="sporulation protein YabP"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16730"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAT5"
FT                   /protein_id="CBL16730.1"
FT                   /translation="MKEAAVTGTNHNAILENRKNLLLTGVTDVESFDERTVSLYTQLGE
FT                   LTVQGRQLHVNGMNLETGEVTIEGDVWALCYGERDKRGPLSLLGKLFR"
FT   CDS             550785..551228
FT                   /transl_table=11
FT                   /locus_tag="RUM_05040"
FT                   /product="Spore cortex protein YabQ (Spore_YabQ)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16731"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAT6"
FT                   /protein_id="CBL16731.1"
FT                   /translation="MGLESFFTASEQGRLFWYSCLFGIPIGIGFDLFRILRAVLPHNRV
FT                   LVALEDLLFCMLYALFVSAFSFGFARGHLRWYFPVGNLLGFTVYYLTAGRVVMGVIHRI
FT                   LGILRRILRVLLLPFVKGYALIREKTIPVFVGTLQKSKKAEKK"
FT   CDS             551673..552143
FT                   /transl_table=11
FT                   /locus_tag="RUM_05060"
FT                   /product="Predicted RNA binding protein (contains ribosomal
FT                   protein S1 domain)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16732"
FT                   /db_xref="GOA:D4LAT7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAT7"
FT                   /protein_id="CBL16732.1"
FT                   /translation="MQVEIGQVYEGVVKGITPYGAFVDLADGVTGMVHISEVANVYVSN
FT                   IRDHLTENQTVKVKVLSINEAGKISLSIKKACPPPQREQRKPRDGASRPQNGGRPRQDR
FT                   GRPNVWEPKKQPPITELSFEDMMARFKQSSEEKICDLKRGSDRKNGSRSRGK"
FT   CDS             552356..553507
FT                   /transl_table=11
FT                   /locus_tag="RUM_05070"
FT                   /product="Putative virion core protein (lumpy skin disease
FT                   virus)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16733"
FT                   /db_xref="GOA:D4LAT8"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAT8"
FT                   /protein_id="CBL16733.1"
FT                   /translation="MAILDVIKFGGLASRDWLVYKHPKDSITLGSQLIVGEGQVAIFVK
FT                   GGAVCDVFTPGTYTLSTNNLPLLQGIINLPFGGKTPFSAEIYYINTVTKLDLAWGTSDP
FT                   IQLIDPKYHVRLRIRAFGQVGMKIADYAGFLRELIGSLNASDVVRYTKVLDFYKGILVT
FT                   KVKSIIADIIIHDQISALEIAAQLDGISQRTQQILTPEFGKFGMQLINFFVKSINFPEE
FT                   DFETINKILEDKAAFDIMGDSRYATKRSFDVYEGAATNQNGVAGAFAAGGIGLGAGAAI
FT                   AGNVQPAASVMQAPAPEAAYCPACHAANKQGAKFCNSCGASMTPPEPKPAGKTCPGCGA
FT                   AVPDGSKFCTECGMSLQPPVCACGATLEPGSKFCNQCGRKVGE"
FT   CDS             553923..554345
FT                   /transl_table=11
FT                   /locus_tag="RUM_05090"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16734"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAT9"
FT                   /protein_id="CBL16734.1"
FT                   /translation="MAENLCPQCGAPLAPGATECKYCGEAVAPAQVQPQPQPQYQQQGA
FT                   YGQPGQPVQVFVQTGDNDGIDPSWPVKSKITAGLLAILLGGLGIHKFYLGKTGMGILYL
FT                   LLCWTYIPGIVGLVEGIMYLCSNDHNFQVKNHVRLQ"
FT   CDS             554636..555373
FT                   /transl_table=11
FT                   /locus_tag="RUM_05110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16735"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAU0"
FT                   /protein_id="CBL16735.1"
FT                   /translation="MFCKRCGNENPEDAVYCIKCGYNMWDKSKQKPPVPNPSTESVSAH
FT                   VSVPRHEHTHKPASVPAPSLARRVYPPKLIVALVLIGVALLGMLLPWFSYGDEGGDYGR
FT                   KREMGKVSGLQYESIFLGTIGGESNPITDKMEKYGKKDMELKNNLELLGITSIVATIAL
FT                   GAGLFLGFICRKKVWIPVGVACISFWIIFSILDTLDENSPYQGYISLYIEANGWVAVCW
FT                   LASFAGFILSLMSDSEQKKNQSA"
FT   CDS             555405..556781
FT                   /transl_table=11
FT                   /locus_tag="RUM_05120"
FT                   /product="NPCBM/NEW2 domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16736"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013222"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAU1"
FT                   /protein_id="CBL16736.1"
FT                   /translation="MKKKTMAWGCALLMGLTLTACGADASKFTGYIEDLDMQGAYSYYE
FT                   DHIDSSKKKAELDQEISESMDGLYDKLVDQYIAGNLDSEKLSLFKQLTSDAEFSETSGY
FT                   SDFLQDLAYIDQSKQNYDTAMQYYDQKDYDAAIAYFGGVMQRDTVRYEEAQKTIEACRA
FT                   EQSKQLVQDIQSQIQTKAFKEAHYKIEQLKNTDKEEADKLVTEYDAALKADADARLTSY
FT                   FDAFDYEGAVGYLAQVTPLCYSSDLSDRQTQLADEFVVYVLKIADKDADAENYEGASAV
FT                   VKQAMNALGQDNEKLSGAYDAYRSHLPVYLVDLDYMSCKNHVATHDTLEDNTGNMYHNA
FT                   LYMYERVSWQDGEGSADYFINGKYATFSGTVAVPRGFANDSNSAYFEVYGDGKLLYTSP
FT                   TMKNDSFPEAFNIDISGVKVLKIYYPDSNGNAKLATIYDGKLNPKEADKSSDSSEDNEE
FT                   "
FT   CDS             556885..557604
FT                   /transl_table=11
FT                   /locus_tag="RUM_05130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16737"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAU2"
FT                   /protein_id="CBL16737.1"
FT                   /translation="MFCMRCGNENPDDAVFCRKCGYTMQSVGQQITPPVPEPEPAAHRY
FT                   ASADQATLYGYPIKGIIALMLLVAAFLGLMQPGLSAQLHYVKLEFDAREYNLPHVIQMF
FT                   VSEEEIRPTAWSIENEDEDEEQILHFKDEKAIHTCFVFFCISEILSAILLIVGLIVGLV
FT                   SHRYSGAAVAACACVVIMFLLAAYLTGKSPIMTTGSSGLVYLRFTRGKGIAISLICSVA
FT                   ATVVGLIGNHEHKTSET"
FT   CDS             complement(557932..559260)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05150"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16738"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAU3"
FT                   /protein_id="CBL16738.1"
FT                   /translation="MAAYIFSILSCVADQLTVLFFLREYGTFRGSFLKANVIIDTVLIL
FT                   EHTILVFGMGLPQGGPIVSTFDTLFLLGSWLWLCKESVKKRLILLGILIVTALIGELSI
FT                   LAVQCGLFGLSMANMNGYTVYTLVGKILTLDEMFLIYVGITIVLRLKKDRYRIRYLCSI
FT                   LFTIAAHFGFQICFTYLDWNHLTTAKLLCLQAFQLLLLILVIQQYFYFLRQHDFRIKEA
FT                   ELQGLQLEMQNTYQYYLLATEQFEEASRIRHDYNNQIQSIQCMLDNQQVEEARALLHSC
FT                   GGSTRGAKLISFCSTPIINVVLTIKTNAARNLGIETQCILQDSQRLELNNYELCGLFSN
FT                   LLDNAIEACQQSGSSYRYIEIKGKALGQTYMLRMENSCKPQSDSAKAPQKTTKQEPGHG
FT                   YGLKILQSIAQSHGGRFQLDILQEGCAVSTLSLPLHASATVRA"
FT   CDS             complement(559314..560033)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05160"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16739"
FT                   /db_xref="GOA:D4LAU4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAU4"
FT                   /protein_id="CBL16739.1"
FT                   /translation="MYLIYDDDPAHCAQLRTLLLSDPNNTEQDIRTASTEADAIRQLSG
FT                   DTAVLFQDIRLEHDENGIRFAEYIKQHYPLCLIVFITAYTQYWENVFSVMPSGFITKPF
FT                   TPEKVARVVLNINHHLPILRPMIHIREADNKLVSLPAADVVFIENENRRTQFYDDYYAG
FT                   SKPAPLFSSHYSIAEIEQFLPSCFIRCHVSYYINMNHIRELRRYEMILHNGKSILISQR
FT                   RYKDVENAFFRFTSDKL"
FT   CDS             complement(560248..560778)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05170"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /function="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16740"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAU5"
FT                   /protein_id="CBL16740.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTMRIREGDPLEIYTSNDGEVI
FT                   FKKYSAINEIGENAAQVAEIMHKLAGCPTVVFDRDHVVAVAGVPKKEFHERRVSPALED
FT                   LMENRRSYAGKPEQTFFSVEGIDKSAIACQPIFTSGDVTGAVAFLGDGKSPSELQVSLI
FT                   TAAAQFLGKQIEA"
FT   CDS             complement(560975..564226)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16741"
FT                   /db_xref="GOA:D4LAU6"
FT                   /db_xref="InterPro:IPR027050"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAU6"
FT                   /protein_id="CBL16741.1"
FT                   /translation="MRPLTLTMSAFGPYAGKTTLPLEQLGERGLYLITGDTGAGKTTLF
FT                   DAIAFALYGEASGQNRSSSMLRSKYADPATPTYVELTFAYGGKRYTIRRNPAYDRPKTR
FT                   GAGTTPQSAEAELTMPDGRVLSRVKEVNQAVQELLGIDRNQFSQIAMLAQGDFYRMLLA
FT                   TTDDRVQIFRKLFRTEPYRRLQDRLKERTGELERTRSSIRSAISQYTAGIRLMPEDPEQ
FT                   ETLTGLLEGTLPESELLPLLERLLERDAQGLEQAEQTCARLEEQLTVLHQSLDRAKQAA
FT                   RLREAYRQAQEQLKAQKQQRDACKATLDASLSDQTRQKELTVEITRIREQLPRYAEKEQ
FT                   LRTTLAQMKQDATHSQQEIKQTQERIAQGRSRYEKHVLELKSLANAGENREKLAALIKE
FT                   QQKKDQHLAVLSEKLTGYDKLCRQLAAAQQAYQQAEHAAGQQRQTLEQLTEQLQTLGDA
FT                   PARQERLLAQKQAAEQRTEQLATLAQRLDAYRIQSGELEQAQRAYAAAAETMQQEKDAY
FT                   DRMQQAFLDAQAGILAASLQDGAPCPVCGAASHPHPAQPAKNAPTEAELKAARNRSDKA
FT                   QQTCTQASRHAGTLRGKAESLAQSIREQCSALGLERDLPALPGHLQQEQSLLKDKQAGL
FT                   DAELTETEQHIALRRQLETEQPKTEQILRQMEDALAGKRDARSSLDAQVQAAAEQLLEH
FT                   TRTLELDCTLDMLPKKLNLMQKASSISADSLSGRLQREEQNVARRQELEQSNPRDEAQL
FT                   RQMESDYADAREQLARLLEQASTAAKQLEEYSQLLPFADRKEAQAQITALEGEQSRLEQ
FT                   LAVQRQQAYDAAREAHATAQSRCRTLEEQLAQYQQEDVPGLEAQLRQLEQDKQQAGQEK
FT                   THRISRLGLNRSARDGILQQQARLEKTMQELRMVSGLSNTAAGKLSGKERVALETFVQM
FT                   HYFDRIIRRANRRFLVMSSGQYELKRQQSATDLRSQSGLELCVVDHYNGTERSVRTLSG
FT                   GESFMASLSLALGLSDEIQSSAGGIRLDTMFVDEGFGSLDEETLQQAMRALQSLTESNR
FT                   LVGIISHVGALKNQIDKQILVTKQPAGGSHAQVQV"
FT   CDS             complement(564223..565359)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05190"
FT                   /product="exonuclease SbcD"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16742"
FT                   /db_xref="GOA:D4LAU7"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAU7"
FT                   /protein_id="CBL16742.1"
FT                   /translation="MKLMHLSDLHLGKRVNGFSMLEEQRFILEQILQLVQAEQPQGVLL
FT                   AGDLFDKPTPPAEAVSLLDDFLAGLSHLGCTIFAISGNHDSPERIAYGGRLLRHSGVHM
FT                   SPVYGGSISPITLEDDLGPVDFYLLPFLKPAYLRSVMPETEIHSCQEAVEKALEGLPVD
FT                   PRRRNVLVAHQFVAGAQVLEQEELLIGGSDGVDAALFRDFDYVALGHLHGPQSVGRDTL
FT                   RYCGTPLKYSFAEASHHKSVTLVELDAKGQVTLNLLPLTPQHDLREIRGTYDQVMDRSA
FT                   YTQQNRFDYLHITLTDEEDVPDAIGRLRTVYPNLMKLDYDNRRTRETGELLPEDTLEHQ
FT                   SPLELFGDFYRMQNNKELDDAQLAYLNGLTKEIWEEEV"
FT   CDS             complement(565489..566094)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05200"
FT                   /product="Cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16743"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAU8"
FT                   /protein_id="CBL16743.1"
FT                   /translation="MTNIITISREFGSGGHEIGEHVAQQLGWKFYDRHIVEQVAKESGL
FT                   SEKFIEESGEYATSRSSLLFNLSIAGAAMGSGSLSLYDEIYVEQCKLIKKLAAESPCVI
FT                   VGRCADYVLRERQDCMHIFIWADVKARIERISGQVKEGKSPEKMLKERDNRRRVYYRNY
FT                   TGQEWGKVQNYQLALCSSALGLETCAELIVQLVKQQNG"
FT   CDS             complement(566140..567534)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05210"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16744"
FT                   /db_xref="GOA:D4LAU9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAU9"
FT                   /protein_id="CBL16744.1"
FT                   /translation="MKQAVSTEQNKMGTVPVRRLLLGMGAPMIVSMALQALYNIVDSYF
FT                   VSCMPDTEQIRNMGDLAVNALTLAFPVQMLMVAISVGTGVGINALLSKSLGAGDRQQAS
FT                   AIAGNSIFLSLCTFGIYLLFGLVGVPAYIHTQTRDPLATELAVSYLRICTIGSLGVTMY
FT                   LTYEKLLQATGRTMQTTIAQISGALVNIVLDPILIFGWLGCPALGVAGAAYATVIGQFV
FT                   SCGLDALFFYRHARTELDTGLRFLRPRLRVIREIYQVGIPAILMQALMSFMTYGVNIIL
FT                   RDVSAAAVTAYGMYYKIQQFVCFAAFGMNNAMIPVIGFNYGMGSKQRIRQGIRYGQLYA
FT                   CIIMLVGAVILQVFARPLVGIFAVSEETRFLCVLAIRIISLGYLCMGANIGYQGIFQAL
FT                   GHGVQSLLLSLVRLIIVALPLAWGLTRLDNASELVWIAFPAAEACALLLGLLMMRRIRR
FT                   QVLDRL"
FT   CDS             567811..568371
FT                   /transl_table=11
FT                   /locus_tag="RUM_05220"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16745"
FT                   /db_xref="GOA:D4LAV0"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAV0"
FT                   /protein_id="CBL16745.1"
FT                   /translation="MSQTAAPAKGFALRDLAFIGLFAVLIAVCSWITIPGAVPFTLQTF
FT                   GVFCTLGMLGGRRGTCAILVYILLGIVGIPVFSGFTGGIGQLLGMTGGYILGFLLMGLL
FT                   YWLMTRLTGSSLPVMILAMVLGLAVCYTFGTIWFLQVYTRQKGAITLMAALWSCVFPFL
FT                   IPDGIKLALALLLTKRLTRQFRI"
FT   CDS             570350..571060
FT                   /transl_table=11
FT                   /locus_tag="RUM_05240"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16746"
FT                   /db_xref="GOA:D4LAV1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAV1"
FT                   /protein_id="CBL16746.1"
FT                   /translation="MGYSIYIADDEKNIRDLIKSFLESDGYRVWAFETGDALMGAFQAA
FT                   PADLVILDIMMPGTDGLTICQQLRAKTDVPIIMLTAKDSEYDYVQGITIGSDDYLTKPF
FT                   RPTTLLMRVRSLLRRMEMNSRRPVQPEEPDDLVVGDLTFSAEANTISCNGKGIGFTQTE
FT                   LRMLSYMMQKPGKAYARDKLLETIWGYETEVETRVTDETLRRIRRKLSLAGSSVCVQTI
FT                   WGYGYKLEVSEPVK"
FT   CDS             571057..572283
FT                   /transl_table=11
FT                   /locus_tag="RUM_05250"
FT                   /product="His Kinase A (phosphoacceptor) domain./Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16747"
FT                   /db_xref="GOA:D4LAV2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAV2"
FT                   /protein_id="CBL16747.1"
FT                   /translation="MKHIKVRILATIWVSIFLLFVPFYIILNLTLPVHFEKEAKAALTY
FT                   EMEYMSSMQKQESEDALALDYVGIFFSGDICFIDLTQDPAENSAADNSYGKYNVQSAEH
FT                   DVLSYYDSQGLPFGQIRTLKTDNGYYVMVLYEDVFSWDGEKVPTIMYLNIQPIVQYTKR
FT                   LNWLLDAIFLCVAAIMSVIGFRLGGQIEESQENQRRFFQNSSHELKTPLMAIQGYAEGI
FT                   QTGVVDPIHSAEVIMQESDRLTRMVEEILYISKIDVHQLVLHIAVLDVRELLYDCLRSA
FT                   EPIQNKKQCSVVTDFPDAPVRVRCDEDQLTRAFMNVLINGMRHCDKTVWLSCKADRHII
FT                   TITIRDDGGGMDPQDLPHVFDRFYSGKKGNTGIGLALASDIIRLHKGSITAHNDKSGAV
FT                   FEIRLPVAP"
FT   CDS             572381..573901
FT                   /transl_table=11
FT                   /locus_tag="RUM_05260"
FT                   /product="Non-ribosomal peptide synthetase modules and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16748"
FT                   /db_xref="GOA:D4LAV3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAV3"
FT                   /protein_id="CBL16748.1"
FT                   /translation="MICNVLDYLERSAARQPEKDAVVDENKRYTYEQLRLCSARIGTAL
FT                   SGIIAPGEPVGVYMEKCADVLPVFFGTVYAGGFYSVFNNELPASRLTQIASVLAPRVMV
FT                   TTGALKQEAAGIFSGMELLTFEELMQTEPDFDRLAQIRRGRIDTDPLYVNFTSGSTGTP
FT                   KGIVVGHRSVLDFIDCFTETFGITESDVIANQAPFDFDVSVKDIYSAMCTGATLVVVPR
FT                   RLFSAPVELIDFLCAHRITTMIWAVSALCLITTFHALDYKTPDTIRKILFSGEVMPLKA
FT                   LKNFQSHLPEVTYVNLYGPTEITCNCTYHILDKERDYSAGIPIGKAFPNEDVFLLDGED
FT                   RRITAPETVGELCVRGTALALGYYGAPEQNAVHFVPNPLNPHYPETIYRTGDLARYDAN
FT                   GELVFSGRKDFQIKYMGHRIELEEIEREMAAIDGVERCCCIFDEKKSRLKGFYIGSVEK
FT                   DALHAEMKEKLPAFMVPGILRRVEDMPLTKNGKIDRKKLAELVGGKTN"
FT   CDS             575125..575355
FT                   /transl_table=11
FT                   /locus_tag="RUM_05280"
FT                   /product="Phosphopantetheine attachment site."
FT                   /EC_number="6.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16749"
FT                   /db_xref="GOA:D4LAV4"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAV4"
FT                   /protein_id="CBL16749.1"
FT                   /translation="MDKLIEILEDIQPDIDYNTCEDLIDGHHLDSLSIISLIAELEDEF
FT                   DITVPAVEIIPANFNSAKAMWSMIQRLQEED"
FT   CDS             575357..576991
FT                   /transl_table=11
FT                   /locus_tag="RUM_05290"
FT                   /product="Predicted membrane protein involved in D-alanine
FT                   export"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16750"
FT                   /db_xref="GOA:D4LAV5"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAV5"
FT                   /protein_id="CBL16750.1"
FT                   /translation="MSLSSLLMGGSYVGMTSFFTVAFLLVFLPTCIILYTLMPQKAKKY
FT                   FLLAASVGFYWLISGTLVVYLFLTTISIHYFGIWLDRIHRQRDEAVKAAEKPERKAIKH
FT                   AYLLRSRWVLLFAAALHIGTLLTLKYAPFFTRNVNSLLGHMGLSLQLEIPKYLLPIGIS
FT                   FFTMQAVSYMFDVYRETIKSDENLFRLGLFMSFFPQIVEGPICRYGQTAEQLWNVKGIT
FT                   FSNLTLGIQRILFGMMKKMVVADRLNPLIETVFSGYKDFQGGVIAIAAVCYTVQLYMDF
FT                   SGSMDAVMGTAQIFGITMPENFARPFFSKTISEFWKRWHITLGAWFKDYIFYPVTMSKP
FT                   MKNLTSAARKKIGNHFGPLLAGAVALFCVWFSNGLWHGAAWSYIFYGMYHFTLILTGNI
FT                   IAPAVQWTNKKLHINPEWFGYRLFQILRSCILVVIGELFFRAEGLRNGIAMFKGMVTDF
FT                   RFSTLNEDLLDTLGVDIQDLIIVGVTLLIVFVISILNEKGIQVRASLQKRNVVVRWAVL
FT                   YALILYIIVFGAYGTGYIPVDPIYANF"
FT   CDS             577003..578007
FT                   /transl_table=11
FT                   /locus_tag="RUM_05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16751"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAV6"
FT                   /protein_id="CBL16751.1"
FT                   /translation="MRTVIKNTLCSLLFLGILIGMLALLSVLFRPKENTKEAGFQDPRA
FT                   NAVLSEPKNTIDVVFLGDSETYNTFIPLQIWRDYGYTSFVCGTPAQSLCYTEEFLVKAF
FT                   AQQSPQIVFLETDAIFKIFTQSQVISQDVENTLPVFRYHDRWKTLQASDWTFQVDYSHR
FT                   ENNKGYMYDERVRPSTRLNYMKKTDAKEEIPGKSRQAVENIYEYCRKNNAKLVLISTPS
FT                   TAYWNYKRHNSVAELAESLGVEYVDMNLINDQVGIEWSTDTRDRGMHMNIYGARKCSAF
FT                   LGAYLAKTEQFQDKRKDASYADWFDALEAFNESTDNALDRPSPEPEDNTKKAD"
FT   CDS             578110..580542
FT                   /transl_table=11
FT                   /locus_tag="RUM_05310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16752"
FT                   /db_xref="GOA:D4LAV7"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAV7"
FT                   /protein_id="CBL16752.1"
FT                   /translation="MKFKRILAAGMAVLCSVLPLCPAASAQGDGLVDSGIDYTELVGTV
FT                   RTPGAGYTSTLAFRCKPGETKAYNPTGDLTLLFVDIGGFSSGSNGTTDSDGNYTPGTDY
FT                   DLDGTFFKSMRTTLENCRQNGCMAALRFRYDANGVRDPEPATFEQMLRHIEQIRADGFL
FT                   EDYQDILCFVESGFVGCYGEQWGGKYCSIPDKAKLLELMLDVVPDPIPVTVRTPNIFAQ
FT                   WAGITEEELGTYVLEPGSRASRVGLYNDGYMGSNSDLGTFHDRERDLKWLRQQTLTSYY
FT                   GGEFSGNLDFAKQYDTYLPEHAVPEMYYSHLSYINANIYQLYKDYTFGAAYDVEGVDNS
FT                   AYYGQTVFQFMRDHLGYRFVLRDSDLSESVSQGDTLRLCMDVENTGFANPIPRQKAEIL
FT                   LEKDGQYLRTEVDADSRTWYSCTTVSPEFDLHLPAAMEPGRWNVYFKLSTGDNTLGQLE
FT                   YRSVQFANAHTWNEQLGANYLGSFSVTASEAGARSTDNGFYQTNAADPVTGSDGTLFTT
FT                   QGLVTVDGTLTSDTERRDALLCAEDAAGNRMYITNDDQYLYILVDLEQQAASPVYNLSF
FT                   RNASSGTSYWMYYQGSFVYFNGEGGVPLGCVQKHSGSTIEFRLPLGELMGLAPGVELTG
FT                   IDYTVQDQADSWKSAGSIRADSYIIQDDFNVYSGKQTVNLAKGDTLSVAAHTSGSDLSY
FT                   QWYKDGKLIPDATNAIYEILAESAQDCGIYAVQVTSASGVRTRLFDVCRVAAVLEQPLA
FT                   GDLNLDGAVTVADVVLLQKHLIRAATLTDQQAAAGDLNKDGVCNGFDLVLLRRILCV"
FT   CDS             580678..581793
FT                   /transl_table=11
FT                   /locus_tag="RUM_05320"
FT                   /product="transporter, YbiR family"
FT                   /function="transporter, YbiR family"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16753"
FT                   /db_xref="GOA:D4LAV8"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAV8"
FT                   /protein_id="CBL16753.1"
FT                   /translation="MKQILQFFRREAVLCIAGALAVGSAFAVPPSGAYLDYIDFRVLIL
FT                   LLCLMLTVAGIRQTGAFTALCQGLLRRVHSVRMVGLLLVLLCFFLSMLLTNDVTLVTLV
FT                   PFTLLLLEGIPRQDADRITIRLLVLETAAANLGSMLTPMGNPQNLYLYNRYGFSMGTFL
FT                   SAIAPYSVLSLALLAGSCLLFLPVQPIAPPRAQSRIQSPGRLGAYCLLFGVNLLTVLRI
FT                   LNPWILLGVICIALLLLDRSLFRKADYSLLLTFVFFFIFVGNMGNIPALSGALQRLLQG
FT                   RELLTAVLASQVISNVPAAILLSGLSEDGRALLIGTNLGGLGTLIASMASLITYKLYAA
FT                   TPGSQPKRYMGVFTLCNLAYLAALLLLYAFI"
FT   CDS             581803..582513
FT                   /transl_table=11
FT                   /locus_tag="RUM_05330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16754"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAV9"
FT                   /protein_id="CBL16754.1"
FT                   /translation="MRHENGEWMLQGTEASDPSRIRDPEGLIAYVEQAGFLPLFQNEIP
FT                   GFSVEEHTLAADWWTGDPERDPWEWRSIAARSHRLAYGKFFSGKAGFLSLEWLPCFVNH
FT                   RRDGYDFDSLYEAGKAGHREHQIMELFTEGASLFSWQIRQLLDTGKSPEGALTRLQMQL
FT                   YLVTEDFQQRLSKQGVPYGMSAARYCTPEKLWGYEAVTAAYGESPADSYDRIRQQILKR
FT                   YPDASDRAIRRICP"
FT   CDS             complement(582571..582981)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05340"
FT                   /product="Predicted acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16755"
FT                   /db_xref="GOA:D4LAW0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAW0"
FT                   /protein_id="CBL16755.1"
FT                   /translation="MEFTTYHSLPDAARQIREAVFVREQGFQLEFDKTDETAVHIVAWD
FT                   GTQPAGTCRVYPAEGCFHIGRVAVLPQYRGTGLGRELMRRAEAYIRCTGGTAAELSGQV
FT                   QASGFYKKLGYTPVGEVYPDEGCPHIRMQKQL"
FT   CDS             complement(582994..583527)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05350"
FT                   /product="Fructose-2,6-bisphosphatase"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16756"
FT                   /db_xref="GOA:D4LAW1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAW1"
FT                   /protein_id="CBL16756.1"
FT                   /translation="MGTVYFTRHGQTVWNVENKICGATDIPLTQLGHQQARALGERLLA
FT                   EQCPIDRILYSPLIRAAETARHIAEVTGIPTQPEPRLTEQNFGIYESTPRDGMEFRTAK
FT                   AQFVNSFGTGESMLRVAQRIYNLLDELKAGRETCLLVAHNGIARVVRSYFVDMTNAEYA
FT                   AYGMHNCEIVSYSF"
FT   CDS             583650..583955
FT                   /transl_table=11
FT                   /locus_tag="RUM_05360"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16757"
FT                   /db_xref="GOA:D4LAW2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAW2"
FT                   /protein_id="CBL16757.1"
FT                   /translation="MAHILIIEDDSSINSMLRDALGNSGYTYAFSGTEGLLLLEREQFD
FT                   LILLDLMLPGMRGDEVLRRGRQLTQAPFLVLSAVDSLESKVELLTPGGGRLHHQAL"
FT   CDS             complement(584328..585668)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05380"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16758"
FT                   /db_xref="GOA:D4LAW3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAW3"
FT                   /protein_id="CBL16758.1"
FT                   /translation="MKTPIQLSDHFTYRRLFRFTLPSIASMIFASVYGIVDGYFVSNYV
FT                   GKIPFAGLNIIMPFIMMLGAVGNMIGLGGSALIGKTLGEGDREKANSLFSFFTYFMGAA
FT                   GVLLAIIGNVFLPRIAVLLGAEGAVLDNAILYGRICLCGIPFLTLQYTLQGFLITAERP
FT                   QVGFWITVAAGVTNMVLDALFITVFHWGLAGAAIATVIGQLIGAGVPIALFFSARNNWL
FT                   LKLGKAKFDGHALLKACTNGSSEFLSNVSMSLVGMLYNAQLLKYAGNDGVVAYGVIMYV
FT                   NMIFIAVFFGFSVGTSPVFSFNYGADNGTELKSLFRKCASIILGSSVIMLLAAEVLARP
FT                   LAMIFTSYDQSLLDMTTHAFAIYSVSFLFCGIGIFGSGLFTAMNNGLISAILSFVRTVI
FT                   LQITFIFVLPRLWDLDGIWWSAVLAEGLAAALSIVCILAYRKKYKYM"
FT   CDS             complement(585665..586120)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16759"
FT                   /db_xref="GOA:D4LAW4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAW4"
FT                   /protein_id="CBL16759.1"
FT                   /translation="MDIRTYIKQLDQLMKEYDAIYHTAAVAYGLSDTAMWILYMVSDAT
FT                   ETYTQQDLCRQCCFPKQTINTAINNLIRNGYLTLETLSGTRNSKRIILTDAGQALMQTT
FT                   IDPLKQAEDAAYSKFSDAEQQCYLELTRRLNTNLREELQAQLKRRTL"
FT   gap             586216..586608
FT                   /estimated_length=393
FT   CDS             586699..587613
FT                   /transl_table=11
FT                   /locus_tag="RUM_05400"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16760"
FT                   /db_xref="GOA:D4LAW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAW5"
FT                   /protein_id="CBL16760.1"
FT                   /translation="MDYIIETKDLTKRYGQHLAANAVSLHVKRGEIYGFIGRNGAGKTT
FT                   CMKMICGLTCPTSGSIQLFGKSAQESGKLRSRIGSLIEEPGLYYEMTAYENLKCKCLMT
FT                   GIDQKGYIDGILELVGLSYARNRKAKAFSLGMRQRLGIAMTLVGNPDILVLDEPINGLD
FT                   PQGIAEMRQLFVRLKEERHLAIMISSHILEELSKLADTFGIIHDGKLLQEISHAQLMDK
FT                   CSNYVEIITPQPEQVSVSLEKMGYTRFKVMDKETVQVFERLDETAAMNRQLILDGCTIV
FT                   QSRIVATELEDYYFKITGGNQNA"
FT   CDS             587606..588409
FT                   /transl_table=11
FT                   /locus_tag="RUM_05410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16761"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAW6"
FT                   /protein_id="CBL16761.1"
FT                   /translation="MLNLTKLYLYRMLRTKVAWVCMIILVGLTAFTLSVNYMIDKMTDS
FT                   MAMDGDTSVVMEEEQPETETSILDEYLGVVQNGFPMMIFGIFTAIFYNSDEKHGYVKNI
FT                   VTQYNNRSSVLLPRILSLGIYVLAVSLVNFLVVAILFKCFYPDTGLGLQGTTLGYMGMH
FT                   FLLLLTFLFIVQFITAFARGTALAVTYSVCASMNMAALAAMPLNFLARKFLHVQNPNVT
FT                   KYFLDTYLFSIRSAEHTWSLLVLFVCYAGVAAALACLLLNKRDMR"
FT   CDS             complement(588527..589177)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05420"
FT                   /product="VWA domain containing CoxE-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16762"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAW7"
FT                   /protein_id="CBL16762.1"
FT                   /translation="MANNTTELVFILDRSGSMAGLESDTIGGFNAMLDKQKQEQGEGFV
FT                   TTVLFDDRCETLHDRRKLSEMAHITDRDYTVRGCTALLDAMGSTITHIRSIHQYIRPED
FT                   VPAHTVFVITTDGMENASHSYTLEQVRGMIQQQKEAGWEFLFLGANIDALQTAASMGIR
FT                   EDHAAQYMCDAAGTQLNFDAVSCAVSSVRANCSVGREWKKRIEEDFRTRSKKH"
FT   CDS             complement(589269..590288)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05430"
FT                   /product="Predicted phosphatase homologous to the
FT                   C-terminal domain of histone macroH2A1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16763"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAW8"
FT                   /protein_id="CBL16763.1"
FT                   /translation="MPLQIIRQDITQMKTDAIVNAANSTLLGGRGVDGCIHRAAGPELL
FT                   NACKALGGCPTGEARITPGFRLSCKYIIHTVGPLWQGGHAGEPALLKSCYRNALTLALE
FT                   HGCRSIAFPLISAGAYGYPKRQALQIAEDTILTFLEQHEMAVYLVLLDPGAVVLNEPYA
FT                   TELPAFVRQMLRKGQSPSRTHGFPLRRRKAAAVPTLESTLEEDACPQAAFCIPSSLNER
FT                   LAQIDESFSQMLLRKIDQLGMTDSACYKRANIDRKLFSKIRSDMHYKPSKSTAVAFAIA
FT                   LQLDGQETGELLRKAGFALSNSSKFDIIIQYFIAKGNYNIFEINEALFAFDQPLLGSR"
FT   CDS             590785..591066
FT                   /transl_table=11
FT                   /locus_tag="RUM_05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16764"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAW9"
FT                   /protein_id="CBL16764.1"
FT                   /translation="MTDKEFKRLKRSELIEIIYEYQKREQALQSRVEALQAQLDEKNLK
FT                   IQQAGSIAEATAALTGIFEAAQKTADAYLEHIRAANPPPEPEKKADTT"
FT   CDS             591063..591638
FT                   /transl_table=11
FT                   /locus_tag="RUM_05450"
FT                   /product="signal peptidase I, bacterial type"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16765"
FT                   /db_xref="GOA:D4LAX0"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAX0"
FT                   /protein_id="CBL16765.1"
FT                   /translation="MSRRNRQQVSLPSPEQVSRAYQQDQYRKRYKRAFISTLSVLAVIA
FT                   AVAVLVSTLFLPVIQVSGNSMEPTLSDGDVLVLLKSKSYERSQLCCISWQNKMLLKRVI
FT                   GLPGDVVSIDTEGNVTVNGVLLDEPYVSDKTLGECDVTFPCQVPEGKVFVLGDHRSTSI
FT                   DSRSSEIGCVDQDQIVGFVLFQVWPIGG"
FT   CDS             591718..595083
FT                   /transl_table=11
FT                   /locus_tag="RUM_05460"
FT                   /product="Carbohydrate binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16766"
FT                   /db_xref="GOA:D4LAX1"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008970"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAX1"
FT                   /protein_id="CBL16766.1"
FT                   /translation="MTDSYVTDIRARHKRNIRLAWLLLILGLVVACSVAWTLRGVGITM
FT                   ANETVCGMEEHQHSAACYADTADGSQLICTLPEHIHTVACTGIDTANNGPPVVEITTPT
FT                   EDPTEPATEPERETVQLPNYLADASASYEKNVIYVKTALGERSKDTVHEYLANLGLPGT
FT                   NDGKYILNSEESPYILQVGDTVELCIYTDSSNTDGFWSSSSPDGVLVAGTATTTTLADG
FT                   TKKIEKTYSTAKAGTGVIYFGNQSSFYVSVPVPKEELKDFHYDHADIEITDGGYYEIKR
FT                   TVTDQNGNQVTTRQIFDSYISGVNHCYIYNAAGSLIKTYESTDYQANGKPGETQYELTS
FT                   KYKCMEKEEKWFKRSEVDHAQFDVQLLLKPRKQIVTVTKDGVQSSQTETDISDSTGESD
FT                   VTILSAVFNMNHRSVVDANNKCPDHSGLDFNLMANVNQIITVEPASVEPTAHKQLTNGS
FT                   IGTNQFRFELLDKDGKLIDRQYCDTTGKVTFESQYFLMPGTYTYTIRESIPSEAVQIDG
FT                   KPYSRGIFYDSHTEKVTVTVTADAQGNLSASMAYAGGSAPVFHNTAVTERYMPISVQKV
FT                   WSDSSTVNHKADAIGFRIWRTESGQPDALVSIDGKSKFYLNDASGWKWSYTKLPVQYAG
FT                   RTYSYRVEEVDIPDGYIAGYTSGQNGGTLEYTITNTSKDAITLSIQKQWLAPDGTPMQG
FT                   TPTAQSVSASLQRQCKEVEIPVTIQVVSPAGALLEQYKQPAYVGSSFTFTLGVTEGTAE
FT                   NVSVVSAEKCSAAYANGVFTVQDIQVGARVQVRCDNVMDSTKLLLHHTFEDTQEDWTCT
FT                   GDAKPGSAYSTNYAATGSGYHALKIYNRTKAWMGASFTLDSSVIKPGQTYSFSAYLNRA
FT                   AVYTESDNTTTHNLGADHTAPLNLTLYYEDSAGVPNYLGIAAVAAASSGSWIHLRNASL
FT                   TIPADCTVMKLQVDANGEEGTDKFSDLFLDEVIIAPAGMDISVEQNTGRVLLNNPEFYS
FT                   FTVTGKTIPADVQQNADNWHLDAWNKQIEITAAEGWIKTLSGAELGQVSNRIYQYFVEE
FT                   DPMTGFTPSYSDMYVSSNTAQTPIIIKNQSIAYTLPATGGVGLVPFLGGGSLLILASGL
FT                   YSYKLIRSKRRSSA"
FT   CDS             595132..596772
FT                   /transl_table=11
FT                   /locus_tag="RUM_05470"
FT                   /product="Cna protein B-type domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16767"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAX2"
FT                   /protein_id="CBL16767.1"
FT                   /translation="MKATKRIFSVFLTCVLAFTMAFAMGLTASAADYTITINKPAGDID
FT                   RTYEAYQIFQGNLDGNTLSDIEWGTGIDGAAFLTELKKNASFTSCTDAKTVAEKLAAFT
FT                   NDSDEAVAFAKLAGKFLTTATATSSSGKITVPAGYYLLKDVTTVTDDALSLNILKVVKD
FT                   VTVNPKADHPTVDKKIGTDISTGVAANEATIGDKVPFVIASKVPQMQGYTKYFFVLNDS
FT                   MTAGLTYNKDVAIKIGTTTLAADAYDVTYDDTANTMKIVIKDFIQYKSEAGKDIVVTYS
FT                   ATLNEKADLTQAGNKNTVKLTYSNNPNVDYKGDNEPDTTDPVGVTPEHVTVTYSTKLQL
FT                   TKVDGADHNVKLEGVEFQITGTSIKTAVSKGEYFKQDAAGTYYQLKDGTFTETDPTAET
FT                   ESKYVSTSVKYAKVTDTTEQTKMQKVTASGTTDANGLITFEGLGAGTYYITELKTLGGY
FT                   NLLTAPITVTITATPSETGCGWTVSSNATFEDDMVKLTVENNKGSVLPITGGIGTTIFY
FT                   VIGGLLVCGAAVMAITKKKLSVEDKADQN"
FT   CDS             596842..597705
FT                   /transl_table=11
FT                   /locus_tag="RUM_05480"
FT                   /product="LPXTG-site transpeptidase (sortase) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16768"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAX3"
FT                   /protein_id="CBL16768.1"
FT                   /translation="MKRYVSTAVIAAAFFVGISLLLYPVISEYINAKHQSKAIASYDEI
