spacer

EBI Dbfetch

ID   FP929048; SV 1; linear; genomic DNA; STD; PRO; 2209938 BP.
XX
AC   FP929048;
XX
PR   Project:PRJNA39163;
XX
DT   25-MAR-2010 (Rel. 104, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 2)
XX
DE   Megamonas hypermegale ART12/1 draft genome.
XX
KW   .
XX
OS   Megamonas hypermegale ART12/1
OC   Bacteria; Firmicutes; Negativicutes; Selenomonadales; Veillonellaceae;
OC   Megamonas.
XX
RN   [1]
RG   metaHIT consortium -- http://www.metahit.eu/
RA   Pajon A., Turner K., Parkhill J., Duncan S., Flint H.;
RT   "The genome sequence of Megamonas hypermegale ART12/1";
RL   Unpublished.
XX
RN   [2]
RA   Pajon A.;
RT   ;
RL   Submitted (23-MAR-2010) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
XX
DR   MD5; 2a50f6218aeb860b5ea7133853be6203.
DR   BioSample; SAMEA3138358.
DR   EnsemblGenomes-Gn; MHY_R_29750.
DR   EnsemblGenomes-Gn; MHY_R_29760.
DR   EnsemblGenomes-Gn; MHY_T_29250.
DR   EnsemblGenomes-Gn; MHY_T_29260.
DR   EnsemblGenomes-Gn; MHY_T_29270.
DR   EnsemblGenomes-Gn; MHY_T_29280.
DR   EnsemblGenomes-Gn; MHY_T_29290.
DR   EnsemblGenomes-Gn; MHY_T_29300.
DR   EnsemblGenomes-Gn; MHY_T_29310.
DR   EnsemblGenomes-Gn; MHY_T_29320.
DR   EnsemblGenomes-Gn; MHY_T_29330.
DR   EnsemblGenomes-Gn; MHY_T_29340.
DR   EnsemblGenomes-Gn; MHY_T_29350.
DR   EnsemblGenomes-Gn; MHY_T_29360.
DR   EnsemblGenomes-Gn; MHY_T_29370.
DR   EnsemblGenomes-Gn; MHY_T_29380.
DR   EnsemblGenomes-Gn; MHY_T_29390.
DR   EnsemblGenomes-Gn; MHY_T_29400.
DR   EnsemblGenomes-Gn; MHY_T_29410.
DR   EnsemblGenomes-Gn; MHY_T_29420.
DR   EnsemblGenomes-Gn; MHY_T_29430.
DR   EnsemblGenomes-Gn; MHY_T_29440.
DR   EnsemblGenomes-Gn; MHY_T_29450.
DR   EnsemblGenomes-Gn; MHY_T_29460.
DR   EnsemblGenomes-Gn; MHY_T_29470.
DR   EnsemblGenomes-Gn; MHY_T_29480.
DR   EnsemblGenomes-Gn; MHY_T_29490.
DR   EnsemblGenomes-Gn; MHY_T_29500.
DR   EnsemblGenomes-Gn; MHY_T_29510.
DR   EnsemblGenomes-Gn; MHY_T_29520.
DR   EnsemblGenomes-Gn; MHY_T_29530.
DR   EnsemblGenomes-Gn; MHY_T_29540.
DR   EnsemblGenomes-Gn; MHY_T_29550.
DR   EnsemblGenomes-Gn; MHY_T_29560.
DR   EnsemblGenomes-Gn; MHY_T_29570.
DR   EnsemblGenomes-Gn; MHY_T_29580.
DR   EnsemblGenomes-Gn; MHY_T_29590.
DR   EnsemblGenomes-Gn; MHY_T_29600.
DR   EnsemblGenomes-Gn; MHY_T_29610.
DR   EnsemblGenomes-Gn; MHY_T_29620.
DR   EnsemblGenomes-Gn; MHY_T_29630.
DR   EnsemblGenomes-Gn; MHY_T_29640.
DR   EnsemblGenomes-Gn; MHY_T_29650.
DR   EnsemblGenomes-Gn; MHY_T_29660.
DR   EnsemblGenomes-Gn; MHY_T_29670.
DR   EnsemblGenomes-Gn; MHY_T_29680.
DR   EnsemblGenomes-Gn; MHY_T_29690.
DR   EnsemblGenomes-Gn; MHY_T_29700.
DR   EnsemblGenomes-Gn; MHY_T_29710.
DR   EnsemblGenomes-Gn; MHY_T_29720.
DR   EnsemblGenomes-Gn; MHY_T_29730.
DR   EnsemblGenomes-Gn; MHY_T_29740.
DR   EnsemblGenomes-Tr; MHY_R_29750.
DR   EnsemblGenomes-Tr; MHY_R_29760.
DR   EnsemblGenomes-Tr; MHY_T_29250.
DR   EnsemblGenomes-Tr; MHY_T_29260.
DR   EnsemblGenomes-Tr; MHY_T_29270.
DR   EnsemblGenomes-Tr; MHY_T_29280.
DR   EnsemblGenomes-Tr; MHY_T_29290.
DR   EnsemblGenomes-Tr; MHY_T_29300.
DR   EnsemblGenomes-Tr; MHY_T_29310.
DR   EnsemblGenomes-Tr; MHY_T_29320.
DR   EnsemblGenomes-Tr; MHY_T_29330.
DR   EnsemblGenomes-Tr; MHY_T_29340.
DR   EnsemblGenomes-Tr; MHY_T_29350.
DR   EnsemblGenomes-Tr; MHY_T_29360.
DR   EnsemblGenomes-Tr; MHY_T_29370.
DR   EnsemblGenomes-Tr; MHY_T_29380.
DR   EnsemblGenomes-Tr; MHY_T_29390.
DR   EnsemblGenomes-Tr; MHY_T_29400.
DR   EnsemblGenomes-Tr; MHY_T_29410.
DR   EnsemblGenomes-Tr; MHY_T_29420.
DR   EnsemblGenomes-Tr; MHY_T_29430.
DR   EnsemblGenomes-Tr; MHY_T_29440.
DR   EnsemblGenomes-Tr; MHY_T_29450.
DR   EnsemblGenomes-Tr; MHY_T_29460.
DR   EnsemblGenomes-Tr; MHY_T_29470.
DR   EnsemblGenomes-Tr; MHY_T_29480.
DR   EnsemblGenomes-Tr; MHY_T_29490.
DR   EnsemblGenomes-Tr; MHY_T_29500.
DR   EnsemblGenomes-Tr; MHY_T_29510.
DR   EnsemblGenomes-Tr; MHY_T_29520.
DR   EnsemblGenomes-Tr; MHY_T_29530.
DR   EnsemblGenomes-Tr; MHY_T_29540.
DR   EnsemblGenomes-Tr; MHY_T_29550.
DR   EnsemblGenomes-Tr; MHY_T_29560.
DR   EnsemblGenomes-Tr; MHY_T_29570.
DR   EnsemblGenomes-Tr; MHY_T_29580.
DR   EnsemblGenomes-Tr; MHY_T_29590.
DR   EnsemblGenomes-Tr; MHY_T_29600.
DR   EnsemblGenomes-Tr; MHY_T_29610.
DR   EnsemblGenomes-Tr; MHY_T_29620.
DR   EnsemblGenomes-Tr; MHY_T_29630.
DR   EnsemblGenomes-Tr; MHY_T_29640.
DR   EnsemblGenomes-Tr; MHY_T_29650.
DR   EnsemblGenomes-Tr; MHY_T_29660.
DR   EnsemblGenomes-Tr; MHY_T_29670.
DR   EnsemblGenomes-Tr; MHY_T_29680.
DR   EnsemblGenomes-Tr; MHY_T_29690.
DR   EnsemblGenomes-Tr; MHY_T_29700.
DR   EnsemblGenomes-Tr; MHY_T_29710.
DR   EnsemblGenomes-Tr; MHY_T_29720.
DR   EnsemblGenomes-Tr; MHY_T_29730.
DR   EnsemblGenomes-Tr; MHY_T_29740.
DR   EuropePMC; PMC3535981; 23147725.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   SILVA-LSU; FP929048.