FT                   ASHMSEADYDEIFAEARAYNDALARTEGAFYQPERVSGYLEALDITGTGIMGYVTIDKI
FT                   GVELPVYHTVETDVLQSAVGHLPGTSLPIGGEGTHAVLSGHRGLPSARLFTDLDKLEPG
FT                   DLFTITVLNRVVMYRVDQVKIVDPTDVTDLQLIPGKDYCTLFTCTPYGINSHRLLVRGV
FT                   RIETPEDAAPRYIANEAYRIDPLIVTPAVAAPMLLGIAVVMLIKSRRSALKQKLRKEGL
FT                   IVHEKQ"
FT   CDS             597692..598570
FT                   /transl_table=11
FT                   /locus_tag="RUM_05490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16769"
FT                   /db_xref="InterPro:IPR008970"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAX4"
FT                   /protein_id="CBL16769.1"
FT                   /translation="MKSSKYCWTAALLLVLCMLLPWCGVAAADVSDKEYGSFSATFNAG
FT                   AAPLRSAEITLYRVADVEFNQEQTLYHYTDAYAACGVDLDTLGQTDAAAQMLQFISDKG
FT                   LTGMTGTTDDQGRVAFSQVPFGLYLVAQTNEVPYFSKSAPFFSCIPYLDGGQICYDVDA
FT                   TPKVSVEILIDLTVKKVWNDDGTGRPEQIQVMLSRGGQLVDTVTLSEENQWSHMWSAVP
FT                   QSDDWTVREVEVPNYTPSYRREGNTFIVENTPKLVQTGQLKWPVPVLACLGGALLLTGV
FT                   ALGRKKQHAGA"
FT   CDS             598557..599156
FT                   /transl_table=11
FT                   /locus_tag="RUM_05500"
FT                   /product="LPXTG-site transpeptidase (sortase) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16770"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAX5"
FT                   /protein_id="CBL16770.1"
FT                   /translation="MQGRKLLSRLCIVLGVLCIGGAAGLGIRNQQEDARAQQQAEQVLA
FT                   QLQQDASGSTHTAPVILPEETVPSMRTVSINGYDYIGYLTFPTLDTELPVMDHWSKAGL
FT                   KIAPGRYYGSVYTGDLVIAGHNYAKGFGKLKALRQGDPVLFTDMDQVTYRYQVDQIEIL
FT                   EPGAVADMIQSPWELSLYTCTYNGQLRMTVRCHEIK"
FT   CDS             complement(599235..600941)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05510"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16771"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAX6"
FT                   /protein_id="CBL16771.1"
FT                   /translation="MAKSRMEFTKNQTEWIVLTLLALLLLLFQLITSRLTRYGGTFAIG
FT                   ETELEYGRLCSIFNVLQIFTGMLMVINTKRKGWICMSILSILNLIMVISTVFVQQQVNN
FT                   LPGVAMQALNLIICSTIYFYVRKCDINAARLDEVANTDELTGLPNRRSLLRHVNRRISK
FT                   GTPFAFVLLDLDNFKSINDTAGHEYGDEILQQIAQRWKEQVQNKNAFFARLGGDEFVLI
FT                   TDYNGDLGKLEQMLHEAINRAPSDKRTRFSVRDSSFFITASMGISLFPEHADNVSTLMS
FT                   YADIAMYQAKARGRQGLCMFRQEMDSALTDNLQIEQMLRDALQENRFFLAFQPQYHISD
FT                   HSLRGFETLVRMRDAKGNQVSPGRFIPVAEASALMIQLDQWIMGNALTCMQPVVAQHPD
FT                   IILSVNVSARNLLHGDFSTYVQNLLRSTGFPARNLELEVTESLFISSLEHASKILNRLR
FT                   DIGIRIALDDFGTGYASLSYLNRLPIDLLKIDKSFIDQINSDTNGNAFVKAIITMGHVL
FT                   GCEVISEGVESDSQLDVLKGYACDLLQGFLWGKPLSFEEAKQLAQKEPIPS"
FT   CDS             complement(601251..602576)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05520"
FT                   /product="Endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16772"
FT                   /db_xref="GOA:D4LAX7"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAX7"
FT                   /protein_id="CBL16772.1"
FT                   /translation="MLKKLWAYLSAAAVSVAMLGSMSANAAYVKANDYTRNLSVTDVTA
FT                   VQDYLTAKCDTVNSLADLNQDEVIDAMDLALHKRILLGNLELLEPPTQMRDLTASQLLD
FT                   EITIGWNLGNTLDATTTSWLPNPTPAQSETAWGCPMTTKAMIDKVKEGGFNTVRVPVSW
FT                   IDHTGSAPEYQIDEAWMNRVQEVVNYVIDNDMYCILNIHHENDWLIPTNAQKDSVNARL
FT                   DAIWTQIATRFGSYDEHLIFEGMNEPRLVGDPNEWNGGNQEARQVINSYNQTFVNTVRA
FT                   TGGNNAIRCLMVPTYAASCSSTTVNDFVLPTDTVANKLIVDIHSYSPYNFALNTSGTSS
FT                   FTQSDISQLQWTLQEIYNSFGAKGIPVIIGEFGALNKNNINGRVLWGENYLRIAKSYNI
FT                   RCIWWDNNAFDTSGENFGLLNRGTLTWQYPELLEAMMKGLNS"
FT   CDS             complement(602662..602757)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16773"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAX8"
FT                   /protein_id="CBL16773.1"
FT                   /translation="MQEICVRAFLCPDMIFRGSTAIYSGKTATST"
FT   CDS             complement(602774..604387)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05540"
FT                   /product="Carbohydrate binding module (family 6)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16774"
FT                   /db_xref="GOA:D4LAX9"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAX9"
FT                   /protein_id="CBL16774.1"
FT                   /translation="MNVSHKSHRRRAGLMALCMLATCGAMLPENSVQQTVSADSFGLYG
FT                   DLDGNGMVNAMDLQLLKSYVLGNITSFPAGDASFGDLTGDGQVNKADVQILQDYLMSRC
FT                   NGFIQQGTVYDNIYFAKHAVLELAATETTNAGSLTGTYVNVDNVQGSAVTWTVQAPVEG
FT                   NYRVDLRFANGSGAVRPMALQCSNGSDTWTLSFAATSGWTDWQTYSLVLKLNAGANTLR
FT                   VTSTQDAGGPNLDYLRLTRTDAEATAPDAVDPPVTEEVTLADMPAEYTTAMEWIWTNRI
FT                   QDEQSTARRNTIFDQIVGGNGSINYVIRWQSYKHITLEQRQKLEQLLEDAINGWTDYLV
FT                   GYEGWKYQHVDVKIVGWAVLDKSCLEDLQPDEIVYDNLLEPYDSSGDTSNGVETIPNLL
FT                   PSAPDELSRFYHFSNNIGFDYPGGLDKRFDMYLWATQGFPSIGGCGGDWGQRLSDDAYL
FT                   NIINSGFGIHVLEHELGHGFGLTDFYGGEGEKGGFPPGGFPGGENSLMMAGSASKITDF
FT                   DSWMLRYVWSKIKDESGRFS"
FT   CDS             complement(604591..605115)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16775"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAY0"
FT                   /protein_id="CBL16775.1"
FT                   /translation="MLCRNCGTDNEPGAAFCHGCGAPMQQMPPMQHCPGCGQEIPSGLA
FT                   FCPNCGMPQGQRMPNVNEQAPLRQPPLPPPMGQIPPMQQAPPPGMYNPWQQPILPESNG
FT                   KAVAGMVLGILSLMAWILPLVGYPISITGLVLSIKGKQETRGGIAKAGFVMSIIGLSLT
FT                   ACSSLLGILLR"
FT   CDS             605274..605582
FT                   /transl_table=11
FT                   /locus_tag="RUM_05560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16776"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAY1"
FT                   /protein_id="CBL16776.1"
FT                   /translation="MNATAIIGIVILVLFVGSFIAYGVVLYLGREHKQTVLVKSKYTTK
FT                   NRRQKHGGTVVHYTVVCKCGAFNRKFSCSHRVYEHMREGQSYLAKTKMGEILSLHNQ"
FT   CDS             complement(605680..606501)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16777"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAY2"
FT                   /protein_id="CBL16777.1"
FT                   /translation="MKFTKFAAALLACTFVGAAFVGCGSDSSEAPATTEAATTQAPATT
FT                   VAADQAATPAATAAAPVEFEKAVVAESGDAILAMVDEQWYVQYWGKDTDLLTYDAGVEK
FT                   ITGDGDYTVSVNAGTKGCLYDITGDANGEYTPAGISFAAVKVFDGTTLFPDMSIDITSI
FT                   KVDGKEITMTAKNYTSSDDGKEMRANICNTFVNSLPEDAHNADGVIAADNKDYAPVIID
FT                   TKDFKSWTTVEVNFTVSGTGKTKEDAGTADDSSKAEDASKADTSADSSKAE"
FT   CDS             complement(606827..608461)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05580"
FT                   /product="Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16778"
FT                   /db_xref="GOA:D4LAY3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAY3"
FT                   /protein_id="CBL16778.1"
FT                   /translation="MTITDILERNAILYGKDTALVEINPDIQEVHRVTWKEYELIEPAP
FT                   VSYYRREITWSVFNEKANRFANLLLSRGVKKGDKVAILLMNCLEWLPIYFGILKTGALA
FT                   VPLNFRYASDEIKYCVDLAEVDILVFGPEFIGRVEEIAPEISKKRLLFYVGENCPSFAE
FT                   HYDRLVANCSSASPDLPLDLTDDAAIYFSSGTTGFPKAILHNHESLLHACKVEREHHGQ
FT                   TRDDVFLCIPPLYHTGAKMHWFGSFLVGGKAVLLKGVKPKCILEAISQEQCTIVWLLVP
FT                   WAQDILDALDRGELKLEDYKLDQWRLMHIGAQPVPPSLIARWKKYFPNHQYDTNYGLSE
FT                   SIGPGCVHLGVGNIDKVGAIGKAGFGWEVKIVDDKGNTVPQGTVGELAVKGPGVMTCYY
FT                   NDPKATDEVLRDGWLYTGDMAQEDADGFIFLVDRKKDVIISGGENLYPVQIEDFLRSND
FT                   NIKDVAVIGLPDQRLGEIAAAIVELKPDHPCTEAEIMEFCNQLPRYKRPHKIIFAQVPR
FT                   NPTGKIEKPRLREMYGGASLVAKQNHS"
FT   CDS             608741..609814
FT                   /transl_table=11
FT                   /locus_tag="RUM_05590"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16779"
FT                   /db_xref="GOA:D4LAY4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAY4"
FT                   /protein_id="CBL16779.1"
FT                   /translation="MKYGVKMSDIAKEFSVSVVTVSNALGDRGGVSPELCAAIKAKAVE
FT                   LGYRPSVARRPRQKQETGDKPARRFLTVGILTAERFCGDKGTFYWELTQRVTRLLKRST
FT                   NVLCESVSMRQEKNCLPPELVTSHKVNALIMLGQIGHDYLDMILQVGLPVVFLDFYDEH
FT                   YHVDSIVSDSYYGGYLLTDYLISMGHRRIGFMGNVTETSSIHDRFMGYIKALMEHGIPY
FT                   RKDWTLADREPNGPLITDLVFPPDMPTALVCNCDETAFRVISALKESGYRVPEDVSVVG
FT                   YDNYMVSDMCVPSITTVEVNLEIMAQATVDIIFKKLEHPDYSEGKRIIPGKLIIKNSVR
FT                   RLQEHEHEKVESKTGVD"
FT   CDS             609780..609977
FT                   /transl_table=11
FT                   /locus_tag="RUM_05600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16780"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAY5"
FT                   /protein_id="CBL16780.1"
FT                   /translation="MKKWKAKQAWIETAILLVILAGVFLIQQATGCWLDVRYEPLLYGL
FT                   ILGLYWLLRSIFRRFWTQQR"
FT   CDS             609996..610742
FT                   /transl_table=11
FT                   /locus_tag="RUM_05610"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16781"
FT                   /db_xref="GOA:D4LAY6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAY6"
FT                   /protein_id="CBL16781.1"
FT                   /translation="MQQDTEKKIAEHLFSQREESFAHASFDREIAFYESICSGNMKLVR
FT                   VFMKPLCCEGCGVLSEDPLRNLRYHMVVLAALIARYCIKGGMPPEESYTLSDFYIMKTD
FT                   KCRTEAEIRRVHLEMIEDYTGKMRRIKLNGAYSRQIVHGVDYIITHLHSRILLEDTAKH
FT                   LDISPAYLSRLFKKETGMTFSDFVNKQKIEEAAALLLYTEYSDTQISTLLAFSSQSYFI
FT                   KVFRKYMGTTPKQYKKQYNIPDFAGR"
FT   CDS             610931..614080
FT                   /transl_table=11
FT                   /locus_tag="RUM_05620"
FT                   /product="Beta-glucanase/Beta-glucan synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16782"
FT                   /db_xref="GOA:D4LAY7"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR004197"
FT                   /db_xref="InterPro:IPR008263"
FT                   /db_xref="InterPro:IPR008264"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018221"
FT                   /db_xref="InterPro:IPR018242"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAY7"
FT                   /protein_id="CBL16782.1"
FT                   /translation="MKKSAIRRLAAAAAACSVLVSALPALPTMTTLAAGNIITNSTFES
FT                   GTSGWGTYKESGGACSLSTENGRLALKISNVGKVNYAVQVFYDIIPLYKNGVYRLKYDI
FT                   SCSTNRFVECMIQQNGGTYQAYTWKGLNLTNSPQSVNYTFTMEQDTDIMSKLVFNCGIQ
FT                   EADGALPEHTIYLDNVSLELIDDSQVDYSASRPYEPPIVTNQVGYRCDSQKTAVFRNMG
FT                   SASEFSVVNAVTKQTVYTGRLSGDKTNSSANETNRVGDFSQVTTPGKYYITCGSLDPSY
FT                   TFEIGDDVYGSLLDDSVKMLYLQRCGTAVQDSTFGHPACHSTMATIYGTNQQIDVSGGW
FT                   HDAGDYGRYIVPAAKAVADLLYAYQQNPELYGDASGIPESGNGVPDILDEVRYELEWMQ
FT                   KMQRQDGAVYHKVTCENFPGYVAPEKETAPLIVTPVSSTATADFCASMALAYEFYKDVD
FT                   SNFAKDCLSRAEQAWSYLEQNPNLNFSNPSDISTGEYGDKSDRDERYWAAAQLYRATGS
FT                   SKYESALNSMVVCTGMDWATVGDYGNIALLTSDSISKSTSAYTKAKNVVLTQADQLLSK
FT                   SGSSPYGVALTKYDWGSNMTVANAGIILGLAYQLTDQASYLNAANAQLDYLLGVNPVGE
FT                   CFFTGYGTVSPENPHHRPSMAIGKAMPGMLVGGVNQNLEDSAAKAYCQDLPAAKRYVDN
FT                   AESYSTNEVTIYWNSPLTYLVALTGEGGSTPVVEKYLLGDVNNDKTINAFDLVLARRGL
FT                   TTGFDNQSAEQAADVNQDGKVTVADIVVMQQYLLGKIKAFSGEPAVTTAPPQTTAPTTH
FT                   TTVDAIQTTRNPSGIQDYGTPMNQNATMQADFRKGANAEFFASDGWTNGSCFNCGWYKE
FT                   NTSFNGGVLNLTIDKDHSGKYAYSGAEYRTNGYYKYGYYETSMQAIKNDGVVSSFFTYT
FT                   GPSENNPWDEIDIEVLGKDTTKVQFNYYTNGVGNHEYMYDLGFDASEGFHTYGFDWQAD
FT                   HITWYVDGKAVYTAYGNMPTTAGKIMMNVWPGIGVDDWLKPFNGNTPLTARYQWVTYNQ
FT                   Q"
FT   CDS             complement(614149..614472)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05630"
FT                   /product="Branched-chain amino acid transport protein
FT                   (AzlD)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16783"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAY8"
FT                   /protein_id="CBL16783.1"
FT                   /translation="MPDTSRFLLCLLVMAGVTYLIRMLPLVFFRQPIRNRFARSFLHYV
FT                   PYAALSAMTFPAIFYATSSPLSAAAGLLAALLLAYRSCSLISVAAGACGTVLLCEWAVH
FT                   LLS"
FT   CDS             complement(614465..615178)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05640"
FT                   /product="Predicted branched-chain amino acid permease
FT                   (azaleucine resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16784"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAY9"
FT                   /protein_id="CBL16784.1"
FT                   /translation="MHAPKHSFTEGLRDGLPIFLGYVSVAFAFGISATGQGLAVWQVVL
FT                   ISMTNVTSAGQLAGVPLIAASAPLTEIGLTQLIINLRYALMSVSLSQKLDPDVRLGDRF
FT                   AISFVNTDEVFAVASGKEGKVGRAYLYGLILPPYVGWAVGTLVGAVAGNILPAFLISAL
FT                   GIAIYGMFIAIIVPPSRTNHAVLGAVLTAAGLSCLIYYTPLPISSGFSIILCTVVTSVI
FT                   LALIKPLPEEDETHA"
FT   CDS             complement(615364..615777)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16785"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAZ0"
FT                   /protein_id="CBL16785.1"
FT                   /translation="MKHRMLPATAGILLSTALCTCLVGCGKGNSSSLPDAPITTAVSAV
FT                   TNAAVSTAVGTTQPDKPSDATVTTTAGAENELPILAPGTGQSGEELPVLTIPAETNQPG
FT                   TTAVPRQTDAPTTFTMVTIPSTGIELPFVPYEE"
FT   CDS             616677..617645
FT                   /transl_table=11
FT                   /locus_tag="RUM_05670"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16786"
FT                   /db_xref="GOA:D4LAZ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAZ1"
FT                   /protein_id="CBL16786.1"
FT                   /translation="MTPQQIEYVLLVAQLRSFSKAAQKLYITQPSLSKYIINIERQLGT
FT                   EIFDRSTTPISLTAAGEAYVATARQIKAAQDDLANRIADMQNLRAGTLKIGASTFRTSY
FT                   MLARSISQFCREHAGVEVSIADNNSENLKEMLRAGQIDLLISTGSFDPKYFDVEPLATE
FT                   QLYAAVPAAAPVNGKLADWQLSWEDIRSRSERFLRAKPVDLSRLRDVPFILPQQEEFNE
FT                   EVMQRSFIAFGGLPEPALRVRTIDAAFSFVVSGFGMTLIPDTMIHFGNYAAHPVFYALE
FT                   PAHAQRQICLVMRRSSYVSKAAAAYCLTLKRLVEIGTWRIL"
FT   CDS             617630..618748
FT                   /transl_table=11
FT                   /locus_tag="RUM_05680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16787"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAZ2"
FT                   /protein_id="CBL16787.1"
FT                   /translation="MADPVTIREKLGQDAYAGLCAASLTLAGNNARLHRAFSAGQVRIA
FT                   FLGGSVTAGCLDNAYVPEPFPLHGVQRLRSAMPGKRFYLYDYSIAGTGSDYGLVCVRRE
FT                   LSLCRPQLVVVEYGINDAKTPESIGCFESLIRMLLQLPEKPAVCLLLVGMEDGYCCRAH
FT                   MTRIAAHYGLPVVDAAAALEDAIRGGQLTWWDYAADSCHPHPAGHQWLGDCLFAGLHEW
FT                   LSAPADAPQPLPPACAYHAPLTDLELLFLDALESPYEHRFGEDGLPMLLHTADHGGSWK
FT                   LPLYCRGVLLVYRQYASHNYATFYASLDGGDPVPLRGYSLFGWGNPVTVLLSGGDTSGE
FT                   HVLTLAPADCDRNLKFELVALGIWGGKRKESD"
FT   CDS             618748..619473
FT                   /transl_table=11
FT                   /locus_tag="RUM_05690"
FT                   /product="Acyl-ACP thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16788"
FT                   /db_xref="GOA:D4LAZ3"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAZ3"
FT                   /protein_id="CBL16788.1"
FT                   /translation="MFSMEYRLGASRVDETGLLRCSGMVDLMQDCSGFQLDTEQALNTY
FT                   FAEHGLGMYLASRQIDIVRMPAYGEQMTLKTWIFDCNRFYGCRNTLLLDAAGEVCAASW
FT                   CIGVFVDLSTARGTRIPQILLEQVRLEPAYEMEYLPHKLILPDASQPWEQLSDRVADRS
FT                   MIDRYHHVNNARYFDLGEEALPEGYAYRRVRIAYKTPAKHGALICPRRLTTAEGCWIAL
FT                   CDGQGKPYAQLLYSDIVPV"
FT   CDS             619594..620748
FT                   /transl_table=11
FT                   /locus_tag="RUM_05700"
FT                   /product="GDSL-like Lipase/Acylhydrolase."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16789"
FT                   /db_xref="GOA:D4LAZ4"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAZ4"
FT                   /protein_id="CBL16789.1"
FT                   /translation="MRACKAVATAVCLAVSCTGLLAGCRTEENDMHKTYAPSEEAVLPL
FT                   GRTYYADDMRWCAYSGTGAAFTFTGTKAEITIAGDQIAEAPDNQANYARIAVYVNEERV
FT                   VDDQIDQPEKTYTVFQSDAAQEVTVRIVKLSECAMSTIAIKQITVDSQEGIRPAQPQSR
FT                   LIEFVGDSITCGYGVDDEVAEHHFSTATEDVTKAYAYRTAQTLKADYSMVSISGYGILS
FT                   GYTDSGKLQPHQIVPRYYPKLGFSNGSFGDKKPASIRWDFARQPDLVVINLGTNDDSYC
FT                   QTDAQRQADFAAAYVEFLKTVREKNPDAPILCTLGIMGDRLYPSVEAAVAAYSKETGDS
FT                   NVSCMKFDVQNQADGYAADWHPTAKTHEKAATRLAEEIRSRYGW"
FT   CDS             620926..621489
FT                   /transl_table=11
FT                   /locus_tag="RUM_05710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16790"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAZ5"
FT                   /protein_id="CBL16790.1"
FT                   /translation="MKKLVVFAAALALLTGCTADSSSTGSSAAQPAQTTAAASGSSQTG
FT                   NTESSIHADYPVYDSLQALQEKSDLILRCKFQKREETSFENSPYTRMTIQVQEAYKGDA
FT                   KQGDTLTFLQLGTNEAAQNPVVCNDYVSMQSDQEYVLFLTKSGEEYFMPSPAQSCYLWA
FT                   EGDKTLSPVLDSSVALSVKAEDLK"
FT   CDS             621639..621950
FT                   /transl_table=11
FT                   /locus_tag="RUM_05720"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16791"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAZ6"
FT                   /protein_id="CBL16791.1"
FT                   /translation="MEEKKACPCCCQKTTKRSAEQKKALLNRLRRIEGQVRGIQTMLEQ
FT                   DAYCNDVLIQSAAVNAAMNAFNRELLASHIRGCVVRDIRAGQDEVIDELVATLQKLMK"
FT   CDS             621962..624469
FT                   /transl_table=11
FT                   /locus_tag="RUM_05730"
FT                   /product="copper-(or silver)-translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16792"
FT                   /db_xref="GOA:D4LAZ7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAZ7"
FT                   /protein_id="CBL16792.1"
FT                   /translation="MKQYEVTGMSCAACSARVERAVSAVPGVESCAVNLLTNSMGVEGT
FT                   AAPDAVIAAVQAAGYGASLKGAKQDTVPKDTLRDTETPRIRRRLITSVALLLVLMYFSM
FT                   GHMMWNWPLPHWFDGNHVAMGLVQLLLAGSILVINQKFFVSGFQSLWHRSPNMDTLVAL
FT                   GSGASFLWSVYALFAMTDAQVHGDMDRVMIYMDEFYFESAAMILTLITVGKMLEARSKG
FT                   KTTDAIRSLMQLAPKTATVIRDGKEETIPAEQVQKGDVFAVRPGESIPVDGVILEGESA
FT                   VDESALTGESIPVDKALGDPVCAATINHSGYLRCEASRVGEDTTLSQIIRMVSDAAATK
FT                   APIAKIADRVSGVFVPIVISIAAVTTLVWLLLGYGTAFALARGISVLVISCPCALGLAT
FT                   PVAIMVGSGVGARNGILFKTAVSLEETGKVQIVALDKTGTITQGAPVVTDLLPGSGVSE
FT                   QRLLAAAAALEAKSEHPLAKAVLAYARQQGITPEEVTAFTAHAGNGLSGTLDGKRLTGG
FT                   SLRFIASRSPLSLETEQAANAWSEQGKTPLLFLEDDTFLGMIAVADTIKEDSPAAIRQL
FT                   QAMGIRVVMLTGDNARTARAIGAQAGVDQVISDVLPEGKEAEIRRLRQQGRVAMVGDGI
FT                   NDAPALTSADMGIAIGAGADVAIDAADVVLMKSRLSDVPAAIRLSRGALRNIHENLFWA
FT                   FFYNLIGIPLAAGVFVPLGLTLNPMFGAAAMSLSSVCVVSNALRLNFCRLYDTRRDHKG
FT                   KPAAASGSTQTRTLHIKGMMCGNCENHVRTALEGIQGVGTVQVSHTAGTAVVTLNETVA
FT                   NDTLKQAVKQAGYKVTAIESQEV"
FT   CDS             624473..624727
FT                   /transl_table=11
FT                   /locus_tag="RUM_05740"
FT                   /product="Copper chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16793"
FT                   /db_xref="GOA:D4LAZ8"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAZ8"
FT                   /protein_id="CBL16793.1"
FT                   /translation="MIRTILQIDGMMCGHCEAHVNDTIRQAFPVKKVESSHTKKETVIL
FT                   SEEPLDEEKLRAVIAQTGYTLGEIRTEPYEKKGLFSFLK"
FT   CDS             complement(624813..625712)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05750"
FT                   /product="ABC-2 type transporter."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16794"
FT                   /db_xref="GOA:D4LAZ9"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D4LAZ9"
FT                   /protein_id="CBL16794.1"
FT                   /translation="MTGLGNLIRRNCKLFFKDKAMFFTSLITPMILLVLYATFLAKVYR
FT                   DSFASSLPKGMDIPQKLIDATAGGELLSSLLAVSCVTVSVCCNALMVQDKVTGARRDLT
FT                   MTPVRRSTLALSYYFATIISTLIICILALGAGMLYLAKVGWYMSAGDVFLLLSDVVLLV
FT                   LFGTALSSIINFFLSSQGQISAVGTIISAGYGFICGAYMPISQFGAGLQKVISFLPGTY
FT                   GTSLLRNHALRGVYAEMEAQQFPAEIIESIKDSIDCNLYFFGTKVSLPAMYGILCGAIV
FT                   LLIGGYVLLNLLHRKAKK"
FT   CDS             complement(625709..626650)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05760"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16795"
FT                   /db_xref="GOA:D4LB00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB00"
FT                   /protein_id="CBL16795.1"
FT                   /translation="MYNKQKGPNMEHIIEIKGLNKSFGEVHAVRDLSFHVDAGALFAFL
FT                   GVNGAGKSTTISILCGQLRKDSGTVIVCGKDTDADMGDISRMLGVVFQDSVLDKALTVR
FT                   DNLQSRAALYGIKGQAFRKRLEELAKLLDFGDLLGRTVGKLSGGQRRRIDIARALLHQP
FT                   RILILDEPTTGLDPQTRKLLWDVVQKLRREAHMTVFLTTHYMEEAADADYVIILDNGAI
FT                   AAQGTPLELKNQYTGDFITLYGLDDAQKQTLGLPYEQLRDAIRVSVPNTAAATRLITAH
FT                   PALFTDYEITKGKMDDVFLAVTGKKLTGGMDK"
FT   CDS             complement(626754..628013)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05770"
FT                   /product="Diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16796"
FT                   /db_xref="GOA:D4LB01"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB01"
FT                   /protein_id="CBL16796.1"
FT                   /translation="MKTTFATKEIVERIAAQYPTPFYLYDEKGIRENARKLKQAFAWNK
FT                   GYREYFAVKATPNPFILKILQEEGCGVDCSSLTELMMSEACGFSGSDIMFSSNVTPAED
FT                   FKLAKKLGAYINLDDITHIDFLEQVAGLPETIFCRYNPGGHFEIETHVMDNPGEAKYGF
FT                   TTQQLIDGFKILMQKGVKHFGLHAFLASNTVTNAYYPKLARVLFETAVMLKKETGADIR
FT                   FVNLSGGVGIPYRPEQEPNDILAIGEGVRQAFEEIMVPAGLGDVAIFTELGRFMLGPYG
FT                   NLITKAVHEKHIYKEYIGVDACAANLMRPAIYGAYHHITVLGKENAPCDHKYDVTGGLC
FT                   ENNDKFAVDRMLPKIDMGDYLAIHDAGAHGFSMGYNYNGKLRSAEILLCEDGSFKLIRR
FT                   AETPADYFATFDFTGLFPQK"
FT   CDS             complement(628010..628714)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05780"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16797"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB02"
FT                   /protein_id="CBL16797.1"
FT                   /translation="MDAAEMLMQFALTRQEALIYMALTTDGAMTGYEVAKQLGISRSNC
FT                   YTSLASLVEKGAAYLLEDTATRYVAVKPEEFCGNRIRMLEELKDKLAQQLLPRAAQTEG
FT                   YLTIGGQENMIDKAVFMIEHGAERLYLSAERVCLEPLIPSLTAAAERGMQVTVITDVPF
FT                   SQPGIRFYTADCHPGQIRLIVDSNAVLTGDLTTDGTCLYSRKKNLIDLFKEAMRNEIQL
FT                   IELYQNEKGSVL"
FT   CDS             631641..632207
FT                   /transl_table=11
FT                   /locus_tag="RUM_05800"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16798"
FT                   /db_xref="GOA:D4LB03"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB03"
FT                   /protein_id="CBL16798.1"
FT                   /translation="MKETKTKKLVLSAVLLALATVLSLFKVYQLPLGGSITLLSMLPVC
FT                   LLSIRYGVKWGLTCSFFYGVIQIALSFGELMSWGMTAGTWVGCLLFDYLLAYGSLGVAG
FT                   LFRKHGAGGITAGIGLAMVLRFISHFISGTIFFAVFCPDGWNVVLYSICYNGSYMLPEM
FT                   AFTMLGAFALFRAPQTRSFVIGAQS"
FT   CDS             632390..633226
FT                   /transl_table=11
FT                   /locus_tag="RUM_05810"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family (TC 3.A.1.7.1)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16799"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB04"
FT                   /protein_id="CBL16799.1"
FT                   /translation="MKKFLALLSCAVLMAATAVGCGSQNEKITVVSREDGSGTRSAFSE
FT                   LMGVVKDDKDNTTDTAEVTNSTSVMLTTVAGNKAAIGYVSLGSLNDTVKAVKVDGVEAT
FT                   AENVKAGKYAVSRPFNIVTGKDLTPLAQDFISYILSTDGQAVVDEKGYISITQGETYKA
FT                   SGQTGTLTIAGSTSVAPLMEVLADKYMALNSGVKIEIQQSGSSAGITSAVEGVCQIGMA
FT                   SRELKDSETAKGVTATKIAMDGIAVIVNKDNSCSELTSDQIRKIYTGETTQWSDLK"
FT   CDS             634349..635161
FT                   /transl_table=11
FT                   /locus_tag="RUM_05830"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16800"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB05"
FT                   /protein_id="CBL16800.1"
FT                   /translation="MKTLKHYWSVAAMSIRLSIQSCFEYPLAFVGWLISNPMQFLVGFA
FT                   TIKFVVMEFDALADWNFKELAFLYGMSVLSHGLSVIFFTKTWYMGWTILRGEMDMLRLR
FT                   PMNTLFQFLFGEMNFVGLTDLVPGVILFVYGCISVQFQWTLHNTAAMLCAVVGGTLLRG
FT                   AFYLGFGSLTFWTKSPFHVSSFFQELFNRTNMYPLSMYPRAVQFIFTFILPMGWICFYP
FT                   ASAFMGKASMLTLPHGMAFVTLALGIALFAVACAVFRAGFKQYESAGS"
FT   CDS             635174..636151
FT                   /transl_table=11
FT                   /locus_tag="RUM_05840"
FT                   /product="ABC-type uncharacterized transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16801"
FT                   /db_xref="GOA:D4LB06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB06"
FT                   /protein_id="CBL16801.1"
FT                   /translation="MAVIEVEHLVKQFQSVKKEKGLKGSVKALFKPERRTITAVKDISF
FT                   SIEPGEIVGYIGPNGAGKSTTVKMMSGILTPTSGEVRINGISPVKDRKRVVQQLGVVFG
FT                   QRTQLYWDLRLGESFELLRRVYDVDDRTFRENMDMMNEILDIDSIIDTPVRQLSLGQRM
FT                   RGDLAAAMLHSPRVLFLDEPTIGLDVDAKHAIRKFIRQINQTRGTTVILTTHDLGDIQE
FT                   LCKRLIIINHGVIIEDGSLDELVERIAPYRELIIDFYTEQHVEHPRAQIVRQEGARTVY
FT                   RFLKREITAAKLIDEIGQQAAIKDISLEEADIDDIIRVAYHGEA"
FT   CDS             636368..636580
FT                   /transl_table=11
FT                   /locus_tag="RUM_05850"
FT                   /product="Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16802"
FT                   /db_xref="GOA:D4LB07"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB07"
FT                   /protein_id="CBL16802.1"
FT                   /translation="MMPLTFAAVGEENMIKKVGGKAETRKFLENLGFVAGAAVTVISQI
FT                   GGNVIVNVKESRVAVSKEMASKIMV"
FT   CDS             636594..636815
FT                   /transl_table=11
FT                   /locus_tag="RUM_05860"
FT                   /product="Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16803"
FT                   /db_xref="GOA:D4LB08"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB08"
FT                   /protein_id="CBL16803.1"
FT                   /translation="MATLKEARIGQTVRVKKLNGEGAVKRRIMDMGITKGTEVYIRKVA
FT                   PLGDPIEITVRGYELSLRKADAEMIETE"
FT   CDS             636886..639372
FT                   /transl_table=11
FT                   /locus_tag="RUM_05870"
FT                   /product="ferrous iron transporter FeoB"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16804"
FT                   /db_xref="GOA:D4LB09"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011619"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB09"
FT                   /protein_id="CBL16804.1"
FT                   /translation="MGIKIALAGNPNAGKTTLFNALTGSNQFVGNWPGVTVEKKEGKLK
FT                   GHSDVTITDLPGIYSLSPYTLEEVVARNYLIQERPDAILNIIDGTNLERNLYLTTQLVE
FT                   LGIPVVAAINMMDVVRKNGDKINTEELAKELGCQVVEISALKGTGIKEAAEAAIQAAKQ
FT                   GTPMIPQHQFGGCVEHAIAHIEEAVLHNIPEEQQRWYAIKIFERDEKVLEALSISKSDI
FT                   EHIEQDIAAAEKEMDDDAESMITNERYVYIANVIKHCYKKKNKGGMTTSDKIDRVVTNR
FT                   WLGLPIFAVVMFLVYYISMVTVGSAATDWANDGLFGDGWHLLGIGSGAYEEAAEEYGDT
FT                   NAIIDGYVAYLGEQGADTAALEGYIDPEADTFDGEAAKHAILEFEKQYSADFSYDVEDE
FT                   ETLEVTTKTATMGDLTTAADAFAGGEPDPAEYGVWVPGIPVLIEQGLDALNCADWLKGL
FT                   ILDGLVAGVGAVLGFVPQMLVLFILLAILEACGYMARIAFVMDRIFRKFGLSGKSFIPI
FT                   LIGTGCGIPGIMASRTIENERDRRMTIMTTTFIPCGAKQPFIAMMAGAIFGGSAWIATG
FT                   AYFLGMAAIVISGIILKKTKMFAGDPAPFVMELPPYHMPTVGNVLRSMWERGWSFIKKA
FT                   GTIITLSTIFVWFTSFFGWVDGSFGMLTEDQMSCSILAYIGKGICWLFAPLGWGNWQAT
FT                   VAAVTGLVAKENIVATMGILYGGDNGVYANLAAAFTGVAGMSFLIFNLLCAPCFAAMGA
FT                   IKREMNNAKWFWFAVGYECGFAYAVSLVVYQLGALFSGNANILGTIAAFALVAFMIYML
FT                   VRPYKESNTLRTKVRV"
FT   CDS             639406..639585
FT                   /transl_table=11
FT                   /locus_tag="RUM_05880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16805"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB10"
FT                   /protein_id="CBL16805.1"
FT                   /translation="MEWFSANIGTILVLLIVCALVALVVRKMIRDRRKGKSSCGCNCGC
FT                   CPNSGMCHSKPPKK"
FT   CDS             639868..641598
FT                   /transl_table=11
FT                   /locus_tag="RUM_05890"
FT                   /product="GDSL-like Lipase/Acylhydrolase."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16806"
FT                   /db_xref="GOA:D4LB11"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB11"
FT                   /protein_id="CBL16806.1"
FT                   /translation="MNNRKQKWTALGVAGALLLPLAGITGFASDAADVRTLQKALIQKD
FT                   ALAQGQDLNEDGAVNGFDLVRLRRQVLEASQSGEIRETDVAITEQTAKLVGRTLRKGDT
FT                   TWLVQSGAAAEFTVTGTSAELTLAGDGCAAGDEKYRPRYAVYVDGELLCDSLMSETETK
FT                   LQLFSGDTVRHATVKVIHLSEANNGAIGVRNLHVAAPDSLAYPCAPTAKKPLSIEFIGD
FT                   SITCAYGVEGKDQYEAFRTDTENFMKSYAYLTAQLLDADYSAVSYSGYGVVSGYTTGER
FT                   NTESLVPDCYDLVGKLPDYAEAWDFDSHTNDVVVINLGTNDSSYLSQDFDGRKDEFTAA
FT                   YTAFLKQVREKNPAAVIICTMGTMGGEDLYPLIQQAITDYTAETGDSQVRSYQSATQKP
FT                   ANGLGSDWHPSALTHELSAYVLADQICTAIGREWSKIGLDAASDGIYDVKINTEAGANA
FT                   AHYVGYDKSFWINMVGGGTKPEDIQAYVGGLTLTPGTYELAFDYTSTVDVTVTYGVQQL
FT                   DDPEQSCVSGSIDATGTKQHAAKTFTITEPVEDAAIVFNLGGTDYYNITLSDITLFKKA
FT                   "
FT   CDS             complement(642001..643098)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16807"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB12"
FT                   /protein_id="CBL16807.1"
FT                   /translation="MKSMALIAASVLLLGCTGCSLSSGASQASGQAESIHSQVNPPPED
FT                   SSITLVNRMTKAERERTALTVFIAEEWDHAAQFLLERSLRLLRIYDEELGMEFTARIIL
FT                   PPGYDPRKKYPVMLDTDGIWRTGLVPQAPLQEHAPTILRDDGSNGVYYHMDDLWQLTSA
FT                   LSLRELMDGTNYEPVILVSLGFSRYPVEWQTERAKMQTILEKREALLHFITDNLMPRLG
FT                   QEFPLCYERSTLCGYGTGALFSHYALFQADQYENQPFGGYLIADPTFQVYSQLKHDPAP
FT                   DAWKSDFGCAQSHMDKFVMLRYSTRMPEDLASSQNADSDPDPIQQLTQRLVELSAPGSF
FT                   EPIEGHYGSDVSGVLLEFLKEYYAI"
FT   CDS             643341..645614
FT                   /transl_table=11
FT                   /locus_tag="RUM_05910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16808"
FT                   /db_xref="GOA:D4LB13"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR024745"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB13"
FT                   /protein_id="CBL16808.1"
FT                   /translation="MNRYKSFGAALLFTIAALSAALPGAGGADTSYQMQVAIDLGGEGK
FT                   AISPYIYGINQSGNQENYNKFTVNAIRQGGNRFTGYNWETNASNAGADWQHCSDNYLSD
FT                   SSDPADCVQTLSREAAANGIGYKLATLQLAGYVAADKNGSVSEAETAPSDRWNQVVLTK
FT                   GSAFADTPDLTDGNVYMDEYVHYIIEKLGNSQSASGIQGYSLDNEPALWHTSHSRLHPN
FT                   PVTIAELHEKSVEMAKAVKALDPDAEIFGPALYGYTAYDHLADGDSSTEWETIQAEKGY
FT                   HWYLDCYLDQMKQASDAAGTRLLDVLDIHYYSESARVGAEDRVQSVRTLYEAGFAENSW
FT                   IGKWCQANVPILPTVQKSIDTYYPGTKLAISEYNYGGEDVSATIAQAEALGCYADANVY
FT                   FASLWGGNEYMFSGINLYTNYDGKGGKFGDTLMPTKTADVSLASAYAAVNGTDQSVVTA
FT                   MLTNKDMSRQETASIALNHSDKQYEAAAVYAVSGDSADIRLLDIVTDVSDNTVQVTLPA
FT                   YSAAMIVITDDASDFDGLEIYDPSKVTERVECFEDPESMLNANGYVEIPITDPEHLKEI
FT                   RLTADVTSSAGSSWAYAGCAVCINAKDAAGNKFWTSKGYQLSLGTGSKAKVEFDGTLEN
FT                   ADKETVEAVIADGKVELQKWWDSSAAKEEEKEDIITVKYTRVEVVYSVSDTPSILRGDV
FT                   NSDGEVTIADVVRLCRYVAEDTELTPAMTEEQLPCADVNGDSIVDSSDITLIARYLAHL
FT                   VDAL"
FT   CDS             complement(645671..646771)
FT                   /transl_table=11
FT                   /locus_tag="RUM_05920"
FT                   /product="Acyltransferase family."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16809"
FT                   /db_xref="GOA:D4LB14"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB14"
FT                   /protein_id="CBL16809.1"
FT                   /translation="MESKRNYQLDVLKFFFTLCIFLYHARLLAPAGGLARQISDKWGWF
FT                   GVHFFFIVSGMLMANSFMRHRTEQTQEPGKAAVRFVVHKFRSIAGIYFISFSFNFVIRF
FT                   CIELHAHQDVSALTTLWKLILGSVPELFLVQMSGVRQIGVNSVTWYISAMLLVMLPLYY
FT                   FLCKKPDFFLHVFSPTAALMLYGFFTQMDNGYFDQNDCIGPFSGGVLRALCGICAGAAT
FT                   WALAQWIREHLSDQQYSTKLTLIEVLFSVYLLLVWIFPSFSAHLMYGALLPIPLLVAVV
FT                   FSGKSRISALFQMPWLRHINRLSMLIYFNHYAARQLITRFDLWLDRPYLQRYLLMAMLT
FT                   AGFCLLCATLEWLIHRCFSQKASKPV"
FT   CDS             646849..646998
FT                   /transl_table=11
FT                   /locus_tag="RUM_05930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16810"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB15"
FT                   /protein_id="CBL16810.1"
FT                   /translation="MRFRNVRSFFSVFFIAPCGMIHTSEVQSRCFPKKQGGARGNAHSV
FT                   CRSR"
FT   CDS             647101..647229
FT                   /transl_table=11
FT                   /locus_tag="RUM_05940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16811"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB16"
FT                   /protein_id="CBL16811.1"
FT                   /translation="MIHVPLRLWREQTGTMPAALPGGGYRMRPPRAADPAARAKPY"
FT   CDS             647313..648413
FT                   /transl_table=11
FT                   /locus_tag="RUM_05950"
FT                   /product="Membrane protease subunits, stomatin/prohibitin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16812"
FT                   /db_xref="GOA:D4LB17"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB17"
FT                   /protein_id="CBL16812.1"
FT                   /translation="MKTMIIQDNQRGLLIKHGRFMRLLEPGKYRLFGDTRVEVLELNQP
FT                   LTSGSCTLETLLACPEIAKQTASVQVADQQLALHFVDGIFAEALSKGQHAFWSIQHSHT
FT                   FQLVSIATPEVAPDVPRYIFSRLPSVYYVKVEVSPYDRARLYFDRKLVGVLEPGTYYYW
FT                   RCSVQVQADFVDTRLTSMTVTGQELLTQDKVSLRISYVYSYRITDYVRIALEINDFKEQ
FT                   LHVAAQLALRDYVGMHPLDEILESKEELSDYVTGRLREKAEKLFVEITDGGVKDIILPG
FT                   EIRDIMNTVLVAQKRAQASVITRREEVASTRSLLNTAKLMDENRTLYKLKELESIERIC
FT                   SNVGSISLSGGSDLLTQLAGLLQGEK"
FT   CDS             648621..648848
FT                   /transl_table=11
FT                   /locus_tag="RUM_05960"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16813"
FT                   /db_xref="GOA:D4LB18"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB18"
FT                   /protein_id="CBL16813.1"
FT                   /translation="MKNKRMKIARIAHDMNQEELAKRVGVTRQTIGMIEQGNYNPTLKL
FT                   CMAICDALDCTLDTLFWIPKEERSQEDETR"
FT   CDS             648835..649368
FT                   /transl_table=11
FT                   /locus_tag="RUM_05970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16814"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB19"
FT                   /protein_id="CBL16814.1"
FT                   /translation="MKQDEAFRKNLAKKLRGAYETDERMDAVNTQGLAACGMIAILYVM
FT                   VRIIYVGVHGGLALPELVLLFLMGLAIWKVNRQHKVHKLPTVFGKVVDPSPKARGKRLG
FT                   LYTLNGAALALTWSLMDLFGDITGQGMCVRQFAIDFMMMLVISFLMDLVINERKIQKYN
FT                   AYIARLEAEENDLS"
FT   CDS             649535..649783
FT                   /transl_table=11
FT                   /locus_tag="RUM_05980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16815"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB20"
FT                   /protein_id="CBL16815.1"
FT                   /translation="MKNFLKDEKTRYFAIGVLAATAGVKFLKSRVFHDGCVKAVAGGMK
FT                   LREDAAASLTRIKEDAEDIRFDEKAEAACAENCGKEA"
FT   CDS             649787..651865
FT                   /transl_table=11
FT                   /locus_tag="RUM_05990"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC/heavy metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16816"
FT                   /db_xref="GOA:D4LB21"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB21"
FT                   /protein_id="CBL16816.1"
FT                   /translation="MQYTIAYDNHNRLRLRCGDYVLTREKANGLTEQLLELQGVRTAQV
FT                   NFRTGSILVTYTPGARQEILAWVGGLQRSQIPEVGLTAAEQADDEFRRDLEQMLAGRLL
FT                   RKLIPSPIRNLMTIYRAVKYILRALDTLLRFEMDISVLDGVSIGVSIAQGHFKTASSVM
FT                   FLLAVSDRLEAYTKKRTRLALSEQLSLNVDSVWLRCGADSVKVPFDRVQVGDQVIVRTG
FT                   SVIPFDGTVCDEEGMVNQATMTGESEAVHKKPGDSVFAGTTVEAGTLVVEVRSLAADSR
FT                   LNQIISLIDESENLKAGVQSKAEHLADAIVPYSFLGFGLVWLLSGNLTKALSVLMVDFS
FT                   CAIKLSTPISVISAMREAAEYGATVKGGKYLEAFAEADAIVFDKTGTLTNASPEVSDVI
FT                   CFNGFERDEVLTTAACLEEHFPHSMAVAVVKKAAAEGLLHEERHAEVEYLVAHGIVTHY
FT                   GGNRAIIGSEHFVFEDEGIPRTPEQTALMREKAAGGSAIFLAIGGQLAGMLVIDDPVRR
FT                   EAKDVIRALRSRGIHRICMLTGDAESAAARVSRELGIDKYVAQVLPEHKSEFVKKLQQE
FT                   GFRVIMTGDGVNDTPALAAADVSVAMSDGSDIAREVADVTLCRDDITVLVTVREISEKL
FT                   MHRISSNYRFIAGFNAALILLGVVGALPPGISALLHNGSTMLIAAKSMTRLTERQMD"
FT   CDS             651989..652039
FT                   /transl_table=11
FT                   /locus_tag="RUM_06000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16817"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB22"
FT                   /protein_id="CBL16817.1"
FT                   /translation="MLFLVIEQSYNIYHAK"
FT   CDS             complement(652064..652762)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16818"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB23"
FT                   /protein_id="CBL16818.1"
FT                   /translation="MVNCMRNYKIIIAFVVCAIAFASIISLPSRMIVEANSEGLVTEKY
FT                   DSKQSRFDFEFSTNEATGTIKSFDVSDNGKIATCINPSNINVYDEYGNFDFAIYTNLTR
FT                   TKVILQWDKNTLLIYLNLSSDCGSKYDLVMINGYEDYQLYSCPVTDNTEKFWGELEMHE
FT                   DELITDKGRYYLQYGNLRYKDNESNEDYAVTENTSFRPWMLLSIPILTVIIWFGFLRKR
FT                   VKRWEEKQHN"
FT   tRNA            complement(652868..652943)
FT                   /locus_tag="RUM_T_24600"
FT                   /product="transfer RNA"
FT   CDS             653130..654287
FT                   /transl_table=11
FT                   /locus_tag="RUM_06020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16819"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB24"
FT                   /protein_id="CBL16819.1"
FT                   /translation="MAHKRKKLVSSLAVFMIIICVLCIAAGLTSNLMFGGRNASPTVAG
FT                   YQIYLNRTADMQPLVTQNAAVFVQAQHDYAKENVVLYTNSAGDKTIGRISLISADTEGS
FT                   DAKIIYYLNNASGTETAEIEKNSIIGLCRFENIAIGSALLVMTGTWGIILLIALPCVIL
FT                   LIYVISRFIAANAEDEEEEEEHDRTVKTRKKPQSPLFNADSAKHADEDFAERKASLAEH
FT                   FHQKGADASKKKKHKSESRQKPADAEASRQRRAKIEEAERLLAREDSRKKGEQDYAQEN
FT                   ETDGDGNDMDARVAAIKRAMRQRAEERERIQAEEEQRIAASKAKQHAAQQQSKQEAPKA
FT                   AEKSPVKTAAPTASRTAPRRPARSSAPMDFEELMRQLDEEKKKLS"
FT   CDS             654555..654824
FT                   /transl_table=11
FT                   /locus_tag="RUM_06030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16820"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB25"
FT                   /protein_id="CBL16820.1"
FT                   /translation="MGKLVQRYIVRLTYRGEQRYLYTRRAAVGDPALARSFARRHAAEQ
FT                   FYAECVFRSPGVVGEVLSVWLEQKHDRRSGGTVYYVPPEQDKKI"
FT   CDS             654979..655350
FT                   /transl_table=11
FT                   /locus_tag="RUM_06040"
FT                   /product="Cell division protein ZapA."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16821"
FT                   /db_xref="GOA:D4LB26"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB26"
FT                   /protein_id="CBL16821.1"
FT                   /translation="MLNRVKVVICGKEYVVQTEEAPSYVYSLAKTLEKKILSITETNTR
FT                   VSAHHAAVMVALSTLDELSKSTANVETIRAQVKEYVDEAGKARIERDLALRENESLKAK
FT                   IAQLENIVKLKSLKDSLDG"
FT   CDS             655343..657388
FT                   /transl_table=11
FT                   /locus_tag="RUM_06050"
FT                   /product="Collagenase and related proteases"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16822"
FT                   /db_xref="GOA:D4LB27"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB27"
FT                   /protein_id="CBL16822.1"
FT                   /translation="MADRLPELLAPAGGPDALLAALRCGADAVYVGAWDFSARQSAENF
FT                   DAAALQEACRLCHLYGAKLYLAVNTLVFDNQFVLLDALIRQAAEAGVDAFIMQDLGAIA
FT                   RVRQICPTMPIHASTQMTIHTVQGALEAARLGIRRVVAARELSCKELETLCSTGMEIEV
FT                   FCHGALCMSVSGQCYLSAMVGSRSANRGRCAQACRLPFTSCGDPEACTLSLKDLCSVQQ
FT                   IPALVQMGVASLKIEGRMKRPEYVAAAVTAYRQALQGQPVDLEQLRAVFSRSGFTDGYL
FT                   TGKRQKMFGIRSREDVTAAKQVLPKLQSLYAKPGKRAALHAKLELAAGQSARLTLADDA
FT                   GHIACVEGDVPEPARTAALDVQRLERQLSKLGDTIYTLAHTELTGEQGLMLSAGSLNAM
FT                   RRAGVQQLDAARIRDNTPVHTLAWSEPMPIHPARTEAWGLHIHAREAAQFSRIPSEQYA
FT                   LAGLPLEQWQPDSLIPMEKRMLMLPRFIEDEAGLMSRLEEMYSKGYRHLLCSNLAHIAL
FT                   GRQLGFVLHGDFGLHVANSAAADAYSQLGLSDLILSVELKRGAMQQLHSPVPSGAVLYG
FT                   RLPLMLMRNCPIRNEVGCKQCGHALTDRTGRSFPVYCTGGYAELLNAEPVYLADRLEEW
FT                   NRMGFGVLLFTTESPEQTARIIEQYRTGHAVLPERYTRGLAYRGVQ"
FT   CDS             657398..657835
FT                   /transl_table=11
FT                   /locus_tag="RUM_06060"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /function="deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16823"
FT                   /db_xref="GOA:D4LB28"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB28"
FT                   /protein_id="CBL16823.1"
FT                   /translation="MKLQIMRLRPEAILPEQQTPGSAGYDLSACLTEDLVIEPGDCVPV
FT                   STGIALCPDRQDVVLLVYARSGLATKHGVSMANGVGVIDSDYRGEVLVPLVNRGREPFR
FT                   ITPGMRIAQLVVTPVLLPRTEEVQQLPDSARGAGGFGSTGA"
FT   CDS             657845..658105
FT                   /transl_table=11
FT                   /locus_tag="RUM_06070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16824"
FT                   /db_xref="InterPro:IPR025470"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB29"
FT                   /protein_id="CBL16824.1"
FT                   /translation="MKNKLVLLFMIVTAAVLGGLLGNLCEGVYGVSWLAYSKAIGLDAT
FT                   TLNLSVFDLTFGIHFQLNVAQIILLAVALFVSPKIANAIQT"
FT   CDS             658236..659252
FT                   /transl_table=11
FT                   /locus_tag="RUM_06080"
FT                   /product="rod shape-determining protein MreB"
FT                   /function="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16825"
FT                   /db_xref="GOA:D4LB30"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB30"
FT                   /protein_id="CBL16825.1"
FT                   /translation="MFTRDIGIDLGTANTLVYLRGKGIIIREPSVVAVNTRTDQARYVG
FT                   KEAKEVIGRTPGSIVAVRPLKDGVIADFDITTTMLQEFIRKALQGTIFTKARVIICIPS
FT                   GVTAVERRAVKEAAEKAGAKRVNIIEEPMAAAIGAGLPTLDATGSMIVDIGGGTSEVAV
FT                   ISLGGIVTSRSVRMAGDEFDNAIVNYIRRKYNLLIGERTAENIKLEIGSAFPSEQESSM
FT                   EIKGRNLLNGLPENITITSAEVRDALAEPLSRVIEAIKITLEKTPPELSADIIDQGITL
FT                   AGGGALLRGLDKLINRETGMPVYVAEYPLDCVAEGTGRILENLEKYRDLLTEEVRYY"
FT   CDS             659318..660175
FT                   /transl_table=11
FT                   /locus_tag="RUM_06090"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16826"
FT                   /db_xref="GOA:D4LB31"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB31"
FT                   /protein_id="CBL16826.1"
FT                   /translation="MSEFFRSFKFKIILGVLALLLGVVLYAVTRGGSTTWLSQGFGVVF
FT                   NPVRQAFTAVSNQIEGGVDTILNAQEYYNENQELRAQIGSLNSQLVDYENTKEELAELR
FT                   KFLGIKEEHPDFVHSAPCHLISYVTNDPYGAFVIDRGREDGISVNDPVMTGEGLVGVIT
FT                   EVADTYATVRTILSPDLSIGAVCNRTKDTGIVEGNLRYAADGKTKMIYMDKTMTMQQGD
FT                   LVITAGSSGLFPRGCVIGNVAETGMEESGLSAYAVIQPAVSLDRITSVVVILDFNGKGA
FT                   NYDN"
FT   CDS             660165..660710
FT                   /transl_table=11
FT                   /locus_tag="RUM_06100"
FT                   /product="rod shape-determining protein MreD."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16827"
FT                   /db_xref="GOA:D4LB32"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB32"
FT                   /protein_id="CBL16827.1"
FT                   /translation="MTISAPKRSPKQERFCIALRWTLYVLLLALCFVLQCTGRHLNPLY
FT                   VIPAAVCISMSEGVLTAAGVGMVTGLMIDISCGKLLGLNALFLVCGCVCTALLFMHLLR
FT                   HNIINVLIVTLLLAAMQGGLDYLFYYYMWNYDAVETVFARWHLPVIFLTTGAVLPLYPI
FT                   FKLIKRRLLPPSGNANEA"
FT   CDS             660738..662762
FT                   /transl_table=11
FT                   /locus_tag="RUM_06110"
FT                   /product="Cell division protein FtsI/penicillin-binding
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16828"
FT                   /db_xref="GOA:D4LB33"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB33"
FT                   /protein_id="CBL16828.1"
FT                   /translation="MKETLALLGDRLRAAILVLLVVISVILGGLRLMKIQVVNGTAYLE
FT                   KAQSTAVYAQPVSAARGEIVDSDGNTIVGNKIGYNIIVEKAYFPADNGAGNAVLLEVAN
FT                   LLKERELDWNDTMPITMVEPFSFLSDSEEQVAKLRTTLNLNTYATAQNCMDKLIGDYDI
FT                   ADTYSPREQRIIAGIRYEMLLRSFAVNNHYTFAEDIPAELVTLIKERRLQLPGFDVIEE
FT                   AIRTVKQGDILPHEIGTVGPIYSKEEFEQLKENGHSYLLSDTVGKSGLELALEKELRGT
FT                   DGVKEITYVNGKVASSQITQEAVGGNRVQLTVDSEFQRGLQGVLEDMMQYLRDLNDPAY
FT                   DEVSAGALVVLDVKSNAVLGMATAPTYNLEDLMNDYQSVLNGENTPLVNRATDGLYRPG
FT                   STFKTITATAGLNTGIINAGSTYFCTRNYKYLDSTVHCTGYHSAINVTRAIQVSCNIFF
FT                   YELAQRLGIDTISEYATYYGLGQSLGLESGDAAGRLANPQTFEKLEMPWYAGYVLQAAI
FT                   GQSEVQVTPLQMAVAASTIANEGVRYRPHLVDGVYNNAGTKLISKTEPVIAEKINVQYD
FT                   SVYPLIRQGMILAAQSTMPKEYSLTHLGFQTAIKTGTPQSPRGTDSFVIGFAPAEDPEI
FT                   AFAGVIEGGNYAKYMVRKVLELYADCYPDTKIGEHLTGE"
FT   CDS             662984..663724
FT                   /transl_table=11
FT                   /locus_tag="RUM_06120"
FT                   /product="Septum formation inhibitor-activating ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16829"
FT                   /db_xref="GOA:D4LB34"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB34"
FT                   /protein_id="CBL16829.1"
FT                   /translation="MSKVIAVTSGKGGTGKSSICSGLGYTLAKQGSRTLIIELDFGLRC
FT                   IDIIFGMQGKIKYDLGDVLHNRVKPLDAVTQVPMASNLNILCAPKDPFASATVEQIVDI
FT                   CKQIRKYFDYIIIDTGAGINSHVFDIVEQANTILVVTTPDPICVRDAQMMSDEFYNRGN
FT                   KRQRLIINKVNKRAIGSELVKSLDEIIDTIGVQLIGVIPEDYELVIATGKGQPIPSTAP
FT                   SLAAFDAIAKRLKGENAPLTVKIK"
FT   CDS             663794..664198
FT                   /transl_table=11
FT                   /locus_tag="RUM_06130"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16830"
FT                   /db_xref="GOA:D4LB35"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB35"
FT                   /protein_id="CBL16830.1"
FT                   /translation="MNIALIAHDSKKELMIQFCIAYCGILSRHNLCATGTTGKQVSEAT
FT                   GLHIQRYLSGSQGGDQQICARISCNEIDVLLFFRDPINPKSNEPNDMNLLRLCDVHNVP
FT                   VATNIATAEALILALERGDLDWREIGNPSL"
FT   CDS             664322..665629
FT                   /transl_table=11
FT                   /locus_tag="RUM_06140"
FT                   /product="histidyl-tRNA synthetase"
FT                   /function="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16831"
FT                   /db_xref="GOA:D4LB36"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB36"
FT                   /protein_id="CBL16831.1"
FT                   /translation="MALNLKRPNGTEDITPANIHKWYTVEQVARSVAQSYGFREIRIPT
FT                   FENTELFQRSVGETTDVVQKEMYTVMAKETKFTLRPEGTAGTIRAMLQNGLLNEALPQK
FT                   VFYLLSCFRHERPQAGRLREFHQFGLEMAGSAEPVADAEVISLAKAVLDTLGLKGIQLY
FT                   INSIGCPTCRAEYHKALRAYFEARKDQLCDTCLSRLEKNPMRILDCKSPICGELGKDAP
FT                   VILDYLCEDCKTHFEKLQGYLKAMDIDFSINPKIVRGLDYYTKTVFEFVTTDIGAQGTV
FT                   CGGGRYDGLIEELGGQHQPALGFAMGIERLLLTMESQGCDFLEPNHCDLYIATMDPEGV
FT                   SRAMQYANLLRQEGFWVEYDLLGRSFKSQMKYADKIGTSYLLVLGENELTTGNANLKNM
FT                   KTGEQTPLLLDDSFVDSFTNVAMYGMFDGVMDEISF"
FT   CDS             665687..667450
FT                   /transl_table=11
FT                   /locus_tag="RUM_06150"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /function="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16832"
FT                   /db_xref="GOA:D4LB37"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB37"
FT                   /protein_id="CBL16832.1"
FT                   /translation="MKGLKRTHFCGEVSQIGTEAVVCGFVQKVRNLGTLLFIDLRDRTG
FT                   VVQLAFNETQQPELFAKAETCRGEYVLMAHGTVKERESINHDMKNGNVELVVDDLRILN
FT                   KAQTPPFEITSDTKVNEELRLKYRYLDLRRAPLQRNLVMRHQIAKAAREYFYANDFIEI
FT                   ETPMMMKSTPEGARDYLIPSRVHPGKFYALPQSPQIYKQLLMVAGMDRYIQLARCFRDE
FT                   DLRADRQPEFTQIDLEMSFVDVEDILQMAEGFVHHVFQQVLGREIPLPLPRLSYAEAMN
FT                   RFGSDKPDTRYGMEIQDISEYVKDCGFGVFTGAIEAGGSVRAIVAKQAAGTLTRKEIDK
FT                   LTEMVKGIGAKGLAFIRWVEEKPSCSFGKFVGEDKLHEILQALDCQQGDVVLIVADKNK
FT                   VTLPVLGALRQTVARKLDLIPEGQFNFLWITQMPFFEWDEDNNCWMAMHHPFTMPEDDC
FT                   LQYLDSAPEKVIAKAFDLVLNGTELSSGSIRITNYELQQKMFQALGLTDEEIEAKFGFL
FT                   VEAYRFGAPPHGGMGIGLDRLAMVMLGVDSLRDVTAFPKVQNASELMSACPSAVDKENL
FT                   DILGIAVTETE"
FT   CDS             complement(667524..668402)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06160"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16833"
FT                   /db_xref="GOA:D4LB38"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB38"
FT                   /protein_id="CBL16833.1"
FT                   /translation="MREIQVRTPAKVNLTLDVVGKRDDGYHSIESVFQAVGIYDALTLT
FT                   RVDTPGITLSSTNKYLPCNQKNIAYQAAQLFLKHAHRWDGIHIHIEKHIPSQAGLGGGS
FT                   SDGAAVIAALNWLLGCRMSLQEQCEIAAQVGADVPFFLTGGTMHVSGMGEILEPLPPMP
FT                   ALPMVIAKGKAGVSTPEAYRRIDQLTDPVHPDTARVIDFLRNGRYWDAIPECGNLFEAA
FT                   TNLEEVTQIKQIMMDMGAQCALMTGSGSAVFGIFDTGLMAQKCCNALHAVVLYAVTCKT
FT                   LKHSIRIVSRS"
FT   CDS             complement(669577..670056)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06180"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16834"
FT                   /db_xref="GOA:D4LB39"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB39"
FT                   /protein_id="CBL16834.1"
FT                   /translation="MNELLHLLKQNARLSNEELGAMLGITPAEVAAQIKKLEEDGIIKG
FT                   YSVVLNDELANKDTVTAFIELKVTPKRDCGFEDLAKTVMMYDEVESVSLMSGAYDLAVT
FT                   VTGSSLKVIALFVAQRLSTIDGVLSTATHFVLKRYKEKGIFIEQEPIDERGMVSP"
FT   CDS             complement(670075..670917)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06190"
FT                   /product="histidinol phosphate phosphatase HisJ family"
FT                   /EC_number="3.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16835"
FT                   /db_xref="GOA:D4LB40"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB40"
FT                   /protein_id="CBL16835.1"
FT                   /translation="MLIDCHNHTHNSPDGENESVLERCARAAELGIGVLAVTDHCEVNR
FT                   FFSLAHYGVEPNGYDTYDFSRDFELSMQENTAAKAHTPAGVKLLCGIELGQATHELALA
FT                   EHVYADVRLDFVIGSMHQLPGWDDFAFLDYSKVDAAALFHENLQEIARLASTDTYDVLG
FT                   HITYALRYMAAAGIHLELAPYREELAEIFRIVIAKGKGIEINTSGLRQAYGDTFPNLEC
FT                   LKLYRDLGGEILTIGSDAHSNLDLGKGIAQGLDIARAAGFTNIAYFEKHEPQFLKLAD"
FT   CDS             671105..671374
FT                   /transl_table=11
FT                   /locus_tag="RUM_06200"
FT                   /product="ACT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16836"
FT                   /db_xref="GOA:D4LB41"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB41"
FT                   /protein_id="CBL16836.1"
FT                   /translation="MRAVVTVIGKDNVGILHQVSGICAEYRANVIEVTQSVLQDLFAMI
FT                   MLVDISAMTTDFAVLSDRMNQLGEELGLSIHTMHEDIFNSMHRI"
FT   CDS             671393..672751
FT                   /transl_table=11
FT                   /locus_tag="RUM_06210"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16837"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB42"
FT                   /protein_id="CBL16837.1"
FT                   /translation="MLNVYDILETIRMIQDECLDIRTITMGISLLDCIDPDIDRACEKV
FT                   YEKITTRAKNLVSVGQQIETEYGIPIINKRISVTPIAMLCGACKGGDPVKFAKALQRAA
FT                   DACGVNFIGGYSALVQKGFSAGDLELIHSIPEALDVTTNLCSSVNIGSSKAGINMDAVA
FT                   LMGGIIRQSAELTADRQCVGPSKLVVLCNAPEDNPFMAGAFHGVGEPDCVINVGVSGPG
FT                   VVRAALAKHPDASINEIADIIKKTAFKITRMGQLVGARASEMLDVPFGIVDLSLAPTPA
FT                   VGDSVAHILEEIGLECCGTHGTTAALALLNDAVKKGGVMASSNVGGLSGAFIPVSEDAG
FT                   MIAAAENGTLRLEKLEAMTAVCSVGLDMVVVPGDTPAETISAIIADEAAIGMVNNKTTA
FT                   VRLIPAIGKKEGDILEFGGLFGSGPIMQINRKSPAKFIARGGRIPAPMHSIKN"
FT   CDS             complement(672782..673507)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06220"
FT                   /product="pyruvate formate-lyase 1-activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16838"
FT                   /db_xref="GOA:D4LB43"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB43"
FT                   /protein_id="CBL16838.1"
FT                   /translation="MTTGYLHSLESFGAVDGPGIRFVVFLSGCPLRCLYCHNPDTWEQK
FT                   QTLCMTPPQVMEKIRSERSFLLRGGVTLSGGEPLMQPAFCEELLTLCRQEGFHTAIDTS
FT                   GSIPLSQSRHAIDLANMLLLDIKDIDPEDCRTLTGKTNENALATLDHCEQTGKEVWIRH
FT                   VLVPGYTLNPDKLRRLAEKLSGYRCVKRVELLPYHTMGLYKWEALGIPCKLADTPTPTD
FT                   DEIAMANGFFTKQKTPAAE"
FT   CDS             complement(673528..675741)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06230"
FT                   /product="formate acetyltransferase 1"
FT                   /EC_number="2.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16839"
FT                   /db_xref="GOA:D4LB44"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB44"
FT                   /protein_id="CBL16839.1"
FT                   /translation="MKFKSGIWDKEINLRDFIIQNYTPYEGDDSFLAPPTARTRALWDK
FT                   VLALLEQERKAGGVLDIDEHTISTITSHKCGYIDKELETIVGLQTDAPLKRAIMPFGGI
FT                   RMVRNSLAAYGRELPPDVENVFKYRKTHNDGVFDVYTDDMKRARHTGIITGLPDAYGRG
FT                   RIIGDYRRIPLYGVDRLIEDKIAAKKAHDAEPMYGDTVRNLEEMAEQIKALKELKEMAA
FT                   GYGFDISRPAENTQEAIQWLYFGYLAAIKEQNGAAMSLGRVSTFLDIYAEQDLKSGTFT
FT                   EEQIQELVDHFIMKLRMVRFLRTPAYDELFSGDPTWVTESIGGMCEDGRPMVTKMSYRF
FT                   LHTLVNLGPAPEPNLTVLWSHRLPEPFKKFCARISISTSSIQYENDELMRERFGDDYGI
FT                   ACCVSAMPIGKQMQFFGARANLAKALLYAINDGRDERYEDRLCQGVGQLSDGPLQFDEV
FT                   YSKFEYVCEWLTKLYINTLNIIHFMHDKYCYERLQMALHDENIIRTSACGLAGLSVVVD
FT                   SLSAIKYAKVTPIRNAAGIATDFAIEGDYPKFGNNDPRVDELATMVVERFMKRLSRRRT
FT                   YRNSIPTMSILTITSNVVYGKKTGSTPDGRKAGEPFAPGANPMHGRDTNGCIASMLSVS
FT                   KIPYAYAEDGISYTFSIIPDALGKNEEDKENNLVALLDGYTREHGHHMNVNVMNRETLI
FT                   DAMDHPELYPQLTIRVSGYAVNFIKLTREQQLDVIHRTFHTRM"
FT   CDS             complement(675929..676417)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06240"
FT                   /product="Deoxycytidylate deaminase"
FT                   /EC_number="3.5.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16840"
FT                   /db_xref="GOA:D4LB45"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB45"
FT                   /protein_id="CBL16840.1"
FT                   /translation="MLRRDKINYYLDIAETVLERSTCIRRKFGAIIVKHDEIISTGYVG
FT                   APRGRKNCNDLNYCTRDKLGVPKGQRYELCRSVHAEQNAILSAARADMIDATLYLACHD
FT                   ARTDQLDGEVEPCSMCKRLIINAGIKQVIVRQTRDAYKIITVSDWVEQDESLTGSSGY"
FT   CDS             676512..677369
FT                   /transl_table=11
FT                   /locus_tag="RUM_06250"
FT                   /product="dimethyladenosine transferase"
FT                   /function="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16841"
FT                   /db_xref="GOA:D4LB46"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB46"
FT                   /protein_id="CBL16841.1"
FT                   /translation="MENLTNISVVQDLARRHGFHFSKGLGQNFLINPTVCPRIAELGNA
FT                   RPGFGVLEIGTGFGVLTAELAKRADKVVAVEIDQRLLPVLEETLADFDNVKIVPGDIMK
FT                   IDVAALLRQEFGGLPVAVCANLPYYITSPILMLLLESRLPLTSITVMVQKEAAQRLCAQ
FT                   VGTREAGAITVGVHYYGEARQLFPVSRGSFMPAPNVDSAVIRIDLHENPHPEGLDEGFF
FT                   FRMVKAGFSQRRKTLANSLASLLGIPKQAVYAALEQAGLAPAARIEQLTMEQLFALARI
FT                   LQSA"
FT   CDS             677366..677518
FT                   /transl_table=11
FT                   /locus_tag="RUM_06260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16842"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB47"
FT                   /protein_id="CBL16842.1"
FT                   /translation="MIFIAPAFPNGMPPEQPECCKGLRQDSACLPWYTFCIKAASHKEH
FT                   AVLSQ"
FT   CDS             677547..679772
FT                   /transl_table=11
FT                   /locus_tag="RUM_06270"
FT                   /product="Stage II sporulation protein E (SpoIIE)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16843"
FT                   /db_xref="GOA:D4LB48"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB48"
FT                   /protein_id="CBL16843.1"
FT                   /translation="MIKERTTERLTRGQAGALLLSGVSAFLLTGARFGEFSSPLQVSLA
FT                   AVVSPLQGVAVLAGSLFASVTQGTLGDAPVLLCALVMIVLSGFVLPRRTSAGMGALAAA
FT                   AGLSISAGLFFVIGGIDLADLALYLCMAVLAGVAAYFAAEALTAFRPAAGGYSEPNGCA
FT                   FGVCFLLVTGALGSAQLWICNLGVIFAGFVLLQGAKRYGIAGGTVCGVLASAGLMLCSR
FT                   ELGDAAAFLALSGMAAGYFADFHKGAVCLLFLAIQGAGQLLLGTDSAAILLLLNLSAGC
FT                   LLYLALPVEGILEQWLPEVGGEEAPAGFAAVQMDYLAHALAGVRQNAQQIARMLERNGC
FT                   RETTAQSVCEQVCRSCSRRLECWEERYEETAEAFRCAAAGDGTELPEALQDCARAQTLL
FT                   VHMQQAQRQAALHRMLSARLTESQGFLFSQMELTEELLGTAGQRLAVSYSRSMTRKVTQ
FT                   RLEREGYPVHTAVAYRSAEGRLALELYAFADAAPDGGSVRDCLSDALGMELDYTEGRLA
FT                   GEEVRICLWERPPYGLAVFAAQSSARDEEPPGDSYDQFSDGRGHQYLVLSDGMGSGRRA
FT                   SLDARLVLSNFRRLIEMGVSMQTAVGMVNHIMLTKSTEETFATLDIARISQETGETLLV
FT                   KYGAAPTLIQQGQVVTMYQTPTFPIGIVGRPEAHVTRLRLEDSDVIVLMSDGVEDSEYA
FT                   FVKQKLLAGGSLQQAAQAICCKAQRSAADGRPDDITVLLAQVRRNTD"
FT   CDS             679994..681934
FT                   /transl_table=11
FT                   /locus_tag="RUM_06280"
FT                   /product="alpha-1,4-glucan:alpha-1,4-glucan
FT                   6-glycosyltransferase"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16844"
FT                   /db_xref="GOA:D4LB49"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB49"
FT                   /protein_id="CBL16844.1"
FT                   /translation="MIPDLQKENEFPLSLFLSGKNCKSYLFFGAHTISSKGTQYHCFRV
FT                   WAPHARSVSLVGDFNRWDRSQTPMHAIGGGVWECCIPRLEQFAAYKYSIKGRDGKIRMK
FT                   ADPYGAHYETRPATASKIYESSYEWKDDAWRKAKRQRNIYKSPVNVYEVHFNSWRINPD
FT                   GSFLDYRTFAKQMIPYLQKMSYTHIEFMPLTEYPYDGSWGYQVTGYFAPTSRFGTPDDF
FT                   RAMVDAFHAAGIGVILDWVPAHFPKDEHGLFEFDGGCCYEYEDVRKGEHFAWGTKVFDY
FT                   GRPEVCSFLISSACCWFEEFHVDGLRVDAVASMLYLDYDRPDGQWCPNKNGGRENLEAI
FT                   DFLRHLNEAVFEKFPDALMIAEESTAWPMVTKPTCDGGLGFNFKWNMGWMNDMLSYMSM
FT                   DPLFRSGNHDKLTFSFFYCFSENYVLPISHDEVVHGKCSMIGKMSGGYDQKFDSYRAFL
FT                   GYMMAHPGKKLLFMGQEFAQMKEWDYQHQLDWMLLDYPKHNTMLKYTRKLNRFYAEHPP
FT                   LWERDDSWDGFSWIANDDYQQSVIAFRRFDDKGEELIVVCNFVPVERREYRIGVPYKGS
FT                   YKLLFNSDATEFGGSGAAEKAVKSEAIPMHGFDNSIALTLAPLSTMFFKPVPYKKRRST
FT                   KKSAPSKAAQK"
FT   CDS             682026..683201
FT                   /transl_table=11
FT                   /locus_tag="RUM_06290"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16845"
FT                   /db_xref="GOA:D4LB50"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB50"
FT                   /protein_id="CBL16845.1"
FT                   /translation="MLLAGGQGSRLYALTQDMAKPAVPYGGKYRIIDFPLSNCTNSGID
FT                   TVGVLTQYQPLVLNDYIGNGQPWDLDKLHGGVHVLPPYQTNAGASWYEGTANAIYQNMS
FT                   FIERYDPEYVIILGGDHIYKMDYSKMLQFHKQHQADSTIAVLDVPMEEASRFGIMTCDE
FT                   EGRVVDFTEKPKEPKSTLASMGIYIFTWKKLKQYLIENENANSGSKDFGKDIIPAMLAA
FT                   GERLFAYAFEGYWKDVGTLDSLWEANMDLLSPSVPLDLYDKEWKIYSRNLNMPPQYIGD
FT                   KAAVENSMISEGSEINGTVDFSIIFSGAVVEENATVKYSIIMPGTVIKAGAVVEYAIVG
FT                   EDCVIHENAKIGASPETIENRDEWGIAVVGHKVDVSEGKTVLPKQIISDNL"
FT   CDS             683214..684338
FT                   /transl_table=11
FT                   /locus_tag="RUM_06300"
FT                   /product="glucose-1-phosphate adenylyltransferase, GlgD
FT                   subunit"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16846"
FT                   /db_xref="GOA:D4LB51"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB51"
FT                   /protein_id="CBL16846.1"
FT                   /translation="MSANISVMGLIFASMHDSSIIDLTKLRTMGSVPFGGRYRLIDFPL
FT                   SNMVNSDIDDVGVITKSNYGSLLDHLGSGREWDLSRKNGGLHLLPPFSHVGTGIYRGRL
FT                   EALDGVWEYVEHSPAEYVVLSDCDIVTTIDYRPMIRAHIESGADITVAYSKGFYDKDVN
FT                   QNATLLGIGEDGMVDDVMIDPPMRGTGNLCMNTFVLSKSFLKQLVKEKMSRNQYSFSRD
FT                   VLQDKAAGYRIAAYEHTGYVARLDSLSSYYEANLALLNPENRNGLFKKSAPIYTKIMDN
FT                   GPVRFGLESDIQNSLIADGCIIEGKVENCVLFRGVKIGKGTVVKNSVIMQNTSIGSKCS
FT                   LNCVITDKDVEIVDDRVLTGSQSYPLYISKGAKI"
FT   gap             684800..685844
FT                   /estimated_length=1045
FT   CDS             complement(686960..688654)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06330"
FT                   /product="Endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16847"
FT                   /db_xref="GOA:D4LB52"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="InterPro:IPR018242"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB52"
FT                   /protein_id="CBL16847.1"
FT                   /translation="MKQFWRKTASVMTAAALLAGTSVFFTDAMSGQGLRASAVDDTNDD
FT                   WLHAEGDKLYDMYGNEVWLTGANWFGMNCSECFLHGLWSCDMSDTLASIADHGINLLRI
FT                   PVSTELLYYWMIGEPDPASGINAKNTPDYSFNPELCREDGTQMDSLEIFDVLLKLCKEN