XX
CC   This is a reference genome for the metaHIT project
CC   DNA source: Rowett Institute of Nutrition and Health, University of
CC   Aberdeen -- http://www.rowett.ac.uk/divisions/ghp/
CC   Sequencing technology: 454
CC   Genome coverage: 27x
CC   Annotation was added using ab initio prediction IMG/ER --
CC   http://img.jgi.doe.gov/submit (Markowitz, Szeto et al. 2007).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2209938
FT                   /organism="Megamonas hypermegale ART12/1"
FT                   /strain="ART12/1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:657316"
FT   rRNA            complement(2..117)
FT                   /gene="5S"
FT                   /locus_tag="MHY_R_29760"
FT                   /product="5S rRNA"
FT   rRNA            complement(199..3108)
FT                   /gene="23S"
FT                   /locus_tag="MHY_R_29750"
FT                   /product="23S rRNA"
FT   misc_RNA        complement(708..815)
FT                   /locus_tag="MHY_29810"
FT                   /product="Pseudoknot of the domain G(G12) of 23S ribosomal
FT                   RNA"
FT   gap             3203..3411
FT                   /estimated_length=209
FT   CDS             3463..4365
FT                   /transl_table=11
FT                   /locus_tag="MHY_00100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05257"
FT                   /db_xref="GOA:D4KG78"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG78"
FT                   /protein_id="CBL05257.1"
FT                   /translation="MIIYRGYIMSKLINKILLIMSTILILFVVSFSAVFGYLFFQHSQN
FT                   IESSRLESTALSLADILSKSTGNNPLTNIYNANVLQLVNILEQGEIWLVDKNTLQIVGS
FT                   RFNPALTYDQLPAQAANDLQSILNGQNIRTQTFNIYTQPHYTTIGVPIYDNEGNVKGAL
FT                   LFHSKMPTLKFSWYDGIALMLFCSIVLFVILILLLKVLLKKYVLPLEVLNQFIEKILHH
FT                   NYTSHIKTKASDEIAQLAQNLNRLSLYLQNLETTSKAKAQSDNNLIIKTAYKLHTPLKE
FT                   LKHDIHELAQKNPIYLSHI"
FT   CDS             4371..4910
FT                   /transl_table=11
FT                   /locus_tag="MHY_00110"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05258"
FT                   /db_xref="GOA:D4KG79"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG79"
FT                   /protein_id="CBL05258.1"
FT                   /translation="MQKNIDKLDMIANNLLDLSQLDNKDFTLQKDLLNLIEILQDSIKA
FT                   REKVAKEQNIKIDLKISLAKEIILFTGDKNRLKQMFCETLDKALQIYPQKSDLIIKILE
FT                   DDNNYYIYMQNNNDEVSVEHLPEMFPQFYQTAEDDTILNSIELKIAQHLASLHQIKLTT
FT                   EKQSDKYTVFKFTINK"
FT   CDS             complement(4994..5128)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05259"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG80"
FT                   /protein_id="CBL05259.1"
FT                   /translation="MLRKENAKQAIRLEVSKEYWQNNKRIGDTIYVKLPQDKIFLLNK"
FT   CDS             complement(5185..6048)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00130"
FT                   /product="ABC-type sulfate/molybdate transport systems,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05260"
FT                   /db_xref="GOA:D4KG81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG81"
FT                   /protein_id="CBL05260.1"
FT                   /translation="MALEVAIKKYYPDFSLDVNFYTEKGILGVLGASGCGKSMTLKCIA
FT                   GIETPDEGKIILNGRVLFDSEKKINLSPQKRNIGYLFQNYALFPHMNVEENIAVGIKIK
FT                   EEQKEIIAKYLKIFHLENLKKAYPKNLSGGQQQRVALARIFASQPDILMLDEPFSALDD
FT                   FLKWQVELELAKVLKLYGKNVLFVSHNRDEIYRFCDEIMVLSQGKTVSFSTKKDLFEKP
FT                   NSIAASKLSGCKNHSRIEKIDKYLCRAIDWNIDLTVTSEISDKDRYIGIRAHELMIVDD
FT                   KERKKI"
FT   CDS             complement(6059..6721)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00140"
FT                   /product="molybdate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05261"
FT                   /db_xref="GOA:D4KG82"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG82"
FT                   /protein_id="CBL05261.1"
FT                   /translation="MDFSPLYISLKTAGLATVITFILGIYAARFICKLKKYQGFIDGII
FT                   TLPLVLPPTVVGFFLLLFLGKNSFIGQFLALFDINIIFSWPATVITAVVVSFPLMYRTT
FT                   RGAFEQIDKDLIFAARTLGMSEEKIFWKIILPLAKSGILAGAILSFARALGEFGATIML
FT                   AGNIPGKTQTVSTAIYSAVQANDQETAFVWAGIIIVVSLMVMVLMNYWLKQQQKVNS"
FT   CDS             complement(6798..7598)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00150"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05262"
FT                   /db_xref="GOA:D4KG83"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG83"
FT                   /protein_id="CBL05262.1"
FT                   /translation="MKSNGKNIVILVMYCLLTVVFAGCGNTSQDNSSQKTEKQQEVYIV
FT                   AAASMTDAIKEIGANYEKEYPNVKLTYNFGSSGALQTQIEQGAPADVFISAAQKQMNAL
FT                   DKKGLIDKSTRKDLLENKVVLIVPKDSELSLNDFADVATDKVNKIALGEPKAVPVGQYS
FT                   EEIFSNLKILDAMKQKAVYASDVRQVLGWVETGEIDCGIVYATDAAISDKVKVLMEAPE
FT                   NTHKPVVYPIAMVNSSKNPDVAKDFIAYLSQDAQKIFWQNMDLT"
FT   tRNA            complement(7829..7904)
FT                   /locus_tag="MHY_T_29740"
FT   gap             7905..9684
FT                   /estimated_length=1780
FT   CDS             9836..10195
FT                   /transl_table=11
FT                   /locus_tag="MHY_00160"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05263"
FT                   /db_xref="GOA:D4KG84"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG84"
FT                   /protein_id="CBL05263.1"
FT                   /translation="MKKTNAARILDRLKIDYELKEYKVDLNDLSAIHVAKDVNMDIKTV
FT                   FKTLVARSDKNDIIMACIPGDDELHLKKLAQVANFKKVEMIHLKELLPLTGYVRGGCSP
FT                   LGAKKLILYSLMKQL"
FT   CDS             10322..10765
FT                   /transl_table=11
FT                   /locus_tag="MHY_00170"
FT                   /product="Predicted small molecule binding protein
FT                   (contains 3H domain)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05264"
FT                   /db_xref="GOA:D4KG85"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG85"
FT                   /protein_id="CBL05264.1"
FT                   /translation="MNTDERREQILYTLKQTNTPITGSELANIFKVSRQIIVGDITVLR
FT                   ASGHNIFATPRGYLLPHDQAKEEQLATIACQHNDDNLQTELEIIIDNGGKVRDVIVEHP
FT                   LYGEIRVNLFINSRRDIQLFLAKKKNKCFCFNEHNKRSSLSYN"
FT   gap             11086..12505
FT                   /estimated_length=1420
FT   CDS             complement(13538..13807)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05265"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG86"
FT                   /protein_id="CBL05265.1"
FT                   /translation="MQSKMKQAYIGEIQYQTKMLNNLKVWLRNMIMLSSISLILILFGD
FT                   EMYSFLSTVGIVLMILSVIACLILSLGIKNGQDNINKLINYIEK"
FT   CDS             complement(13824..14660)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00220"
FT                   /product="PTS system IID component, Man family (TC 4.A.6)"
FT                   /function="PTS system IID component, Man family (TC 4.A.6)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05266"
FT                   /db_xref="GOA:D4KG87"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG87"
FT                   /protein_id="CBL05266.1"
FT                   /translation="MEKKISKKTLNKSFRNWYYGHLTCFSQEHMQTFGYLCAMLPIIEE
FT                   LYKTKEEQKKAMQTYTAFFNTEPQVGSVVVGITASLEEAKANGADDINAETINGLRAGL
FT                   MGPLAGIGDSLVVGTLIPILLGIAMGLSTGGSPIGAIFYIIVWNLLITWGMRFLYFKGY
FT                   ELGGKAIDFLVGERATAIRESIVMLGTIVIGAVAGTWINIRTGFTMTAEGADKPFLVLQ
FT                   DTLNGVFPNILSAVFVIFCWYLLTKKNMSPIYVMLLLVVIAFVGVLVGFFDTGLTY"
FT   CDS             complement(14661..15515)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00230"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05267"
FT                   /db_xref="GOA:D4KG88"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG88"
FT                   /protein_id="CBL05267.1"
FT                   /translation="MEISWLQAIILGIFACLASMPGMGGTVIGNYTLGRPLVGGLVCGI
FT                   VLGDIQSGILIGTAMQVVYIALVTPGGTVSADVRAVSYIGIPLAMIAVKSLGLDPASPA
FT                   GIGLATSFGSMVGTLGTVLFYGTATINLAWQHIGWKAVEEGNFHKLYFVDMGLPWISHI
FT                   ICSFIPTVVMCLYGQDAVEAIKTYLPMDGIAMQTLFTVGALLPSVGVAILLKQVVNDVM
FT                   DFIPFFLGFALAAGLGLNLIGAAIVGGMFAIINYKIQMLRIEAKKAAASGVTSYDDDDE
FT                   EDI"
FT   CDS             complement(15551..16042)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00240"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05268"
FT                   /db_xref="GOA:D4KG89"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG89"
FT                   /protein_id="CBL05268.1"
FT                   /translation="MSVSFIRIDDRMIHGQTCTRWAREYPCDGLIAVNDKAAKSDVLKA
FT                   AYKAASGKKTFVWTVEDFKKKAQKVLDSDTRYFLITKDPIDMRKILVEQGFKCGITKVI
FT                   VGPCNDREGSTTLGNNQSITQEEAQALEDISKAGYSIEFSLLPDVSIGNWDKFKGKFGF
FT                   "
FT   CDS             complement(16074..16571)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00250"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05269"
FT                   /db_xref="GOA:D4KG90"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG90"
FT                   /protein_id="CBL05269.1"
FT                   /translation="MIIFVNIDRIIDVKRIIRKYKNEGATTMKYVILVSHGKFANGLND
FT                   ALSMLAGNREDILSVGLENGKSVDEFTALFTEKVKDISTDDEVILLGDIIGGSPLTNAT
FT                   NVLVNKGIKTVILGGMNLPLALTTVLMKDTVSLDEIADQVLEQARMAMQEFKIVEESED
FT                   DI"
FT   CDS             complement(16707..17996)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00260"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05270"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG91"
FT                   /protein_id="CBL05270.1"
FT                   /translation="MIKKVIISFIAIVFTYVAVTNLYTNKVVIHLGIFVGNWEVPNGND
FT                   YKIIDDAIARFEKLHPNVEIEYESGILKSDYSLWLANKIVNGEEPDVFMIVDEDFNTLS
FT                   SLGVLKDLTEEIENDKTFNKDDYYESTLKAGQYEHKQYALPYESNPMLMFVNKTLLEKE
FT                   NIPIPENDWTLDDFYNICQQVTKDTNGDGAIDQYGCYNFSWLNSMYSHGIRLFDEDGKE
FT                   CFIDQDEAKEAVIFVEKLNKLNQEHIITKEEFNTGKVAFAPMSFAQYRTYKPYPWRVKK
FT                   FSDFEWDCIKMPLISSNDKGSEISSLLMGISSRSKNADIAWEFLKMLTYEKETQKDLYK
FT                   YSQGISSLKSINKSEDIVCLLGKDNKENQINVNLLDEVMNKTLEHSRFKKYNQALNLID
FT                   IKINDMIRNKSDIDIGLLELQKDINKYLNE"
FT   CDS             complement(17989..18123)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00270"
FT                   /product="Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05271"
FT                   /db_xref="GOA:D4KG92"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG92"
FT                   /protein_id="CBL05271.1"
FT                   /translation="MFLSEGTVRNYLSSILSKLNLRDRTQLAIWAVQTGQIAKDFDND"
FT   CDS             complement(18726..20015)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00300"
FT                   /product="Signal transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05272"
FT                   /db_xref="GOA:D4KG93"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG93"
FT                   /protein_id="CBL05272.1"
FT                   /translation="MNRTYGLFFFIVKNTMFILNVIIVLFYVAVIAITTKYIIGNDLAR
FT                   SFLDKVMYMPTAPVYIISGSVGLLLCLAYCVYYREFNNIRNKTINYLYSLLEVVISVIL
FT                   IFLIYLSYNGIILFVFCDCMYHLKKGLKYQVLLVALGLIYLLANYEIVTYFYPLVNIEE
FT                   YFLVYDASIRNCLIIIKRLLEGFNIILFIIFMIIYILKQIQENEYINKKLSMVAMINKK
FT                   MQKYVIVTEKFGEKNERKRLARELHDTIGHALAGMAVGVDACITMIDKNPQLAKAQLKI
FT                   ISKAIRKGMKDVRNSLNKMRPDFLQQYRLKEAIEKMKEEISDVTDLKINLNYQIDETGF
FT                   DTKIEDILFRVIQESITNSIRHGLATVVDIDIYKENNLLCLKIKDNGKGCKAINYGFGL
FT                   KQMVERVSQIRGDINFYSENGFTTEIKIPL"
FT   CDS             complement(20015..20107)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05273"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG94"
FT                   /protein_id="CBL05273.1"
FT                   /translation="MAKKNRKNIIIPISLINKENLFKYDEDRWQ"
FT   CDS             complement(20091..20924)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00320"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05274"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG95"
FT                   /protein_id="CBL05274.1"
FT                   /translation="MVLIIFTVTYNIYTAPIAKHKVFGVSYMTMNNPFYKIINNEILKV
FT                   VEKNNDTLITLDPELDVDKQNEQIYKFIDQKVDGIFINPIDFEQIEPALQAAKRANIPV
FT                   IIIDAPVSDESLVNCTIVSDNYDAGVQCAKDMMERLDSANIVLLKHTTAKSAKERIEGF
FT                   LSVIDNNEKYKVINEAECDGQLEIAMPKMQEIIEETPDIDVVMALNDPSALGALAALEK
FT                   NNKNDVMVYGIDGTPEIKALIGRNQMIVGTVAQSPIKMGQIAVENMYNILNGKKK"
FT   CDS             complement(21144..21221)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05275"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG96"
FT                   /protein_id="CBL05275.1"
FT                   /translation="MQVPPVPVDDYAAIVIGRKYLKDNK"
FT   CDS             complement(21344..21544)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05276"
FT                   /db_xref="GOA:D4KG97"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG97"
FT                   /protein_id="CBL05276.1"
FT                   /translation="MNDEILAIDPGREKTGIAILKNSDVLEHKIINSEELVQIIKSLLE
FT                   KYIIKTIVMGNGTSSKKNMIY"
FT   CDS             complement(22788..23873)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00380"
FT                   /product="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05277"
FT                   /db_xref="GOA:D4KG98"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG98"
FT                   /protein_id="CBL05277.1"
FT                   /translation="MRILDKYILKETIMTFIFGICAFSAVFLGSGTLLRIAQYITQYGA
FT                   SFSAIVRLIIYSLPGIIVWTFPMSMLLAALLTFGRLSGNSEIIAMKACGVSFKRLVTPV
FT                   IAFSLGVSIFSIGFNEYVVPASNQAYADLVRYEIQGNTSPESQEHIIIKQIQDGNIQRL
FT                   VYARKYDAETGNLDNLSIQEFEQGKMVRVENAEYAKWSVDEWVMYNGVLYDLSQPNTER
FT                   MMKFDSQVLPINQTPKQIIKSQKKPDEMTIKELREQINIMKSQYVDTKKLEIELYQRFT
FT                   VPMASLMFALIGAPLGIQPNRSSSSIGFGISIIIIFIYYTLMTLAGAIGQNSFIPPVIA
FT                   VWIPNIVTLIAGIYLIRKESK"
FT   CDS             complement(24651..25427)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00400"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05278"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:D4KG99"
FT                   /protein_id="CBL05278.1"
FT                   /translation="MKKYSKLKTALVVAIMSFSMINTVIAADTPIELKGDVIEYNAQTD
FT                   MAIATGGVTIIRDGGVLTGGQATYNFKTQEASITGGVTANKDDMNLKAESLISNANQEV
FT                   VAKGSVVLVKADNTLTGEEIHYNQATSDISMPLGGNATGPQADIRGDVLSGNLMTNQYT
FT                   ATGNVYLNSKTNDVQSTSDTATYSGNGQDFNFVATGNVNIKSPSRNIVTNSDNATYNST
FT                   ENGKLVLTGNAVATQNGNIVRGNTLTVYLGDNVNIK"
FT   CDS             complement(25978..26547)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00420"
FT                   /product="Lauroyl/myristoyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05279"
FT                   /db_xref="GOA:D4KGA0"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGA0"
FT                   /protein_id="CBL05279.1"
FT                   /translation="MGTWEWLAAGLVKAGFSVTALAKTQPDSQYTKLLDEYRAQVGVEI
FT                   FARGAASELLAASRALKKGRILGFLADQDAGPGGAFIEFLGEVCSTPMGPAVFARKFMS
FT                   PVVPAFIIRQSDGTHKIEIYEPIVYNDTGDTNADLYDFTERMTKIIEEQIIAHPTQWIW
FT                   FQKRWNTRPEQQKVKHHTVKTKVVNK"
FT   CDS             complement(26619..26888)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05280"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGA1"
FT                   /protein_id="CBL05280.1"
FT                   /translation="MKYKLLKYFSAFLCCLSHKNLLRLGHILGILYFHLIAKERNRAVD
FT                   RMMKSFKIDEEKAKKIVKDSFINLSQNVLEILYMPRLKKMILNI"
FT   CDS             complement(27238..27501)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05281"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGA2"
FT                   /protein_id="CBL05281.1"
FT                   /translation="MQYTQDALARAKNVKMLILDVDGVLTDGSIAVGDNGELFKTFNVR
FT                   DGLGITLAQKLGIKTAIITGRESKMLAYRARELKINAFYPTK"
FT   CDS             complement(27501..28472)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00460"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05282"
FT                   /db_xref="GOA:D4KGA3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGA3"
FT                   /protein_id="CBL05282.1"
FT                   /translation="MIKEKAIETLQIEADAVKKLINHIDDEFETIVNAILACNGRVIVT
FT                   GMGKSGHVGRKIAASLASTGTPSFFMHPAEAFHGDLGMVTANDMVLAISNSGESNEIVN
FT                   ILPIIKRIGAKIIAMSGRRESTLGKNADYYIDISVEREACPLGLAPTASTTATLAMGDA
FT                   LAIALLSSRNFTAQDFAVFHPGGALGRRLLLTVENVMHSGEDNPVISVHKTAKEALFLM
FT                   TAKGLGATSVVDENGKFIGLVTDGDIRRMLARGAEFLDEPVEDLMTKNPVIITKDKMAA
FT                   EALSMMEKHQPKPITVLPVIDVEKNEPVGIVHLTDLLRQGVV"
FT   CDS             complement(28525..29346)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00470"
FT                   /product="3-deoxy-8-phosphooctulonate synthase"
FT                   /EC_number="2.5.1.55"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05283"
FT                   /db_xref="GOA:D4KGA4"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGA4"
FT                   /protein_id="CBL05283.1"
FT                   /translation="MHTVKIGNFEVGAGNPLVLLAGPCVLESYERSLYIGKTIKEITSR
FT                   LGIPYVFKASFDKANRSSYNGYRGPGLEEGLKWLQSIKEELNVPVVTDIHNETQVEPVS
FT                   KVVDVLQIPAFLSRQTDLLYTAAKSGCVVNVKKGQFLAPADMKNVVKKLEEAGSEKILL
FT                   TERGASFGYNNLVVDMRSFPIMRSTGYPVIFDATHSVQLPGGAGTSSAGNREYVEFLAR
FT                   GAAGVGVDGFFMEVHDNPEEALCDGPNMVYLDKLEDLLKDLIAINEITKKK"
FT   CDS             complement(29685..30107)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00490"
FT                   /product="CMP-2-keto-3-deoxyoctulosonic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05284"
FT                   /db_xref="GOA:D4KGA5"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGA5"
FT                   /protein_id="CBL05284.1"
FT                   /translation="MKIICVIPARYASTRLPGKPLADIAGKPMIVRVYERVLNAIKPAE
FT                   VIAAVDDERVYEAVAKAGGKAIMTAKNHPTGTDRLAEVAQKCPDADVIINVQGDEPLID
FT                   PQIIDDLAQEFLNDEDLKMATVKTPMKEEEKQNQEM"
FT   CDS             complement(32594..33631)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00530"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05285"
FT                   /db_xref="GOA:D4KGA6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGA6"
FT                   /protein_id="CBL05285.1"
FT                   /translation="MKSVQLSSLLTPTVEFLAAVIVTVILWFGGYQVVNGALTAGALIA
FT                   FLTYAVNLANPVKRISRVYGTINKAMAAAERVFDVLDTQEDLKDKPEAKELPKISGKVK
FT                   FDHVSFGYKDGVNVLHDLSLTANPGQVIAFVGPSGAGKSTIANLIPRFYDVTEGAITID
FT                   DIDIRDVTIKSLREQIGVVPQETMLFSGTIKENIRYGRLDATDEEIIEAAKAANAHNFI
FT                   MNLSDGYDTKIGERGITLSGGQRQRMAIARAILKNPRILILDEATSALDTESEEIVQEA
FT                   LDKLMVGRTSFVIAHRLSTIVHADKIVVLDNGRVQEMGTHQELMQTGGLYSHLYNIQFS
FT                   NKKAK"
FT   CDS             complement(33769..33981)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00540"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05286"
FT                   /db_xref="GOA:D4KGA7"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGA7"
FT                   /protein_id="CBL05286.1"
FT                   /translation="MSYITNDVAALQAALVDSLIELVTESSILIGSLVMMFYLDWKLSL
FT                   VTLIVVPLIGQAMKIFGRKLKKVVH"
FT   CDS             complement(33981..34325)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00550"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05287"
FT                   /db_xref="GOA:D4KGA8"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGA8"
FT                   /protein_id="CBL05287.1"
FT                   /translation="MNDYKRLILFIKPYWKRLLLAIVCIIMSAAANLYVPWIIKDMIDK
FT                   VLMERDMVLLNLIAVGIVVVFFFRGIFFYGQSYLVSYIAQRVIIDVREMLYVKFQKLQL
FT                   AYYEKNKQEQ"
FT   CDS             complement(34331..35164)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00560"