FT                   GIKVMVDVHSPDANNSGHNYELWYGKEMSTGVMVTTEIWMDTWVWLADRYKNDDTLIAL
FT                   DLKNEPHGKRGYDSATCPTTIAKWDNSTDENNWKYAAETCAKKILEVNPNVLIVVEGIE
FT                   QYPKTEQGYNFDTPDVWEPTVDRPSPWHPAWWGGNLRGVKDYPIDLGEHQDKLVYSPHD
FT                   YGPSVYAQTWFDKDFTTQTLLDDYWYDTWAYIDDQGIAPLLIGEWGGHMDAGKNQKWMG
FT                   LLRDYMIENHINHTFWCINPNSGDTGGLLDATFSKWDEEKYGLMEPSLWQDDNGRYISA
FT                   DHVYPLGSNGQSLTEYYGGTPTPPTTTTKPADTTASGTVTKGDLNKDGKVTIADLLLMS
FT                   RYLVREIDASKIPSTAACDVNGDGRVNAVDCVLVKQFLAHLIDKFPA"
FT   CDS             688928..689833
FT                   /transl_table=11
FT                   /locus_tag="RUM_06340"
FT                   /product="Thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16848"
FT                   /db_xref="GOA:D4LB53"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB53"
FT                   /protein_id="CBL16848.1"
FT                   /translation="MYEILIAGGGIAGLTAALYAARAGCSTLVLEQQYYGGQIVNAPLV
FT                   ENYPGIDQISGADLAKRIYDQALGAGAGYESARVERAERRQNGFALHTDRGIFEGRGLI
FT                   LATGARSRPLGLAREEALTGHGVSYCAACDGGLYRGKNVAVVGGGNTALLDCLLLAQGC
FT                   GRVYLIHRRSSFRGENALLEQVQALHNVEIRTDASVTELLGQERLSGIRLQSGETLAVD
FT                   ALFIAVGRHPRTEPFARLVELDPGGYIRAGEDCRTTAQGIFCAGDCRTKSTRQLCTAAA
FT                   DGAAAALGLCEWLSNEKKQA"
FT   CDS             complement(689860..691092)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06350"
FT                   /product="phenylacetate-CoA ligase"
FT                   /function="phenylacetate-CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16849"
FT                   /db_xref="GOA:D4LB54"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011880"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB54"
FT                   /protein_id="CBL16849.1"
FT                   /translation="MKMTETQFNLIKAQLKKLTSQPCFYQRKLEGINIDQIQSQEDFEA
FT                   LPFTWKGDLREAYPLGLQAVPDEEIVRIHSSSGTTGTPVIIPYTRQDVEDWAEMFKRCY
FT                   ETAGITNLDRIQITPGYGLWTAGIGFQNGAERLGAMVIPMGPGNTDKQLRMMMDMKSTV
FT                   LCATSSYALLLAEEIAKRGIGNRIHLRKGVIGSERWGEKMRNRIANELGVQLYDIYGLT
FT                   EVYGPGIGISCDHACGMHVWTDYLYFEVVDPKTGKNVPDGEIGELVITTLHKQGAPLIR
FT                   YRTHDLTRVIPGECPCGSPFPRIDTILGRTDDMVKVKGVNIFPSQIEELLTGIEGASSE
FT                   YQFMLDHVNGKDICTLFVEANDGANRYELEIELQNAFKSKIGISVNVKPVSIGELPRSE
FT                   KKSTRVFDNRY"
FT   CDS             complement(691108..691689)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06360"
FT                   /product="Pyruvate:ferredoxin oxidoreductase and related
FT                   2-oxoacid:ferredoxin oxidoreductases, gamma subunit"
FT                   /EC_number="1.2.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16850"
FT                   /db_xref="GOA:D4LB55"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB55"
FT                   /protein_id="CBL16850.1"
FT                   /translation="MTSTSCLLCGVGGQGTVLASKLLAYAYMQQGKSVRTAETIGMAQR
FT                   GGCVVSHVRAGAEIHSPLIPKGKADVMIAFEPAEAVRCLPFLKQGGTVVVNQKAVKPVT
FT                   ASLSGLAYTGAEMLEYLQSAGIRTILIDGDAVCAACQSPKVLNIALLAAAANTDALGIS
FT                   VAQLKDAVQKLVPEKFHALNLGAIEYVCNR"
FT   CDS             complement(691686..693467)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06370"
FT                   /product="indolepyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16851"
FT                   /db_xref="GOA:D4LB56"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB56"
FT                   /protein_id="CBL16851.1"
FT                   /translation="MGNAAIAMGALHAGVNLVAGYPGTPSTEILETVAKCNDGSVYVEW
FT                   SVNEKAALEVAAGASYAGARTLVTMKQVGLNVASDPLMSLAYVGVKGGMVIVSADDPGP
FT                   ISSQTEQDTRHFAQFAKLPVFDPSTPEEAYEMIQDAFAYSEKYGTPVLFRPTTRVCHSC
FT                   ADIQLHETPTVHKPEGFVKDTMRWVIFPRTSYLNHIKLEERTPVLSKDFSAYRFNQLTG
FT                   SGKLGIVTSGISYTYLQEALEDYTGQVKVLKIATANPFPEELALQFLEGLEQVLAIEEL
FT                   DPVLERALTYLCGKHHLPVQIHGKLDGMVQPAGENSVESVHKVLEGYLGLDAVPAVRLP
FT                   EPPQMPVRPPVLCAGCPHRASFYAVKQAMKGRKAVFSGDIGCYTLGNAMPLDMVDTCLC
FT                   MGADITMAQGLHRIEPDTVNFSFIGDSTFFASGMTGIVNAVYNRTDIILMVLDNSTTAM
FT                   TGHQPHPGTGMTMMHEISPRVSIEAILRAVGLTSVETVDPLNLEQTIQAVRTAADKSGV
FT                   KAIICKSPCIAVSKPAKRLQVDESRCVGCKQCIRELGCPAISLKGQKAYIEPDLCFGCT
FT                   ICAQVCKPGAIREEDAQ"
FT   CDS             693697..694545
FT                   /transl_table=11
FT                   /locus_tag="RUM_06380"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter membrane protein 1,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16852"
FT                   /db_xref="GOA:D4LB57"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB57"
FT                   /protein_id="CBL16852.1"
FT                   /translation="MQKIKETGMRLLFALCACISILAVVLICWFLFSNGIPAIGEIGAD
FT                   KFLLGERWKPLEKQFGIFPMIIGSIYVTAGAVLVGVPIGILCAVFLARFCPPRLHRLLK
FT                   PAVDLLAGIPSIVYGFFGLVVIVPLVQSLFGGSGKGILTASVLLGIMILPTIISVTEAS
FT                   IRAVPESYYEGALALGATKERSVFCALMPGARSGITAGVILGTGRAIGETMAVVMVAGN
FT                   AAVMPDGLLSGVRTLTANIVLEMGYAADLHREALIATAVVLFVFILIINLMFSLLKRKE
FT                   G"
FT   CDS             694547..695410
FT                   /transl_table=11
FT                   /locus_tag="RUM_06390"
FT                   /product="phosphate ABC transporter membrane protein 2,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter membrane protein 2,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16853"
FT                   /db_xref="GOA:D4LB58"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB58"
FT                   /protein_id="CBL16853.1"
FT                   /translation="MKLSKALRQYRGHKGSLAVRLLLYGAAVFTIGLLLFLIAYILVKG
FT                   IPNLTPELFAWKYTSENVSMLPSIINTLLMTGLTLLLAVPVGVGAAVYMTEYAKTGSKL
FT                   VKVVRITTETLQGIPSIVYGLFGFLFFVIACGWDYSLLSGVCTMAIMVLPLIMRTTEEA
FT                   LLAVPGTYREGSFGLGAGKLRTIFTIVLPSAVPGILSGVILAVGRIVGETAALIFTAGT
FT                   YAAVPKDLFSSTRTLSVHMYALLNEGLYTNQAYATAVVLLVVVIGINCLSGAVAKKFAG
FT                   GANKDE"
FT   CDS             695403..696152
FT                   /transl_table=11
FT                   /locus_tag="RUM_06400"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /EC_number="3.6.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16854"
FT                   /db_xref="GOA:D4LB59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB59"
FT                   /protein_id="CBL16854.1"
FT                   /translation="MNKFSISDMNLHYGSFHALKNVQLEIAPREITAFIGPSGCGKSTL
FT                   LKSLNRMNDLVEGCRIDGQVLLDGEDIYGDMDVNLLRKRVGMVFQKPNPFPMSIYDNVA
FT                   FGPRTHGIRSRVQLDELVEQSLRSAAIWDEVKDRLRKSAFGLSGGQQQRLCIARALAVK
FT                   PEVLLMDEPTSALDPISTLKIEDLATELKKDYTIVMVTHNMQQATRISDKTAFFLLGEV
FT                   VEFGVTDQIFSMPKDKRTEDYITGRFG"
FT   CDS             696165..696863
FT                   /transl_table=11
FT                   /locus_tag="RUM_06410"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16855"
FT                   /db_xref="GOA:D4LB60"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB60"
FT                   /protein_id="CBL16855.1"
FT                   /translation="MRNRFDEQLRQLKLDMIRMSSLCETAITVTMQNMLSSDQVYTLDD
FT                   SEEAFQQLQNIKNTYEKAGFLKEEIDQMERQVENQCMKLLLHQQPVAKDLRVISAAMKM
FT                   IYDLQRIGDQAYDIADISRYVQDTELMHRLPMQQLADAAVAMVTDSVDAFVRMDFALAK
FT                   HVIAADDTVDEYFSRMKEELAKVLRQDGDSSVCLDILMISKYLERIADHAVNIADWVIF
FT                   AQTGAHSGKE"
FT   CDS             697567..699231
FT                   /transl_table=11
FT                   /locus_tag="RUM_06430"
FT                   /product="Signal transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16856"
FT                   /db_xref="GOA:D4LB61"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB61"
FT                   /protein_id="CBL16856.1"
FT                   /translation="MKRSIFKGMLLVSVLSLLACTVLIMDVLYGYFDKRANEELHQQAT
FT                   SIARGVEAAGMEYFEGFQASERVTWITAAGTVLYDNQADQSRMENHSDREEFIKAKSDG
FT                   AGEATRYSSTLAEKTIYYALRLEDGSVLRVSQTQYTVLTVLMGLATPVVIVLLCVMILS
FT                   AVLSSAVVKRIVKLINAIDPEHPDTDADYEEIAPLLYKIHTQNQEIARQMRTLKKQQEE
FT                   FRQLTAHMREGLLVADSHCEVLSWNAAALEIFGVPESTDTRNIYEFNRSEPFRMAVEQA
FT                   LAGQPAEQLLSLGQHSYRMLASPVQEQDAVTGIMVLLLDVTEQEHREQLRREFTSNVSH
FT                   EMKTPLTAIHAIAGMLVQDVIEPKDVKKFAGDIYRESARMIALVNDTLRLSRMDENGIA
FT                   EPKEPVDLYDLAEEVIARLRVTAEKKQVAFSLAGTHVTVNGVYSMLEEMIYNLCDNAVK
FT                   YNKEQGTVTVSVLTAGKEGILMVQDTGIGIPQEDQSRIFERFYRVDKSHSRAIGGTGLG
FT                   LSIVKHGAAYHNAQVQVSSKPGEGSTFTVIFPETLQA"
FT   CDS             complement(699335..699706)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06440"
FT                   /product="LSU ribosomal protein L12P"
FT                   /function="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16857"
FT                   /db_xref="GOA:D4LB62"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB62"
FT                   /protein_id="CBL16857.1"
FT                   /translation="MASEKILKFVEDIKGMTVMELSELVDAIQEEFGVTAAIAAAPAAG
FT                   AGAAAAEEKTEFDVVLASFGDSKMGVIKAVKEILGLGLKEAKEVVESAPKTLKEGASKA
FT                   DAEEIKTKLEAAGATVELK"
FT   CDS             complement(699754..700263)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06450"
FT                   /product="LSU ribosomal protein L10P"
FT                   /function="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16858"
FT                   /db_xref="GOA:D4LB63"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB63"
FT                   /protein_id="CBL16858.1"
FT                   /translation="MASEKVLEAKKAKVVKLTEQLQSAVSCVFVDYKGITVEQDTKLRK
FT                   ELREAGVHYSVEKNTMLRFALHNIGMNDFDGILEGTTAVAISNDDQTAPARILGKFAET
FT                   QDDKFNLKAGFVEGVAYDQAGVMALSKIPSKDVLLAQLVGSLQGPIQKLAATVKAVADS
FT                   KSDDAA"
FT   CDS             complement(700493..701665)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06460"
FT                   /product="Stage II sporulation protein E (SpoIIE)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16859"
FT                   /db_xref="GOA:D4LB64"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB64"
FT                   /protein_id="CBL16859.1"
FT                   /translation="MNNFCADIGYRSVNKFGEQLCGDHVDVISPDDHSTVIVLADGLGS
FT                   GVKASILSTLTAKIISTMMAENMKIEDCVATIAATLPVCAVRGVAYSTFTIIRLVENEE
FT                   AEIIQYDNPMVILFRDGKYQDIPSTQMQIDGKTIYRSRIKLQEQDIFIAMSDGAIHAGV
FT                   GMTLNFGWQREDIISYMETFAEVGFTAKTLTTILLDECVRLYGGKPGDDTTVCTIRIRK
FT                   RQPVNLIIGPPANREDCNKMMSLFFSKEGKHIVCGGTTSNIAAKFLRKKLIPALDFPDP
FT                   EIPPIAKIEGVDLVTEGIITINRVLSYAKNYLEDNESYAKWSCQKDGASLIARMLFEEA
FT                   TDINFFVGRAVNPAHQNPNLPIQFHIKMQMVNELAECLKKMGKQIKVSYF"
FT   CDS             complement(701658..703328)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06470"
FT                   /product="Iron only hydrogenase large subunit, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16860"
FT                   /db_xref="GOA:D4LB65"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB65"
FT                   /protein_id="CBL16860.1"
FT                   /translation="MSEFLKLRKTNCKNCYKCIRHCPVKSIRFSGNQAHIVGNECILCG
FT                   QCFVVCPQNAKEIADATEAVKVLLEGEEPVVASIAPSFIANYGVGIEAMEQALRQLGFA
FT                   AAEETAIGATYVNRMYEDILRNRKPDVLISSCCHSVNLLIQKHFPQALPYLADVISPMQ
FT                   AHSVDIRRRMPNAHVVFIGPCLSKKDEADHYTGYVDEVMTFEELTRMLEEANIQLEQNV
FT                   DHNSQSRTRLFPTSGGILKTMEKVPGYQYISVDGIENCIAALHDLEQGGLNNCFIEMSA
FT                   CAGSCIGGPVMEKYHRTPIRDYAAVDAYAGSEDFPIETLPQERIHKEMEAINRKLPQPT
FT                   ETEIFTILRQMGKNKPSDELNCGSCGYNTCREKAIAIYQGKADLTMCLPYLKDRAENFS
FT                   DHIINNTSNGILVLNESLEVQQINQTACEILNVRHPSDVLGEQVIRIRDPKDFLDVKNG
FT                   GATIRDRRTYLAEYNKYVDETILYDASYRVLMCMMRDVTEEERQRRTKESIRQQTIETA
FT                   DKVVDKQMRIVQEIASLLGETAAETKIALTKLKGAISDE"
FT   CDS             complement(703360..703599)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06480"
FT                   /product="NADH dehydrogenase subunit E"
FT                   /function="NADH dehydrogenase subunit E"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16861"
FT                   /db_xref="GOA:D4LB66"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB66"
FT                   /protein_id="CBL16861.1"
FT                   /translation="MKIKVCIGSSCHLKGSRQVVEQLQALIAQKKLEDQIELAGTFCMN
FT                   NCQNGVCVSCDDQIYSLTPDTVDQFFNNEVLTKL"
FT   CDS             complement(703950..704621)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16862"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB67"
FT                   /protein_id="CBL16862.1"
FT                   /translation="MKQIFFCPDQWRMDATVPTGVAAITEVTGFDGKTTEAWQLGNWQY
FT                   DWSTIRTDIVLEPGEEYTFVFWLNGGENDQYDEVCNLEVFGEGQWEERQTFRLNRGFIK
FT                   PLKYKNGWYLMAVPFTAPAADKVTLRFNAMRAVTTIAPAEEPAQYEELISDPENYDQAQ
FT                   RSNVVFENGWPEPGEQPVLHFEVNNSDVSITKAQLKKAALVAGGAVAGALILRRIFRKK
FT                   P"
FT   CDS             704906..705661
FT                   /transl_table=11
FT                   /locus_tag="RUM_06500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16863"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB68"
FT                   /protein_id="CBL16863.1"
FT                   /translation="MKNVYKRINRGLVLAGVLLVGFVIYVISDTLQFKKTKPLLKDMAA
FT                   DYMQKLCELNVTPEKYRSLEELAKQPDYVKSIQDDLTKLLNENWKDVESAQSQSFYYYG
FT                   MNRSEVEAGYNSYLKDSGEVYGYITKMTAAVNNADCSVTKCGVNTAQVIMSFDCVVQYV
FT                   GDPCWFSPAYPNAMQDIAGGNMYMYQEDVAIPQGKEQKRSSDLMSTTVTVSYEFTYQLV
FT                   DGDWKIIYLDSLGWENGSTVIVSGEGGEA"
FT   CDS             705661..706608
FT                   /transl_table=11
FT                   /locus_tag="RUM_06510"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16864"
FT                   /db_xref="GOA:D4LB69"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB69"
FT                   /protein_id="CBL16864.1"
FT                   /translation="MEVALKIDHLNKYFGKRQILHDICMEVYAGEVFGFLGPNGAGKTT
FT                   TIKIVVGLLRLDEGDVQIHGHSITKHFEDAMACVGGIVENPELYKYMTGRENLRQYARM
FT                   RTGVDEKRIDEVVELVGLSNRINDKVGKYSLGMRQRLGVAQALLHRPKLLILDEPTNGL
FT                   DPAGIKELRDILKNLAHKENIAVLVSSHLMSEMEMMCDRVGIIVGGRILDVQTTEDMIS
FT                   AAQDTTIRYTLKVSDPAAAVQALTQLPEQAKQAVEDSLVLRIETERADEIIGDVIETLV
FT                   SRQIRVMTCVPEQTKRLEDVFIAMTQENGGAQIG"
FT   CDS             707948..708112
FT                   /transl_table=11
FT                   /locus_tag="RUM_06530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16865"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB70"
FT                   /protein_id="CBL16865.1"
FT                   /translation="MTASLLLILVAAFLIGGVLTIVCGGMFTDRSRYEEDSRQENGTEQ
FT                   DPQKGEHSH"
FT   CDS             complement(708214..709494)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16866"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB71"
FT                   /protein_id="CBL16866.1"
FT                   /translation="MNTRKLLSGAAALALLCSAGGCGQNESEQTHAEVQQNSGTSDIST
FT                   TDAPVSTEPAGTTGTSSVATTAVSTTSVPGTQPQFCMTTNPPVSTCEPQDNSHTEQAQT
FT                   NPDPSANWQEALAAEIETWGGETFCNRLGSTTFRGTRYGFTKREVSETTYEYIFFSVDP
FT                   DNRGSILNRWTKSRPDITTMYACNGRFYLKSNVPGKRYESWVDTVARVIDLYDTSGTLI
FT                   QTCTLPHFNAWHDQVPGDGGELSSDFITVCGNGSILIRQYKTTDAYDRMHFYYLLDPET
FT                   GEKTALPPPYEGAFGFFQCGNPVYPLEVDGVYQNKLYVTCTDDCKQKTGYWYDLNAGVW
FT                   HALDVDLNDSDVNPSDSDNYAIGRFLFTKGRVYDMKTDQLLSGLPESAAPLDPNKLLDP
FT                   NRTLTVNDTGVYLRQDDGSNTAILKWD"
FT   CDS             complement(709593..712340)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06550"
FT                   /product="Pectate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16867"
FT                   /db_xref="GOA:D4LB72"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB72"
FT                   /protein_id="CBL16867.1"
FT                   /translation="MKGFLRMGRSLLLSLTLLAAWMLPLFGDAALPAAAASVDYPVQLM
FT                   NIAAKDNSSVLTAGGTGDGAAVLPKAPGKDLTLSWRFDRVGKDSVGTFFKLVNAASGRL
FT                   LTPAGYQVSAGTSVILYGSESAKSQHWYVIPVQQDRLGNDLYYKIVNYSDTSLALTRGA
FT                   SGMSLASYTGADNQLFLLNADGLQGFAGYCQDDNTGKVKAADIGGLFGEVVEVSTFADL
FT                   KKYATADEPYTIVVTADLKVTSLQKDSSGRYYCPDGRIYVHSNKTIIGSYNAHTLYNVQ
FT                   FCTATKHGVGNNIIIKNFDLQHDAESNGNDSIVVYFGSGQNLWVDHCTFTGHAAVNTAS
FT                   TGLEDWDKFLACCYDADYCSVSDSSFGLHEYGLILGYPADDENSYKTYNNFPRMSLLGN
FT                   RFTNTITRGPGLMRYGYFHSMNNYVNTFSMAYTVHTACKIYAENCYYDGGSIKGNVICD
FT                   WNSVTYPGSYAESGSKFVNCKRTTIEGQAQNCTWRPNKNYSYVTLSADQAKTYCESYTG
FT                   CQTSKNNMMYLRYGTKGIPSAGYTESPSAPTAASFPEGAAYRIKNVNSGLYMQVAGGKA
FT                   ENGANVQQWGTDGTSVHDVWKLYSAGDGYYYIVSALGDGASFVLDVAGKKADNGANLDI
FT                   YQYNGGTNQQFMFTANGSGSYKLRTRISGDASAVEVANGDTGSGANVQQWQINGAACQD
FT                   WILEEAADPGCKMDVSLIYGFENENSGQMMEIANASMQDGANVQQYPSNGLDCQKWVLT
FT                   AYGSGNLYYIRSAQDDSFALRAESGENGGNLSIAPFAAKSDAQLFRFVKNLNGSYSILT
FT                   HASAEACLVETGYASKENGANVQQWENTSNGCQRWLLHTEAKPVRGDVNRDGSLSVADL
FT                   VLVQRWLTRVPDMTLADWKAADLTGDGILTGADLVLLRQALRTA"
FT   CDS             712604..713599
FT                   /transl_table=11
FT                   /locus_tag="RUM_06560"
FT                   /product="SseB protein."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16868"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="InterPro:IPR027945"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB73"
FT                   /protein_id="CBL16868.1"
FT                   /translation="MAEEEKKTPEGQQPEQPEQQAQPTRPAPITNPKLLEAIAQFKSET
FT                   NRVNEIKFLQEMLNARYLVPVIMETPPNETMKPGERVSTRVAFQMLTNDKNEKFIPAFT
FT                   DQDELVKNTVQPRHQVAVLTVRDFAMVFSQNPICKGFVINPFGDNMCLTREQLENLFQH
FT                   ARQVPRQQDGKVLVGGAPSLSSQVDMAMNNLKKEKEMEAYIRAAKETEARKAAEAEESE
FT                   DKPKIQQTVNPVSAAEKPQELIDALSRYLKKQKGVKRAYLQLMLGEQPHYLIAAECDDD
FT                   RAAVFAAIKAEAGTYTDLAVKVVDVASDSAKDLVSGEKPFYEKKRFGLFS"
FT   CDS             complement(713655..714056)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06570"
FT                   /product="Predicted ring-cleavage extradiol dioxygenase"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16869"
FT                   /db_xref="GOA:D4LB74"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB74"
FT                   /protein_id="CBL16869.1"
FT                   /translation="MRLDGFGLFVRDMGRMIRFYRDVLGFEIREDEDTSNVYLIKDGTL
FT                   FLLYGRDDFERMTHRRYEYIKGLNGHSELALYVGTFQEVDEQFRRVVALGATPVLEPET
FT                   EPWGQRTCYIADPEGNLIEIGSFNKPFAR"
FT   CDS             complement(714066..714929)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06580"
FT                   /product="5,10-methylenetetrahydrofolate reductase,
FT                   prokaryotic form"
FT                   /EC_number="1.5.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16870"
FT                   /db_xref="GOA:D4LB75"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB75"
FT                   /protein_id="CBL16870.1"
FT                   /translation="MKTCELFRDHTVLSFEIFPPKPTSPEDTIYRTLDGLRDLHPDFIS
FT                   VTFGAGGGANNQKSLEIASAVKHQYGIESVAHLPGINLTRSEVLTMLEQMQQQGIENIL
FT                   ALRGDVLPDTQPRGEFRHADELISFIREHGDFNILAACYPEGHTESPDTVTDLRNLKRK
FT                   VDAGANQLVTQLFLDNRYFYEFREKAELVGIHVPIEAGIMPVTNKKQIERMVQLCGVHL
FT                   PDKFMKVMNRYEHQPEALQDAGIAYAIDQIVDLITQGVDGIHLYTMNKPYVARRIYEAV
FT                   HRLLYA"
FT   CDS             complement(715017..715415)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06590"
FT                   /product="uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16871"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB76"
FT                   /protein_id="CBL16871.1"
FT                   /translation="MENKSLAQVRELFQDDRFATLNGAQITEIGDHFAKCELELEERHR
FT                   NALGAVMGGATFTLADFAFAVASNWEKPGTVSLSSNITYLGGVKGSRLIAEAHRVKDGR
FT                   TTCYYQVTVTDELGTQVAAVTVTGYHTA"
FT   CDS             complement(715482..716576)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06600"
FT                   /product="GTP-binding protein YchF"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16872"
FT                   /db_xref="GOA:D4LB77"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB77"
FT                   /protein_id="CBL16872.1"
FT                   /translation="MKLGMVGLPNVGKSTLFNALTNAGAESANYPFCTIEKNVGIVSVP
FT                   DERLDKLAEMYHPEKFTPATLEFVDIAGLVKGASKGEGLGNKFLADIREVDAIVHVVRC
FT                   FENIDIIHVDGEINPARDIETINLELIFSDIEMLERRIDRAKKASKGDKKYLAEVDFLE
FT                   RLKAFMEEGHSARAFDFTEDELEMLKSTPLLSAKPVIYAANLCEADFVHNIDTNPHYKK
FT                   VCEIAEAEHSAVLPICAQMEAEISDMSDEDKKLFLSELGLEVSGLGRIIQEGYSLLGLI
FT                   SYLTAGQPEVRAWTIKKGTKAPQAAGKIHTDFEKGFIRAEVVSFDDLMACGTMAAAKEK
FT                   GLVRLEGKDYVMQDGDIVLFRFNV"
FT   CDS             complement(717676..718902)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06620"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16873"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB78"
FT                   /protein_id="CBL16873.1"
FT                   /translation="MAEHAKFTEEMKKTHTILVPNMLPVHFKLFISMFEQYGYHMELLE
FT                   TSSRAVVDEGLKNVHNDTCYPALLVIGQFLEALKSGRYDVNRVALLITQTGGGCRASNY
FT                   IHLLRKAVEREFPQVPVISLNFSGLEKDSAFKVTPPMFLKLLYGVLYGDLLMSLYNQCK
FT                   PYELERDATDRCLAKWQKRLEESFANGGYLHTGRNYRAILEDFAKLERSKVKKIRVGIV
FT                   GEIYVKYSPLANNDLEKFLLSEGCEPVVPALLEFVMYCAAGTVVDAKLYDHTTNMTRLY
FT                   RLGYKLIYSRLKQQIRIVKQHGVFDPPHDFEEVRRAADEYISQGVSMGEGWLIPAEMAM
FT                   LAKSGTKNIICAQPFGCLPNHIVAKGMSRAIKQKHPDANIVAIDYDPGATRVNQENRIK
FT                   LMLSNAKQG"
FT   CDS             complement(718939..721866)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06630"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16874"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB79"
FT                   /protein_id="CBL16874.1"
FT                   /translation="MQTQYSLGIDVGSTTVKTVVIDDAKQIIRSRYQRHYSRIKETVSE
FT                   QLEQIAGEYPDSLFTLCITGSAGLGLANHADLPFVQEVHAAFIAVKEAYPDTDVVIELG
FT                   GEDAKIIFLTGGVEQRMNGSCAGGTGAFIDQMATLLGVTADELDRLALQAEQVYPIASR
FT                   CGVFAKSDIQPLLNQGARREDISASIFQAVVDQTVSGLAQGRQIQGKVLFLGGPLSFQK
FT                   GLRKAFVQTLGLDDAHAVFPETAPVFVAYGCALFAKEGGTPMRLSDCLEKLQKARGGEQ
FT                   RMTGRRLFEDRAEYEAFIQRHKQHDLKYADLHTYTGDAYLGVDAGSTTTKLVLITGKGE
FT                   LLYSHYASNQGQPLDKIAEKLREIYREKNPAMRIRASAVTGYGEELMKDGLGMDFGIVE
FT                   TVAHYRAASYFCPDVDFIIDIGGQDIKCFKIKNHTIDSIMLNEACSSGCGSFIQSFAQA
FT                   MGYDIAEFSQLGLFARNPVDLGSRCTVFMNSSVKQAQKDGATVEDISAGLSASIIKNAI
FT                   YKVIRAKSVEELGQNIVVQGGTFLNDAVLRSFEQELGRNVIRPAISGLMGAFGAALYAM
FT                   EHQKAESTLISPEALAQFSYTTRAATCKGCTAHCSLSIVRFSDGHTYISGNRCEKGAGK
FT                   AKGTSLPSMMAIKYDRILHTNDTKSAHPKARVGLPMALSFYEQMPFWHAFFNVLGFETV
FT                   RSEESDRNVYYKGQHTIASDTICYPAKLTHGHIESLLEQKVDFIFYPCMSYNIDEGEND
FT                   NHYNCPVVAYYPELLKANNPKLNKQNFRFPYMDLNQPKNVARVMQETLADYVITRKQTK
FT                   AATEAAFAAQKQYREWVIAEGQRVIAQAREAGKPIIVLAGRPYHIDPEINHGIHKLITS
FT                   LDMAVVTEDCVAHLGHVQDLQILNQWTYHARLYRAAEYVTTQPDMQLVQLVSFGCGIDA
FT                   ITTDEVRSILERKGKFYTQLKIDEINNLGAAKIRLRSLVAAMEQT"
FT   CDS             722161..724194
FT                   /transl_table=11
FT                   /locus_tag="RUM_06640"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16875"
FT                   /db_xref="GOA:D4LB80"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB80"
FT                   /protein_id="CBL16875.1"
FT                   /translation="MKKWSITRPDEAAAGALTKGSDLEPLCAVVLAARGIRTVQAAADF
FT                   LGSDELSDPFLIRDMQEAAEVINEAVESGKPICVYGDYDCDGVTATVMLYSYLECLGAD
FT                   VRFYIPERSEGYGMNEASIRQLAQEGVSLIITVDNGIAALAEAELIAQLGMTLVVTDHH
FT                   QPGECLPRAAAVVNPHRADCPSPYKNLCGAGVALKLIAALDGGGYDMALEQFGDLAAIG
FT                   TVADIVPLDGENRFLVRRGLEYLQNTEREGLLALIQVAGLAEKPLDAHSIGFMLAPRIN
FT                   AAGRFGSPTLAVRLLLCDDPQEAESLAAQLDQLNTERKAAENAIMQQIDQKLREEPALL
FT                   HARVLVLAGEGWHPGVIGILAARLVERFGKPCFLLSVEGDTARGSARSFGDFSVYQCLH
FT                   AASGVLTHWGGHKGAGGMTLSAADLPEFDRLVQQYAREQFPVMPVPELSALLLPPALYT
FT                   PKQAAGLEVLAPFGAENPEPLFAVVGASVTGVTSTKNGQHSRITLRYGDVNISAFWFFC
FT                   KPDALPFRQGDACDLLLTIQADSWNGKPCIRARIRDGRLSGTKQSAYFAAQASYEAYWR
FT                   KEALPRAYYGRMLPARQELIRVYNAIGQEDMPLEALYAACAGTDLNYCKFRICCDIFAE
FT                   RGLIALDPAAGTLRRLPVTAKVQITESQVFLELHRLAENGFT"
FT   CDS             724209..726422
FT                   /transl_table=11
FT                   /locus_tag="RUM_06650"
FT                   /product="(p)ppGpp synthetase, RelA/SpoT family"
FT                   /EC_number="2.7.6.5"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16876"
FT                   /db_xref="GOA:D4LB81"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB81"
FT                   /protein_id="CBL16876.1"
FT                   /translation="MPEEICTIDMLIQKILTEDKQYDLSKIISSYEFAAKAHEGQTRSS
FT                   GQPYIIHPLSVSYILLELGMDTDTICAAMLHDVVEDTPVTLEEVKKRFGQDVAMLVDGV
FT                   TKLNKIPIFSPEEQQAENVRKMLLAMSQDIRVIIIKLCDRLHNMRTLRYRPSYKQRKTA
FT                   LETMNIYAPIAHRLGIRAVKEELEDLAFRYLDPYAYAEIEHILEIKKEEREAFIESIKK
FT                   RIADRFKDVEFSAPPQIDGRVKSIYGIYKKIFVNHKSIEEVYDKYAVRIIVNTVGECYN
FT                   VLGLIHDMFRPIPNRFKDYISTPKANMYQSLHTTVLGREGIPFEVQIRTWEMHATAEYG
FT                   IAAHWKYKEGVQGKDKMEERLAWIRQVIEAQQASDDAEEIVRIIKNDIAPEEIMVMTPR
FT                   GDSIALPIHSTIIDFAYRIHSEIGNKTIGAKVDGKIVPLDYQLQTGQICEIITSKDPKK
FT                   GPSRSWLEIAKTNEAKSKIRAWFKKECRGENIETGKNALEREFRRYQIHVPEDKLEEFL
FT                   ADDLKRHNCSTLDDFYASIGYGGILLSKIMSRLRDKYVKQYKTEETAPTPEAPNPGVRA
FT                   RNTGSIILDDIDSCVVKYAQCCNPLPGDEIVGFITRGHGISIHNKNCVNYRAAMKRNDP
FT                   AEAERWVNVQWAATPQTAMQTGIEVIATDRVGLVYDITGVLMESKIPIIHSASRNLKNG
FT                   NALFEAAITIAGTEQLRNLMDKIRHVKGVISVERAAVKTEKNG"
FT   CDS             726474..727100
FT                   /transl_table=11
FT                   /locus_tag="RUM_06660"
FT                   /product="Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16877"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB82"
FT                   /protein_id="CBL16877.1"
FT                   /translation="MKVHMLSLGPLGANCYILETDQKNAIAVDIGGDPEILLRLLRQQG
FT                   LHLDRILLTHGHYDHIGGVAQVQQETGAPVYIHGDDLGMLTDEIRSLSTPMGMQGFAPV
FT                   PDADTLTDGEHIRLDDVELTVLHTPGHTPGSVCYLGNGLLLSGDTLFRQSIGRTDFPGG
FT                   SMPQMRKSLTRLNGLTGDLLIYPGHNGASTLDYEKEHNPYLRDYT"
FT   gap             728259..728593
FT                   /estimated_length=335
FT   CDS             728840..729184
FT                   /transl_table=11
FT                   /locus_tag="RUM_06690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16878"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB83"
FT                   /protein_id="CBL16878.1"
FT                   /translation="MEYDAWSDLRKVFDAAAEKTGSAIAYSRLRLERAKCLNRLNGLYE
FT                   ELGRASYFALVRSREPDTASLVEQITRKRRELEELCAGLGEGSTVTCPFCAGQNRSDST
FT                   YCADCGAPLT"
FT   CDS             729181..730536
FT                   /transl_table=11
FT                   /locus_tag="RUM_06700"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /function="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16879"
FT                   /db_xref="GOA:D4LB84"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB84"
FT                   /protein_id="CBL16879.1"
FT                   /translation="MRKKNEIVPLTITGMTAEGNGVGRIEGEAVFVPRTAVGDKLQCRI
FT                   VKAMPTYAFGIIEQLEEPSLDRIQPDCPVYASCGGCAFRHMTYQAECNVKQQVVEDAFV
FT                   RIGGLHPVFLPILGCDTPIGYRNKAQYPVGMQNGQAVCGFYAKRSHRIVPYTHCALQPP
FT                   LFGEILEAALEHIRQQGLQPYDEQRGTGLLRHLYLRQGYHSGEVMLCFVVTRPAREQLM
FT                   PLSQQLQHRFPQLTSICMNVNPARTNVILGKRTETLLGQAAIRDTMCGIRVELSPHAFY
FT                   QVNTAQAERLYGIAREFAQLDGRQSLLDLYCGTGTIGLSMADGVKHLTGVEVIPQAVEN
FT                   AIRNARENRIENADFHVGDAAQWAQQLAQRGEHPDVIVLDPPRKGCDAQTLEAVCRMAP
FT                   QRIVMISCNPATAARDCALLDKMGYHAQKVQAVDLFPRTGHVECVVLMSRKK"
FT   CDS             complement(730805..731545)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16880"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB85"
FT                   /protein_id="CBL16880.1"
FT                   /translation="MRKQSIDSKVAKQTKEENERIEAFRRLISLIQSKIYNPLMQIVDS
FT                   FNRNTANGKLKLSNIEINDEEETFSFQYTVEPLSEDEDEREISFCFMTTPIEETQPLRV
FT                   IPTTVYYDEDDKNELLNNIINPNPRIIEYKYLKSKILLWGVIQADCGVGINVAILDNPA
FT                   DPLYGILKVFLRVPNIHGWNYWIPIETKEQLKSVCPYFREYNYSTKVEDFEFNVIKTLI
FT                   QFNITFSYGQIKDPNGNGLIAKLY"
FT   CDS             complement(731680..732438)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06720"
FT                   /product="Protein kinase domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16881"
FT                   /db_xref="GOA:D4LB86"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB86"
FT                   /protein_id="CBL16881.1"
FT                   /translation="MKRIDIGTIVVDDNNNQYSIIDEVGSGGFSRVYKATCNGGFYGIK
FT                   VLDHFDSKSIYSLKNEFDIASRVASDHAIKYYYLNEHGHNDYPCFIVMEFADGGSLEDE
FT                   LKTLERIGASYPSEKLFDIYIQLIDGMIDICQEAVHRDIKPANILKSNGKYKISDYGLS
FT                   KYINEATRSASKTMKGYGTKEYYAPELWANPGEHGLNNIQVDIYAMGIVFYQIANNRYP
FT                   YNDTGDYRTMHMTAAINPFNSNVDTVFRIS"
FT   CDS             complement(732473..733807)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16882"
FT                   /db_xref="InterPro:IPR025748"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB87"
FT                   /protein_id="CBL16882.1"
FT                   /translation="MKPKLFLIAALCLSLTACGMDSSTTPAQQPTDQVTEQTTPAESVC
FT                   RATITEINGNTVTVTPVDGSWELSSADKFTLSASLLDEGVTPAVGMTLEITYDGNILEI
FT                   YPAMFGNIQKVTVVSEPATASLSNKGTLMNDLEYEIAKGDSYNSKYKQRGYCVDVVDGK
FT                   YQYTICSGERSTGGYGIKVTGLDCLDCGTVIVTVEETAPAQDETVTEAFTYPNCAITFS
FT                   HEPPDGIIIKNSSGFEYECLGILTSTQDLKTPRYSLPRRAIMVNGTLYVDTGYVSSLVR
FT                   CGMLDGTIEKVIDSSEIPDEDGEANFNAEGWQYGFEKDTLDVQIGNEFCIFAAEGSYTA
FT                   EDGYIPEGVMHFMATVDEVTDDGFVIVKTDTPSERFPQIKKDVRYRLSMEAYDPGIYNG
FT                   ELAPGNVLIVACKGNFEGEDPVTITDVYSFSPVGSSPCQPYDASK"
FT   CDS             complement(733835..736000)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06740"
FT                   /product="conserved hypothetical protein, ribA/ribD-fused"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16883"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB88"
FT                   /protein_id="CBL16883.1"
FT                   /translation="MITIKQISITDLSTDAIVNAANEHLQAGGGVCGAIFSAAGYDKLQ
FT                   AACDVFKHCDTGSAVITSGFDLKAKYIIHAVGPIWRGGQNGEPQALYNAYKRSLELATE
FT                   NGCHSIGFPLISAGIYGYPLEDAWRQAIHACRDFENSSTHSIEIIFAVLDKRIIDTGIE
FT                   ILNELNSSSSSLLFENLLISGRQVEAVFFHLPNELYGFLSNWYMSPFDLDGVHYSSMEQ