FT                   /product="Lipid A disaccharide synthetase"
FT                   /EC_number="2.4.1.182"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05288"
FT                   /db_xref="GOA:D4KGA9"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGA9"
FT                   /protein_id="CBL05288.1"
FT                   /translation="MNIPVFSYIPPSAWAWRKGRAKEVAKIADKIVAIFPFELDVYKKA
FT                   GADISFVGNPLMDNVKASMSREMAAEFFGIDLKEDNILLLPGSRKQEIANLLEPMLQAA
FT                   QLIKKERPEIKFFLPVATGIDKKYLEEKINEYGLTVKLCETKTYDLMNCCDFAIATSGT
FT                   VTLEAALMGLPSIVLYKMSAITYRIAKIFVKIKYFSLPNILVDKQVLPELLQDEVNGEN
FT                   IARLARDLYKDTESAKRVKEELLMVKEKLGSPGVADKTAELILQTADRFKNEIKG"
FT   CDS             complement(35218..35484)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00570"
FT                   /product="Lipid A disaccharide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05289"
FT                   /db_xref="GOA:D4KGB0"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGB0"
FT                   /protein_id="CBL05289.1"
FT                   /translation="MYKIMFSAGETSGDMHGANLAKALKNICSDIEMFGFGGPQMEQAG
FT                   VKLCKNMLDYSVMGFWEVLVNLRKMFKLKDALVAEMKNKSLIF"
FT   CDS             complement(35561..36151)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00580"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05290"
FT                   /db_xref="InterPro:IPR010415"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGB1"
FT                   /protein_id="CBL05290.1"
FT                   /translation="MIGKVTKEILFSGQHELPDARMIALLSSLKDRSDDTMMLAFVAEL
FT                   AKEGITTFDQTMLLKMIMPKKGVLTKRQPTERENLDMEFGFKMAKALGGLDIGQTVVVK
FT                   DKAVMALEAIEGTDACILRGGKLACGNAVVAKVAKPAQDNRFDMPAVGVKTIESMIEVK
FT                   ASGLVIEAGRTLIVDREKVLSLADENAITIVAM"
FT   CDS             complement(36222..36368)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05291"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGB2"
FT                   /protein_id="CBL05291.1"
FT                   /translation="MKSIGLLSGIGRLPVEVAKAARAMGIDVYAVGLVDGVEEDLKKCS
FT                   NRF"
FT   CDS             complement(36384..37187)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00600"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam
FT                   ine O-acyltransferase"
FT                   /function="acyl-[acyl-carrier-protein]--UDP-N-acetylglucosa
FT                   mine O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05292"
FT                   /db_xref="GOA:D4KGB3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGB3"
FT                   /protein_id="CBL05292.1"
FT                   /translation="MEAESKIHPLAIVHENAKIGKNVEIGPFAVIGENVEIGDGTRIEP
FT                   HAVITGWTKIGKDCVIFPGASIGAEPQDLKFVGEKSYVYIGDRTKVREYATIHRACGAE
FT                   EETRIGNDCLLMAYTHVAHNAIIGNNVIMANNASVAGHVIVEDRAVLGGFAGVHQFVKI
FT                   GRNAMVGGFSKLVQDVVPYTIVDGRPANVCGLNSVGIARAGISVSSRKAIKQAYRILYR
FT                   SGLKLAQAISVIEQEVDSCAEVEHFLRFLRNADRGICRENHEGNN"
FT   CDS             complement(37281..37721)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00610"
FT                   /product="3-hydroxyacyl-[acyl-carrier-protein] dehydratase"
FT                   /function="3-hydroxyacyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05293"
FT                   /db_xref="GOA:D4KGB4"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGB4"
FT                   /protein_id="CBL05293.1"
FT                   /translation="MRIDIPEIEKVLPHRPPFLLIDRIIELEPMKYAVGIKNISINEDQ
FT                   FRGHFPGHPIMPGVLILEAMAQVGGFALLYPAENRGKLAYFGGMDNVKFKKPVVPGDQL
FT                   IMKSEIVKIRGDFGKVHCEGFVDDKLVAQGDFTFALQKPENL"
FT   CDS             complement(37741..38568)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00620"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05294"
FT                   /db_xref="GOA:D4KGB5"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGB5"
FT                   /protein_id="CBL05294.1"
FT                   /translation="MIKQKTIAVDVSYTGIGLHSGTEVNMKLRPAPVDTGIVFIRTDLP
FT                   EKTQIKAIASNVTSTLRATTISNGDVKIFTIEHLMSALFASDIDNCYIEIDSEEPPVTD
FT                   GSANVFLELLEKAGIKEQEKEADIITINKVYRIDDKERFIMVLPYDGFRVSFTSINPHP
FT                   LIGIQYHDFEFTSKDLYKKEIAIARTIAYEKEVEALRKMGLGLGGNLDNVIVYNDEGWM
FT                   NKLRFPDELVRHKILDAIGDLRLAGRIKGHVIAVKSGHELNTKLAKKILADFT"
FT   CDS             complement(38614..38742)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00630"
FT                   /product="Bacterial lipid A biosynthesis acyltransferase."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05295"
FT                   /db_xref="GOA:D4KGB6"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGB6"
FT                   /protein_id="CBL05295.1"
FT                   /translation="MMASLTSLVEQHIRDYPEEWFWLHDRWKYVERKKKKQITCSK"
FT   CDS             complement(38802..39380)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00640"
FT                   /product="Lauroyl/myristoyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05296"
FT                   /db_xref="GOA:D4KGB7"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGB7"
FT                   /protein_id="CBL05296.1"
FT                   /translation="MAIHNIERCLKVSTDKAEQIAKKSWTRFGPMIMEVLRFKVICKNI
FT                   DKYVTIKGEENIKKAMSYGNGGVIATAHSGNWEIIGAALTHKGMKIAGVAQHQRNEGVN
FT                   NFINYCRAFTGMHITDKLDIKEMMKMLGQKYFIGLIMDQDGGSTGIIMPFLGYEASCVQ
FT                   GPAVMSRFKSAPILPAFITEDKKDQDIIF"
FT   CDS             complement(39367..39504)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05297"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGB8"
FT                   /protein_id="CBL05297.1"
FT                   /translation="MLYHILVFLSDICCLLPASVARFIGKILGELTWIVVPKKETNGNP
FT                   "
FT   CDS             complement(40411..40668)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00670"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase, LpxD."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05298"
FT                   /db_xref="GOA:D4KGB9"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGB9"
FT                   /protein_id="CBL05298.1"
FT                   /translation="MKRTLAEIANLINGKLCGDYDENLVITGATGIALAGPSEITFAVD
FT                   PHLEEAIACNAAAVIIQEDVDGFSKTCIKVKILEKLSIFY"
FT   CDS             complement(40790..41143)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05299"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGC0"
FT                   /protein_id="CBL05299.1"
FT                   /translation="MKIKLMLVIALVTLMSVFMSGCGSETKLGYLDAERVMNEAPQIKT
FT                   IRDNIDAKNKEIEAKETDLMSKKATMSDEEFKKAQMDIQRQYQGLDMQYKSQVKIQWIR
FT                   YSQKYQQKKNYLL"
FT   CDS             complement(41460..42278)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05300"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGC1"
FT                   /protein_id="CBL05300.1"
FT                   /translation="MANEQDKDNDMQENKKDKSRKSAIITGVICVLLCIIGALYIWHKQ
FT                   TQKPPVQLDVNSAIATVDIDKLMSKHSDYAKLEKLQAEKILILIKLKSYALNTEQLQPP
FT                   QVNPASQVFEQVVDEQNNLQEIKAKQQLKEETITKEHEIRQRLSIEKNKAETLITDKYT
FT                   NAIFNCTMKLDNAENLRLTQEEKDNLLTLLEQLKKERGENVALIEQQYNLKVADELMKW
FT                   RAQREQELGINVQKIHQIDVQNSLERQQAEQKERHNIFKIDCRCFKLEKR"
FT   CDS             complement(42366..42620)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00720"
FT                   /product="Outer membrane protein (OmpH-like)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05301"
FT                   /db_xref="GOA:D4KGC2"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGC2"
FT                   /protein_id="CBL05301.1"
FT                   /translation="MQDKQKELIDPIRNSIEEQVKAVADSRGINVVLDKNNVLYGGQDI
FT                   TQDVLTKIQAQGDVTTDNTNSSDATSAEATDTTNSSGQN"
FT   CDS             complement(43048..45003)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00740"
FT                   /product="Outer membrane protein/protective antigen OMA87"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05302"
FT                   /db_xref="GOA:D4KGC3"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGC3"
FT                   /protein_id="CBL05302.1"
FT                   /translation="MANISAFSINNCFANVADNNVHENIVSAESLTEEVVAAKIDETMQ
FT                   DVSADNEAAKEDKEIVINNDKKNKVDKVQDPEAIAKMNTWKEQRPTEETIKNNNSAYTD
FT                   MTVVSVDVVGNEKIAKEDILNVLTIKAGDKFNIKNIEQDRNNIYNTGYFYDNYPSYEIV
FT                   PEGVKITYHVMENPVLNSVEILGNQVYSTDKIEDMLTVKKGEILNIRQLNTDLANIEAS
FT                   YRQDGYILAKLRDISIDESGNLTLTFNEGILEGYVVKGNDKTKDYVITREMRIKPGEVF
FT                   DAKKARRSMQRVYNLGFFEDVSVKILPGKEDPNNIIMELTVIEKRTGSFGIGAGYSSED
FT                   GLLGMVSVSDSNFMGIGDSVKAMYEFGGEDGDDSGYSISYTKPWLDEKETTGTFRIYDR
FT                   KFEYDDYDNGGDLIETYDKKNQGYELNFGRPTDEYTMNYLGFKINNTEYRGHEDGLDRS
FT                   TNTEWLDNNFGETRSIIASQVRDTRDNIFYPTEGTRTSLSVEYAGLGGDFDYTKLTGSI
FT                   QKYYKVGHAQVLALRGSAGYANEDLPEAALFEVGGQNSVRGYRDGQFSGNRMLMGTVEY
FT                   RFPLVNKVQGSLFTDVGDAWGGKSWGPWSSIEDDLDLHASVGLGLQMQTPIGALRLDYG
FT                   WGEDGGRLHFNVGGNF"
FT   CDS             complement(45188..46942)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00750"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05303"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGC4"
FT                   /protein_id="CBL05303.1"
FT                   /translation="MIDGTLKDYPLQNIQIDAELDNKVVKIDKFYAEQGAGKVAAQGSI
FT                   DLENGPIDARISASNMDVNLLTHLCDMNININGVMNGDIQVGGTIDEPTADISIYTQGD
FT                   GTQFDNAYALANLKNGVIYINQMAANKGQCAIKAEGSIPIAALEMDKRNEQNINQQMNL
FT                   KVYLENTDLNILPSLTPFVEWSMGNVQGDLNITGTVQKPNFKGNISTVDSAIKFKYIDS
FT                   PLENINVDIDFDQDLMTVKRFTGKMGEGDYNLVGMAHLTSQGITGYSFNLDLNNLDIVS
FT                   DYYTGHLVGNLQLIEEEFHGRRLPKLITNLDFNNIEVSMPPLPETTDTPLPEMLLDINV
FT                   TLGDNVHAYDALLYDLYIKGAFNIKGTTIHPKSSGSLTVDKGTINVLKNIFKIEVGNIV
FT                   FNQVDSFFPSIDFLAVTRLDRTKIFASLQGPLDKQLEPRLFSEPAMNDAEIIKLLAFRT
FT                   DYKEGSSGEITEDDLLSLASVGLQMSFLNEIEGTLRNVLNLDEFRISRDSLSDSAKKRF
FT                   DTDDGDVYSVQIGKYLSDKVMLRYTKGINYDLNRVGLQYYMNNNVGIITEVEDDGVYNI
FT                   KLEMQWKF"
FT   CDS             complement(47014..49506)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00760"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05304"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGC5"
FT                   /protein_id="CBL05304.1"
FT                   /translation="MQKKSKIIVGASVFIIFCISLMTFLWINSQSFKQETANLISKQVE
FT                   NILGTKININSLYIVSTNSAAIDDVEIYDKENELIAKADKVVFTIDFWQILRQSPLAGL
FT                   SEVDVINPEVNIIQRSDGSWNVEDLIDKDSDTPVDFKGIVKVENGQSKLRFEGKQLSID
FT                   KINLEADCADLTAINLDGSLNHEDALVEFDGVVGEVIKTNLEIKAQDLDILKYLPFIPE
FT                   EYLANVNIKQGFINKANITISGNLENQYTLDGSVSFVDGACEVLGQNVEDIRGIILLNN
FT                   KNIQLFVSGSAQGQKVAVHGNIEDYMTEPRLRLIAESKSFRPELFIEGIPFNGEVSFVS
FT                   AIYGTLDDIRIGAQVNSKLGYIYDYPIEDINIQARYRDNKVFIDDFRADFANGWIWASG
FT                   QCDLADLSYKGSFRASNIDMSVFNNYLPQVITGNAIIRGDFKGQGVEFENLDLSGRLEV
FT                   NNGSYDNIPVEKLEASFYKEKDLLQIDALTASFANGGKLAAKGGLQNDNINADFYASNV
FT                   DMSLVKNYLPDMEISGDANFSGRLSGDLDNPVLRIDLMAKDGSILNQPFDSLLVNAVGN
FT                   LDGMRVDRCQFINDGEITHEATGVLGFKGKQFIDMVVQTKQARVENLMQVVMPEFKITG
FT                   NVDNSIHLTGNLQDIKATGNVHFYEGSLYGILITQVDGTYEYNDGDIVLKDFVITSPFI
FT                   KATLSGNLDKSKEMNFKFKADEILIDKLQVDLPYPVSGKASFDGVLTGKVGALNFDGIL
FT                   QADDIILNGENIDDIYGHLKLANRILSLEQFKFKQNNGEFDFNGAVNLNTKQVEGKAII
FT                   VQADINAAMSMANLKIIY"
FT   CDS             complement(49632..50963)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00770"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05305"
FT                   /db_xref="GOA:D4KGC6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR028351"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGC6"
FT                   /protein_id="CBL05305.1"
FT                   /translation="MNKKSLNKTITAVLLSGSLFLGGSNLAFAQDTVDLTLDNTVELAL
FT                   ENNRTIKQSVYDTDSARWALSEAKGQKGFSINWQTVAAAASGETYDLQNRDSTYQNVVE
FT                   ASIPLYTGGQLENNIKSKEIGVDISDLTLENTKQQIKYDTTKGYYNILQCRNLVGVNQE
FT                   TVDQLQAHLDTVNAKYAAGTVAKSDVLRSQVELADAKQNLVNAENNYDLSISSLNNLIG
FT                   LPIDTKINIQDELKYTKYDLSLAECMDLAMTNRPDGVAAAKAIEQAKASVKAAQAGNLP
FT                   QLSAYASYTVDGDDAFNNDAAEKSEVGVKASWNLFDNNVTKAQVRQAEAALAKAQENAQ
FT                   YVNEGIQLEVHQAYLNLLSAEKNIQTTSVAVNQASEDYTIAQVRYTAGVGTNIDVMDAA
FT                   VALTTAKTNYVQALYDYNVSKAQLDKAMGLPVDLDVQAVAAKTY"
FT   CDS             complement(50981..51505)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05306"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGC7"
FT                   /protein_id="CBL05306.1"
FT                   /translation="MATNMETVVADPQTAQSLKNIISNADNISQRADNMMSKVSSIEVK
FT                   PGVEALYSGGQSEWMVNADVKVYTDPNSFLLIGADDIGGDDSGTNLQIGTGNGIFTGRG
FT                   GLVDDKVGVGVDLKAGEKGKISVDAYDPNDLRVKLKGQYEVAQDTYLIGQIKDINDSDE
FT                   RAAYVGLRHEF"
FT   CDS             complement(51481..52290)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00790"
FT                   /product="ABC-type transport system involved in resistance
FT                   to organic solvents, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05307"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGC8"
FT                   /protein_id="CBL05307.1"
FT                   /translation="MLAKLERGEKMSNEAKVGIFTTIGLALLIGIIVYLSGFSFGKEKD
FT                   YTFDITFNQVTGLKIGAGVSYAGIDAGRVSAIEAYKDKARVTVVIKGNMQIAKDSLFTI
FT                   SSDGLMGEKFISIMPPQHPSGEYLVGGEEVHGVDEKGLDYLLVQASVTLDDVRGLIKSM
FT                   NDILGNQDVQKSLIQTAVNLKDLTGNMNQLMQVMSTLAVNNQQDIDNMIKNLSAMTASM
FT                   AKAADEIEIMINDFAGDGETANNMKVAIANLSATSESVKKWQLIWKL"
FT   CDS             complement(52265..53002)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00800"
FT                   /product="ABC-type transport system involved in resistance
FT                   to organic solvents, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05308"
FT                   /db_xref="GOA:D4KGC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGC9"
FT                   /protein_id="CBL05308.1"
FT                   /translation="MIKVVNIYKSFKDRLILNNINFEVNKGETLVIIGGSGSGKSTLLK
FT                   LLIGLLRPEQGQIFIDGKEISKLKEEELDKVRLNMGMVFQYSALFDSMSVGDNVGFGLQ
FT                   EHSKLSAKEIKEIVEEKLNLVGLSGFANYMPNELSGGMKKRVSLARAIAFEPKILLYDE
FT                   PSSGLDPVTSAKIDELIVQMQKLLGVTSIVVTHDMKSAFYIADRIAMLYQGEMIAIGTP
FT                   DEIRNSTDSRVLEFINVSQIRKR"
FT   CDS             complement(53012..53782)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00810"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05309"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGD0"
FT                   /protein_id="CBL05309.1"
FT                   /translation="MIIRFFEKIGRFVIGHLETLGQFTILIGNTIAQLRYPPRMRHVFQ
FT                   QMSHLGVDTLPIITLTMLFTGMVITLQTATEFIRLGAQSTVGGIVTIAVGRELGPVLAG
FT                   VVTAGRVGAAITAEISTMKVTEQIDALKVMATNPIGYLVVPRLIACMFMLPILVVFGDV
FT                   IGSIGGWMVAEYYDINIYMYLHSIDTFVDVHDITGGLLKSIVFGAIIAIVGCYYGLNAQ
FT                   NGAEGVGKATTRSVVISIIVIFFSNCLLSMLLYR"
FT   CDS             complement(54139..55986)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00830"
FT                   /product="SpoIVB peptidase S55."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05310"
FT                   /db_xref="InterPro:IPR008763"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGD1"
FT                   /protein_id="CBL05310.1"
FT                   /translation="MLLLYTNSALAMPPIMTTSELKPGMQGYAETVVQGAQQVSFNVEI
FT                   IGVVNNGKGSSKQILARAYGPIIDETNGVIHGMSGSPVYVDGKLIGAVARAVGQDVLPY
FT                   KFYITPIEEMLKIWTLPDSLAVINKSNIEKVKIPSLGEYEKNQDNYDENIDKEVEKYKS
FT                   KHLATPEGQEAVKGKAQKRLEEILSGLDIETQEDKTDVDADIVQTDKIIKDLEDNSKTD
FT                   VNADKLEEHISLTDFILKSLEKQNKAQASSFNNTSMMPIYVSGFNDNALNFLANNLKYK
FT                   NMTPYNTGEFISAPMGNKDSDIKQNATLKAGDPVGVVMAYGDFSAGGTGTVTAVEGNKI
FT                   LGFGHAMTYKGNVNYFMTEADIIGSAGGILNGVKVSSFGKIIGRVNQDRFSGVGGILNE
FT                   YPSSIPVRVKVKDRNLGKEETFVSKIAYDEDILPTLASSIVYASMDRTADRASYGTSKI
FT                   KFTIMTDEVPEGKFERENMFYDPKDVGQFTVGELTQALYFLCTNMDKPSNILDVKVDVD
FT                   FTSSRKTASIVSAIPDREEAKPGELVNFNVTLKPYRRENVTVTIPYTIPKTQKEGQMFL
FT                   EVKGGGFVQLGQVLQSGLVVTPQDIAQLSTVDRLNEIKI"
FT   CDS             complement(56045..56386)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00840"
FT                   /product="Biotin-requiring enzyme."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05311"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGD2"
FT                   /protein_id="CBL05311.1"
FT                   /translation="MGKIKDLLKEVIEMKRKYLILSTIIALILLTTVGLAMGNKQVEQK
FT                   AVIAGTVSSTVAEGTTVKMGDSLVEISTLTGTSAAARATVNGVVKQVLVKVGDNITPNQ
FT                   VVVYVEQLE"
FT   CDS             complement(56451..57887)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00850"
FT                   /product="Exopolysaccharide biosynthesis protein related to
FT                   N-acetylglucosamine-1-phosphodiester
FT                   alpha-N-acetylglucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05312"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGD3"
FT                   /protein_id="CBL05312.1"
FT                   /translation="MNLKIFIFMMVGICLFQLPVANAKNNSAKNIQTKITTEKIEKSMI
FT                   NSIRFSKASDKVRVVFDINADTKYDVKQQPNGDIMVDFSEPINKQYLSGINVNDDTVPF
FT                   LEVYSDDKTSCVVIKVTDNSAFDMGELNNPRRLYIDVQKDYEYSITKELEPGLTQISYY
FT                   SKKSGVKQHAQLVEVSPKYFKFVPVLGGGDKMAKNTVCAMSDYVNAAVAENASYFGSGK
FT                   ELYGVTKIAGDLVSSMYLTRTGFGVLADGTPYIGDVSYSGIVQSKNGDVYVSGLNGTRT
FT                   SDSVMLYNQYYGKSTGTDNSGIEYVVKDNKIVKINSGNSLLRPGEIVVSATGNGKNILS
FT                   GLNVGDDLVVNQILNTPWDSATDILGAGPRLVKNGQVDITSSIEQIGPDVTGARAPRTA
FT                   VGILKNGNVLFAVLDGRQAHSKGMMLDEFARFLIGMEVVDAVNFDGGGSSELVIGGKIV
FT                   NSPSDGMERPVATALTAVRR"
FT   CDS             complement(57969..59006)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00860"
FT                   /product="rod shape-determining protein MreB"
FT                   /function="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05313"
FT                   /db_xref="GOA:D4KGD4"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGD4"
FT                   /protein_id="CBL05313.1"
FT                   /translation="MFGMSMDIGIDLGTANVLIYIKGKGIVMREPSVVAIDNDTNRILA
FT                   IGEDARRMIGRTPGNIVAIRPLRDGVIANYDITEQMIRYFIGKVSGRRFMFRPRVMICV
FT                   PSRITTVEKRAVQEAAMQAGASHAELIEEPMAAAMGAGLDVAEPNGCMVVDIGGGTTDV
FT                   AVISLGGVVVSDSLRMAGDKFDDCIITYIKNKHNVMIGERTAEIIKIEVGQAFAGARDE
FT                   KIEIRGRDLITGLPKTIEVKSDEVSEALAEPVSSIVQCVKRVLEDTPPELSSDIMDRGI
FT                   IMTGGGAMLYGLDSLIQKETGITTYLADDPLTCVAIGTGKALEYMDKITRISKKSNGHE
FT                   RKIEE"
FT   CDS             59335..60285
FT                   /transl_table=11
FT                   /locus_tag="MHY_00870"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05314"
FT                   /db_xref="GOA:D4KGD5"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGD5"
FT                   /protein_id="CBL05314.1"
FT                   /translation="MFKGKVVIVGASNVGSAVLTKLLDFQLASEIALIDLNENKCKGEA
FT                   LDANDATSCIHSLNIRTYHGDYSDCKDADLIIITAGPSIKPGEKADRLILSKTNCKIMS
FT                   SVMSEITKYTKDALILMITNPLDVATYHVSTQFDYPREKIIGTGTMLETFRLRRIIADR
FT                   YHIDPKNIHGYVLGEHGNSAFTAWSTVNVAGLGLEHVDEYFHFNDKLDKKAIEQALVNR
FT                   AYDIINLKGYTNTGIAMVAARFTKSFMYNEHTILPMSAVLEGEYGLSDVALSIPRMICA
FT                   DGIVRSFAPHLPKEELDLLYASAESVKKAIASAKE"
FT   gap             60368..60595
FT                   /estimated_length=228
FT   CDS             complement(63022..63777)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00900"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /EC_number="3.5.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05315"