FT                   YIMYQKCVLFGDQATAKKVLLTDDPSEQQKLGKLCTGYINGVWAGARQAIAMRGLLAKF
FT                   NQNADLRERLINTKEAYLVECAHSDKIWACGIRLNESERFDATKWTGQNILGFALMAVR
FT                   EIIQENHEVNNTRSIDKFHGCLIGGAAGDALGYAVEFMHENQIISKYGNDGITEYELKN
FT                   GVAEISDDTQMTLFTANGLLFGTTRGMTRGIMGDYESYIQIMYQNWYRTQKETYPIQED
FT                   YLCSWLMNIPALFSRRAPGNTCLSAIKQGAEGSTVHPINDSKGCGGVMRVAPIGLYFVN
FT                   KHQQFEMSDKLGAEAAALTHGHDLGFIPAAALVHIIRALLEERISLKDAVKDAIDAMRK
FT                   LFPDAKHINEFTAIMEKSIMLSDTASDDLNAIHQLGEGWVAEETLAIAVYCALKYERDF
FT                   DKAIRVAVNHNGDSDSTGAVCGNILGAYLGYDAIPQKYKEHLELHDIIIEIADDLYNDC
FT                   RISEYDSNRDEVWESKYIYATYPGGKR"
FT   CDS             complement(736040..736978)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16884"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB89"
FT                   /protein_id="CBL16884.1"
FT                   /translation="MIFDNELFYERILELCRVAGITTTSFPLTHNQSPKQVVYIESEKD
FT                   ILLTAYQRKQLASIEYVSHLFDIPSDAFDDTTEKNKISFYSVVLSSTLSERSQLAADTH
FT                   AFLHTSFGSEVSIVFYKHDDYTMLSMSGFGHQSILSDWFSLYDELDDLLYKLDISNFSI
FT                   KSSKAFYIDFVYNCARWYYTHPYSYDYAALELFPVDYFKENDIHDIEQEQLEELIRQIK
FT                   NRAVIEYGDDYVDQDDITVTVTSDYNLDLELLLLDIDDEAQEQNPFGEDPYEDDYPEDD
FT                   LDEYEYADIDSELFNDPILLMKWLEKQDKQG"
FT   CDS             complement(737001..737552)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16885"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB90"
FT                   /protein_id="CBL16885.1"
FT                   /translation="MFDRDYTITGKHATFLKFLAVKNSKEDEADVPKSSAKLLERYIDV
FT                   YMNAAVWGILYSKRAPKDTDSKDRARIYADAYSAEHANCEFLYRLVMLLDESVELTPSE
FT                   RVDRAFRYDSDESKKEEAQQCMELFHEYVRGGLELMYEQFTDGCINRIDYMERVYEVMT
FT                   TFKREYEGFSYDEALAKLMK"
FT   CDS             complement(737565..739547)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB91"
FT                   /protein_id="CBL16886.1"
FT                   /translation="MLIKTLRMENFRQFKGTTNVSFSVDPKQNVTVILGDNTFGKTTLL
FT                   QAFNWCFYGIAKFDHNPDMLLNLEIASEMREGDKRIVEVEITVIHQDVEYVISRTQNYY
FT                   FERGKAVGEREALAKVSYKQENGEMEPIKASQVKNMINTILPEDLSTYFFFDTERVSSI
FT                   STRKDVAEAVKGLLGLAPIDNAVHHLGDRTKKTSVIGRLYGSMDLDGDSRAQDALNRIR
FT                   IAREKRDAISAQIEECNSQINSYEAKKDQLETILRDNEESARLQREKEKLEKLLIAEKS
FT                   NLDEKIALFFKEFSNGALAFFSQSLVRRTSEFLKEVKVDDKGVVDLTAPTILELLRRGR
FT                   CICGAEITEGNDAYCHLKEELAYVPPENIGNTVRHYRDKLSNFSRSADTTYDSITNRYA
FT                   EIHRLMDRIQDMEDDLQRISESIKDTENMAQYEADLLDTKKRLRELNAKKERLIRDDGS
FT                   YKQTIDSCQKLYDSLVAVSGKNKQIMELISYAESVREWFATTYKEKEHDIREQLEDKVN
FT                   DIFERMYHGHRRVAIDMRYQVSLLTTIADKEVAAGESEGSNRVKNFAFIAGLVALAKEK
FT                   IIADSGEAGIPIPTEPYPLVMDAPFSNADETHTANISKVLPEVAEQVIMFVMQKDWNYA
FT                   QPVMANKIGATYHLQKQSETYTVLN"
FT   CDS             complement(739558..739722)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16887"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB92"
FT                   /protein_id="CBL16887.1"
FT                   /translation="MKSNPQELDEKRLSAMKVKILEAEMKNLKTREKNNDQMVETITKI
FT                   ISNEAGKKY"
FT   CDS             complement(739712..741880)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06790"
FT                   /product="DNA or RNA helicases of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16888"
FT                   /db_xref="GOA:D4LB93"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB93"
FT                   /protein_id="CBL16888.1"
FT                   /translation="MSFLDLTLKPEYRSRLDDVVNDFYTPVLNEAVMYKRAVGFFSSSA
FT                   LSAIALGIKGLLKNDGQIQIIASPRLSEEDITAINEGLRKKDEVIKEALLRELQEPKGR
FT                   FEELRLNLLCNLIAAGKLEIRIAFMDEEGEIGLFHEKLGLMIDEEDNVIAFSGSMNESE
FT                   TAFKINYEAFDVFTSWSHDADRVLSKQSAFTAMWNDYEPGIKVMSFPEISEELLTRYRR
FT                   TDTIKSAIEEFNAPVVNDLSLNVEGPHVPPTVQMRSYQEKAILNWEQHNYQGIFDMATG
FT                   AGKTYTALAAIAHLYKAKERNLAVIIICPYQHLVEQWKDDVEAFGMKPIICYSASSQKN
FT                   WRDRLKNAVTSFNLGVKKHFCMLCTNATFSLDDVQQQMIKLQGNIVIVVDEAHNFGAEK
FT                   LSRSLLQHFPYRLALSATIDRHGDPEGTQKLYDYFGEKCITYTLQEAIDSHMLTPYYYH
FT                   PSVVALNETELQEYMDLTVKIRKNSHVLSDGKIELSEYAKMLLIKRARLVAGANGKLEA
FT                   LRNDIQEYIDQSHILVYCGATTLHDADYSEKHPSQDEAKQIDIVVDMLGNQLGMRVSKF
FT                   TSEEKSDERERIKEEFAEGKHLQALVAIRCLDEGVNIPNISTAFILASSTNPKEYVQRR
FT                   GRVLRNSPGKQYAHIYDYITLPIPLDCVSQYDAETIEGVQSLAKREISRMVDFSSIAEN
FT                   PYESDQLISEIRQAYDIIPEMEDEYDEV"
FT   CDS             complement(743058..743405)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16889"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB94"
FT                   /protein_id="CBL16889.1"
FT                   /translation="MFAERIAKAVTGLRIDDWNNSILEQFITSLQQFKNTVEDFDSTAD
FT                   QRQDVKGKQYKIVTVNENGEEEIKSFDRVEYSRRAELLYRDITGAISDMGQSISEQEKR
FT                   QVLFEILESLC"
FT   CDS             complement(743438..744292)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16890"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB95"
FT                   /protein_id="CBL16890.1"
FT                   /translation="MRSTLIQTGVLQQNERKALFSAENAEESIRYVLDVIRAFFQSTAT
FT                   EGERSLGELYTQLVDHQHGIGMKKGAIPVYIAVVLHEIKKDLIIKSNGVEVKINSDTLN
FT                   SINEKPDIFSVLMEDWDQDKKDYLSALDELFTDHIIEKERALNSFSYIVSAMDRWYLAL
FT                   PKCAREMQRRYANDKSISKKHKAFFHLLKAVKSNARDYLIIQLPNAFEETLASETVSDQ
FT                   IKSCKQELDQAKDELIKRVIKEISSIFGATAGMSLKNLLTEWYESLSKNTTQNLFATMK
FT                   MLY"
FT   gap             744393..745811
FT                   /estimated_length=1419
FT   CDS             complement(746232..747197)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16891"
FT                   /db_xref="InterPro:IPR025248"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB96"
FT                   /protein_id="CBL16891.1"
FT                   /translation="MKFRAHDTFAIRKGWLNKGLRNIENAPDVFISKEKNPMDVLGIGA
FT                   NMVKSLRYWLQATGLTVEPNSGKRKQSLTSIGEIIYNNDPYFEETGSLWLVHYGLATNF
FT                   EDATSWYLFFNEFQMQEFSEDDFYKSLRKFITMQDSETMPSSRAISDDFKCIINTYYPG
FT                   KRNSSDDIDPENNIECPLTELGLISYVTTTQGNRIYRKCTPKNENIPDLIALYAILKQI
FT                   GEQKEVKISVLQNSTNSIGKIFLLDTLSLLHILYQLEGAGYIKVVRTAGLDVIRILTDL
FT                   TPEECVKQYYSEFCRFPESSGYAPEECVKQYYSELNGNQR"
FT   CDS             complement(747194..748684)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06850"
FT                   /product="3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase and
FT                   related enzymes"
FT                   /EC_number="1.8.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16892"
FT                   /db_xref="GOA:D4LB97"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB97"
FT                   /protein_id="CBL16892.1"
FT                   /translation="MLDKPLAYKDCSVWANNSRYYIDGKSVSLTSKMYSKHTPEYLLLK
FT                   LQEYHDQNQYDVFNQFIERFIRANSTRFYEIVNEAHQFIQEQASKFPIENIVLSFSGGK
FT                   DSTVTADLVTKALQNPSLVHIFGNTTLEFPLTIEYANRFRDNHPLAIFKTAKNNEQDFM
FT                   SVCEDIGPPARMMRWCCSMFKTGPITRVLTRYYRDTKILTFYGIRRDESTARSKYNRVE
FT                   DDAESVKIQKQTVATPIFYWKDIDIWLYILTEQIDFNEAYRLGYDRVGCWCCPNNNLRA
FT                   QFLSSIYMPEKYKRWRDFLIQFAVRIGKPDPEVYVDTGKWKARQGGNGVKAAEDVKIRF
FT                   TNCTSEEHAKIYRLNRPMDDEFLNMLTPFGIVSKELGRKLVHEVIVLDARTNVPILSVQ
FT                   PFQQADYEFSVKVKTMNVASHDDLQRMVGYQVRKFNACRKCLKCESLCRFGAISIIGDS
FT                   YHIDETKCKRCKMCVTAKYLDGGCMMDKYLKTKEGSKK"
FT   CDS             complement(748690..748884)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16893"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB98"
FT                   /protein_id="CBL16893.1"
FT                   /translation="MFVNCAEVKQKQLFRRMYSGVLNAKHRLFVTEMMQIKNDAHFVMA
FT                   RQSTLRQIFVLFFQKNGYY"
FT   CDS             complement(748943..749938)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16894"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:D4LB99"
FT                   /protein_id="CBL16894.1"
FT                   /translation="MADMKVQKIKLLKIWEILNWKSDEQHPLSTQDIIVELSKLGIKCD
FT                   RRTIYGDIDAMQSNGYSILNRRRGHDMVYWVQERKFDLPELKIIMDAIQNSKFIPKDKT
FT                   EELLNKIASLGGSESTHLLKRNAVSFNVVKHSNADIYRITECLERAIECEHRVTFRYFD
FT                   LNASGERVYRHDNQLYKEEPLAMICDDGNYYLMCYHPEPEYENNVKVFRVDRIADISET
FT                   DESVSKDAKKASKAITNYPKQVFKMYGGKIQKVRLSFDESLIGVMFNKFGEEISIRKSG
FT                   ARFTASVEVQISPTFWGWLTQFPNQMEIVSPVDVKEAYTTWVRSAIKQEE"
FT   CDS             complement(750201..750587)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16895"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBA0"
FT                   /protein_id="CBL16895.1"
FT                   /translation="MSAYDRAAQFSSFNALEGYEDMVGEEAREVGQMETLTESEMEVLN
FT                   QKINLIADVLEDGHYPVLKFTYFLNDSMKQGGSYVTMTERVRKIDVVGRKIQLFRTVGA
FT                   SKSYMELEMDKIKDISGDLVDFIE"
FT   gap             750610..751523
FT                   /estimated_length=914
FT   CDS             complement(753218..753808)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16896"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBA1"
FT                   /protein_id="CBL16896.1"
FT                   /translation="MKHTEEQIIAAENRLHIVIPKMYREFMLADHAMEFDDGILYDIEA
FT                   IAERYVTLGFSESAPELIPIGNDNGDYELVMKSGSKTTRFGFLEQGSIGTAEPQHLQNF
FT                   IKWYESGHLFSQEKKEKIDWSAKVKVVLKKCPEDKVRTIMKIRKAFQLETPAAQLLSAA
FT                   ENTPFVLTEKLTAIVAKKIIEQEQLQSWVEIRF"
FT   CDS             complement(753825..754115)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16897"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBA2"
FT                   /protein_id="CBL16897.1"
FT                   /translation="MKQQVIRMERKYVKVNSDFDSTGYMQPRTITWEDGRVFIIEAVKD
FT                   FRPAGAHHDSPTCDCYTVVVKGETKYLYFEKSIKNHASRFGRWYVECPQKN"
FT   CDS             complement(754129..754662)
FT                   /transl_table=11
FT                   /locus_tag="RUM_06920"
FT                   /product="thymidine kinase"
FT                   /function="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16898"
FT                   /db_xref="GOA:D4LBA3"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBA3"
FT                   /protein_id="CBL16898.1"
FT                   /translation="MGSSKTANALMVRYNYVEKGKKVVLLKPKCENRDGEKTIRSRIGL
FT                   EDPCEFAEEFLEQYSGEHYDCIIVDEVQFLAAEVINRLSDLVDTYGITVICYGLRTDFR
FT                   SELFPGAKRLMELADDIEQIKTICWCGKRAHFNARILNGEMVTEGEQVQLGGNESYMAL
FT                   CRKHYKERQIKPQK"
FT   CDS             755149..755472
FT                   /transl_table=11
FT                   /locus_tag="RUM_06930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16899"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBA4"
FT                   /protein_id="CBL16899.1"
FT                   /translation="MMISPLSYIAEYENDTFEQLLQERDCLIAEIHELEKIVYSEDRSD
FT                   EAWSICPQPDVRYQMNLDYLSELCAFISKKYNREIVWKDAEESIDDDDSSSTIAVKKSE
FT                   SQN"
FT   CDS             755510..755953
FT                   /transl_table=11
FT                   /locus_tag="RUM_06940"
FT                   /product="Predicted phosphatase homologous to the
FT                   C-terminal domain of histone macroH2A1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16900"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBA5"
FT                   /protein_id="CBL16900.1"
FT                   /translation="MGRCGVCGAIFREAGSSELTKACSAIGGCKTGNAVITPGFKLSAK
FT                   YIIHAVGPVWSGGTQNEPKLLYSAYKQSLLLAKEYDCHSIGFPLISAGIFGYPKERAWR
FT                   KAIQACNDFVNDNPDYQIDIIFAVLDDEIKAIGEKTITEIYNK"
FT   CDS             755973..756569
FT                   /transl_table=11
FT                   /locus_tag="RUM_06950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16901"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBA6"
FT                   /protein_id="CBL16901.1"
FT                   /translation="MDFNAYISEIWNKEHSLALAFNEPKDSSEKKPPYDSINIHQRLDW
FT                   IDYCNNHNITIEENYIDELFDNIISNFTFQAFDGNDILYGDIMDCIDYAPTHKKQAYDE
FT                   KLIEALNSILTGKYKFETTFNLFFSWIRHRFLFLNELKLGFPLEEAGIMICFYNRNRNS
FT                   FIFKRDTDFLTMKAIANYFLMAYESCKKNQIAYDI"
FT   CDS             756559..757254
FT                   /transl_table=11
FT                   /locus_tag="RUM_06960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16902"
FT                   /db_xref="GOA:D4LBA7"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBA7"
FT                   /protein_id="CBL16902.1"
FT                   /translation="MISEDLIKARYFLQHFMRDVLVSAINNGYYEYESKIKQIIEELKL
FT                   EKAVKPTVFISYQWSKTSSEIADRIQNELKDIAAVRRDTTNLVTGDSLSEFMKTIRSQD
FT                   FAILIITDEYLTRRNCMYEVAQLLRDYDNHETKFWERVLLFVTAKIYAAEEKAAIIKFW
FT                   DDKVNELDAKIKDLHGETTEKLAKELKECRYISMEIGKLLEYASDTLCEKDLDKFILNA
FT                   KEKITKLTS"
FT   CDS             757944..758402
FT                   /transl_table=11
FT                   /locus_tag="RUM_06980"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16903"
FT                   /db_xref="GOA:D4LBA8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBA8"
FT                   /protein_id="CBL16903.1"
FT                   /translation="MSIKLAQEFDFDIVKKITHKTIKEIYPHYYSNGAVVFFLNHHNDE
FT                   NIMNDISNHNVFLCYNSEQNAVGTVTIKKNEICRLFVLPQYQGNGYGRELADYAETTIA
FT                   KHYDEIILDASLSAKSIYLKRGYQEIGYHSIKTDNNDYLCYDVMKKQI"
FT   CDS             758588..760072
FT                   /transl_table=11
FT                   /locus_tag="RUM_06990"
FT                   /product="UTP-hexose-1-phosphate uridylyltransferase"
FT                   /function="UTP-hexose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.10"
FT                   /EC_number="2.7.7.12"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_06990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16904"
FT                   /db_xref="GOA:D4LBA9"
FT                   /db_xref="InterPro:IPR000766"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR023425"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBA9"
FT                   /protein_id="CBL16904.1"
FT                   /translation="MIYNTIQGLIRHGIRSGLIAEEDELVVRNQLMDLLHLTDWEDCEG
FT                   RSGSLDELLDEVVDYACANGIIEQTAVQRDLFDTRVMGVFTPMPHEVNREFSRQYARSP
FT                   EAATNWYYAFCKNLNYVRAGRIAKDLKWTYASDYGTLDITINRSKPEKDPRDIAAAKNQ
FT                   KSAAYPKCQLCLENMGFAGHLTHPARQNLRPVPVEIQQEKWFLQYSPYGYYHEHCILFH
FT                   SRHVQMVIDRSVFEKLFDFLEQFPHYFIGSNADLPIVGGSILSHEHFQGGKYTFPMETA
FT                   SVEKPFVLKDFPEVAAGLVKWPMSVIRLTSANRAQLVQACDHILQKWRSYTNPDVGIYA
FT                   RTENTPHNTITPIARMRNGRLECDLVLRNNRTSPERPLGIFHPNPSLHHIKKENIGLIE
FT                   VMGLAVLPARLAVELDVLREKMLARADLTEDPRTAPHAEWAVQVLHAHPEFAPEHAEQI
FT                   LRLEVGKAFEQVLCDAGVFKRTPQGQEAFLDFVEGL"
FT   CDS             760938..763304
FT                   /transl_table=11
FT                   /locus_tag="RUM_07020"
FT                   /product="Glycosyl hydrolase family 59."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16905"
FT                   /db_xref="GOA:D4LBB0"
FT                   /db_xref="InterPro:IPR001286"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBB0"
FT                   /protein_id="CBL16905.1"
FT                   /translation="MRNRGAGMVSANNSSRLLLDYKAEHPEAYCEILEYIFGEDGIGVN
FT                   HLKLEMGSDINSSSGTEPCVMRSAHERADVTRGAGYQLAADAKKINPDLTLDMLWWSEP
FT                   RWVSDVDDLYAARYQWYKNTLDAAYETYGLKFDYVSAVQNERGADLEWVKYLSVHLKSE
FT                   RDCPYDYAGIKVVGGEEVCTWGFADRMYEDEELMHAVDVVGSHYTSCSTARAQQLAREY
FT                   GKELWFSEASSPMSYGQGTYRFDGTHSGLSDLNGVLDIANRIIGMYPNGGMTLYEYQPV
FT                   VSAYYDGVCYCQKQLISAADPWSGYYLLDSGFYMSLHFSQFLKKGWAFVDSGCFSDGKP
FT                   GGDGHAIVDAVYSYMTATDTESGDYSTVIANTTPEPIAYTFRVSAVDKASAPVGVWETR
FT                   GPDGGSYDAHYFKKISDIIPEEEQGAYTYTVLVKPYSMVTVSTVTPRRTEYKNKEASEQ
FT                   ALLTLPYADDFAYENYPPDYLTSRGGAPRYTTDQGGAFEVEQTESGNALVQQITAHTRA
FT                   KEWGFTPDPVTCFGDDRWYNYSVLVHVKLDPSEEPAKNYAGVGLRYTLACNAVSGYSIR
FT                   LYQDGSWALLAQDTVKARGSIGDFDPGAVHALHIKAEYNVITAWIDGEPVAEYVSRSES
FT                   LMGAGRGALYSAYHRNCFSRLVIRPTADAESYITRYDNTDVCFAYEGAWEHQTATGFKH
FT                   YKRTISQGKEGAVCIVRFVGTGFSLFGETGKAVLSVVIDGGEPRSVQVCETGPREISYR
FT                   CDGLAKAAHTVRITVAAGTYSVDGMEVIGGEVPGF"
FT   CDS             complement(763451..763852)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07030"
FT                   /product="SSU ribosomal protein S9P"
FT                   /function="SSU ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16906"
FT                   /db_xref="GOA:D4LBB1"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBB1"
FT                   /protein_id="CBL16906.1"
FT                   /translation="MYESKIKYFYGTGRRKHSVARVRVYPGSGNITINNRSIDDYFGLD
FT                   TLKLIVRQPLALTETAEKFDIVCTVTGGGVTGQAGAIRHGLSRALLEYDAELRPVLKKA
FT                   GFLTRDPRMKERKKYGLKAARRAPQFSKR"
FT   CDS             complement(764431..764589)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16907"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBB2"
FT                   /protein_id="CBL16907.1"
FT                   /translation="MLMIPDPTGFPSRNFYSIAKVKRKMRNQENGSKTERMQEIEGYKL
FT                   NFRHFAN"
FT   gap             764592..764925
FT                   /estimated_length=334
FT   CDS             complement(764926..767721)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07060"
FT                   /product="Beta-galactosidase/beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16908"
FT                   /db_xref="GOA:D4LBB3"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013812"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBB3"
FT                   /protein_id="CBL16908.1"
FT                   /translation="MYKQYDLSGIWRFAMDPDKNGVREQFFATVLPDTIPLPGTTAQAK
FT                   KGTYNTSRNTGYLTECYPFSGWAWYQTTFTPAPEDLHKPLLLTLERTRMTRLWINGTEL
FT                   GSCDSLTTPHCYRLPALEDPSPVTITICVSNTDYPTKGGHMTSPDTQTNWNGITGEISL
FT                   TVLPPVHLSDLQAYPDAAHKSVTLRGMLRGAAHTSLTVTGKAFSKDDPCIREISPIRTD
FT                   LDADTEGTFSLLIPLGEDALLWSEYTPVVYELHLSMPDVPGDAVIRFGLRSLSTKGMEF
FT                   QVNGTPIMLRGKHDGMLFPLTGAAPTDLAEWLRLLSIAKAYGINHYRYHTSCPPEAAFA
FT                   AADLLGIYMQPELPFWGTLAAPGEEQYNETEQAYLVEEGFRMLRAFGSHPSFCMLSLGN
FT                   ELWGSSQRMGEILRDYRETDPRHLYTQGSNNFQFWPCILEEDDFFSGVRLSKERLIRGS
FT                   YANCDLPLGHIQTCRPSTDHSYDPLIFPVQQESAEAGAAEIQIQYGTGTKTIRVDQQAE
FT                   GLIPHKPIVTHEIGQYTVYPDFEEIPKFTGVLQARNFEVFREWLRDAGMEEQARDFFLA
FT                   SGHLAAQCYKEEIEAVMRSRHIAGFQLLDLQDFTGQGTALVGMLDAFMDSKGLISEKQW
FT                   RGFCSDVVLLAEFDRFNYAAGEFFRAQVQLRCYRPGLTGTAHWRLTAGDACLAAGSFPL
FT                   PDAPMGLVTLGQIETRLPETEITRSLTLTLEIPEADTENGYIIYVYPRKKPQLPPAIRV
FT                   AYTAAEAQTMLDRGARVLLLPETVKEVVEGFYCTDFWCYPMFRQICESMDRPVAVGTMG
FT                   LLVDQAHPALSDFARAHCTTPQWYDLVTHANCAVLEHAAPHIRPMVQMIDNFERNHKLG
FT                   ILFEARVGTGRLMVCTIRLGEIAERIEVQAFTDALYRYMASDRFEPRQELTPQQLTELF
FT                   I"
FT   CDS             767944..769188
FT                   /transl_table=11
FT                   /locus_tag="RUM_07070"
FT                   /product="Bacterial capsule synthesis protein PGA_cap."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16909"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBB4"
FT                   /protein_id="CBL16909.1"
FT                   /translation="MRIKKGKLAALLCAVLLLPGCSFQSINNSGSGLLSQSSPSDSPQS
FT                   SAEESREEPTTEPENRKVRVVAVGDNLVQTGVLRAAQSYSTDGTYDFGPCYENVKPYIQ
FT                   AGDVSIINQETLIANDEFPITGSNFNFNSPTQLGQAILDAGFNVITMSNNHMLDKGIDG
FT                   LIATMNYWDNMRAKNDITVVGAYRDQEDMENIRIREVNGVKMAFVAFTEHTNGIPMPKN
FT                   TDVKIILTSDTETMKSQIKAADAIADVVVVSVHWGIEDSFVVSDQCRELAQDFVDWGAD
FT                   VILGSHTHTAETMEYLTRQDGTQGFVFYSLGNFISAQTDSFNMLGEMADFDIIVDGQTG
FT                   EVLISDVKVIPVITHYDDGKLRNLRLYPYSMYTEELANSHGLPVAPLGTAKKFNMDVLN
FT                   KYIQDNIPVEFQKLD"
FT   CDS             769692..770531
FT                   /transl_table=11
FT                   /locus_tag="RUM_07080"
FT                   /product="Cohesin domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16910"
FT                   /db_xref="GOA:D4LBB5"
FT                   /db_xref="InterPro:IPR002102"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBB5"
FT                   /protein_id="CBL16910.1"
FT                   /translation="MKAKKLIASLLAMSMTAAAVGLAVQAADTVTISVGNDTVAAGETF
FT                   SVDVSLSGIPATGACAVDFAVEFDSSLVTISDVKTGALCDTGAASAEGNINADLADTTF
FT                   DWNVADDLVCLTWTTGLLDSSYWLKDGGVFVTITGTVNADAAAGSKAAFNIVPVDREVL
FT                   PGSGTKNQEILVGYVDDSLVDHNYTTATKTGYVTVAGETGDTLYGDVNCDGEVTISDVV
FT                   MLSRYVAQDTELNPVPSAQGLKNADCESNGNIDAGDITAIARYLAHLIEASQLGPQA"
FT   gap             771456..772235
FT                   /estimated_length=780
FT   gap             773245..774872
FT                   /estimated_length=1628
FT   CDS             complement(777794..778702)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07130"
FT                   /product="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16911"
FT                   /db_xref="GOA:D4LBB6"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBB6"
FT                   /protein_id="CBL16911.1"
FT                   /translation="MPVFFVIFVGWFLKKIGIIRKDFQDANNRLVFRVLLPVMLFCDVA
FT                   ETDLSATFSMKFFLFCVSATLACFAAVWILAALFYKDRASIGSFVQGAIRGSAGILGVA
FT                   FAENMYGRAGMVPLMMIAIVPIYNIGSVILLTMYSSERPPQGQIKKVCLEVLTNPLILG
FT                   ILAGIPFALLHVQFPALVQKSLNNLSMITSPLALLMVGADFDLQKASAQRIPVLLATAI
FT                   KLLIQPAIFLPIAVLLGFRDESLIAILIMLGAPATVSGYIMARGMHNNVSMAGSIVVLT
FT                   TMLSAVTVTGIIFVLRTFGYV"
FT   CDS             complement(778737..779984)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16912"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBB7"
FT                   /protein_id="CBL16912.1"
FT                   /translation="MKPFRQIALLTAGMLLLSAAGCGKKEDSQMQDSSSQSTWSMADPS
FT                   LNLPTLNLGHTTEDMIRRAVVNPGNTARLADAMKRAQAGEKITIGTIGGSITQGTAAST
FT                   TDERYANRALQWWAKAFPKAQLDFVNAGIGATDSYIGVHRVDADLLSKKPDVVIVEFSV
FT                   NDTDAALNLQTYDSLVRKILQAENHPAVILLFTTQEDGTSLQDTHMQIGSAYNLPMISY
FT                   KNAVLPEIEAGKFTWKDISPDNIHPNSVGHGIIGELLWSYFNSVYAKLDQIDTSDLTFT
FT                   ATPVTKDLYAKGQLLDSKTLTPKTMQGFEQAEVSNQFPNDWTTKEGGELTFEVTGSNIG
FT                   VLYYKTVDGKSGQYCVYVDDRLIQVLDGDFTGGWGNYAQAQQVYTSDTPSTHTVTIKQL
FT                   EGTDLTQFTVLGLLVS"
FT   CDS             complement(779993..780838)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07150"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   [carboxylating]"
FT                   /function="nicotinate-nucleotide pyrophosphorylase
FT                   [carboxylating]"
FT                   /EC_number="2.4.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16913"
FT                   /db_xref="GOA:D4LBB8"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBB8"
FT                   /protein_id="CBL16913.1"
FT                   /translation="MNLPQNYIDDLIRRALAEDITYVDITTDTLMPDSHTSEAYYIAKD
FT                   EGVLCGMDVALRVFDLAGGNVETRALFHDGDKVCKGDILATMTGSTKTLLKGERTALNL
FT                   LQHMSGIATATNRCVHLVEGTRARITDTRKTLPGMRALQKYAVVVGGGRNHRFNLSDGA
FT                   MLKDNHLDAYGGITPAVAALRDKIGHMVKIEVEVRNLEELQEALDAGCEIIMLDNMSCE
FT                   DMAAAVQINAGRALLEASGNVTAETIRPIAETGVDIISLGALTHSVKCFDISMRIKQAK
FT                   "
FT   CDS             complement(780856..782307)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07160"
FT                   /product="L-aspartate oxidase"
FT                   /function="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16914"
FT                   /db_xref="GOA:D4LBB9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBB9"
FT                   /protein_id="CBL16914.1"
FT                   /translation="MTNHYDVIIAGGGAAGLYAALNLPASLRVLLICKRELTLCNSALA
FT                   QGGIAGVYDSPEDDVQLHKQDTLVAGGFKNNTETLSILVNEAAQDIGRIIDLGVEFDRN
FT                   PDGSLHRTLEGGHSKHRIFHHKDATGFEIVSKLLQTVRTLPNVEILENTLLCGVAKTGT
FT                   GFSVDTLHEGTYTAFHSHFLLLATGGIGRVYEFTTNSAIATGDGITFAYELGAPIKNLS
FT                   LVQFHPTAFNNRHTRECFLISEAVRGEGAYLLNAAGERFMQRYDDRLELAPRDVVSHAI
FT                   ILESRRQDSQEFYLDISHKDPEFLKHRFPMIYENLLKQGYDLTTDRIPIFPCQHYLMGG
FT                   IDVNADSRTALDRLYAAGECSHTGVHGNNRLASNSLLEALVFSRHAAMDIAKHLSEVPD
FT                   TFEEHSFPHDPDAPPIPQGLRTEIRHIMQHSYFVIPDREAAAAGFERVARIRQMLLEGN
FT                   YRINADYIEAKSLATVAYLILKEVI"
FT   CDS             complement(782454..784193)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07170"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16915"
FT                   /db_xref="GOA:D4LBC0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBC0"
FT                   /protein_id="CBL16915.1"
FT                   /translation="MKAGKHTRRTMFWAMAAALCMGCLTTLVLLMDVHPAIRPYTPLIL
FT                   GTAVSGLLAVLCTLIVLVKALRKPEQIPEAHSVLDPFSLESILLLILCTIPVWWAICKH
FT                   HESMPKAAFLRQEPLAQCNVGLYAALLCFLSLESLASLLRRIRSGQLAATSLLAAFFQT
FT                   PVRQEKRAALHERLHAPIELPDASGDKLHAAASSIRQRLNAPVTLPDTPAGNQLRRIIN
FT                   RCAQSIRNRKAQCRTRWHSLPFSQQTALHSMAAMVVILSLALCFSPFDRPNQISAMLLL
FT                   SLLVIAVYIGIQMRRSQQIDRLSQRIHTISQGDFSPAAPAEGSCVAAQFRELDQIQDST
FT                   RDAIARQVQAERTKVNLVTNVSHDLKTPLTSLISYIDLLSKEELPPQAMDYVHVLERKS
FT                   QGLRRMVQDVFDLAKAASGEDVCCTRLDAVMCLRQVLADMEDTIQRSGRDIRLQTDLDR
FT                   CIIRAEGNKLYRIYQNLLANALRYSMENTRIYIRVTGTQTEFSCCIQNTSSYEMHFTPE
FT                   EITERFTRGDAMRSTEGSGLGLAIAKSFAEACGGGFRVAIDGDQFKAILTFPCCGSDAS
FT                   LEA"
FT   CDS             complement(784190..784981)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07180"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16916"
FT                   /db_xref="GOA:D4LBC1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBC1"
FT                   /protein_id="CBL16916.1"
FT                   /translation="MIKTGKRKEWRSTCLRNMMMDYTQCTVLVADDDRDIVRAIATLLE
FT                   QEGLTVLRAYNGLEALEAVAEHPVSLILIDVMMPKLDGLSAMMKIREQKNIPILILSAK
FT                   SEESDKILGLSMGADDYIAKPYHPQELAARVKSSLRRYLHLGAADSARMQKLIRVGGLE
FT                   YDPDTRQLTVDGEPVRLTSKELKIMELFLRNPGRIFSAEEIYSRVWNEDAYAVENTVMV
FT                   HIRHIREKIEINPREPNYLKVVWGIGYQLQDPAARKGGKKP"
FT   CDS             785197..786039
FT                   /transl_table=11
FT                   /locus_tag="RUM_07190"
FT                   /product="Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16917"
FT                   /db_xref="GOA:D4LBC2"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBC2"
FT                   /protein_id="CBL16917.1"
FT                   /translation="MIGIIAGAAAGLLTAELVRENCCMLAVRQDTIDQPAYTGHPLKLA
FT                   LVSDTHIINRRRQRRCQRLLRAVRAAKPDLILVPGDLVSRTCTDFSLVQQLLTGLCAIA
FT                   PVYYAPGNHELDMTEPMRQKLYRTMEATGTVLLCNRTVQLEGLALCGVTLKYSMFRNQN
FT                   RGFSGLSKYTPEDMEQAVGVHRGMTLLLAHSPLALDTYAAWGAELVVSGHVHGGMIRLP
FT                   VVGGLLSPERKLFPAYSRGHYRQGHTDLIVTGGIAKPRLFNPPELRIITLQGKDDSSL"
FT   CDS             786215..787489
FT                   /transl_table=11
FT                   /locus_tag="RUM_07200"
FT                   /product="Adenylosuccinate synthetase"
FT                   /function="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16918"
FT                   /db_xref="GOA:D4LBC3"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBC3"
FT                   /protein_id="CBL16918.1"
FT                   /translation="MPANIVIGTQWGDEGKGKIIDILASRAEVVVRSQGGNNAGHTVVN
FT                   NGQTYKLHLVPSGILYPGTACLIGAGVVLDPKDFISELDNLHARGVSTDNLKIDPRAHV
FT                   VMPWHIVLDGLSEKFRGNSDIGTTKRGIGPTYMDKYERCGIRMYDLTHPEVFAQKARST
FT                   GALKNKIITAVYGGEAIDLDAVIQEYTEYGKRLLPYLADVSVLTYEADKAGKTILFEGA
FT                   QATLLDIDFGTYPYVTSSHPLSAGVCVGTGVGPRMISNIIGVAKAYTTRVGKGPFPTEL
FT                   NDEIGEKIRNVGGEFGTTTGRPRRTGWFDAVIVRHSVRVNGLDGLAINKLDTLSGLGTL
FT                   KICTAYKMADGTITRNLPPTLEELAGCTPIYEEAEGFDEDISGCKSFEELPESCKRYIA
FT                   RLEELCDCRIAMIGIGPDRSQILER"
FT   CDS             787520..788662
FT                   /transl_table=11
FT                   /locus_tag="RUM_07210"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16919"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBC4"
FT                   /protein_id="CBL16919.1"
FT                   /translation="MSEEQNNGLSQLEESTYVPKQKEDRLAGVAAPVLEDTAYVAPKEK
FT                   KSHLADVAAPTLADDDYVDTRKKHSLEGVQAPVLEDPDAHAASKPAQPAAFTPVPLTQQ
FT                   QLDVLAQQRAQSGQPPYTPEQIAAIQKAYMDRQVAAHAASQPAEPAPQPQVKAPVLEES
FT                   TYTPPVKEKHEPQVSAAAAASLLEEPAPEPERKVSRFNEADLEAAKANAQKRAIEQSLN
FT                   MTTNVDKAESRRLMNELRMEREAELAKKGFTVVIVLMILGLLAAAALYFFSVREFQDSM
FT                   DNGFYSGVTKVMNYTSFGLGVVSVLLILRVGFVKKLGSFLFGLMTALLLFPGLPMLMQK
FT                   KEEGMALTAVGYGAALILCFAICFILSTSEPVNMFYKRKE"
FT   CDS             788713..789288
FT                   /transl_table=11
FT                   /locus_tag="RUM_07220"
FT                   /product="Phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16920"
FT                   /db_xref="GOA:D4LBC5"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBC5"
FT                   /protein_id="CBL16920.1"
FT                   /translation="MLYLRWLRAEENNHSGQHRAAYDALAWGLWRESGIRHALLERQDR
FT                   GKPFLPMYPQVHVNVTHCRFLAAAAVDAAPVGVDAEPVRPLRERVLERTCAREEQDWVL
FT                   SQPDPDYAFIRLWTAKESYVKATGTGIGVPLQEVTFTLTEESIRSRMDAGFTQLLLPEH
FT                   VITICHKTGKGQVLTLCPKEEWICWNRI"
FT   CDS             789270..790034
FT                   /transl_table=11
FT                   /locus_tag="RUM_07230"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.100"
FT                   /EC_number="1.1.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16921"
FT                   /db_xref="GOA:D4LBC6"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBC6"
FT                   /protein_id="CBL16921.1"
FT                   /translation="MLEPDLTGKIALITGATGQLGRVMAHTLADCGADIVVHYHANRLQ
FT                   ADKLVAELTRMGRRALAVQADVTDRDSVFAMRDKVEAVLGMPQILVHNAVIQYAWKPIL
FT                   QQDPGDFDSQYRSCVMQTVYMAQAFVPAMQAAHYGRILVINTECAALAEAGCGAYTAAK
FT                   RGLDGLCRCLAKEVAEDGITVNQIAPGWTITERDRDANTQVQPDYDRQVPMGRRGTDAE
FT                   IAQMAAFLVSDLASFTTGAFIPVCGGRVMPAI"
FT   CDS             790180..790884
FT                   /transl_table=11
FT                   /locus_tag="RUM_07240"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16922"
FT                   /db_xref="GOA:D4LBC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBC7"
FT                   /protein_id="CBL16922.1"
FT                   /translation="MAAFVTLRDVRKEYRMGEVLIKASDGISFELEKGEFVVIVGPSGA
FT                   GKTTVLNMLGGMDTCDSGEIIVDGQDIARLKKKEITRYRRYDIGFVFQFYNLVQNLTAK
FT                   ENVELATQICRDAADAAQMLEKVGLEDRMDNFPAQLSGGEQQRVSIARALAKNPKLLLC
FT                   DEPTGALDYQTGKHILKLLQDTCRRDGMTVVVITHNSAIAPMADRVIEIKNSKVHGVRM
FT                   NAHPEPVEQIEW"
FT   CDS             790889..794176
FT                   /transl_table=11
FT                   /locus_tag="RUM_07250"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16923"