FT                   /db_xref="GOA:D4KGD6"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGD6"
FT                   /protein_id="CBL05315.1"
FT                   /translation="MRIIVTDSYEEMSKVAARIVAGQLYLKPNSVLGLATGSTPEGMYA
FT                   NLVKVHQSVGLDFSEVISFNLDEYIGLDKENEQSYYYFMHKHLFDHVNIKPENIHIPNG
FT                   NPENLEEECKKYDKLIEAKGGIDLQVLGIGQNAHIGFNEPDIKFEATTHKVKLDEETIK
FT                   ANSRFFENEEDVPKYAISMGIKTIMLAKKIILLASGKNKAEAIYKAVYGSVRPDAPASI
FT                   LQLHQDVVVIVDKDAASLLPEKDKKVFVK"
FT   CDS             complement(63968..64672)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00920"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05316"
FT                   /db_xref="GOA:D4KGD7"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGD7"
FT                   /protein_id="CBL05316.1"
FT                   /translation="MKILHQLDRPNFKASKSDKILIRYIKEHAEEFCTTPIASLAINCG
FT                   VSEATITRFVRKMGFASLQLFKLTLTEEMVNNKQRTIISKDITCDESIIITANKLLANN
FT                   IATLEQTVSGLDEDILLKSVNMLKKAERIFFIGLGNSGFVADDSAYKFMRIGFNARGID
FT                   NSHLIMLHMALLHENDVVVVISHSGESFEIIKAVELAKRNGTKLIVITSNRDTILKEYA
FT                   DACIFMKQENLY"
FT   CDS             complement(64688..65371)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00930"
FT                   /product="Transcriptional regulator/sugar kinase"
FT                   /EC_number="2.7.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05317"
FT                   /db_xref="GOA:D4KGD8"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGD8"
FT                   /protein_id="CBL05317.1"
FT                   /translation="MVDPKEGCIFYALPDAIPDYTGVQLKKIVETEFNLNCAVENDVNC
FT                   AALGEMWLGAGKGCSSLFCITVGTSAGGCAVYNHQVIHGVCNSAGEIAYMRIPKGTMHE
FT                   VVSTTRLVKDVAKAKQLDEKELNGKIIFDWAKNGDEDAKFAINTLMKNLADGITNITAV
FT                   LNPEMIILGGGIMAQSEYLRPLINNALKQRLVEDVYTHTKVDFAKLENDAGMLGALYNL
FT                   LHQTM"
FT   CDS             complement(65436..65582)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05318"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGD9"
FT                   /protein_id="CBL05318.1"
FT                   /translation="MEKQKYICIDIGGTAIKYGLADEQGNFIEKSSMPTEAKLYGGPGI
FT                   VEK"
FT   CDS             complement(65619..66758)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00950"
FT                   /product="cyclically-permuted mutatrotase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05319"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR019937"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGE0"
FT                   /protein_id="CBL05319.1"
FT                   /translation="MKKLLASLIVSATVAATLPLTSAFAAPETVGQPQILWQSVGTLSP
FT                   AQGQTENIGVAGMLSGNYNGYIIAGGGANFPNGGPAVGGPKKTYSDVYVFKASKEGLTE
FT                   VDHQQMPFEIAYGMSVTTKDGVYYIGGSTDAVGAKTITRLTTDAKGKLKIEKVGELPFK
FT                   IQNGVAGYANGALYIGLGNQDGKASADFYKFDLKSKELTKLASFTGALREQSVSQILNN
FT                   KLYVFGGGTNTALTDGYVYDIQKDAWDKVASVEVDNKAISVYGGNSIKLNEDEMLVIGG
FT                   FNKEVYDWAVSNLGSLKDQELADFKAKYFGADVAEFKWNNQILVYNAKTNTWRSIGQIP
FT                   FNAPCGEGLVYAGDSIISINGEVKPGVRSNRIYQGFIVK"
FT   CDS             complement(67338..68843)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00970"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05320"
FT                   /db_xref="GOA:D4KGE1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGE1"
FT                   /protein_id="CBL05320.1"
FT                   /translation="MQGFTWIDTAVLVIYLLGVLFAGLWFSNKEHQGKEFFKGDGTIPW
FT                   WVTCVSIFATLLSPISFLSLPGNSYGGSWILWWAQIGMLIAIPLTIKYFLPIYSTLQID
FT                   TAYHYLEKRFGSKGLRILGALMFIVFQTGRMSIIMYLPCIALAELTGINVNILIIVMGI
FT                   IAIIYSYSGGLKAVLWTDFIQGVVLIVGIALTLVVMIASINGGFGTVMDTLTTGHKFLL
FT                   ENEVWFSSDILSTSVFVILVGGGLTTFSSYVSSQDIVQRFTTTTDIKQLNKMTLGNGVL
FT                   SIFAATVFYLVGTSLYVFYTQNPDLLMTTRQDLVFATYITYELPAGITGILLAAIFAAS
FT                   QSTLSTGINSVATSWVLDIQSVINPEMSSERQTKIAQYISLGIGILAIIVAIFLASGDI
FT                   KSAYEWFNSFIGLALGALVGMFVLGAFSKHANAKGAVAAFIVSSIIVIYLKYFVPSVSY
FT                   WTYTIITIISSLVVGNIVSYLTDKSFVAPKGTTVYTSKAPSSK"
FT   CDS             complement(68964..69014)
FT                   /transl_table=11
FT                   /locus_tag="MHY_00980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_00980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05321"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGE2"
FT                   /protein_id="CBL05321.1"
FT                   /translation="MRARAKEIYKNIFDFN"
FT   CDS             complement(69618..69851)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01010"
FT                   /product="Dihydrodipicolinate synthase/N-acetylneuraminate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05322"
FT                   /db_xref="GOA:D4KGE3"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGE3"
FT                   /protein_id="CBL05322.1"
FT                   /translation="MSTRDLKGLYSALLVAFDENGNINEKGLRQIVRHNIDVCKMDGLY
FT                   VGGSTGENFMLSTEEKNVFLKLLKMKQKMISL"
FT   CDS             complement(70650..70751)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05323"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGE4"
FT                   /protein_id="CBL05323.1"
FT                   /translation="MLILKVFLALDLFLIIFIMLNKIAIYKIFLKIF"
FT   CDS             complement(72308..73174)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01050"
FT                   /product="EamA-like transporter family."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05324"
FT                   /db_xref="GOA:D4KGE5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGE5"
FT                   /protein_id="CBL05324.1"
FT                   /translation="MPNRVLGGIFLTIAASIWGGMFVAVKLVVDIIPPIPLVWFRYLVA
FT                   FVVLSMVVIYEGINLKIDKKDILLLISIGIIGHTISIVTQEYGTMYSSAQMGSVVTSAT
FT                   PAFMLIFAVWLLKEKITLRKILSVILATVGVIMIAGVDNMDFDKQLGVLFSTIAALTWA
FT                   LMSVMLKLIPSKYPPLLINFYAVITGIVCLAPLNIPTLDLLPWDEILNPVAIGSVVYLG
FT                   AVSTAGAFLLWNKGLLLMEAGASGLFFFFQPIVGTFLGWLILDEQITLNFWIGSILIFY
FT                   RCIFSYS"
FT   CDS             complement(73369..74265)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01070"
FT                   /product="Predicted glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05325"
FT                   /db_xref="GOA:D4KGE6"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGE6"
FT                   /protein_id="CBL05325.1"
FT                   /translation="MTLGIYMMMISICLAGQSDNLSKETSEKINLVWQPVIDEENDLSK
FT                   IDKIPGVNVVSPSWFVIDSEQGHIQNKIDINYLKNVREKGYKIWPLIHNDFNAEMTHKW
FT                   LNDKKAKDYIIRQLIFYAHRYNIEGYNFDLENIYDEDRDKLTEFMKEVTEALHQDKVII
FT                   SMDITVASDMENWSKCYDRKALGEYVDYLVLMAYDEHGRLSKTAGSVASLNWVENGVKD
FT                   LTEQVPSEKIILGIPLYMRLWEEDYEGNISAKTLNMEDANKLMKEKDKYPIWLKMKVRY
FT                   ILLIMKMEKYIVYGKKM"
FT   CDS             complement(75203..75865)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01090"
FT                   /product="L-serine ammonia-lyase"
FT                   /function="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05326"
FT                   /db_xref="GOA:D4KGE7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGE7"
FT                   /protein_id="CBL05326.1"
FT                   /translation="MRSAFDIIGPIMIGPSSSHTAGAVRLGLMARAILGEEVKIINIKL
FT                   YGSFAQTYKGHGTDRALIAGIMGFKPDDERIRNSLEIAKEKNIEFNFSKVDLEDAHPNT
FT                   AIIELIGVTDRKIEVTGASIGGGNIIISAVNNYEVQLSGKYPSIIIVHQDMPGVVNGVT
FT                   AALARYNINIAYMKVSRSERGAEALMNIEVDDTISDEAVKACSRVIGVKKVLRIDAI"
FT   CDS             complement(75942..76376)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05327"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGE8"
FT                   /protein_id="CBL05327.1"
FT                   /translation="MNKDLMKVIKSEEEIEQEVESLCRWAAARAGVIVVAPVLGQIALA
FT                   ANEIYLIKRIANVYDKNFDETASCAFVGALGGTFVGQSLATLIPFPPLQIPIGMAVTYA
FT                   VGKAANAWIKDDMPDISEYADKYKNIFNKAKEDVKISYLV"
FT   CDS             complement(76548..77108)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01110"
FT                   /product="channel protein, hemolysin III family"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05328"
FT                   /db_xref="GOA:D4KGE9"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGE9"
FT                   /protein_id="CBL05328.1"
FT                   /translation="MLYYGYDKGILHLTSIIVYGVSMILLYLASTLYHSFSFCSQKVQS
FT                   VFKCIDHSAIYLLIAGNYTPFALIALYGTLGWAVFGVVWGLALAGIVFQIFFYNRFRVI
FT                   GTICYLVMGWLAVTIVNPLLDTLSVEAIWWLVAGGVLYSIGAIFYLIRKIPYNHVIWHV
FT                   FVILGSAAHFITIYCYVLPLSID"
FT   gap             77367..78177
FT                   /estimated_length=811
FT   CDS             complement(78261..79241)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05329"
FT                   /db_xref="GOA:D4KGF0"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGF0"
FT                   /protein_id="CBL05329.1"
FT                   /translation="MQFMTVPSLANAQAMEIKSNLAIDLEDIKDTAEYKGYLWRIDAKD
FT                   EDNLPRNFRTSKDKFKKASDKYGIDVNYVPTREGLDELQASGSAQFSLNQFSALTKALQ
FT                   ENGAKDIYIVDLRQENHGFFNNDAVSWYGKRDWANIGKSRKEIIRQEMNLLKANLNKNT
FT                   KRATLNDDKNADEVDTSLIKTVTTEKNLVKKSNLHYVRIAATDHVWPSPENIDEFIKLY
FT                   KSLPKDAWLHFHCEAGKGRTTTFLAMYDMMKNPQVPLKDILYRQLLLGGNYVAYTEDIS
FT                   ASSNWKAPYYNQKAKMIEVFYQYVQENHQNNFQVLWSDWLKNHSL"
FT   CDS             complement(79909..80052)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05330"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGF1"
FT                   /protein_id="CBL05330.1"
FT                   /translation="MANRIKYINELDCLIRDVELVGAQLQETLDEVINNLVEKNEILAK
FT                   KS"
FT   CDS             complement(80853..81728)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01160"
FT                   /product="phosphate ABC transporter membrane protein 2,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter membrane protein 2,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05331"
FT                   /db_xref="GOA:D4KGF2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGF2"
FT                   /protein_id="CBL05331.1"
FT                   /translation="MTVIQRAKFMDKFMTGLFYVVAGFFLLLLLAFTLYVIIKGFANFT
FT                   PNMFSFTRNGIGNLFFNTIYLVFLSLLVSVPLGIAAGIYMAEYAKPGKTTKFLRICIET
FT                   LSSLPSIVVGLFGYLVFIVMTGSQWNLFAGALAVSILSLPLITTVTEDAFRSLPPGYKK
FT                   GSMGMGATLWQTIRYVMLPACMPRIMTGVILAAGRGFGEAAALLYTAGMSTDIVWSNWN
FT                   IFSPTCPLNPFRPGETLALNIWASRTEALAPNAADIANLSSAILMIMVFSFSIGARFLS
FT                   SYLDKKNGGK"
FT   CDS             complement(81725..82630)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01170"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter membrane protein 1,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05332"
FT                   /db_xref="GOA:D4KGF3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGF3"
FT                   /protein_id="CBL05332.1"
FT                   /translation="MESSHTAVYRQNNIWRGIITACGLLMIIITLAIGAFLCYKGVGTF
FT                   TTYGHSVGEFLFSSQWAPADNAQGGGKVGAAIFIFGSIITCALALLISTPFSIASAIFM
FT                   TEISPGIGRKILQPAVEIFVGIPSVVYGWIGLTILVPFIKDLFDLKFGFSVLAAGIVLA
FT                   VMIYPTITSLSADAIRSIPKSFRQASYGLGATRWQTISQVVIPASKSGLMTAIVLGLAR
FT                   AFGEALAVAMVIGKMKAFPESLLSPTTNLTAAIASDMGGAMEGSEYNIALWSMALLLFI
FT                   ISLVFIFIIHYISAKGGHKA"
FT   CDS             complement(82713..83597)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01180"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family (TC 3.A.1.7.1)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05333"
FT                   /db_xref="GOA:D4KGF4"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGF4"
FT                   /protein_id="CBL05333.1"
FT                   /translation="MNWKKLASLGVVAMMSLSILGCGSDTASNDKAASSSSLSGSITGS
FT                   GSSALLPLAKDAADKFKELHPEVSITLNGGGSGTGLKQVADGSVDIGNSDVAADTKLDK
FT                   AVADGLVDHKVCVVTMAPVVNKDIAATVKSLTKQQLTDIFTAKITNWKEVGGPDEEIVL
FT                   ITRPSTSGTRALFKEFALGGAEEASNKSLETDDSGTLLQSIKDNKGAIGYVALSYLVNN
FT                   QDVATVSVDGVAPTLENTYNGTYPVWGYEHMYTKGEPNATVKAYLDFIMSDEYGKSMEA
FT                   QGYGVTSKMQVQR"
FT   CDS             83893..84300
FT                   /transl_table=11
FT                   /locus_tag="MHY_01190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05334"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGF5"
FT                   /protein_id="CBL05334.1"
FT                   /translation="MRCTKCNHELDEHGICPNCYHIHDVQTMSNREINNFDGITIEDEN
FT                   NYRKETTQENQQQYQQSYNNRYYRSPRSSGIKVRYINLGGKSSSSWLTRGLMAIGGIAI
FT                   IGFFFFVALPALLTLLGVGVVAWLIFHFFKR"
FT   CDS             complement(84618..84833)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05335"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGF6"
FT                   /protein_id="CBL05335.1"
FT                   /translation="MIIGNDFEAIMYIRNYQKSDLKSIIFLFRETVHSVNSKDYTQEQV
FT                   KYGYLKILMKKLAFEFIKPLHIGGYR"
FT   CDS             complement(85947..86390)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05336"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGF7"
FT                   /protein_id="CBL05336.1"
FT                   /translation="MMIFNFMPYLYLFCLYNQYENAIGGLFKPFSVIIFMGLIINFLHG
FT                   KLKKCLKYFILSISMILSLMELFIISKYYTFTTAGIISVIIGTNLHETIEFITMYFSWS
FT                   YLIFIFVLVLIIYLLNYISRKVKLNNKLVILFYLIFVYIVYFM"
FT   CDS             complement(86629..87957)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01240"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /function="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05337"
FT                   /db_xref="GOA:D4KGF8"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGF8"
FT                   /protein_id="CBL05337.1"
FT                   /translation="MLNLEKSSQAFAQAKEVMPGGVNSPVRSFARVKCDPPFIAKASGS
FT                   KIYDIDGNEYIDYVGSWGPMIVGHAHPNVVKAIQEATTRGTSYGAPTLLETQLAKKVIE
FT                   LMPSIEKIRMVNSGTEATMSALRVARGYTGRDKIVKFIGCYHGHADSLLVKAGSGAATF
FT                   GQPDSPGVTKGTAKDTITVPYNDIEAFVNLMNEQGDEIAAVIVEPVAGNMGLVLPKQGF
FT                   LSTLRKETEKHGTVLIFDEVMCGFRVALNGAQAAYGIRPDLTCLGKIIGGGLPVAAYGG
FT                   KREIMDCVSPKGPVYQAGTLSGNPLAMTAGIATLDIISADPAWGKADYTRELSIKTKHV
FT                   LQGFAKAAKDAGVKVQLHQAGSMFGVFFNENDVYDYATSESSDQEAFGVWFMSMLEQGI
FT                   YLAPSQFETLFMSGAHSDDDIVKTIDAAEVAMKKVAEFLNNKQ"
FT   CDS             complement(88760..88963)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05338"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGF9"
FT                   /protein_id="CBL05338.1"
FT                   /translation="MIDESENTISFYGTLKQYEQIKNFLQEQDKPQKQVSLEAKVTAIQ
FT                   KDAAKDLGVSWEWSKTSPITRA"
FT   CDS             complement(89639..89761)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05339"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGG0"
FT                   /protein_id="CBL05339.1"
FT                   /translation="MTTEEKQKDKVNTNNENIEIKTQQQQISTINKNEKKVKNQ"
FT   CDS             complement(89918..90061)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05340"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGG1"
FT                   /protein_id="CBL05340.1"
FT                   /translation="MVKYKEFIREKLQKLNNLPKKWQQIIICILVIIVAIIYCFSGEEK
FT                   QK"
FT   CDS             complement(90138..90920)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01310"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05341"
FT                   /db_xref="GOA:D4KGG2"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGG2"
FT                   /protein_id="CBL05341.1"
FT                   /translation="MAIDHNWPQFSVPDGVGGRFTVFTDVGLTTAACIGFDIDEFLRGA
FT                   RDMDEACKSDNVWENPAMLNAALKYIASEKYGRHIEVMMPYGDYLESLSMWYIQLLAES
FT                   LGKQFDKEGNEVCYGRTPVVALGTRDMHSQTQQHQEGMLDKVVQFIRVEKWENDLVIPN
FT                   VFPEVKKLADISGVTMGDALEVARQSNADALASNKRFNALFSLPEMNAYHLGELLYMLA
FT                   MSVAYEGEFANVDAFDQPGVEAYKRIMGPKLQELKAKQ"
FT   CDS             complement(90974..91591)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01320"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05342"
FT                   /db_xref="GOA:D4KGG3"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGG3"
FT                   /protein_id="CBL05342.1"
FT                   /translation="MSIKLKSGFTFDYDNLFGEGKVTKADIEAFGEKLKEAHKAMNVMR
FT                   ETGVIKGHLSKDGEPEKVLFSQCPYIQEGPLNSPESMKRLQDLRESVRNRVDAVVSLGI
FT                   GGSYLGNKVLFDIQCGEFWNSKSTEERNGYPKFYFSGNNIDPRRTKDLIDNLEDCAEIT
FT                   KTHYKRNYKVMLIVISKSGGTLDTMSNFMVVYDALKKIHRLK"
FT   CDS             complement(91769..93103)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01330"
FT                   /product="phosphomannomutase"
FT                   /function="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05343"
FT                   /db_xref="GOA:D4KGG4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGG4"
FT                   /protein_id="CBL05343.1"
FT                   /translation="MELKSSAFKAYDIRGKFPEEVNEELAYRIGRVFPTLFNAKRVAVG
FT                   HDIRLSGPDIQKALELGLTEMGCEVVDIGQCGTEMIYFATAHLGLDGGIMITASHNPKE
FT                   YNGLKLVRKEARPISGDTGLKDIEAKVMAGELGTPAEVPAKVIEVDIMKDYIDHLLTYV
FT                   DMSALKPLKIVVNSGNGAAGPAIDELEKRLPFNFIKVNNNPDGTFPNGVPNPLLMENRE
FT                   ATAKVVREEKADLGVAFDGDFDRCFIFDENGDMIEGYYIVGFLAKAFLNKNPGAKIIYD
FT                   PRLTWNTIELVEEAGGVPVMCKSGHAFIKDCMRKEDAVYGGEMSAHNYFKDFSFCDSGM
FT                   ITWLLVAELLCQAEGKMSEMLKERMERYPISGEINSTVADAKAVMAAIEEKYGSTGEVC
FT                   KMDGFSVDYPEWRFNVRISNTEPVVRLNVETRGDKKLLEEKQQKF"
FT   CDS             complement(93226..94143)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01340"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05344"
FT                   /db_xref="GOA:D4KGG5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGG5"
FT                   /protein_id="CBL05344.1"
FT                   /translation="MFNMSSNLIRALGDSKTPLYFLILGCVLNIILEVVFIGVFNWGIQ
FT                   GAGFATVLAQLINGGCCVYYIKKKIPLLHFELKDLKISREIAIQHLKVALPMGFQASII
FT                   AIGAIILQVPLNNLGEVAVAAYAAAQKIDMIAVMPLMSFGMAMAAYTAQNYGAGRMDRI
FT                   KTGVNKCILMSGGFSILAGMINICLGPILIRLFVGDGQEQVVEYGHIYLIVNGSCYLIL
FT                   SLLFIYRYTLQGLGQSIIPTFAGIMELVMRAAAGLFLVDAFGYIGACWANPMAWIGSCV
FT                   PLMIAFYITRKSLLKKYYEHKLSV"
FT   CDS             complement(94136..94582)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01350"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05345"
FT                   /db_xref="GOA:D4KGG6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGG6"
FT                   /protein_id="CBL05345.1"
FT                   /translation="MVKDLTTGSPAKLILMFTLPLIVGNVFQQLYLLSDTLIVGRLLGV
FT                   SALAAVGCSGCLMFFMIGFVIGFTAGLSICTGQRFGAKDEEGMKKSAAACVVLSAITTV
FT                   IVTIFGVIMVRPALIFLQTPPEVLDMACTFLTVNFFRNCSYNDV"
FT   CDS             complement(94641..95225)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01360"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05346"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGG7"
FT                   /protein_id="CBL05346.1"
FT                   /translation="MLIGRLEDAYDPPKHLPNADVIIVLGGGATGDTPDVTGTGTLCSI
FT                   PANRLLTAVRLQKKLGIPIIVSGGQIYEDSGREADIARRILKELGVSEDMILLENRSLN
FT                   TTQNAEYSTNILKSRKYKQPLLVTSAFHMERAVVNFNKLGVDVIPYPCDYMVNKEKVFH
FT                   YNRLAPSSQALEFTAIYLQENLRTFVTKYIE"
FT   CDS             complement(95249..95398)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05347"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGG8"
FT                   /protein_id="CBL05347.1"
FT                   /translation="MIEFLKFGASWVLPPGIFFVLFLFIAYCCKKRKQTRLAIAITFVT
FT                   FIFI"