FT                   /db_xref="GOA:D4LBC8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBC8"
FT                   /protein_id="CBL16923.1"
FT                   /translation="MNRSIFKNTLRSIWKTKGRFLAIFAIIALGSGFFAGVKVTSPDMK
FT                   LTADAYYKDTHLADLHLKSTVGFSRAEVQKLAQRQGIAGCYGGYSTDQYLHAEDTASAI
FT                   ARIWSVDFTQVGTGSSQDLNTPTLREGRWPEQPDECLIEVRTPGEFKVGDTLTLDPAKG
FT                   EEPVTDTLKTDTFTIVGVADWSMYVDFERGTTTVGNGKVESYILVPPEAFTLEVYTDVF
FT                   LTLEDTRELYAYDQVYTDTVQAYAEQLEADAPDIYCLREEQLRADAQKELDQARKDLDA
FT                   GWEAYESGKQELADQLAAARQKLEDGRTDLDAQISQLADKQKELEQGEKTLAASQKQLD
FT                   AQASSLKTQQTAFQQAQQTLSDAVQFSENLLTAIDNYRYTCMVPPLDAQTEQLIDNASV
FT                   LDGSGMEFTKMLRQYITEPVDAAEKGMHASALKLYAQNYQASLYNQQGDLDRQGAQLTA
FT                   AQKKLNASQSTLDAKKKELEQGKQQLQEGQQAIADAQAKLEQGEEEIADQQAQGEQKLA
FT                   DSKAELEQGEAELKNSEAKLDTIGEQIQWYVLDRSYNVGYDSFWEDADRVDSIARVFPI
FT                   FFILVACLVCLTTMTRMVEEQRTEIGTLKALGYSGAAVAGQFLLYSMAASLLGVFAGVG
FT                   LCTQVFPRVIYAAYLLMYNLPPVHCPFHWGYALGSLGAALLCTGATSLAACYVELTSVP
FT                   AQLMRPKPPKNGKRVLLERIGWLWKRLGFHAKVTIRNVFRYKNRVLMTVVGVAGCTALM
FT                   LTGFGLRNAISVIVDLQYSRVYQYDLLGVYDPDADTKKLEDLHQKVTDTPELTDTLYAL
FT                   QKSATITGAGGSIEAYLFVPQEPERLPEFIRLIDRKTDAAYTLEEQGAVVTEKLARMLD
FT                   VGVGDTITLEGASAPVAVTAITEQYVFHYVYLSPAQYTALYGEYTPNCFAAKLAAGTSE
FT                   DALSEILLANGAVRSLSYNSHAGDKFHELIGTLNYVVLLIIISSGALAFVVLYNLANIN
FT                   ITERMRELATIKVLGFYDREVAAYIYRENTISALLGMLAGLVLGIFLCHFVVDTAQVDA
FT                   VMFYPDIPAYAFGLAALLTIVFTVLVNGLLYFKLRRIDMAGSMKAIE"
FT   CDS             794185..794628
FT                   /transl_table=11
FT                   /locus_tag="RUM_07260"
FT                   /product="Predicted P-loop ATPase fused to an
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16924"
FT                   /db_xref="GOA:D4LBC9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBC9"
FT                   /protein_id="CBL16924.1"
FT                   /translation="MQIRIVTEQKKRYLEMLLLGDEQENMIDRYLERGAMYVLEDPEPV
FT                   GVCVVTDEGNGILELKNIAVSPAVQGRGYGRAMLEFLQSRYRGQYRLLQAGTGESPLTV
FT                   PFYEACGFRRSHVIPDFFTQYYDHPIFEAGVQLRDLVYLQKPL"
FT   CDS             complement(794690..795958)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07270"
FT                   /product="O-acetylhomoserine sulfhydrolase"
FT                   /function="O-acetylhomoserine sulfhydrolase"
FT                   /EC_number="2.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16925"
FT                   /db_xref="GOA:D4LBD0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBD0"
FT                   /protein_id="CBL16925.1"
FT                   /translation="MKFETQCMHEGYTPANGAPRVMPIVQSTTYAFDSTDHIGDLFNLP
FT                   NEHMYSRFSNPTVECVEKKIAALEGGVAAMCTSSGQAASLLSVINVCSAGDSFISTNSI
FT                   YGGTVNLFAVTLKKLGIECIFVSPEASDEELQAAVKPNTKLVFGETLANPALTVLDIER
FT                   FAAFAHRNNLPLIVDNTFPTPYLCRPIEHGADIVIHSTTKYMDGHALQVGGVIVDGGHF
FT                   NWANGKFPDFVEPDESYHGISYTESFGNQAYIIKARMQLMRDLGCYPAANSAFLLNLGL
FT                   ETLAIRMDRYCDNAQKVAEYLEGCKHVASVSYPGLNSSPYYNRAKHYMPKGCSGVITFN
FT                   IKGGKSAAVKFMDALQLASKVVHVADIRTCVLHPASATHRQLTDAQLEAAGIDGGMIRF
FT                   SVGLENVEDIIADIAQAMDKLDA"
FT   CDS             796174..796560
FT                   /transl_table=11
FT                   /locus_tag="RUM_07280"
FT                   /product="ATP synthase I chain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16926"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBD1"
FT                   /protein_id="CBL16926.1"
FT                   /translation="MQKDALLHEFRVIGIRTVFLNIAVYLISGLVQGFTLSFAVGLLLG
FT                   TALLFVYLLLLSRSVARSVEQPGGRPQVQMVSGYLLRLVLIGAVFLLAMQISWINAFAA
FT                   MIPLVYPRLIYVGHACLHKNGEQL"
FT   CDS             796646..797404
FT                   /transl_table=11
FT                   /locus_tag="RUM_07290"
FT                   /product="F0F1-type ATP synthase, subunit a"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16927"
FT                   /db_xref="GOA:D4LBD2"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBD2"
FT                   /protein_id="CBL16927.1"
FT                   /translation="MKLSDFLTGVKEVEVNGPKVITSFTIPGIDLTINLTETIVVGWIV
FT                   ILILLAVILFLTHNMQVRAVTKRQAIAEMLVETVENLVDSSMGKKFRSFAPYIATIFVF
FT                   SCFGSLISLIGLRPVTGDFNTTFCWGLMTFVLVERAKIKTSGIGGFLKGFFEPIPLMLP
FT                   LNLLSEAATPVSMGFRHFGNVAGGMIITSLLYFALTAASTALGLAVPVLTVGIPALLSV
FT                   YFDLFTGFMQAFIFIMLTMAYLDSAFGSEE"
FT   CDS             797458..797712
FT                   /transl_table=11
FT                   /locus_tag="RUM_07300"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /function="ATP synthase F0 subcomplex C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16928"
FT                   /db_xref="GOA:D4LBD3"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBD3"
FT                   /protein_id="CBL16928.1"
FT                   /translation="MEKAILLAGSAIGAGLAMIAGIGPGIGEGYAVGKACEAIGRQPEA
FT                   SGPVTRTMFVGCAVAESTGIYGFVVALILLFANPLLGKL"
FT   CDS             797805..798302
FT                   /transl_table=11
FT                   /locus_tag="RUM_07310"
FT                   /product="ATP synthase, F0 subunit b"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16929"
FT                   /db_xref="GOA:D4LBD4"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBD4"
FT                   /protein_id="CBL16929.1"
FT                   /translation="MLDFLSIDVGSLLFTLLNTLILFLVIKHFLFGRVHAVLEARQQEV
FT                   AKTYQDAEDASRHASELEEEYTGLMQNAKTESEQLIRNATRTAQSRSEEILAQARKDSG
FT                   DMLEHAAAQIEQDKKRARNQLRGEISDLAVEIAQKVVERDLNQSDHDRLISDFIDSVGD
FT                   SQ"
FT   CDS             798299..798826
FT                   /transl_table=11
FT                   /locus_tag="RUM_07320"
FT                   /product="ATP synthase, F1 delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16930"
FT                   /db_xref="GOA:D4LBD5"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBD5"
FT                   /protein_id="CBL16930.1"
FT                   /translation="MTGQVGKVYADAVFDLCLEEDTLEPVYKDLNACAAVFRKEPGLAQ
FT                   LLEVPTIPLEEKRALVERLFAGNQTVVSLVCMLTQRQRIPYVQAVTDTFNDLYREHKGI
FT                   ARMTVTTCVPLRDTQRQQLIAALQKKYGKQVELTERIDPAILGGVIVQYGDTLLDNSVR
FT                   SRLEAVRRQLKQ"
FT   CDS             798884..800398
FT                   /transl_table=11
FT                   /locus_tag="RUM_07330"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /function="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16931"
FT                   /db_xref="GOA:D4LBD6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBD6"
FT                   /protein_id="CBL16931.1"
FT                   /translation="MDLRPDEITGIIKEQLKHYHAQLELNDVGTVVTVGDGIATIHGLD
FT                   KCMSGELLEFEGGVQGMALNLEQDFVGAVMLGSDRDIKEGAAVKRTGRIVSVPVGEELL
FT                   GRVVNALGQPIDGKGAILTHETAPVEKVASGIITRKSVHKPLQTGIKAIDSMIPIGRGQ
FT                   RELIIGDRQTGKTAIALDTIINQHDKDVICIYVAIGQKRSTVANVVETLEKAGAMRYTI
FT                   VVSATASELAPLQYIAPYAGCAMGEYFLAQGKDVLCVYDDLSKHAVAYRALSLLLKRPP
FT                   GREAYPGDVFYLHSRLLERACSLNEKYGGGSLTALPIIETQAGDVSAYIPTNVISITDG
FT                   QIFLETDLFNSGVRPAVNPGISVSRVGSAAQIKAMKKVSGSLKLSYSQYRELQAFSQFG
FT                   SDLDQDTKERLAKGERIVEVLKQNRNAPMTVEHQVIVIYAVVNNFLREIPVKEISDFEH
FT                   ALCTHVDETHPDIIQSIRDTGDLNQETQAALDAVLRDFAAQYLSAQ"
FT   CDS             800440..801309
FT                   /transl_table=11
FT                   /locus_tag="RUM_07340"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /function="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16932"
FT                   /db_xref="GOA:D4LBD7"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR023633"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBD7"
FT                   /protein_id="CBL16932.1"
FT                   /translation="MATANLKDIKRRIKSVESTMQITKAMELVASSKLRRAKEKAERAE
FT                   PFFNMLYQMMCQIVAESGDFQSTFLQHHTGGAVLLIAIAGDRGLAGGFNSNVFKQVQIR
FT                   MEELQTAGREPVVIAIGRKAVEYFQRRNVRILAEFENIGEDITVYKALDIAERIVTLYE
FT                   KGDIQAVELIYTNYVSPLVQEAHHMHVMPVEHLEYAPGGYHALTTYEPSPEAVFDALIP
FT                   KYLAGMLYCAVIESFAAEQAARRLAMENATDNATEMITDLSLVYNRARQSAITQEITEI
FT                   VSGANAQS"
FT   CDS             801366..802763
FT                   /transl_table=11
FT                   /locus_tag="RUM_07350"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /function="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16933"
FT                   /db_xref="GOA:D4LBD8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBD8"
FT                   /protein_id="CBL16933.1"
FT                   /translation="MQNIGKIVQIIGAVVDVRFAPEHLPKLLNAIEVDNHGARLVLEVA
FT                   QHIGDDVVRCIAMGTTDGLVRGTDAVDTGSPIRVPVGRETLGRVFNLLGEPVDDKPAPQ
FT                   VKEHWAIHREAPSYEEQTASSQVLETGIKVIDLIAPYLKGGKIGLFGGAGVGKTVLIQE
FT                   LINNVANQHGGISVFTGVGERTREGNDLYNEMKESGVIDKTVLVYGQMNEPPGARMRVG
FT                   LSGLTMAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGAL
FT                   QERITSTNKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRQISSLGIYPAVDPL
FT                   DSTSRILTPEIVGQEHYEVARAVQTILQRYTELQDIIAIMGMDELSEEDKLTVSRARKI
FT                   QRFLSQPFSVAEQFTGMKGKYVPIKETIRGFKEIIEGMHDDLPESAFLFVGTIDEAVEK
FT                   AKKGVSE"
FT   CDS             802760..803164
FT                   /transl_table=11
FT                   /locus_tag="RUM_07360"
FT                   /product="ATP synthase, F1 epsilon subunit (delta in
FT                   mitochondria)"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16934"
FT                   /db_xref="GOA:D4LBD9"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBD9"
FT                   /protein_id="CBL16934.1"
FT                   /translation="MTAFPLKIVTPEKIFFDGSAERVVLRTSEGDLCILARHEPFVASL
FT                   PSGPVRITVDGADRYAALSTGVVQVEKEGTTILACAIEWAEDIDLAWAKRSEQQAIDRK
FT                   NKAKSDAELRRAELKLQRALNRIHVSGMQK"
FT   CDS             complement(803212..803916)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07370"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16935"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBE0"
FT                   /protein_id="CBL16935.1"
FT                   /translation="MDLLNVTAASIGSIIALFLLTKLIGNKQMSQLNLFDYINGITIGS
FT                   IAAEMATSLESDFLKPLLAMGIYALATVLSDLASNRWLSARRFLEGRSLILYDNGKLYR
FT                   NHLKRARMDLSEFLTQCRTGGYYNLDSLQLIVMEANGRLSFLPKPDARPVTPADLNMQP
FT                   QPDSPQIPVILDGKILTGNLQDSGKDMQWLNHQLAMHHYTPKEVLLALCNPDNTLSVYK
FT                   KEDTNRHTDRFQ"
FT   CDS             807097..808029
FT                   /transl_table=11
FT                   /locus_tag="RUM_07390"
FT                   /product="MoxR-like ATPases"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16936"
FT                   /db_xref="GOA:D4LBE1"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR016366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBE1"
FT                   /protein_id="CBL16936.1"
FT                   /translation="MNNQIQALLDSVEQVIVGKRPVITRVVAALLCNGHVLIEDVPGVG
FT                   KTQLAASLSRSLGGSFNRIQLTPDIMPSDVVGFSMVDQQTGKLEYRPGAAMCNFLLADE
FT                   INRASPKVQSSLLEVMEEYQISLDGQTRPLPRPFMVLATQNPVETYGTYHLPEAQMDRF
FT                   FMRISMGYPTPEEEMRILERTEHYNPIENIKAPAVTLDSVLRLQQQVAQVTVADSVKAY
FT                   ILSIVSATRSMEEVTLGVSPRGSIALYKAAKANAFMFERSYVTPGDVKAMAECVLAHRI
FT                   LLSAKGKTVFGTPQACLASVLDRVAVPMG"
FT   CDS             808033..809193
FT                   /transl_table=11
FT                   /locus_tag="RUM_07400"
FT                   /product="Uncharacterized conserved protein (some members
FT                   contain a von Willebrand factor type A (vWA) domain)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16937"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBE2"
FT                   /protein_id="CBL16937.1"
FT                   /translation="MAAVVGYLAVLGILALFTFYMDGDTGVQLLAVYLLLPAASALLTL
FT                   LARRQLKIRLTLPDSVKKGGTCMLTAEITKRWRIPLPFVRFRLEPDGHFDSPMVPVQTA
FT                   LAFGRQDTRQAELLPRICGQAQVDAADPRVIGYFGFLKLKLEMPAPAQVMIVPQVPELT
FT                   AKDALFTVMSTAVQTESEEETNTQVAFGAATTAGYEHRDYVPGDPLKRINWKLSSKRQS
FT                   LMVRMDEAVSLSRVHVLLDLARPQGAPAYKSRFLLEQQITEGALGMLALCARQGMAAVF
FT                   SYQSLSGWQEVLAESPEAVEELALHVLERGFSEELGAARLSGSFLSGSGNGVYLIYTAN
FT                   PDPELLSQAAHMRGEVHIVMPGGMDAAGAKLHFWWLQSDFRLLPMT"
FT   CDS             809229..811433
FT                   /transl_table=11
FT                   /locus_tag="RUM_07410"
FT                   /product="Transglutaminase-like enzymes, putative cysteine
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16938"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBE3"
FT                   /protein_id="CBL16938.1"
FT                   /translation="MVKRLLRLDWVPVVFAALILTGIMSYYAGHYLPLAAVGSLVVMLV
FT                   QFRVLDWIHKMRWRGWLIYLAGLILSLFLISQLIQLVEPSQQVEFFIWVLTPQSVLDFS
FT                   GSYTLVMFLLFGIFIGFCVHFFTRIQYRVLVTFVLMMFPFLLFGREGDPMPVWLMLLLP
FT                   AAYFAVMIYCRNRRPSSDAPKPAEICSGTIFLWIALAAVLILPKPAVQADRQLIESLLN
FT                   FDSLTDFLMERINEFTDSSHVDGFYQNSSKIMFYVQAQEPLNLKFKTFTLYDPATDTWK
FT                   AGKQDQKPDGTISPAEDPVNVDPALLSNALLHVLTADPSIGARYGLDLTGFSEQPRTTA
FT                   RACTVYAEKAQYNFGLTPTCWSICYGANNSSVTRSGVLYDNSVMRSYRVQYYGQQDQLT
FT                   ELAVYLNRTLDQEQWKQLLRHAWFGASDLPAEEREALKRAYRIVRYSRLLTDDYMAADA
FT                   PEIPEGVKALAQSIVGDAQSDLEKAQLLEQYFWHNGFVYDKTYYKSPGENAETFLTSTR
FT                   RGICFDFATSYVLMCRAVGIPARYVEGYSMNETDQKGMFVIRGDDAHAFAEVYLTGIGW
FT                   YSMDPTISAGDTSDGLQVDSLVRFIGLMVLGGFALAVLLWWLLHRRIAEAWFRWRVFRT
FT                   APEQAASLLMARIKKQAQLSDGCTAEELSRQLQVQYQAGCDRILAALEQCIYAQRPMEG
FT                   AAVPGLYVEYTLARDRITQVQREARKKRRKRKKGDSMELA"
FT   CDS             811478..812929
FT                   /transl_table=11
FT                   /locus_tag="RUM_07420"
FT                   /product="Bacterial SH3 domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16939"
FT                   /db_xref="GOA:D4LBE4"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBE4"
FT                   /protein_id="CBL16939.1"
FT                   /translation="MTAAVLAAMIMITGICRLSIPVQAATGEYKSWLQTDSRWGSIQLG
FT                   SSGATMSRIGCAVTSLAKLVVHSGSATEETFDPGKLCNYLSKNGGFDSSGNIYWTVVTG
FT                   LVPEFHFCAYTSFKTTTEAEKVAELEKYIQDGYYMAVSVKNQGHWVAVDYIKDGEVYIM
FT                   DPASNAKTNLFDSYDCAGVTQIRLFKGLNPPPTTGNAPVESYYKTGRYTTNTGLNFRAN
FT                   AGITYEILADIPKGTLVTVEGTSGAWGRITYNGKVGWICLEYCTYVEGDYSYPTGRYRS
FT                   TSDNGLYVRGGVGSTTGAIGMLAYLEEVEILEVQDGWGRLNYQGKTGWVCMKYMEPVAA
FT                   TTATTTTTTTTTTTTTTTTTTTTTATTTTTTTTTTTTTTTTTPQPTTTSTTTTTQTTVP
FT                   VTTAPEQTTTTTMDTLMPGDLNGNGQVDAVDTVLLYAYLAGNLELNSRQLEAADVDRDG
FT                   ELTLMDVVLMQRMQDGLYDWKDYTT"
FT   CDS             812926..813894
FT                   /transl_table=11
FT                   /locus_tag="RUM_07430"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16940"
FT                   /db_xref="GOA:D4LBE5"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBE5"
FT                   /protein_id="CBL16940.1"
FT                   /translation="MNWIETQIITASAGVDALCAMLTDLGIKGFSIADPADFQEFLQNK
FT                   EGKWDYIDQDLLGMAQGDTTVTVYLPDNAQGAEQLVALRAMLAQIHARDDAQLFGTLEL
FT                   TLKNVREEDWANNWKQYFKPFTVGERLLIKPSWETCENPRNRAVLEIDPASSFGTGQHH
FT                   TTRLCLELLEQLMHPGDRVLDLGCGSGILSIGALLLGASGATAVDIEENAAATATENAR
FT                   KNHIDPTLYRVFCGNVLEDETLCREIGDGYDLICANIVADVLIAMKQLFRRFLRPEGTL
FT                   IVSGIIMERRDEVLDQLKSAGFTLLEVREKEGWAAASLRIS"
FT   CDS             815963..816622
FT                   /transl_table=11
FT                   /locus_tag="RUM_07450"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /function="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16941"
FT                   /db_xref="GOA:D4LBE6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBE6"
FT                   /protein_id="CBL16941.1"
FT                   /translation="MTYKESFIKFMVDCGVLTFGEFTLKSGRVAPYFVNAGNYNTGEHL
FT                   AKLGEYYAACIQENNIPVQTLFGPAYKGIPLSVSAAVALYHKYGKSVHYCFDRKEVKDH
FT                   GEGGMFVGKQLEAGEQVVIIEDVMTSGKAVREVYPKLKGAADVNITGMVITVDRMERGL
FT                   NSDKSAVQEVKAEFGIDVYPIVTMADIIDAIANDIVPGKEYLDKMIAYREQYGVCK"
FT   CDS             816715..817668
FT                   /transl_table=11
FT                   /locus_tag="RUM_07460"
FT                   /product="Lyzozyme M1 (1,4-beta-N-acetylmuramidase)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16942"
FT                   /db_xref="GOA:D4LBE7"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBE7"
FT                   /protein_id="CBL16942.1"
FT                   /translation="MAKTRKNFIICIQSVLILGLLCLVAFLLIRMRQQEEPAVPANAGM
FT                   AQNSVQEDISVIPKGEIEVDWNYELSGKKILLSDATYGQIYLPVYDNVPAFAQNREQIV
FT                   NRNGRRYYVSDGQITSDMGIDVSAHQGDIDWDKVKASGIDFVFIRIGYRTYGGGDIMAD
FT                   SMFRQNYEGAKAAGLQVGVYFFSQAISEEEAVQEANFVVKQLQGCKLELPVTYDWELIY
FT                   DDTARTDNVPVDVLTDCCLAFSGVVEHAGYEPMIYQNKRTSLLKLDLPRLQGISFWLAE
FT                   YGSIPTYYYDCQYWQYSCKGKVPGIEGDVDLNIRFS"
FT   CDS             817678..818658
FT                   /transl_table=11
FT                   /locus_tag="RUM_07470"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16943"
FT                   /db_xref="GOA:D4LBE8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBE8"
FT                   /protein_id="CBL16943.1"
FT                   /translation="MRQITIQQNDAGQRLDKFLAKSMPALPKGLMCKFIRTKHIKRNGK
FT                   RCAISDRLEPGDVLTFFISDDFFPEHAPQQTPDFLKAPAKLDVVYEDTQVLILNKPVGL
FT                   VVHADNGGTEDTLIHRVLHHLYQAGTYDPAGEQSFTPALCNRLDRNTGGLVIAAKTAAA
FT                   LRDVNELIRSRQLCKQYLCVTAALPPRQQDRVQAYHRKQPAGNLVEIRDAPAEGFAPID
FT                   TEYRVLAQEQGLSLVLVTLHTGRTHQIRAHLAHLGAPLLGDNKYGSVRANRRYRVFTQQ
FT                   LWAWRLGFPELDGALAPLSGRIVTAPEVPFVSAFFPGVQLPPPIT"
FT   CDS             complement(818707..819633)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07480"
FT                   /product="ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16944"
FT                   /db_xref="GOA:D4LBE9"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBE9"
FT                   /protein_id="CBL16944.1"
FT                   /translation="MKELNTYEKELLHQVAELDALPVGAYNIRANGASAARNTTAHIDI
FT                   VTKTDKPGIDIIIKPGTVNESVHIPVIISESGLKDNVYNDFFIGENCDVTIIAGCGIHN
FT                   CGSGDSQHDGIHTFFVGENSKVRYVEKHYGEGEGRGKRFMNPTTIVHLNRNARMEMETT
FT                   QIAGIDDTLRKTTADLAEGSSLVIHDKIMTTGDQHAIAEFDADLNGAGSSCNIVSRSVA
FT                   KENSRQEYTSRLNGNAPCSGHTECDAIIMDHGCVLASPQLTANHVDASLIHEAAIGKIA
FT                   GEQLMKLMTLGLTEKEAEEQIINGFLK"
FT   CDS             complement(819630..820376)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07490"
FT                   /product="ABC-type transport system involved in Fe-S
FT                   cluster assembly, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16945"
FT                   /db_xref="GOA:D4LBF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBF0"
FT                   /protein_id="CBL16945.1"
FT                   /translation="MLELQNVCFEAEGKQILRDISLTLEDRFVAVTGPNGGGKSTLAKI
FT                   IMGIDQPTSGRILFDGTDITGMSISDRANLGISYAFQQPVRFKGLRVQDLLKLASKKDT
FT                   TVTEACSVLSEVGLCARDYMNRELNSTLSGGELKRIEIAMVLARGTKLSIFDEPEAGID
FT                   LWSFQNLIHVFEKMYEKIRGSILIISHQERILNMADKILYIKDGSVAAYGAKDQILPQL
FT                   LKNQDSSTCKVLTDKLAEGKKEVPVA"
FT   CDS             complement(820536..821816)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07500"
FT                   /product="O-acetylhomoserine sulfhydrolase"
FT                   /function="O-acetylhomoserine sulfhydrolase"
FT                   /EC_number="2.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16946"
FT                   /db_xref="GOA:D4LBF1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBF1"
FT                   /protein_id="CBL16946.1"
FT                   /translation="MSYQFETLQVHAGQEKPDPATDARAVPIYATTSYVFKDSAQAAGR
FT                   FGLTEGGNIYTRLMNPTSDVFEQRIAALEGGAAALAVATGSAAITYAIQNIALAGDHVV
FT                   ASHNLYGGTYNLLANTLREQGITTTFVDPSDPANFEAAITDKTKLIYAETLGNPNSDVI
FT                   DLEAISAVAHKHGIPLIVDSTFATPYLLRPIEHGADVVVHSATKFIGGHGTVMGGVIVD
FT                   SGKFDWTQNDKFPGLTAPNPSYHGVVFSQACGNIAYIMKIRTTLLRDQGATISPFNSFL
FT                   LLQGLETLSLRVERHVENALKVVDYLSKHPQVERVNHPSLATGHAKELYDKYFPNGAAP
FT                   IFTFEIKGGAEEAKRFTESLQLFSLLANVADVKSLVIHPASTTHSQLSKEELLASGIKP
FT                   NTIRLSIGTEHIQDILADLEQGFAAVR"
FT   CDS             821996..822424
FT                   /transl_table=11
FT                   /locus_tag="RUM_07510"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /function="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16947"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBF2"
FT                   /protein_id="CBL16947.1"
FT                   /translation="MMISTKGRYALRVMIDLAEHNSGGYVPLADIAERQEISEKYLESI
FT                   VSMLSKKGLVDALRGKGGGYRLNRAPDQYTVADILYVTEGSMAPVACLEPGAKTCDRAA
FT                   YCRTLDMWKRLYELITQFFSGITIADLIADKSGGDFVI"
FT   CDS             complement(822500..823180)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07520"
FT                   /product="conserved hypothetical protein TIGR00104"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16948"
FT                   /db_xref="InterPro:IPR001378"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBF3"
FT                   /protein_id="CBL16948.1"
FT                   /translation="MEPIAYIHTDFPTKFGLPRQSGLVEALEGQVVFLPAYSKPEAFRG
FT                   LEQFSHIWLIWEFSAARKQGDWSPTVRPPRLGGNQRMGVFATRSPFRPNSLGLSCVRLQ
FT                   GVSFEGGQAVLHVSGIDMMDGTPVYDVKPYIPLADCRTDASQGYTRQTATHQLKVHFPA
FT                   ALLEQLPADKRDAAVGILQQDPRPGYSEDPDRIYGVAFAGFDLRFTVTENQLTVRSVEP
FT                   LDKP"
FT   CDS             complement(823286..824092)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07530"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16949"
FT                   /db_xref="GOA:D4LBF4"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBF4"
FT                   /protein_id="CBL16949.1"
FT                   /translation="MEIKLIACDLDGTLLDSRGRLSPENLDAIRRMTDKGYCFVPTSGR
FT                   NREQIPQALQQFPGIRYLITLSGACVTQLPEGKALFRHPLSREHADRLLRIGKQQGAAV
FT                   LLYTPEGVLLEHGALEQRQDRALLEDAIGICRPVEDAQAFCLAEDVQVEKAVFFCRDAA
FT                   QETRLHQALDDGTFQLCVSAENCLEVTARGIHKATGIRALLLRLKLLPEQVLTIGDSGN
FT                   DVSMLELTPNSFAVANAMPEAKRAARHLTVSNDQHVALRIARLLGI"
FT   CDS             complement(824106..825734)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07540"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /function="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16950"
FT                   /db_xref="GOA:D4LBF5"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBF5"
FT                   /protein_id="CBL16950.1"
FT                   /translation="MNKIQGKGVCGAVTMGKLYFYKKDNDTISRKTITDPEAEQQRFDR
FT                   ARQQAAQELDALHEKALREVGEIHAQIFEIHRMMLEDEDYCSSVSHIIHTQRVNAEYAV
FT                   LRTSDSFSQMFSTMTDEYMQARAADVVDISNRLIRCLSGGSEESLLTREPVILVAEDLT
FT                   PSETVQLDKEKILAFLTLRGSENSHTAILARTMAIPAVVGLGHLDPAMEGKTAIVDGFT
FT                   GTVCIDPDAEAIAAYTRKKQQEEEKHRLWQSLRGKSNTTLDGRSIRLYANIGGLDDISA
FT                   ALQNDAGGIGLFRSEFLYLQNDHMPTEEEQFRAYREAAEKLAGKPVIIRTMDIGADKQI
FT                   DYFHLPKEENPALGYRAIRICLSEPELFRTQLRALYRAGVYGDLSIMFPMITSPEEIRH
FT                   IQKQAELARQELRQQEIPFREHMETGIMIETPAAAVISDILAPMVDFFSIGTNDLTQYA
FT                   LAIDRQNPSLEAFYQPHHEAVLRLIHQVIRNAHKAGIWAGICGELGADPALTERFLRMG
FT                   VDELSVSPAQILPIREKIRSMDLRQ"
FT   CDS             complement(825750..826085)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07550"
FT                   /product="Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16951"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBF6"
FT                   /protein_id="CBL16951.1"
FT                   /translation="MFPKKQPILLPERQKPQPQCGGREQFMKQFVYTITDENGIHARPA
FT                   GQLVQAAKAYESEITLTKGDKTASAKKLFALMGLGVKQGDPVTVTVEGSDEAEAAAGVE
FT                   AFLKANL"
FT   CDS             complement(826135..826596)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07560"
FT                   /product="Predicted flavin-nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16952"
FT                   /db_xref="GOA:D4LBF7"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBF7"
FT                   /protein_id="CBL16952.1"
FT                   /translation="MSMRRTDRQMDRDSAWQAVDACSFGTVSMLLPEGEPYCVPLSIAR
FT                   IGETLYFHCAQEGLKLKALRKHPAVCVSCVGMAEPVHDKFTTRYTSAILTGTAREVTDE
FT                   AEKIRALRAICEKYTPENMSRFDAAIAQSLSRTGIWRIDVTGITGKCKK"
FT   CDS             complement(826593..827636)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16953"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBF8"
FT                   /protein_id="CBL16953.1"
FT                   /translation="MATTIQEALAICNANLTGDLKTDIPYLEGQVRRYAHEPNGEELAK
FT                   RITELAFSLLPKEQQDQFMTATTLNGKRLDELFHEARELLNQEKYQEAAVSLRALTAKC
FT                   EEGFGKESKLHYFSFRNPFEYHLYRMLYPGQSNIERAPYDFAMYYTLYGYALVELGKLD
FT                   DAIEALEQGIRFNPVSCDVRFELAEVYKLKKEPEKLLAVIRELFPIANSTYAMSRIYAD
FT                   LGFYAIAVHDYDAAVCFFYESLVYNNHPGVQAELVNLRGLMGHNIEPPTRKQVLAVFEK
FT                   YELPAGPNEELIRLALVLAKTAVQDEQMQLGAYFYSIAYDLTRDPEIKKQIDAIRAAMT
FT                   PEESKQA"
FT   gap             829054..829484
FT                   /estimated_length=431
FT   CDS             829923..830063
FT                   /transl_table=11
FT                   /locus_tag="RUM_07600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16954"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBF9"
FT                   /protein_id="CBL16954.1"
FT                   /translation="MVILLSMVLHFKLYSILNKKASPPTEKIEKSIQKNEGILSDVRSR
FT                   I"
FT   CDS             complement(830148..830795)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07610"
FT                   /product="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16955"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBG0"
FT                   /protein_id="CBL16955.1"
FT                   /translation="MNSPYMGKFRISQLYKGVAHDGLDLVGVDSKTIHSTVNGVVLYAG
FT                   WENSFNHRQGFGQYVKIRRTGTQEVYYFGHLSSLLVKTGDTVRITDPIGIEGSTGRSTG
FT                   SHLHYCMRMGGIKGQHRDINRISGIPNVIGTYDDGYVSRMQTLEEQAQQLSLSVGDRVR
FT                   VRQGATDYKGKKLAAFVYRTVYQVQQISGDRIVIGIGGQVTAAMHAADLTRI"
FT   CDS             complement(831356..832315)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07630"
FT                   /product="Protein of unknown function (DUF2807)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16956"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="InterPro:IPR025386"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBG1"
FT                   /protein_id="CBL16956.1"
FT                   /translation="MKQGKKIALTTASALVFAGLVLSVGSMCAMDFDFSKLETTPLHSE
FT                   TIQVEQSFTNISMTGTSCDIQFLPAPDDSCTVTCSLRQGNRCEAQVQDGTLYIRQWEEQ
FT                   KWYLGISLHPEKIRVYLPEDSYASIQAETNSGDLTISEPLQFQSANLQSNSGSIDLSAS
FT                   ISGKLSMTVQSGDIRAKDTRLHQLEARCNSGSILLDQVHLKADAQLHANSGSITLTDVQ
FT                   GGTLSADAGSGDVRLTNVLTEDSLRLETNSGNIKLQHSDGAAITIRSGSGDVSGSLRTP
FT                   KQFVTQTGSGSCSVPESGTGGACEIRTNSGDIRLKVEE"
FT   CDS             complement(832312..832920)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07640"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16957"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBG2"
FT                   /protein_id="CBL16957.1"
FT                   /translation="MNQTEWITALRQALRGLPREDVERSVGFYEEAIQDRMEEGCTEEE
FT                   AVAAIGTPRDIADQILAEIPLTKLVRKKVAPTRAFRPWEIILLILGAPLWLPLLLAAVS
FT                   VFLAIYIALWSVILSLYAVDLSVAACGIAGIVGTFLYGYLSGGHIAGSLLFLGAGLLCS
FT                   GIALFLVFGFNQAARGILLLSKQFMLCIKALFKKKEEAA"
FT   CDS             complement(832907..833233)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07650"
FT                   /product="transcriptional regulator, PadR family"
FT                   /function="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16958"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBG3"
FT                   /protein_id="CBL16958.1"
FT                   /translation="MDIQLKRGLLDVCVLAAIKNEDSYGYQIIKDIKPYVEISESTLYP
FT                   ILRRLEAGQMLTVRSTEHGGRLRKYYHITEQGLRRLEEFQQEWQELQAIYKFITKEEPE
FT                   HESN"
FT   CDS             complement(833342..833785)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07660"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16959"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBG4"
FT                   /protein_id="CBL16959.1"
FT                   /translation="MHIYIDADGCPVVEQTIRLARQYGVPCTILCDSAHVFQDEYANTI
FT                   TVSTWADSVDFRLVNLLHPGDLVITQDYGLAAMCLARQAYVLHQDGNWYTGENIDGLLE
FT                   TRHTAKRIRRQGGRLRGAPKRTLAQDQAFCQALEQRLRVVTTE"
FT   gap             833813..834103
FT                   /estimated_length=291
FT   CDS             834224..834796
FT                   /transl_table=11
FT                   /locus_tag="RUM_07670"
FT                   /product="Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in cell envelope biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16960"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBG5"
FT                   /protein_id="CBL16960.1"
FT                   /translation="MDLKSFSALEWAHKFIREHVKPGDLCIDATAGRGHDTALLCGLVG
FT                   ETGHVTAFDIQSDAIASTNARLAELGYTDRATVIQGSHSTMGEYAQPGTISCITFNFGW
FT                   LPGGDHNIFTHADTSIAAIGQGLELLREDGIMSLCIYYGRETGFAERDALLAYLRTIDS
FT                   KQYTVMICEFANRSNCPPIPVLIWKGK"
FT   CDS             complement(835047..835316)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07680"
FT                   /product="sporulation transcriptional regulator SpoIIID"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16961"
FT                   /db_xref="GOA:D4LBG6"
FT                   /db_xref="InterPro:IPR014208"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBG6"
FT                   /protein_id="CBL16961.1"
FT                   /translation="MKGQPNDRAIILGEYILEHKATVRAAAKQFGISKSTVHKDVSERL
FT                   PKIQPQLYPLVKEVLELNKQERHIRGGLATKEKYAKLEQQKHKY"
FT   CDS             835469..835717
FT                   /transl_table=11
FT                   /locus_tag="RUM_07690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16962"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBG7"
FT                   /protein_id="CBL16962.1"
FT                   /translation="MERKRNQFDLPGIYYFQAGNTYTGSKGKLRFRIDVDGQIHVACWR
FT                   TPLCFELSEMEGRAEFPLTEEGYDGLIAWLDAEYAAT"
FT   CDS             complement(837282..837734)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07710"
FT                   /product="Bacterial membrane flanked domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16963"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBG8"
FT                   /protein_id="CBL16963.1"
FT                   /translation="MRRYFADKTCINLIRLVLLLVTALLDALAYYFIPVAPYLSALPIV
FT                   LWVVIVTVTVAGLFAAMVYLPLYFRHTCYYVSPEQVVKHSGCFFVRTQTLRRSAIQYTT
FT                   SISTPFSKITGLNFILLSAFGGSMLLLFLSKRDYEQLRTALQPPRG"
FT   CDS             837863..839161
FT                   /transl_table=11
FT                   /locus_tag="RUM_07720"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16964"
FT                   /db_xref="GOA:D4LBG9"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBG9"
FT                   /protein_id="CBL16964.1"
FT                   /translation="MLETVNAFIWGNLLLSLLLGTGLYYTVRMRGFQLRGMGRVLRCTF
FT                   SGCRSRTAGSGRISQLQTMSAALAATMGTGNIVGVATALTLGGPGAIFWMWISAILGML
FT                   LVYAENMLGALFRYRCEDGSWCGGALAYLERGMRSRPLALAFAGCCVLASLGMGNLAQV
FT                   NSLACAAWDGFGVPPVVCGLVTAALAGIIILGGVDRIGKAAQSLILPLSGLYLLCGVVF
FT                   LILRRDALGEAFSSIFRGAFGLTAVGSGISGAAVRRCINIGLRRGVFSNEAGLGSASLL
FT                   HAAGEAEDPCVQGMCGIFEVFADTILCCTMTALVILCSGVTDPTLEGAALVMAAFSARF
FT                   GAFGRIFITLSVMLFAFATLIGWSVCGESAARYLSPRWGSCVYRICFLFACMIGAVQDL
FT                   TLVWQLSDLFNGLMAFPNLIGLIGLRRHVHPPA"
FT   CDS             839220..841304
FT                   /transl_table=11
FT                   /locus_tag="RUM_07730"
FT                   /product="Nucleoside-diphosphate-sugar pyrophosphorylase
FT                   involved in lipopolysaccharide biosynthesis/translation
FT                   initiation factor 2B, gamma/epsilon subunits
FT                   (eIF-2Bgamma/eIF-2Bepsilon)"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16965"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBH0"
FT                   /protein_id="CBL16965.1"
FT                   /translation="MNAVIFCDGGCGWLAPLSRLPKALLPLCGRPLLAYLLDLLADSGC
FT                   VEQTLLVEDGRELSCQFGSLYRGMPLAYAHEAPDHTGTDTLVIPEPVLADFDLCAALSV
FT                   HQNHGGMTALCIAVTEPELYPMLENGQAFTGCCILSAGMPLRQDLYVLARQEQAQLYPD
FT                   AGTWHRIGSVREYLRAQRAVLRSGLKTAGIRTSQGCITPDGQPDNRLEQPCCTGAGLKI
FT                   GGDSRIRSCILGRQVSIGSGVELTDCVVGDGAYIGDNVVCREAWIGAGAMLMQGSCMEP
FT                   GSALGENSRLGEASVLRQGVQVYTDKRVPPRTDAAEDVRSSLPVPLELDSGCLCGEQTA
FT                   LGMLRLGEGLAACGDTAVGCAEDPDSRVLLHTLCAGIALAGGGCLRLEDCTLPQLQAAS
FT                   VMGDCDLLLYADAGAKDCLTLYGKGGLPLTRQQEQQIGGALSMPSGLGFRKHRSGMIAE
FT                   GSGFAALYTRQLALRSRSDCGRRIEISAGAPGLGRLAETLFGGTGAPLVFQLSDGGRRL
FT                   TVYGEDTGFVHYEQLLLLCCMLRGRKGEDAALPDWFPAAGDRLMETYGRRILRYGREED
FT                   SRARALALAQRFSLDGLELGMELTELLAETGESLSALLAQLPPLYTTRRLMEAGDSARQ
FT                   LLQRVCGDPRGGVLQENAQGAVRVLPEGRESLLLYAASSDMETAQELCGQAEAFLRGYC
FT                   "
FT   CDS             841603..843663
FT                   /transl_table=11
FT                   /locus_tag="RUM_07740"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16966"
FT                   /db_xref="GOA:D4LBH1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBH1"
FT                   /protein_id="CBL16966.1"
FT                   /translation="MQTALPEPWRAALPDSAAPFCAEMFPCTIFLRVVPGTTGRQYCIG
FT                   TVRCSRKERLNVNNENQKRFVRPKRESGAVPQQGQNGQKQGGRKPAGRNPQKLGVKPPK
FT                   ANKPQQEQLLPVQQAAHKSKNQKKPKELRKTPVRIIPLGGLNEIGKNLTVVECANDMFL
FT                   IDCGLAFPDSDMLGVDIVIPDFTYLERNVDKLRGVVLTHGHEDHIGGLAYLLKKINIPV
FT                   YGTQLTLALVEGKLREHRLLGKVKLNVVKPRQTVKFGCMAVEFIRVNHSIPDAVGMAIH
FT                   TPAGVIVHTGDFKVDYTPINGEIIDLARFAELGSKGVLALLSDSTNAERPGFTPSERTV
FT                   GESFEKLFAKAEGKRIIIATFSSNIHRVQQIIDCAARYGRKVAIFGRSMVNVMTVAIEL
FT                   GYLTVPKGIIIDIDMMNRYESERIVLITTGSQGEPMSALTRMAMNDHKKVTITPQDFII
FT                   ISATPIPGNEKTVTKVVNELMKCGAEVVYERMYEVHVSGHACQEETKLILALTKPKFYM
FT                   PVHGEYKHFKKQKQLAMDMGIPKENIIIGDIGNVIETDGVDMKIVSQVPAGRVMVDGLG
FT                   VGDVGSIVLRDRKHLAEDGLIIVTVVIDKSIGEVVAGPDMISRGFVYVRESEQLMDEAR
FT                   NLLSHTLASCTPQDFREWNSMKTKLRDALSDFIFSKTKRSPMILPIISEIH"
FT   CDS             843663..843704
FT                   /transl_table=11
FT                   /locus_tag="RUM_07750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16967"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBH2"
FT                   /protein_id="CBL16967.1"
FT                   /translation="MHPGMIRHAAKEA"
FT   CDS             843708..845678
FT                   /transl_table=11
FT                   /locus_tag="RUM_07760"
FT                   /product="Predicted signaling protein consisting of a
FT                   modified GGDEF domain and a DHH domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16968"
FT                   /db_xref="GOA:D4LBH3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBH3"
FT                   /protein_id="CBL16968.1"
FT                   /translation="MREKRPVWFCITVGLLLCSAGYAAYGLHGYDTERFWLSVVLLFVS
FT                   AVLFLISFFLFSKRNIRFIATLNDELAAAEHETMYSLPVPTVILDDSGLILWYNLLFGR
FT                   DILENDDVFGLRIGEVLDLDLPTLLETGSGSVHYCDKQYEISVTTCTRNDRNLHLLCFT
FT                   DVTDYAALQDTFLNTRPTVMLLVIDNYEDVLQNAKESEKATVFVAIEQMLERFMAPTTG
FT                   VLRKLSSDRFVAVVEEQHLQQMIRGKFRILDDARTITVGERYAITLSIGVGHGASTLEE
FT                   SEAFAKQALDMALGRGGDQVALKTENGYKFFGGVSKGVEKKSRAKTRIIANAMQELIHT
FT                   CDRVMIMGHRYGDLDSIGSAIGLAGAILQSGKPAHVVVDRQTTLAGVLIDRMEAEDIHL
FT                   TIDVPTALTQMTEQTLLIVVDTHSKDFVESVDLYQNARQVVVIDHHRKIVNFIDNAVIF
FT                   YHEPYASSAAELVTELLQHFRNTEHLNPAYADVLLAGIMLDTKNFVMRTGVRTFEAAAY
FT                   LRKMGADTIAVRQFFSSSIETYQHRAHLVSQAELYHHCAIAVADEVFNDIKLVAPQAAD
FT                   ELLGIRSVAASFVLYSLNGEVNISARFMGSMNVQVVMEKLGGGGHQTMAATQIPDITVA
FT                   EAKQQLLQVLAEEFAQPEQSK"
FT   CDS             845693..846142
FT                   /transl_table=11
FT                   /locus_tag="RUM_07770"
FT                   /product="LSU ribosomal protein L9P"
FT                   /function="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16969"
FT                   /db_xref="GOA:D4LBH4"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBH4"
FT                   /protein_id="CBL16969.1"
FT                   /translation="MKVILTKDVKGTGKAGDVKEVADGFARNFLIGKGLALEATAKNLS
FT                   DLAGKKASQQHKIDVEKQNAREIAEKINGKTVTVHAKAGANGKLFGAVTAAQIAEQIAA
FT                   QYGCTVDKKRISLKSDIKNYGEYEAEIRLYTGIGAKVTVSVVEAN"
FT   CDS             846164..847501
FT                   /transl_table=11
FT                   /locus_tag="RUM_07780"
FT                   /product="primary replicative DNA helicase"
FT                   /function="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16970"
FT                   /db_xref="GOA:D4LBH5"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBH5"
FT                   /protein_id="CBL16970.1"
FT                   /translation="MNQLEQGGFSEKELPYSIEAEQSILGAILVNSDVLPTVVDLISPE
FT                   CFYNEQHRQLYGIMLRLFTSGSQADIVVVLNEALQARIFENAQEGRKYLAALVDQMPSV
FT                   SNVASYCKIVAEKYYIRSLAYVAREVLDRVADGGDDAQTLLDWSEQKIFDIRQGKDVRG
FT                   LIPISEVIVEAYDTIGKMAGPDREKYIGARTGFSMLDAITSGLNKSDLILIAARPAMGK
FT                   TAFALNIATNVARHSDKEVAIFSLEMSMEQLATRMLSTEALVDSNKLRSGKISSDDWVR
FT                   LASSANYLSGMGIYLDECSGVTVPQIKAKLRRMKNVGLVVIDYLQLMDSATKSDNRVLV
FT                   ISEITRQLKIMAKELDIPVLLLSQLNRGVESRPDKRPMLSDLRESGSIEQDADIVMFLY
FT                   RDAYYNKESERPNISECIVAKNRHGETGTVELIWDGQYTRFSNPER"
FT   CDS             847503..848849
FT                   /transl_table=11
FT                   /locus_tag="RUM_07790"
FT                   /product="tRNA(Ile)-lysidine synthetase, N-terminal
FT                   domain/tRNA(Ile)-lysidine synthetase, C-terminal domain"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16971"
FT                   /db_xref="GOA:D4LBH6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBH6"
FT                   /protein_id="CBL16971.1"
FT                   /translation="MLHCMMETIHRYAMVQPGDTVTVALSGGADSTALLLGLLALREQL
FT                   GISLRAVHVNHHLRGAESDRDAAFCAQLCEERQVPFFLGTCDVATYAAQRKHTSCEMAA
FT                   RELRYAQLEALCPPGSKIATAHTASDNTETVLERLTRGTGLAGLCGIPPVRGRIIRPLL
FT                   YVTRPQILGFLAQQHQSYVTDSTNAQDAFFRNRLRHHVLPVLRQQNPAVDRTVGVMTRI
FT                   LSDEQQYLEQQAQDAFDRCFDPAQNSLSGLQNLHPAMERRVLALFLQRCGVEVSAVRIA
FT                   RVEQLLQTGGKQNIAAGVYLTADQGMLKWEHAQAPSPAVGEMVLQIGENRLMPGRICMA
FT                   RLEKINQVTSNCNVHSKFTNATLDYDKIKGTAVLRGRKQGDSIRLAGRDFTKSVKKLLQ
FT                   EKVPVQQRSKLHYLQDDAGLIWIEGIGISARVQPDAGTQQLLTLTVSDG"
FT   CDS             850861..851595
FT                   /transl_table=11
FT                   /locus_tag="RUM_07810"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16972"
FT                   /db_xref="GOA:D4LBH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBH7"
FT                   /protein_id="CBL16972.1"
FT                   /translation="MVLDVQGLSKQYSKVLAADQVSFQIGEGEIFALIGPNGAGKTTTI
FT                   RMIATLLQPTGGDAVVAGHSVCREPAKVRECITYLPDEAGAYKTMTGKAYLKFMASIFT
FT                   TDRKQADACVQRAMAMCGLGDRLNEKIGTYSRGMIRKLLLSRAVMTRPKLAILDEPTSG
FT                   LDVINALEIRKMILQLARDEGMSFLLSSHNMLEIEYVSDRVGIISGGHLMVTGKPEELK
FT                   TRYGASNLEEVFERVVLQHEVH"
FT   CDS             851582..852907
FT                   /transl_table=11
FT                   /locus_tag="RUM_07820"
FT                   /product="ABC-type Na+ efflux pump, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16973"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBH8"
FT                   /protein_id="CBL16973.1"
FT                   /translation="MKFISLLKKELRELLTAQLVVVLVVTAGMMFMIGQILSNVVQDAA
FT                   KESGSLHICDQDDTELTRSLIQQLKALGYEVDTVEITGEDRAAAMSRLELSSLIILPEG
FT                   FTDALLHGTDPAQVETVSVLKNASMVSSAGDPLAGGLQSIRTILTQVLMEQSGMTQEQA
FT                   AKAMQPFGTKEITVVRDKSAQINSSTLVGFLSMQNMLIPIVVFMLVMYTSQMIIGAIST
FT                   EKIDKTLETLLSAPVSRLSVILAKMLAAAIVALLNAVVYMLGFTGYLSSMLSQSIGDTS
FT                   LGEVVGQAQTMDDIMTQLGVNMTAGSYLLVGLQMFLTILVTLSVSIILGALVNDAKSAQ
FT                   SVLMPIMVLAMIPYLISMMTDIQSLSPVVRTLLYAIPFTHTFSAMSNVMFGNMALYWIG
FT                   AGYQLAVFLICITIALRLFTSDRIFTMSINFGAKKKFSRSKG"
FT   CDS             853039..854970
FT                   /transl_table=11
FT                   /locus_tag="RUM_07830"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16974"
FT                   /db_xref="GOA:D4LBH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBH9"
FT                   /protein_id="CBL16974.1"
FT                   /translation="MLVSLSNIHKYYNGREILHGVNLTINEGERIGLVGANGCGKTTFL
FT                   RILTGKEEPDRFVEDDGVISRASKTTVGYLEQMGGLERSSTVYAEMRSVFADVLQAADR
FT                   MRELEAQMHGALDVVSEEYSRLTAFFESRDGYLIDVKIKTVLNGMGFGEDTYDRVISSF
FT                   SGGEKTRLAIAKLLLEEPNLLILDEPTNHLDFQTVLWLEEYLKDYKGSLLIVSHDRYFL
FT                   DKLCTSICEIERGHLTRYKGNYTTFTRLKAEAVARQLKEYEAQQKEIAKLEDYVARNIV
FT                   RATTAKSAQSRVKALERMERIEKPVMPQKAAKLRFTYETEPPFDLLQVQNIDVTVGIGE
FT                   QKRTLVDSLSFEVKRGEKIGIIGENGIGKSTLLKVLLGKLPHRGNVHWTSNVRLSYFEQ
FT                   ESTQLNPNNTVIDELHDRYPTMTDLEIRSLLGQVRMTGENVFKQIGVISGGERAKVCFA
FT                   LMMLEHGNVLILDEPTNHLDLTTKEVLEEALAAYTGTILFVSHDRYLLNRISDKILEIT
FT                   PHQAELFPGNFDSYLAVHQQRELLAQQEADAQKQRRAAEEAKERGTKVYRTKEQRSREA
FT                   QRRNRIRTLEQEIDALEQQQQQLQEQIGTEEVCADYKRMQQLCNQIEQVKGQMEEKFEE
FT                   LMLLEEEA"
FT   tRNA            855077..855150
FT                   /locus_tag="RUM_T_24300"
FT                   /product="transfer RNA"
FT   tRNA            855154..855230
FT                   /locus_tag="RUM_T_24310"
FT                   /product="transfer RNA"
FT   tRNA            855272..855348
FT                   /locus_tag="RUM_T_24320"
FT                   /product="transfer RNA"
FT   CDS             complement(855406..857673)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07840"
FT                   /product="Response regulator containing a CheY-like
FT                   receiver domain and an HD-GYP domain"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16975"
FT                   /db_xref="GOA:D4LBI0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBI0"
FT                   /protein_id="CBL16975.1"
FT                   /translation="MSNLNNQTAPDIQMIWQCYGQNPQPFLLLRSETNENGTQKLQAVY
FT                   GNQAFYALTKSDPTTLEGTPYQVLFQDNILQHTEQLLAIATEGGSTQIQLSNQSIDNLT
FT                   IRAFQLMPGFCGCLLSQDSQPDIYTEIEKLDENLSGGLLVIEHASPYRLLYINQFLYLL
FT                   LGYGTMAELQEESESASIHSFIHPEDLEKAKEALHSMTDIGFAHCVLRVQKKNAGYLWL
FT                   SLRGKCRMLAGVPVLILTAHEIGNEIETIQLEGNISHQVNLNLAAQYYALYYLEAASGH
FT                   YRLVFHDSRLEQPHIPTDGDHILATRKYLEELVHPDDREKLLRLTNVRELIRCSRQCGN
FT                   CRVLNVQFRRKCGGVYEWVEMYLSINAADRPEQRLVTLAFRNIHEEKLAELAHRYLDVI
FT                   AYAIADTYDAVLEYDTRCNSLFELQMTDDGLRRSQRCRASSEVVTQMAKECIHPDDMNA
FT                   FLEEFHPDRFKKLSKGQAITREYRRHCPDGRYHWCSYSMRCFMQNGRKLYILFVKDIHE
FT                   TKMRVLQQQAELRQAIVEAEQRALEKTQQLFTYYGKTIELMSSVVEYRSLESGEHVKRI
FT                   KNYTKELLQAAIDLYPEQHLTAEKIQSITEASALHDVGKIGVPDGILLKPGRLTKDEFE
FT                   VMKRHTLIGSDIAKEIPFVAERKAEYNYGYNIARYHHERFDGKGYPEGLQGDQIPFCAQ
FT                   IVAIADVFDALTTKRVYKDAYSKEKAYEMIMNGECGTFAPKMLECFARVRERFNKLVQT
FT                   DH"
FT   CDS             complement(858872..860419)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07860"
FT                   /product="Sel1 repeat."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16976"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBI1"
FT                   /protein_id="CBL16976.1"
FT                   /translation="MKAEWILNLKPGEDPEQKAQEWIREYDAFAEDFPDSRALADQLSQ
FT                   RVRNAAALLKGTHAADNLNLNGVPLGDPADMAFAGSWFSLPELVDIQMGWAVLADGRND
FT                   AQGDPHASVRQGFLRELEGKWQDALRCYQQGPEDPEIRRRMQYCRERTTAEGALCYAKA
FT                   QELLLKLRQSEALKLLNRAAHLGNIDAAEQLALSPASKDREKALGLLRHAAGQNDPDAC
FT                   FALYRLYDQGIYPVQATEAERMLHQAADLGHAQAQTLTAEGIGLRPVRTILLEEIHAGS
FT                   KDALWWMVQECEKQGDMEQAVEWLDKAIEANQLDALLATAQAYAEPGTEAYSRADAMDY
FT                   YRRAARAGSLEALTALGDLELTDTHISFYDMALLLHSPDAPRKKPDKHMVEQHKKQLAW
FT                   YTLAANAGAVGPMLVLSDAYAQGYPVEQDAAQAFFWANQGAGAGDPLCMYKAARMLEQG
FT                   NGVQQNLPEAVRLYEQAALKGMAQAAERLWQIYATGLGAIHPNRRKAAFYHRRTNRR"
FT   CDS             860638..861297
FT                   /transl_table=11
FT                   /locus_tag="RUM_07870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16977"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBI2"
FT                   /protein_id="CBL16977.1"
FT                   /translation="MKKPLIQRLGLLGILSLLSYGAAVIFAPLVYPGYNWMAQAVSDLS
FT                   AANAPSLALWNQLSALYNTCEVLCVTVVCLGIQGRKNRLLRSGIYLFAAMEWISAVGYR
FT                   MFPLSDSGYGGTLQDRMHILVTVLVVLLSILSLTLILIAGIRHRDCRSYGICAGIALGM
FT                   MLVGALGMKLVPAAYFGVVERFSVFAATGFDAALGVHLFCMKPAGSPASEQQKEHM"
FT   CDS             861325..861957
FT                   /transl_table=11
FT                   /locus_tag="RUM_07880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16978"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBI3"
FT                   /protein_id="CBL16978.1"
FT                   /translation="MNSIQVNPQSARRLAVYVHGKGGDSKEAEHYKPLLAGWDVTGFDY
FT                   HAQNPWEAQAEFPVFFEEQRKAYDTILLIANSIGAFFSMHALSGRQVEQALLISPVVDM
FT                   EKLIRSMMTWANVTEEELSARGEIPTSFGETLSWEYLCYVRRHPIRWDVPTCILYGDRD
FT                   NLTAPGVMSAFAERTGAVLTVMQGGEHWFHTAEQMAFLDRWVRTSLD"
FT   CDS             complement(862066..862650)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07890"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16979"
FT                   /db_xref="GOA:D4LBI4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBI4"
FT                   /protein_id="CBL16979.1"
FT                   /translation="MDQIRTGSLIRRLRLEQGMTQLALAERLGVSDKAVSKWERGCGAP
FT                   DLSILPLLSQALEVDTDTLLRGDLEANDLTNGNLKRMRFYLCPECGNLLISQENADISC
FT                   CGRRLSPLEPQKTDPAHMLHAERNDGEWYITTEHSMHREHYISFVALLSGDTLILKKRY
FT                   PEWTLETRLPYLPQSTLLWYCTQHGLFSQRL"
FT   CDS             complement(862700..863497)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07900"
FT                   /product="Methyltransferase domain."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16980"
FT                   /db_xref="GOA:D4LBI5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBI5"
FT                   /protein_id="CBL16980.1"
FT                   /translation="MELTNRNIDGGNGFDWGRTSGDYARYRDIYPQTFYDRILARGLCT
FT                   AGQAALDLGTGTGVLPRSLYPYGAQWTGTDISPQQISQAKQLSAGMQITYRVCSAEQLD
FT                   FPTDSFDVITACQCYWYFDHGKVAPLLARMLRPGGRVLFLCMEWLPFEDPVANASEQLV
FT                   LKYNPSWTGAGETMHPISIPDCYGAYFTLTHREEYLLDVPFTRESWNGRMRACRGVGAS
FT                   LPPEQIAAWEQEHMQMLEHMAPEAFTVRHYAAMAELTLHSTER"
FT   CDS             863775..864449
FT                   /transl_table=11
FT                   /locus_tag="RUM_07910"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16981"
FT                   /db_xref="GOA:D4LBI6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBI6"
FT                   /protein_id="CBL16981.1"
FT                   /translation="MITLENVHKIYNPKKANEFEALKGVSLTIEDGEMVAIIGKSGAGK
FT                   STLLHILACIDSYESGEYKIDDTLVKNLSEKQYAQIRNEKIGMVMQDFALVDDFTCLEN
FT                   VLLPLDFAKHKKSNRKELALAALKSVSMDSMAKKPVNKLSGGQKQRVAIARAIVNQPSM
FT                   VLADEPTGALDSKTAEEIMHVFKELNHQGKTVVIVTHDMGVAKQCDRLIEISDGKILET
FT                   AS"
FT   CDS             complement(864511..866109)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16982"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBI7"
FT                   /protein_id="CBL16982.1"
FT                   /translation="MLKLLVKKQLMEIFRNYFYNPKTNKKRSTGAVIGFVVLFAIIMIG
FT                   MLGTMFTALSVSLCKAFIPLQMSWMVFGIMGLLGIFLGAFGSVFNTFSGLYLAKDNELL
FT                   LSQPIPVRSIILSRLLSVYLMGLMYSAVVTIPAAIVYCVYTTVTPAVILGCTLMVLIIS
FT                   MIVLVLSCLLGWMVARISLKLKNKSFIRVLTSLLFIGAYYFFYYKAQGTLRNLIANAVT
FT                   YGQEIQGSAYPVYLFARVGEGDWKAMGLVTLATVLALLLTWRILSRSFLHIATATGKTK
FT                   KAAFRADAIRTRSISGALLSREFGRYASSPVYILNCTMGTLFLLVIVVAVLIKSGTVLP
FT                   TLGKICSEYSGFIPVLACAIVCMVASMNDSATPSVSLEGKNLWLIQSLPVRPWDALKAK
FT                   LQVQLLLTAPPAFLCSVCLAIILPGTLAEQLLMVVTSLLFVAFSALSDLMLGIKSPNLT
FT                   WTNEMVPIKQNFSVFVAMMGGWIYSVALGGLFFLCDRIMSASVYLGIVCLLTAGLSLLL
FT                   YRWLKTKGANIFASL"
FT   CDS             complement(866103..866816)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07930"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16983"
FT                   /db_xref="GOA:D4LBI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBI8"
FT                   /protein_id="CBL16983.1"
FT                   /translation="MLQISHLSKSFGDKKAVDDLSLHIAPGEIYGFIGHNGAGKTTTLK
FT                   SIVGIQQFDAGKITIGGHSIQEDPLGCKQMLAYIPDNPDIYEYMTGIKYLNFIGDIFRL
FT                   PAADRKARIQKYGDLFELTGDLAQPVASYSHGMRQKLAIISAWIHQPKLVLMDEPFVGL
FT                   DPTASHLLKGMMRELCDQGGAIFFSTHVLEVAEKLCDKIAIIKGGKLIRSGTLEEVKGD
FT                   DSLEEVFLELEGETC"
FT   CDS             complement(866820..867446)
FT                   /transl_table=11
FT                   /locus_tag="RUM_07940"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16984"
FT                   /db_xref="GOA:D4LBI9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBI9"
FT                   /protein_id="CBL16984.1"
FT                   /translation="MPPSVKFTKEEIVNAALQVVREKGTAALTTRQIAAVLGVSTRPIF
FT                   TYFQNMQQVQEAVRQAAQALYHSYIKKGLEQVHPFIGLGEQYIRFATQEPELYRLLFLP
FT                   LAPGSESKAMEEMERTQNLVLEFLQQIYQLDEAAAKQFFRDVWLVAHSLAALIVTNCCP
FT                   YSPEEIRQILTSVSLSVCKACKEIPEFVTNHLDRDTLFRSIIEKE"
FT   CDS             868815..869384
FT                   /transl_table=11
FT                   /locus_tag="RUM_07960"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16985"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBJ0"
FT                   /protein_id="CBL16985.1"
FT                   /translation="MREKTVCFSGHRPEKLPGPNSEDAQLLMMVKSLLYYQIRRSAEEG
FT                   YTRFITGLARGVDLWAAGYVLELKRDFSGLQLICVKPTENHGKNFRGEDRYLFDSVLAR
FT                   ADEMYCTGSHYTRRCYQIRNRYMVDHAQRLIAVVDDYNSGTGQTIGYARKCGLELCVID
FT                   IGKLRDKAKAEPDEPIIAPLQANFKI"
FT   CDS             869572..870426
FT                   /transl_table=11
FT                   /locus_tag="RUM_07970"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16986"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBJ1"
FT                   /protein_id="CBL16986.1"
FT                   /translation="MKKNTGSIAIPFLITLLVSFVIIGGIIFFLFGGFGGGGDSLKQLE
FT                   PEITLISEEDQFNLFCVLDTEESDKPVCYMIFRFNPVAKRNTCIALPANLAVNNNGAST
FT                   KLDNVYHMSGVTAARDAAAAALNMALDRYMVFDSTSFQKLCSILGGVECIVDEKIVGLQ
FT                   ESDKMQYLGGSQIQLYLTYPDFTGGEAQRMVVVDSTIAEMLNQTDGSRISETLDRSFST
FT                   IINLVKDSDVTAQDYKNRKHAMKYMLEYAPGSTGYYYLSLQQTGDLLTIPENTLKNMQE
FT                   MVK"
FT   CDS             870428..871198
FT                   /transl_table=11
FT                   /locus_tag="RUM_07980"
FT                   /product="hydrolase, TatD family"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16987"
FT                   /db_xref="GOA:D4LBJ2"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBJ2"
FT                   /protein_id="CBL16987.1"
FT                   /translation="MNEPLIFDSHAHYTDPAFDPDREQVLAALPEQGVARVMLAASDLV
FT                   SARAGIQLAAQYDYIYTSVGIHPEEAGRVPADYLETLEQLLACQKVHAIGEIGLDYHYP
FT                   GYDPAQQKMLFCSQLELAAKHDLPVIMHCRDATGDCMEILRQYRPKGVMHCFSGSAETA
FT                   RELVAMGLYVGFTGVVTFKNARRALEAVRAVPMDRLLVETDCPYMAPVPYRGKRCDSSM
FT                   IPMTAGRMAEEKGCTLEEMLRQTGENAKRLFSVK"
FT   CDS             871321..871770
FT                   /transl_table=11
FT                   /locus_tag="RUM_07990"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /function="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_07990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16988"
FT                   /db_xref="GOA:D4LBJ3"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBJ3"
FT                   /protein_id="CBL16988.1"
FT                   /translation="MIAIGCDHAGYPLKQELLAHLYAKGIAYEDLGCDGTPCDYPRIAQ
FT                   AVCEKIISGSCECGILICGTGIGMSIAANKIPGIRASVCADGFSTRYTRLHNDANVLCL
FT                   GARVIGSGLALELADIFLETGFEGGRHQRRLDMITQLEAAHTKGE"
FT   CDS             871774..872400
FT                   /transl_table=11
FT                   /locus_tag="RUM_08000"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /function="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16989"
FT                   /db_xref="GOA:D4LBJ4"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBJ4"
FT                   /protein_id="CBL16989.1"
FT                   /translation="MAVQRIDHPLVQHKITLMRDKMTGPKEFRELVAETAMLMCYEATR
FT                   DLPTKEIEIATPMGVAKSKIISGRKLAFVPILRAGLGMMDGLMTLVPAAKVGHIGLFRD
FT                   TKSHEPVEYYVKLPEDIAERDVIVVDPMLATGHSAVQAIRILKQAGVANVKFMCIIASP
FT                   EGIAAMQAAYPEVDIYCGAEDQGLNADAYIVPGMGDAGDRIFGTK"
FT   CDS             872620..874224
FT                   /transl_table=11
FT                   /locus_tag="RUM_08010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16990"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBJ5"
FT                   /protein_id="CBL16990.1"
FT                   /translation="MHDYFQRDNIEYLKNSYGKEQWIQVAGECSLHNAKASFWCCLFLV
FT                   DHLKEVMSSPEWDSSNTDCFPGFICSGDSTHYYRYSSLCDYIEPLLFYREFYGVRKNYV
FT                   EVSEEFRLLNNMYYDTNDNKFYAVLDSGNSDEAVRIKDNVNVFVNIKYLKRYAAAKQMG
FT                   ILLFFDIRYETSGGLAENTLSSLNEEYTDESLIYDLFGDEKKSFSRYAFSRLLGKKVIL
FT                   PQPVSECGYFPYEKKREYLEYIIGCDENGDDLTYTSNPDKLANYFGANPDAPHYLTPVF
FT                   FKRGVLDKYLKRPDLYKITDGRLSCGYLWSMEIDNDHKAYVAAYLGDLGRDLPEDEQLH
FT                   WKSYNVLCDEKPSKTAIMRDMCNIPAEPNVIDLKFKRDYKALQEKWNGKYRWCIFKELT
FT                   SKDKYNLDNIRIPSSNSQEEFDTLVLSLVKCVIDSLNEEMLVIATPEDNDGKTIRGISK
FT                   LQTWLSENGATDYEKHITFLRNLQELRSTGTGHRKGKKYDKVSKLFNIDQKSLIDVYEQ
FT                   ILSQADEFIMFLTGFIG"
FT   CDS             complement(874301..877360)
FT                   /transl_table=11
FT                   /locus_tag="RUM_08020"
FT                   /product="DNA or RNA helicases of superfamily II"
FT                   /EC_number="3.1.21.4"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16991"
FT                   /db_xref="GOA:D4LBJ6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBJ6"
FT                   /protein_id="CBL16991.1"
FT                   /translation="MNGEKKQPEWFRISGDESFTLYSKFRRTKGVLDTVGTIAYELRAE
FT                   QEQAVLQTFDYFMSHEKSEFLWNAKPRFGKTLATYDLCKHLQATKGDYACNILIVTNRP
FT                   AIANSWYEDFVKFIGTESGFRFVSEVSALKGKPFVTSREEYTDSLTKELADCIEFVSLQ
FT                   DLKGSLYFGGQHDKLKELVNMQWELLVIDEAHEGVDTSKTDVAFHQIKRNHTLHLSGTP
FT                   FKALANDKFPSDAIYNWTYADEQKAKSGWNDPERNNPYENLPQLNLFTYQMSEIIREEL
FT                   KQGVEIEGETEEYAFDLNLFFSVKANGDFVYEESVDRFLEALTSQEKFPFSTPELRAEL
FT                   KHTFWLLNRVDSAKALAKKLKEHPVFGEYEIVLAAGDGKLSEEEETKKAYDKVRDAIDR
FT                   NDKTITLSVGQLTTGITIPEWTAVLMLSNIKSPALYMQAAFRSQNPWRYQENGTLHVKK
FT                   NAYVFDFDPARTLIIFEEFANDLSSGTSGGKGDSDQRKQNVRELINFFPVIGEDENGEM
FT                   IELDAEKVLSIPRKIRSLEVVRRGFMSNFLFQNIANIFNAPPEVIDIIRSLPNAPEGDL
FT                   VDVSPETREDLSVNDEGEVELSDEFVIGTAQDVFGDKIYSDISETLERKTEEILAAPES
FT                   SENQQISHLQDVFRKELVAPVMQVTNDTYGADLKKRDAQKLQKQLEQKADRLVTQEYGD
FT                   YSIQKKTLEAQRQDALSHLSETGQTAAEVNEQFDTLVQEATDAFKERVSNVLEETVPTL
FT                   CEEVVKTVETKKRERTKETIEEAVRDHLRGFARTIPSFLMAYGDEETTLSTFDMIIPDE
FT                   VFYKVTSITLDQFRFLRDGGSYTDAETGEEKHYPGKLFDPVVFDDSIKEFLSLRTRLGN
FT                   YFDESHTEDIFDYIPPQKTNQIFTPKRIVKQMVDMLEQENPGCFEDPNKTFADLYMKSG
FT                   LYIAEIVKRLFNSNGMKQAFPDETQRLQHIFENQVYGLAPTEIIYQIALYFILGFEGGE
FT                   LIEKHHLRQCDALPLAKDGTLETKLDSIFG"
FT   CDS             complement(877637..878452)
FT                   /transl_table=11
FT                   /locus_tag="RUM_08040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16992"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBJ7"
FT                   /protein_id="CBL16992.1"
FT                   /translation="MLSDSHFKILMYEGDASTIFPNTDIKGGVVISYRNTMDEFGAIQT
FT                   FTIYPQLNTILKRILQFVENNSLAELAFVATKFNSENLFRDFSHYEGHERRMSSNVLSF
FT                   DCFHSEKQNRGDIQIYGIYEKKRSFRYISYEYVDLSDTNIQKYKIIMPKADGNGAFGSI
FT                   ITMPEILPPASGFTHTFLGLGGFETKDEAKAALKYIKTKFARALLGVLKVTQDLNADKW
FT                   KYVPLQDFTPTSDIDWSKPIAEIDRQLYKKYGLTPDEIKFIETHVKEMK"
FT   gap             879661..880183
FT                   /estimated_length=523
FT   CDS             complement(881065..881343)
FT                   /transl_table=11
FT                   /locus_tag="RUM_08070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16993"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBJ8"
FT                   /protein_id="CBL16993.1"
FT                   /translation="MENEGICIIMRKDGRYMGKFVTGYGDDRKAQYQYVYGKTYEEAEN
FT                   KVLIGREIATRFLSCRYITVGKVYREWLNAVVNRVKESTLANYINKF"
FT   gap             881521..881653
FT                   /estimated_length=133
FT   CDS             complement(881800..882936)
FT                   /transl_table=11
FT                   /locus_tag="RUM_08080"
FT                   /product="Superfamily I DNA and RNA helicases"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16994"
FT                   /db_xref="GOA:D4LBJ9"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBJ9"
FT                   /protein_id="CBL16994.1"
FT                   /translation="MPSMNLIKIECAGSGKTWSICQTALSIVSSDIKKRVAVISYTNQG
FT                   VQAVQTEIKKQNNGIMHSRITVESLYSFLLRELIKPYQTYIFGINEVKSLDFSRMYGFI
FT                   NKHRIGQKARYMTVGHNITANEAAELVVQLNNRSNGQVIKRIERIYDTIFFDEVQDLSG
FT                   YDLEIIRRIAASSINLVCVGDPKQATFKTNSGQKNKNISGAKMELFFKNLEKSHSAQLT
FT                   YNNISRRFNVDICRFANDVYPSSNEMSTFMTSITPHDGVFLILKSDIPDYYDQYSPQVL
FT                   RYDKKTDTLGLSSMNFGECKGLTFDRILIFPNKPFLEYIQKGKALGSPEKYYIAATRSR
FT                   YSIAIVVDKFPSKSKFQLEDTIIPVGTGNIIGKKILFS"
FT   CDS             complement(882914..884533)
FT                   /transl_table=11
FT                   /locus_tag="RUM_08090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16995"
FT                   /db_xref="GOA:D4LBK0"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBK0"
FT                   /protein_id="CBL16995.1"
FT                   /translation="MYISKLIVKNYKLLKEVNIDLNEKINIFVGENDSGKSTILEVLSI
FT                   ITSGKLNGYAFERQIKANMFNDEARKEYINSLATGLPISPPEIIIEAFLQDADPQYSGT
FT                   NNSLLKDACGIRVRVHFNEEYSELYSSLLSSKEIYDIPVEFYSVELRYFNGSPVLQRFS
FT                   PIKAAFIDTTRKNYAYVVDKFVADNITNFLTPQNQTDLTTAYRKSRHDFSNSEIVKKLN
FT                   EDVRKNTDLDGRELTIDLKEEDVDSWKSQMSVVVDSCPFENVGFGTQNTIKMGMVLKNA
FT                   DEQVNVIIMEEPENNLSYTNMARLVSKVEKSEGKQVFISTHSSYVANKLDLQNLFLIRK
FT                   GIPTRFNGLPEDTMSYFKKLPGYDTLRVVLAEKIILVEGPTEELIIQRAYLDKHGVLPI
FT                   ENGIDVIVVDSLAFKRYCDITVLLNKKTVIATDNDGNIQENITNKYSEYTTKSNLIFVY
FT                   ESNEELHTIEPSVAAVNFDTDSHAQTFRTVLSKRNSMMTKSKEEIIEFMTNNKAEWALR
FT                   VFDSELKIIYPEYIQNAINELD"
FT   CDS             complement(884668..884880)
FT                   /transl_table=11
FT                   /locus_tag="RUM_08100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16996"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBK1"
FT                   /protein_id="CBL16996.1"
FT                   /translation="MLKTPELTMPRSRKVTTVCNGRREVWTDYEDAKAYFLELMMSTDG
FT                   EEHERAECVYIQLLHGLDECSDGDE"
FT   CDS             complement(885065..885409)
FT                   /transl_table=11
FT                   /locus_tag="RUM_08110"
FT                   /product="Bacterial mobilisation protein (MobC)."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16997"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBK2"
FT                   /protein_id="CBL16997.1"
FT                   /translation="MKDENKRDLYLKVRVSQAEMDAIKRKFANSGMNTLSGFVRAMIFE
FT                   GYIVHIDENELKRLNVLANNIANNINQIAHRVNVTNKVYKEDIEDIKSLADKLIQPLLF
FT                   LQSKCLQLRH"
FT   CDS             886457..886675
FT                   /transl_table=11
FT                   /locus_tag="RUM_08140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16998"
FT                   /db_xref="InterPro:IPR026990"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBK3"
FT                   /protein_id="CBL16998.1"
FT                   /translation="MNNNTIAVEREKTETTFNATSEYKIGHTLYTVTTVFNPASKESLS
FT                   DILKRLIIRESEKLLGESGQEPEKQAV"
FT   CDS             886765..888396
FT                   /transl_table=11
FT                   /locus_tag="RUM_08150"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL16999"
FT                   /db_xref="GOA:D4LBK4"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025378"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBK4"
FT                   /protein_id="CBL16999.1"
FT                   /translation="MKDKITALYCRLSQDDMLQGESNSITNQKAILKKYADDNSFGNTV
FT                   YYVDDGVSGTTFEREGFKAMMADVEAGKVGTVITKDLSRLGRDYLKTGEYIEIIFPDYD
FT                   VRYIAINDGVDTFKSENELMAFKNIFNDWYARDTSKKIRAVFKVKGQSGKHLSNPIYGY
FT                   KHSETDKNLWVIDDEPAEVVRKIFRLCIDGYGPSQIARILTQEGIPTPTAYALSQGRDN
FT                   GHKNAKLHRWGSETIAHILEKAEYCGHTVNFRTHVKSYKNKKRVDNPKEDWLIFENTHE
FT                   AIITQQEFDLVQELRRHKHRPTKIEEVNPFSGVCFCADCGRKMYLCRAKSLTADQEHLK
FT                   CGTYANDKDECTAHFIRTIVLKEIVLGELNKMISFVKENEDEFVRSAMDNSVQKQSSEL
FT                   AKSKKKLKEVEKRIAELDRLFTRLYEDNVSGKISDARFAVMSAGYEDEQKTLRATVAEL
FT                   TAYIDTAEQKSADVTAFIRAVQKYEHITELTPEVMHELIEKIVIRAPDKSSGHRTQQIE
FT                   IHYRFDVAITTAVADSMKYDKKRKAA"
FT   CDS             complement(888496..889098)
FT                   /transl_table=11
FT                   /locus_tag="RUM_08160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17000"
FT                   /db_xref="GOA:D4LBK5"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023821"
FT                   /db_xref="InterPro:IPR023822"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBK5"
FT                   /protein_id="CBL17000.1"
FT                   /translation="MAMTIFYPVGQNLYVNLTNQCPCNCTFCIRQNGDGAYGSDSLWLE
FT                   HTPTFEEVQAACPKDLGKYHEIVFCGYGEPSEALDVLCQTAAYLKQQPGCPPLRINTNG
FT                   LSDLIHGAPTAHRFQGLIDTVSISLNAGDEQEYNQVTRPKFPEAFQALQRFAVDCKQYV
FT                   PHVMFTVVDVIPKEQIRLSQELADRLGVPLRVRTYDS"
FT   CDS             complement(889117..889644)
FT                   /transl_table=11
FT                   /locus_tag="RUM_08170"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17001"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBK6"
FT                   /protein_id="CBL17001.1"
FT                   /translation="MLLEMMSLSETLVEWLTTHMNGLPRELIIFVISLLPILELRGGLL
FT                   AASILGVPIVPALCICIIGNILPIPFILLFIEKILKWMKTTKHLHGIADWLEKRATGPK
FT                   AEQIRKVEFMGTLLFVGIPLPGTGAWTGALIVSLLHVDRKKASLAIFLGVLLAAAIMCV
FT                   ITYLIPWIVRQF"
FT   CDS             890018..890368
FT                   /transl_table=11
FT                   /locus_tag="RUM_08180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17002"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBK7"
FT                   /protein_id="CBL17002.1"
FT                   /translation="MHKYLSDYMKQMNRLLEENRSFTETDLQRHLDKIGFMQHERLIHF
FT                   LVTMLFAIVLFLVLGAFLMTEAMFLLPLLGLILVLLVPYIFHYYFLENTVQKMYVIYDR
FT                   MAERMGASAHQS"
FT   CDS             890365..891273
FT                   /transl_table=11
FT                   /locus_tag="RUM_08190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17003"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBK8"
FT                   /protein_id="CBL17003.1"
FT                   /translation="MKRWSQYRAVLLPTVLLTLLMLGFAWYATGVVDRDRAMEQAENRL
FT                   VQMSQKIDALQSEQSLILDEAQADYQTRARIISMMINTTPTLLETETDLEELRLVAGAE
FT                   VISVSDLQGVIRFSTDQSRVGDRVEDAFLPAITNKVFSEWYFPDESTRDILLVGTARLD
FT                   QDGVIQITFKPDDISQLMQSADLSELVSGTQFMENGTLSVLDESCRYMSHTYSALVGAQ
FT                   SPYAPADFSGNAGHFSASPYQSSALVCYRKYRSYTLVCTLPYREVYARRNSAALWMLAL
FT                   GALLDLTAGFCVTSRLHRDQQ"
FT   CDS             complement(891413..891625)
FT                   /transl_table=11
FT                   /locus_tag="RUM_08200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17004"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBK9"
FT                   /protein_id="CBL17004.1"
FT                   /translation="MTGFELFTTVLGIIGTVCAIVFGYIKSGVDDIKRKQEKEDERHVQ
FT                   VVSRLTAVEASAQQAHHRPDKLEEK"
FT   CDS             complement(891686..891781)
FT                   /transl_table=11
FT                   /locus_tag="RUM_08210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17005"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBL0"
FT                   /protein_id="CBL17005.1"
FT                   /translation="MLDAAGYDCGKIDDIAGVKTIGCHPGLPAGA"
FT   gap             892331..892649
FT                   /estimated_length=319
FT   CDS             892696..895002
FT                   /transl_table=11
FT                   /locus_tag="RUM_08220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17006"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBL1"
FT                   /protein_id="CBL17006.1"
FT                   /translation="MTQRFRKVLSIAASAAMLCSMLLYLPEDHRLGSWLASAEEVSAEP
FT                   EGEGTAESPYQISNADQLYWFAEHADTSAHAKLTDDIVVNENLVNSVGNLNSGSYRSWT
FT                   PIGNLEATLGYTCAFSGTFDGDGHTISGLYDDVGRSYVGFVGELSGSGTVKNLGIVDSW
FT                   FRGYERNGGICGENAGTITHCYFSGTIKTEVGSAGGICGENSGTITNSYNMGLVNGIAA
FT                   SGGMGGVCGENTGTITNSYTTGTVNATEYRTCGGVCGENTGTITNSYNTGSVVAGTYCT
FT                   GDSCGGVCGRNEGTIRNVFNSGTLSHDSDRVYLGGLCGTNTSGATLEYGYNIGKLNAEG
FT                   AALLFSGGVCVTPHGSISHCWYNSDVFGGNAFAAGEADRETVEGRNTAAFVSGEVAYLL
FT                   GEAWGQDLENGQENPALGGVKVYENKIYSRCDAGDTPTLVYSNTKEADVIPAHTYAYGR
FT                   CKVCGAYKNQVGVHLAGHSLTLDGDIGVHFYMELDSRLLANEHAYMRFTLPNGQTQQIP
FT                   VLDAKTDQVDEGTYYVFTCRVAAKEMTSEITAQICTDTLQGPVYSFTVQDYAKYICNNS
FT                   AEYSTEAAALAEAMLQYGAYAKAYFEGTALAPTAAMEVVTADTLSELMPGSSGTLPEGI
FT                   TYYGTTLLLESNTVLRHYFRVEPGFDVSQYAFTGSKGNYYYIDTAGISVNRFRIPVSVS
FT                   VTEQTGFQQSSGSKWSLSYSPLYYLRSVLGAENTDPELKHLVQAMYLFHRAALDYEMSL
FT                   GEITPEPPVAEAELS"
FT   CDS             895159..895674
FT                   /transl_table=11
FT                   /locus_tag="RUM_08230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17007"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBL2"
FT                   /protein_id="CBL17007.1"
FT                   /translation="MNDPIPTHLKTIFRVNEHETNATNLSGSIVCDCGCEYFTILHNEN
FT                   RQYDPSMSYSEQDGLKVVAICNNCRKKHLIFDEATQGYNGLVCGDLKTALDSDLTDYIC
FT                   HKCGSTIFSISLNIEIEDKEQFIEECVNEYPDKFSPDDYVDAFDWIAINVCCKKCSKEV
FT                   EWISLELS"
FT   CDS             895779..897203
FT                   /transl_table=11
FT                   /locus_tag="RUM_08240"
FT                   /product="Endoglucanase Y"
FT                   /EC_number="3.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17008"
FT                   /db_xref="GOA:D4LBL3"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR019834"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBL3"
FT                   /protein_id="CBL17008.1"
FT                   /translation="MKLRRKTAVVMAAGAVMMANAAPVLTAAEVKEMQTGALSEETVQF
FT                   YSYWKEKYLAQDPYVTGDPQYYVFYGEKTYAEAGAEVAVTVSEAHGYGMLIAASMAEHD
FT                   GQAKDIFDGMYRYYKAHPSGIGPNLMAWQQTDNGSAIQNSAGADSATDGDLDIAYALLM
FT                   ADTVWGSDGAINYKQAALAVMNDIMTYEVNQTDWVLQLGDWAHNTREGDTYYAATRSSD
FT                   FIVQYMPVFAEASGDTRWTTLYESTYRIINQMVDTYGTGILPDFIVKDSNGKFVPASAN
FT                   LLESEHDGNFYYNACRTPWRISMDYLVNGNADALKFANALNGFITRKTGGDPAQIMAGY
FT                   TPAGEAVSDWNDLCFDAPFLVAAACGGYDTWHDSLRSMILDYGEDVYFGDTITMLCLIV
FT                   DDNAWIVPAGADQPVRGDVNQDGACTVADVIALQKWLLHTPDASLADWKAGDLCPDGKL
FT                   NAMDLCLLKRELLNLA"
FT   CDS             complement(897281..897826)
FT                   /transl_table=11
FT                   /locus_tag="RUM_08250"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17009"
FT                   /db_xref="GOA:D4LBL4"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBL4"
FT                   /protein_id="CBL17009.1"
FT                   /translation="MQATSTKKRTALWLCVTALFMALNVVMSSFGVPVPGGHLYMNDII
FT                   ICTAAMLLDPLAAFMVGGVGAFLGDLFFYPTPMFVSLATHGLQAIVISVCSHYILKKHP
FT                   VLASGIGVTIGAVIMVVGYSLGRAFIYSTPEYALLKLPYQILQAVVGAVVGMILYWKCG
FT                   IRKLWSSKLMPQKTCPER"
FT   CDS             897919..899010
FT                   /transl_table=11
FT                   /locus_tag="RUM_08260"
FT                   /product="Transcriptional regulators containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17010"
FT                   /db_xref="GOA:D4LBL5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBL5"
FT                   /protein_id="CBL17010.1"
FT                   /translation="MKYVIQKENRPVYLQLYKLIRNDIINQVYPYNSRLPSKRMLAEEL
FT                   GISTITIEHAYGLLCDEGYAEARERSGYFVIFQPSDGFAGSTAEPVPVFHKKLDTSSYP
FT                   TFSISILSKTMRKVLTDYGETILEKSPNAGGIQLRSAIRQYLARNRGIQVEIGQIVIGS
FT                   GAEYLYRLIVELLGRSRVYGIESPSYDKIEQIYRAADVDYELLPLSADGIDSGALAATR
FT                   ADVLHTTPYRSFPTGVTATASKRYEYIRWSGYGERFIVESDYGSEFSVSSQPMETLFVL
FT                   SDFDNVIYLNTFSRTISPSMRIGYMVLPKQLVNQFQDRLGFYSCTVPTFDQLVLTELIN
FT                   NGDFERHINRVRRAKRRELEHET"
FT   CDS             complement(899061..899603)
FT                   /transl_table=11
FT                   /locus_tag="RUM_08270"
FT                   /product="O-6-methylguanine DNA methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17011"
FT                   /db_xref="GOA:D4LBL6"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBL6"
FT                   /protein_id="CBL17011.1"
FT                   /translation="MTFIQPYDSPLGDILLAADETGLTGLWFEGEKYFANNLPQKHIRQ
FT                   ETPILSETKRWLDIYFTGKEPDFMPPLHPIGSSFRQAVWSILLQIPYGQTVTYGEIAQQ
FT                   LARQQGIARMSAQAVGGAVGHNEISILIPCHRVVGTNGSLTGYAGGIHKKIRLLELEHT
FT                   DTSRFFVPKRERRCDGI"
FT   CDS             complement(899644..900288)
FT                   /transl_table=11
FT                   /locus_tag="RUM_08280"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /function="DNA-3-methyladenine glycosylase II"
FT                   /EC_number="3.2.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17012"
FT                   /db_xref="GOA:D4LBL7"
FT                   /db_xref="InterPro:IPR000035"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBL7"
FT                   /protein_id="CBL17012.1"
FT                   /translation="MYFAYGEREISYLRQKDRRLCEVIDRIGHIDREVDTDLFSSVIHH
FT                   IIGQQISTKAQATIWLRMQEALGKVNAETILSAGAPKLQSLGMTFRKAEYITDFAQKVC
FT                   SGACNLEAVWHMTDADAIRALCTLKGIGVWTAEMILLFCMQRPDIFSFDDLAIQRGLRM
FT                   VYHHRNIDRKLFEKYRRRFTPYCSVASLYLWAAAGGAIPELRDYKPKNKGA"
FT   CDS             complement(900332..901210)
FT                   /transl_table=11
FT                   /locus_tag="RUM_08290"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17013"
FT                   /db_xref="GOA:D4LBL8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBL8"
FT                   /protein_id="CBL17013.1"
FT                   /translation="MENPLLKYLAFVKTVEKGSFTRAAHELDYVQSSISKMVADLEKEW
FT                   GMTLLERGKNSVCLTSAGKQVMPFLRNLLNDYCELEGQICRMNGIETGVVRIGTFSSVS
FT                   INWLPNIFARLQKDFPGIEYEILLGDYDEVERWIQEGRVDCGFLRLPTHSKFNTVLLKQ
FT                   DEYKVVLPAGHTLAEKETIRAEDLNGLPFLLLEHSGKTEVSDLLESYHIQPDIRFTTWE
FT                   DFAIMAMVEKGLGISVLPDMILQRIPYKIEVRSMQEPYYRCIGLAMKDRKHITPAVQKF
FT                   LEYLRFRECTQ"
FT   CDS             904039..904968
FT                   /transl_table=11
FT                   /locus_tag="RUM_08320"
FT                   /product="cysteine synthase A"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17014"
FT                   /db_xref="GOA:D4LBL9"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBL9"
FT                   /protein_id="CBL17014.1"
FT                   /translation="MKVYEQITDLIGSTPLVKLKNYSANRKLEATVLAKVEFFNPAGSV
FT                   KDRIAKAMLDDAEAKGLLKPDSVIIEPTSGNTGIGLASVAASRGYKTILTMPETMSVER
FT                   RNLLKAYGAQLVLTDGAKGMKGAIEKAQELAAQTPNSFIPSQFTNPANPAAHLATTGPE
FT                   IWNDTDGKVDIFVAGVGTGGTLSGVGAYLKSQNPDVKVVAVEPAGSPVLSKGTAGPHKI
FT                   QGIGAGFVPETLNTKIYDEIIPVENEDAFATGRAIAHEDGILVGISSGAAVFAATQLAQ
FT                   RPENKGKVIVALLPDTGERYLSTPMFAD"
FT   CDS             905176..906042
FT                   /transl_table=11
FT                   /locus_tag="RUM_08330"
FT                   /product="conserved hypothetical protein TIGR00255"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17015"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBM0"
FT                   /protein_id="CBL17015.1"
FT                   /translation="MTGYGRAQQILDGKEILVEIRAVNHRYFEFSSRVPRAYMYLDEKL
FT                   KSLLQGRVARGKTEVCVTINRIDGSDAKIQVNMGTAQGYLQALRDANETLHLQDDLKLT
FT                   DLIRFPEIFIVQKAVENEEAVWEEIRQVASAALDRFVTMREAEGARLKADIKSKLDAIS
FT                   GMVAVVEEASPRMTEQYRNRLYAKLEELLGSNGFDQQRILTEAAVFSEKVAVDEETVRL
FT                   RSHIQQFHALLEDEEPVGRKLDFLIQEMNREVNTIGSKAQELTITQTVVNLKSEIEKIR
FT                   EQIQNIE"
FT   CDS             906058..906321
FT                   /transl_table=11
FT                   /locus_tag="RUM_08340"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17016"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBM1"
FT                   /protein_id="CBL17016.1"
FT                   /translation="MQLINIGFGNMVSSARLIAIVSPESAPIKRIVQDAREQGRLIDAT
FT                   YGRRTRAVIVMDSDHVILSAVQPETVAARLNDNEEEQAQDEE"
FT   CDS             906311..906916
FT                   /transl_table=11
FT                   /locus_tag="RUM_08350"
FT                   /product="guanylate kinase"
FT                   /function="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17017"
FT                   /db_xref="GOA:D4LBM2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBM2"
FT                   /protein_id="CBL17017.1"
FT                   /translation="MKNKGLLLVVSAPSGCGKGTILGEILKDDSFYYSISATTRAPREG
FT                   EQDGVNYHFITKEEFEQRIAQGGMLEYAQYCGNYYGTPKKEVEQMRDAGRDVILEIEVE
FT                   GAMKVRALCPDAVFLFIAPPSVEELRRRLNKRGTEAAEVIEERVSQAARELSYADRYDY
FT                   IIVNGELEKAIQDFRTVVRAEKLRTKNGNKIDEVLNHA"
FT   CDS             906909..907115
FT                   /transl_table=11
FT                   /locus_tag="RUM_08360"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17018"
FT                   /db_xref="GOA:D4LBM3"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBM3"
FT                   /protein_id="CBL17018.1"
FT                   /translation="MLRPAISQIITKNESAYSLVIGVAKRARAIADELYEQGMTLEEKP
FT                   VKTAVEEIASGKYKIVEPESLEE"
FT   CDS             909596..910057
FT                   /transl_table=11
FT                   /locus_tag="RUM_08380"
FT                   /product="peptide deformylase"
FT                   /function="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17019"
FT                   /db_xref="GOA:D4LBM4"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBM4"
FT                   /protein_id="CBL17019.1"
FT                   /translation="MAIRNIVTSEDPILSKPCRTVEEFDDKLGQLIDDMFETLEKAKGL
FT                   GLAAPQVGILKRVFVMDVGDGRVEAVNPVILKESGKQRDVEGCLSCPNQWGYVTRPNKC
FT                   RLRAYDRHGKEFTMDLKELGCRCACHETDHLDGLLFTRLVDEFVQMEDA"
FT   CDS             910084..911037
FT                   /transl_table=11
FT                   /locus_tag="RUM_08390"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /function="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17020"
FT                   /db_xref="GOA:D4LBM5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR015518"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBM5"
FT                   /protein_id="CBL17020.1"
FT                   /translation="MRDKLNIVFMGTPDFSVPCLHALAKSGHRVQAVFTQPDKPKGRGY
FT                   KLIPTPVKAAAQAYGIPVYQPLSLRKGEDAARALETLQALQPDLIVVVAYGQILPVEVL
FT                   ELPAFGCVNIHASLLPKYRGAAPIQWCILNGETETGVTSMQMAQGLDTGDMLLAESLSI
FT                   GEEETSGQLHDRLSELGAKVLLETVAGICQGTLTPVPQDDALSCYASMIRKDMSRIDFT
FT                   KSAREIHNLIRGITGFAFLGGKRHKLLRSALSERTVDPALAGTIVDAKDLTIACGDGHC
FT                   IRILELQAEGGKRLKTEDFLRGNSIENGMKFETEVL"
FT   CDS             911039..911719
FT                   /transl_table=11
FT                   /locus_tag="RUM_08400"
FT                   /product="Predicted Zn-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17021"
FT                   /db_xref="InterPro:IPR007395"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBM6"
FT                   /protein_id="CBL17021.1"
FT                   /translation="MPFMYYGYGFVLIGFLIALLAQWNVKSTYSKYKKIHNSRGITGAM
FT                   AARQILDQNGLYHVRIESVSGELTDHFDPRTNVVRLSDGVYNNTSVAAVGVAAHEVGHA
FT                   IQYAQEYAPMRLRAAIIPATQIGSTLSYPLVVLGVIFQALPLIDLGILLFSLVVLFQLV
FT                   TLPVEFNASRRALNTLGSSHILDSNEVSQSGKVLTAAALTYVAALATALLNLLRLIAIR
FT                   GNRD"
FT   CDS             911719..913023
FT                   /transl_table=11
FT                   /locus_tag="RUM_08410"
FT                   /product="ribosomal RNA small subunit methyltransferase
FT                   RsmB"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17022"
FT                   /db_xref="GOA:D4LBM7"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBM7"
FT                   /protein_id="CBL17022.1"
FT                   /translation="MGAELVFCVRLLDKTFGAQGYSNIALDRALRDSDLNPQQKSRVSA
FT                   LYYGVIERLPELDYVLSRYSKKPPEKLDPTVRNLLRCGVYQLAHMRIPDNAAVNECVNA
FT                   CKKLRYTSASGFVNAVLRGFVRDGKQIPVPKDPALRRQVQYCAPDWLIKQLSSEYGESV
FT                   MDALLTDALGRPPVTLRRNPLAGDASAFLRAMGEISVEKHPLLPDCYRVQGGDVTRTDA
FT                   FAQGMFHVQDLASQLCCLALDPQLGDTVLDLCAAPGGKSFTLAELMEDRGQLYAFDLHT
FT                   NRVKLIAQGAQRLHLQCVHARTGDASLHNPELPQADRVLCDVPCSGLGVIRRKPEIKYK
FT                   DPAAFTGLPPVQAKILENAAHYVKPGGYLVYSTCTLSRAENDGVVDGFLQQHPEFEGVS
FT                   FLETLGEPFGNWKVTLHPGCLGSDGFFMAKLKRAR"
FT   CDS             914100..914798
FT                   /transl_table=11
FT                   /locus_tag="RUM_08430"
FT                   /product="Serine/threonine protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17023"
FT                   /db_xref="GOA:D4LBM8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBM8"
FT                   /protein_id="CBL17023.1"
FT                   /translation="MVRDENQDRVETLQLEDGVLAVVCDGMGGERSGGEASRLAIGEAV
FT                   SHFKEGYHAGMNGSEIKQLLCASISAANSVVYTKSKLDYKNFGMGTTCVMAYVDDTMLH
FT                   VANVGDSRAYLLQGLAPLEQLTVDHTVVQMLLAQGKITREEMKSHPQRNMLTRAIGVER
FT                   TVKPDYFEQTHDSRFLVLLCSDGLSSYCSKDEITQALREQSFETVCGHLVDMANQKGGR
FT                   DNITLAIISD"
FT   CDS             914814..917024
FT                   /transl_table=11
FT                   /locus_tag="RUM_08440"
FT                   /product="Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17024"
FT                   /db_xref="GOA:D4LBM9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBM9"
FT                   /protein_id="CBL17024.1"
FT                   /translation="MDKNIGKKLDGRYEITELIGVGGMADVYKATDVVDHKTVAVKILK
FT                   KEFAENEEFLRRFRNESKAIAVLSHPNIVKIYDVGFSDKIQYIVMEYIDGITLKEYMEN
FT                   EKVLSWKDSVHFVLQILRALQHAHSRGIVHRDIKPQNIMMFPDGTIKVMDFGIAKFARE
FT                   QGKTATDQAIGTVHYISPEQARGDVTDAKSDVYSVGVMLYEMLTGKKPFDTDNPVTIAV
FT                   MHMQAKAERPRNINPDIPIGLEEIILHAMVKDPAHRYQTAQEMIRDIEQFKENPDIVFG
FT                   YHDDDDEEDAQTSDSPTRFFQAVTPATAEIPAMREGRDDQEDYEESDEDEYDDEDEEEE
FT                   ERRSLFVPILTGVTIAVIVAAVILVTYLIVGWLNGDNQGDKKEFAMPNLVGTNYQEAVD
FT                   AWKGKLDLKVTASEYSEYDKDVIFYQSIPENDPIALNSVVEIKVSLGNNTIDVPDVIGW
FT                   TETLATKTLSNQGLTVEVKKAASDTVEKGLVCETVPAAGEAIAPNSKILVYISMGPNAS
FT                   TVEVPNFTSKTLEEAKLDAEVMKLELQVTEVDSSEPKGQIIFQSINAGEQVVTGTVIEV
FT                   KVSNGVAPVNTCNVTFALPENVHGSFYFTFYDGGSVFFTSPVINAEYTSGSASVPLEGS
FT                   GKKELIVSVTNSSNKETARVGTYLVDFDKKTASAKSDVNVHAAFKSIGAIAAQTEPPVV
FT                   TTHPPVQHTTKPAPTHTTAEPPQPTEPAQETEPVGDPNADQD"
FT   CDS             917008..917916
FT                   /transl_table=11
FT                   /locus_tag="RUM_08450"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17025"
FT                   /db_xref="GOA:D4LBN0"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBN0"
FT                   /protein_id="CBL17025.1"
FT                   /translation="MQTRIDPMQTGSVLTGTIIKAIGGLYTVESPSGVFDFRARGIFRN
FT                   RGQSPMVGDRVQVKNGVIDQLLPRKNNLIRPPLANLDQLLFVVSMYKPAPNLLLLDKFI
FT                   AIAEYKQITPILVVTKADLEDPAPLVEIYQKAGIPVYVVEYAIPRTVDAVAACLRGKVS
FT                   AFTGNSGAGKSTLLNAIDASLQLETGSISEKLGRGRHTTRHAQLYPVQGGGYVADTPGF
FT                   STFETNQYDIIRKEELAGCFREFAPYLGQCRFQDCCHTAERNCALRQAVEDGEIPRSRY
FT                   ESYCRMFEEAKGLKEWELKKN"
FT   CDS             917895..918557
FT                   /transl_table=11
FT                   /locus_tag="RUM_08460"
FT                   /product="thiamine pyrophosphokinase"
FT                   /EC_number="2.7.6.2"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17026"
FT                   /db_xref="GOA:D4LBN1"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBN1"
FT                   /protein_id="CBL17026.1"
FT                   /translation="MGIEKELTCYIFAGAPMEFLPLVSPEPGDLILCADGGYRYAKVLG
FT                   LKPDYLVGDFDTLPEREIPQDCQIRRHPIQKDDTDTMLAVKLGLSLGFRRFVLYGAIGG
FT                   RLDHTIANVQTLLFLYARGAEGVLIGERNEAMLHPPGRRVYPARPDSYFSVFALTTACK
FT                   GVCLEGVEYPLQDAELTADFPLGVSNHITGEQAAVTLAEGMILLVFSRDRHQSGGRA"
FT   CDS             918606..918698
FT                   /transl_table=11
FT                   /locus_tag="RUM_08470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17027"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBN2"
FT                   /protein_id="CBL17027.1"
FT                   /translation="MKIVVVKSPRFLSGILCAIFHIKREPVEEV"
FT   CDS             918783..919097
FT                   /transl_table=11
FT                   /locus_tag="RUM_08480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17028"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBN3"
FT                   /protein_id="CBL17028.1"
FT                   /translation="MKETQWERAEDCPEDALEQARQQEDALFAQALEKQQRKAEAPYSD
FT                   IIVTQCMLCVGLCLGVLIWNYFAPEAALHWLAYCREQLHQLWRPELLEPFLRLDLPVYA
FT                   "
FT   CDS             919090..919659
FT                   /transl_table=11
FT                   /locus_tag="RUM_08490"
FT                   /product="Peptidase family M50."
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17029"
FT                   /db_xref="GOA:D4LBN4"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBN4"
FT                   /protein_id="CBL17029.1"
FT                   /translation="MLSFRLRGVRVIICFGFAAVWALFCLIRAELALPLLLASLIHELG
FT                   HAAAMCACGQKLAVLRFWGGGILMIPRRSRMLTWRQEILILLSGPGVNLAVGWVLWLTG
FT                   SSLAWLHMALGLWNLLPYRNLDGGAVLRCLFPGIRAQMLMTWLVCASTFVLAGACLAAG
FT                   VRNVQLYAMLGYLFLWELPLAQTERI"
FT   CDS             919664..921556
FT                   /transl_table=11
FT                   /locus_tag="RUM_08500"
FT                   /product="Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17030"
FT                   /db_xref="GOA:D4LBN5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="InterPro:IPR023970"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBN5"
FT                   /protein_id="CBL17030.1"
FT                   /translation="MDVSNHIEEHSMLKEKIEKYLLSVQKPARYIGGEAGSIYKDKSKV
FT                   DVRFAFCFPDCYDIGMSHLGMKILYSLTNQRENYWCERVFAPWPDFEQIMREHDIPLYG
FT                   LESLEPIRDFDFIGFTLQYELSYTNILNMLDLAGVPVYAKDRGTAIAPLVVAGGPCACN
FT                   PEPLADFFDLFILGEGEEVNLELMDLYHRMRQEGADRQAFLRAAARIEGIYVPSLYEVT
FT                   YHPDGTIQAVTPKDGAPATVKKRIIRDFDKVFYPDNFVVPFTEIVQDRVSVEVLRGCIR
FT                   GCRFCQAGFLYRPFREKSAETVYGESKALCENTGYDEVSLSSLSTSDHSQIDPMLRKLL
FT                   TYTEEEKINLSLPSLRIDNFSEGLMNQIKRVRKSGLTFAPEAGTQRMRDVINKNVTEEE
FT                   VMKTCRIAFEGGYDTVKLYFMMGLPTETDADIVGIAQLAQKVVDLFYENPHRPKGKNVQ
FT                   VSISTATFVPKPFTPFEFEPQATHAQIEHKQQVLRDAIQSKKIRAALHQSDASLLEAAL
FT                   ARGDRRLSEVLYRAWKKGSTFDSWGERFDYSRWQEAFREAELDPAFYANRTRSYDEVFP
FT                   WDHLDYYVSKDFFIRENQRAHQSLTTPNCRLQCAGCGVNQKVGGACFAEDPDGV"
FT   CDS             922410..922754
FT                   /transl_table=11
FT                   /locus_tag="RUM_08520"
FT                   /product="LSU ribosomal protein L19P"
FT                   /function="LSU ribosomal protein L19P"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17031"
FT                   /db_xref="GOA:D4LBN6"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBN6"
FT                   /protein_id="CBL17031.1"
FT                   /translation="MDALKLISNDSIKADAPELHIGDTVKVHVRIKEGDKSRIQVFEGT
FT                   VIAKKHGGISETFTVRRVAHGCGIERVFPLHSPVVEKVELVRSGKVRRAKLYYLRDRVG
FT                   KAAKVKEQIR"
FT   CDS             922894..923598
FT                   /transl_table=11
FT                   /locus_tag="RUM_08530"
FT                   /product="signal peptidase I, bacterial type"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17032"
FT                   /db_xref="GOA:D4LBN7"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBN7"
FT                   /protein_id="CBL17032.1"
FT                   /translation="MENESLDTSKEETKEVQQPAAPEESGKQEDWKSPVKSLVNDLLDI
FT                   AESVIVSVFVVVLVFAFILRPVTVDGSSMNPTLYDKDRVLMVELFYHPQRGDVVIVDGT
FT                   EAHLFSDPEQTQVVEKKGIGINLIKRVIAVAGDQLDIDFTAGTVTLNGVVQKEDYINML
FT                   TTRNDGAFTYPLTVPEGYIFVMGDNRNASTDSRSTLVGLVPEDAVIGHAVYRFARDEKL
FT                   RSTWAEQFSVID"
FT   CDS             923631..924242
FT                   /transl_table=11
FT                   /locus_tag="RUM_08540"
FT                   /product="signal peptidase I, bacterial type"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17033"
FT                   /db_xref="GOA:D4LBN8"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBN8"
FT                   /protein_id="CBL17033.1"
FT                   /translation="MAEQQPEQNREDVERSILGDLLDLIESILCSVFLVFLVFTFLFRI
FT                   ATVEGASMVPTLVNGDRLIISELGYTPQQGDVVIINARKSYQLDSAQQVVESEGLNKLI
FT                   VKRIIALGGQKVDIDFNTGTVTVDDQVLQEAYINTLTTRDEGGMQFPVVVPEGYVFVLG
FT                   DNRDISKDSRHPNVGFVSESEIMGKALLRVFPLDKFGKVG"
FT   CDS             924290..925162
FT                   /transl_table=11
FT                   /locus_tag="RUM_08550"
FT                   /product="Ras superfamily GTP-binding protein YlqF"
FT                   /function="Ras superfamily GTP-binding protein YlqF"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17034"
FT                   /db_xref="GOA:D4LBN9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBN9"
FT                   /protein_id="CBL17034.1"
FT                   /translation="MAEIRSIQWFPGHMTKTRRMITANLSLVDAVVEILDARIPVSSRN
FT                   PEMDRLTGGKPRLLILNKSDMADERTTQQWLHRLRRSGCAAVAMDCKSGKGVKQFHPAL
FT                   RELLKEQIAQWRAKGLVNRPIHVMVVGIPNVGKSSFINKMAGGKRAKVEDRPGVTRTKQ
FT                   WVKLGDGVEMLDTPGVLWPKFDDQQAAQRLAFTGAINDDVLDIEALAMLLLEYLHEAYP
FT                   QALTARYKINLPEGTEGRILLEELGRKRGMLVSGGEVNTERAAITLLDEFRSGKLGRIT
FT                   LEVPENEGA"
FT   CDS             925162..925779
FT                   /transl_table=11
FT                   /locus_tag="RUM_08560"
FT                   /product="RNase HII"
FT                   /function="RNase HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17035"
FT                   /db_xref="GOA:D4LBP0"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBP0"
FT                   /protein_id="CBL17035.1"
FT                   /translation="MAKALAVKTQLFEYDEAVRNSYPVFCGVDEAGRGPLAGDVYAAAV
FT                   VLPPDVVIPGLDDSKKLTEKRREALYDEIIAKASACCIAAATVEEIEQLNILQAAMLAM
FT                   TRAVSGLDIPVQCVLIDGNRLPRMNLPMQAVIHGDATSASIAAASVLAKVARDRYMLAL
FT                   DQQYPEYGFCKHKGYGTKAHYEALAAHGISPVHRRSFLKNLT"
FT   CDS             925776..926156
FT                   /transl_table=11
FT                   /locus_tag="RUM_08570"
FT                   /product="conserved hypothetical protein TIGR00252"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17036"
FT                   /db_xref="GOA:D4LBP1"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBP1"
FT                   /protein_id="CBL17036.1"
FT                   /translation="MTTRQQGALGEQAVAAYLTAKGYRILRRNYCIRGGEIDIIAENGE
FT                   YIAFVEVKARRPGSMVSGFEAVTPVKQKRLLRTAQAYLYQYPSGLQPRFDIAAVTLRGS
FT                   QVLDLDYLENAFDATDQPTDSF"
FT   CDS             927689..928381
FT                   /transl_table=11
FT                   /locus_tag="RUM_08590"
FT                   /product="Predicted phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17037"
FT                   /db_xref="GOA:D4LBP2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014578"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBP2"
FT                   /protein_id="CBL17037.1"
FT                   /translation="MSLFTIGDLHLSLGVPSKPMNVFSGWENHMELLEQNWRELISPED
FT                   TVVLPGDTSWGMTLPEALADFQFIQDLPGQKILLKGNHDYWWNSMKKMEEFLEANGLDT
FT                   LHILHNNHYPYGKYGICGSRGWVNIGNEQEQSAKVLAREVQRLEVSICSAEQAGLEPVV
FT                   FLHYPPMFGSNCNYDILDVLYRHHITRCYYGHIHGYSHRYAITGERDGIDFHMVSSDYL
FT                   GFRPEFIF"
FT   CDS             928512..929834
FT                   /transl_table=11
FT                   /locus_tag="RUM_08600"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17038"
FT                   /db_xref="GOA:D4LBP3"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBP3"
FT                   /protein_id="CBL17038.1"
FT                   /translation="MSLKSSEKIDVNTQELTFEISADVFEDAVEKTYQKQKKNITLQGF
FT                   RKGKAPRKMVEKIYGEGVFYEDAINSLLGPELGNAIEETKLVLVDRPKVEVTSISKENG
FT                   IVIKATCITKPEVTVPEYKGIKAPKKVKDVTDDEINAQIDVLRQRNARIVSVDDRPVQN
FT                   GDEVNMDFEGFIDGVAFDGGKGEGFPLTIGSGQFIPGFEDQLVGHSIGEEFEINVTFPE
FT                   EYQMPDLAGKPATFKIKINSISVKELPAFDDDFAKDTSDFDTAEEFRADMKKHMEENAE
FT                   KSAASAFENYVFDTLIKNTEAVIPNVMFEHRIDTLIQNFEQSLQQQGMSLDIYLQYTGM
FT                   TMDAFRDTFEERAQNEVKLRLALEKIAEMENIQVTEEEINEGLAPLVAQSGLELEAIKS
FT                   RIPMEDYIVDLKVGKAADLVKEAAVVDNTIEEEKPAEEAAE"
FT   CDS             929948..930538
FT                   /transl_table=11
FT                   /locus_tag="RUM_08610"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /function="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17039"
FT                   /db_xref="GOA:D4LBP4"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBP4"
FT                   /protein_id="CBL17039.1"
FT                   /translation="MSLVPYVVEQTSRGERSYDIFSRLLNDRIIMLSEDVNDTTASLVV
FT                   AQLLYLESQDPDKDISLYINSPGGSVSAGFAIYDTMQYIKCDVSTICIGLAASMGAFLL
FT                   SSGAKGKRFALPNSEIMIHQPLIGGGGLSGQATDIQIRTENLLRTKENLNRILSENTGK
FT                   SIEDIRRDTDRDNFMTANEAMEYGLIDKVIAKR"
FT   CDS             930544..931809
FT                   /transl_table=11
FT                   /locus_tag="RUM_08620"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /function="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL17040"
FT                   /db_xref="GOA:D4LBP5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4LBP5"
FT                   /protein_id="CBL17040.1"
FT                   /translation="MPENFKKCNFCGKGENKVQSMFSAGDVNICDECVCYCYELLYGAD
FT                   ARPKGKGKSRKKSAEKEMKLLKPAEIKKVLDEYVVGQDAAKVALSVSVYNHYKRIFSQD
FT                   DGEDVELQKSNVLLLGPTGVGKTFLAQTLARTLDVPFAIADATTITEAGYVGDDVENVL
FT                   LRLIQAANYDVEAAERGIIYIDEIDKIARKSENTSLTRDVSGEGVQQALLKIIEGTVSN
FT                   VPPQGGRKHPNQEFIHINTKNILFICGGAFDGLERAISKRLQSSSLGFGADVISKKAKI
FT                   KNIFRKAIPQDLVKFGMVPELVGRLPIITALDELDEASLVRILTEPKNALVKQYCKLFG
FT                   YDNIELVIEPEALEAIAKRALEQKTGARGLRAILEDILMQCMFDAPSESGIAKVIVNAA
FT                   CVQEHKQPLMLNQDGAPVGESA"
FT   CDS             932149..934575
FT                   /transl_table=11
FT                   /locus_tag="RUM_08630"
FT                   /product="ATP-dependent proteinase. Serine peptidase.
FT                   MEROPS family S16"
FT                   /function="ATP-dependent proteinase. Serine peptidase.
FT                   MEROPS family S16"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:RUM_08630"
FT