FT   CDS             complement(95899..96228)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01390"
FT                   /product="Predicted UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05348"
FT                   /db_xref="GOA:D4KGG9"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGG9"
FT                   /protein_id="CBL05348.1"
FT                   /translation="MREAPSIRLIEELKQRGAKVQAYDPQAMNMAKSFYLKDVEVEYIN
FT                   NKYDALNDVDALVIVTEWKEFQSPDFMEITARMKGNDIFDGRNIYKAKTVKSHGLNYYQ
FT                   IGVRK"
FT   CDS             complement(96252..97223)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01400"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05349"
FT                   /db_xref="GOA:D4KGH0"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGH0"
FT                   /protein_id="CBL05349.1"
FT                   /translation="MKVAMIGTGYVGLVTGTCFAATGNNVICVDVAEQKIENLKKGIIP
FT                   IYEPGLEQMVKSAQQRGNLKFTTDIKEALKESDICFIAVGTPMGEDGSADLQYVMNAAR
FT                   EIGQYMIHDMYIVDKSTVPVGTGDKVKAVIQEELDKRGSDLKFDVISNPEFLKEGNACQ
FT                   DFMHPDRVVIGSENAKSIEIMQELYEPFIRSSEFFVTMDIKSAELTKYAANAMLATKIS
FT                   FINEIANISERVGADINKVRRGIASDSRIGYSFLNPGCGYGGSCFPKDVKALIKTSKEH
FT                   DYEPELLSSVENVNSRQKMVLVHSITEVLGEDLSDKKLQSGD"
FT   CDS             97401..97655
FT                   /transl_table=11
FT                   /locus_tag="MHY_01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05350"
FT                   /db_xref="InterPro:IPR023806"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGH1"
FT                   /protein_id="CBL05350.1"
FT                   /translation="MKKFSYTTSGTCSKLINFSLDENNIIHDVEFIGGCNGNLQGISKL
FT                   IEGQSAQNVIDKCQGIHCGMRPTSCPDQLSRALSEAIQK"
FT   CDS             97678..97986
FT                   /transl_table=11
FT                   /locus_tag="MHY_01420"
FT                   /product="Histidinol phosphatase and related hydrolases of
FT                   the PHP family"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05351"
FT                   /db_xref="GOA:D4KGH2"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGH2"
FT                   /protein_id="CBL05351.1"
FT                   /translation="MLFDTHLHTKFSADSKMSIENAILSAKQQNIGLVLTEHLDYDFPG
FT                   DDIYEFNPQQYFQEYSSYQSKTLYLGVEVGMQEHTLIQSKNLSKVLLLTKLFAHCIY"
FT   CDS             98474..99208
FT                   /transl_table=11
FT                   /locus_tag="MHY_01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05352"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGH3"
FT                   /protein_id="CBL05352.1"
FT                   /translation="MSLKKAISTGLCISLLFTSGTPALAGSLNSTNTAQPPSYNYGVLD
FT                   STNLQSKLLLVEQSVYGQEQTGALLDRISRLETDFYGKTSSSKTALSDRINTLYSTMFD
FT                   NSVRPSAITQMNGIEWFLSRHVSIKSITDRLTTLETQIYGKPITGTLQKRMNDLAMLAY
FT                   GNSDTKTPLIATTIPVDTLVKIKLVTPLNTETSKVGDKVKFQASEDVIYNGQLIIAAGA
FT                   PGEGVVTKVKVLETSVAMVKLM"
FT   CDS             99294..99668
FT                   /transl_table=11
FT                   /locus_tag="MHY_01450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05353"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGH4"
FT                   /protein_id="CBL05353.1"
FT                   /translation="MAAGASIAGIALLGPIGIVGGIFVNGKDIDLPTGTESYIQTKTPT
FT                   NIYAIQTNLDDNFKVNTPPITEEESNSNSTDTSSNSDVNTSPSTTTENNSSSSSTDYNT
FT                   NTSSSNNDISAENNIYDYEY"
FT   CDS             100831..102255
FT                   /transl_table=11
FT                   /locus_tag="MHY_01470"
FT                   /product="fumarase"
FT                   /function="fumarase"
FT                   /EC_number="4.3.1.1"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05354"
FT                   /db_xref="GOA:D4KGH5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGH5"
FT                   /protein_id="CBL05354.1"
FT                   /translation="MRIEHDFLGELEVPDNAYYGVQSLRGSHNFNITGQKLDSDFIIAL
FT                   AMVKKAAAMANLKTARLDSKIAKALIAAADEIIDGKLHDNFIVDPIQGGAGTSINMNMN
FT                   EVLCNRALEIIGEKKGRYDIISPNNHANMAQSTNDAFPTAIKLCIILKSRKLKIALKRL
FT                   SWELEHKAQEFKDVLKMGRTHLQDAVPITLGQEMSAYASGVNRGLRRIEHALINLHYIN
FT                   MGGTAIGTGLNAEPNYIPEVAKILSVLAEEDFHVAENLIDATNNTDGFADMSSALKNTA
FT                   LMLIKMANDFRLMASGPRCGLNELKLPARQPGSSIMPGKVNPVIAEVLNQTCYQIIGND
FT                   TAICLAVENGQFELNVMEPVIAFNIFNSLKYMTNAVNTFVDNLLIDLEANKEQCYTWLN
FT                   HSVGTITALLPHIGYENASMIAKEAYQTNKPVREIILSKNLLTEEELDIILSPSEMTRP
FT                   GIAGDKLLKENLQKRA"
FT   CDS             complement(102299..102766)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05355"
FT                   /db_xref="GOA:D4KGH6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGH6"
FT                   /protein_id="CBL05355.1"
FT                   /translation="MLPTLDDEKRAEVCQACYDYEDAYLEKHSGVFYDGVIDTLNELAK
FT                   DYNLYVVSNCQVGYIETTLRYANMTDKVKDHLCYGDTGLHKGETIKLLMKKNNIDEAIY
FT                   VGDTQGDFEACEIANIPMIFASYGFGKVENPAYTINDIKELPSLMAKINTK"
FT   CDS             complement(102751..102933)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05356"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGH7"
FT                   /protein_id="CBL05356.1"
FT                   /translation="MKNIIFDIDGTLWDSTDVVAESWNEAIWEKAGIKANLDGDKLKNY
FT                   SVKLWMKLADLCCLL"
FT   CDS             103755..104477
FT                   /transl_table=11
FT                   /locus_tag="MHY_01510"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05357"
FT                   /db_xref="GOA:D4KGH8"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGH8"
FT                   /protein_id="CBL05357.1"
FT                   /translation="MSGPCAVESKEQLLEAAKAVKACGAQFLRGGAFKPRTSPYDFQGL
FT                   AEEGLKMLREVADEVGLNVVTEIVNINDLDMICKYADMLQIGARNMQNFQLLKEVGHTN
FT                   KPVLLKRGLSATISEWLNAAEYIASGGNYNIVLCERGIRTYETFTRNTLDLSAVAAVKE
FT                   LSHLPIIVDPSHGTGRWQMVRPMARAAIAAGADGLMIEVHPHPEVALSDGDQSLKPDNF
FT                   AVVMQEVRQIAQMMGKTL"
FT   CDS             104642..105379
FT                   /transl_table=11
FT                   /locus_tag="MHY_01520"
FT                   /product="Prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05358"
FT                   /db_xref="GOA:D4KGH9"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGH9"
FT                   /protein_id="CBL05358.1"
FT                   /translation="MKVFLDPIECVQGADIIYLSTPVLQIVPLVKKILPHLKPGAILTD
FT                   AGSTKSFIAKQIMDLLPENIYYVAGHPMTGREKSGVTAAHKDLFNNKCYVIVKDTGAPA
FT                   KVVEKIVNLIKLTNANITTLTLEEHDRCASIISHIPHITAAALVNLLDKNPNDLESCIT
FT                   LAGGGFKDTTRIASSNADMWADICISNSEPIIEHLSQLQSLLSGVITSIAKKDRQAIHD
FT                   YFVESKTRRDMILEETKDKYDLI"
FT   CDS             105387..105587
FT                   /transl_table=11
FT                   /locus_tag="MHY_01530"
FT                   /product="EamA-like transporter family."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05359"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGI0"
FT                   /protein_id="CBL05359.1"
FT                   /translation="MQHKAYSFLIIACLLWGFQPVTIKIVTQEMNILTIIPLRFLIVSI
FT                   ILFIIMKITNEKIFYHQKNVY"
FT   CDS             105599..106108
FT                   /transl_table=11
FT                   /locus_tag="MHY_01540"
FT                   /product="EamA-like transporter family."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05360"
FT                   /db_xref="GOA:D4KGI1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGI1"
FT                   /protein_id="CBL05360.1"
FT                   /translation="MGFFGITVSNGIQFTGLQYSSVGNMTLISTTAPVITVILARIFLN
FT                   ERLNLIQIIGIIISFFGTLYLLSGGTLSTFTQMNFNKGDIYFFIGEVAWVIYILLSIPI
FT                   LKKISVLSATAWSGLFGSILTALFAHYSVGLQIVPLSTLGIYSFLFIILGGGITAMICW
FT                   NLGTKK"
FT   CDS             complement(106098..106196)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05361"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGI2"
FT                   /protein_id="CBL05361.1"
FT                   /translation="MVIGSFNVKYAEIIPITGNRFKNIAELLAPTF"
FT   CDS             106195..106281
FT                   /transl_table=11
FT                   /locus_tag="MHY_01560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05362"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGI3"
FT                   /protein_id="CBL05362.1"
FT                   /translation="MQKIISGIFIIFGVYVTTHSHKFVKNAH"
FT   CDS             complement(106339..109398)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01570"
FT                   /product="Beta-galactosidase/beta-glucuronidase"
FT                   /EC_number="3.2.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05363"
FT                   /db_xref="GOA:D4KGI4"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013812"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGI4"
FT                   /protein_id="CBL05363.1"
FT                   /translation="MEEKIFDISKLADSTYFADNRLPAHSDHHYYANEEEMLNEEMSMR
FT                   QSLNGLWYFSYAKNLASRIEGFEKADYNCKIWDTIRVPAHIQMEGYGKPQYTNVAYPWD
FT                   GHEELNEGEIPTENNPIASYVKYFTVPQGWNEVFVSFQGVDSAMALWLNGKFVGYSEDS
FT                   CTPSEFDLTPYLVEGENKLAVQVYRFSSASWLEDQDFWRFSGIYRDVYLYTKPQVHVDD
FT                   LFIHATPCNDYKDGKLSIDFKWNNENAKKLAVKFVDNEENVVIDTVQEITGATSVFTAD
FT                   VENVKLWSAEYPNLYKATFTVKDENDNVVEIIPQNIGFREFKMDGNIMKINGKRIVFKG
FT                   VNRHEFDCYYGRAIPESKIAHDLEIMKLHNINAVRTSHYPNNSKLYELCDIYGLYVIDE
FT                   TNLESHGTWQIRGTVRCDQNTVPNDIPHWHDAVLDRAKSMLERDKNHASIIIWSCGNES
FT                   YGGKNIFDMSEYFRKADPSRLVHYESICWDRVNEASGKMVLAMPDERRYDGTSDMESQM
FT                   YTKVAQIKEFLSKYREKPFICCEYTHSMGNSNGGMHKYTDLTDEEPLYQGGFIWDFADQ
FT                   AIWTRDLYGNDVMNYGGDFGDRPCDYNFSGNGIVFADHAPTSKLQEVKFNYQNFTLVPS
FT                   ETGVKIINKSLFTNTSDYDLIIALAKNGKNVWQKKLTADINAGQTGEVAYTLPTFGAGE
FT                   YVVTASLVLKQATIWANCGHEVAFGQYVFTKEGKADKKAVAPIKVVKSDFNIGVKGEGF
FT                   SVMFSADRKMLTSYKYNGVELIEEFPKMNFWRAPIDNDNGCGMPFDTAQWKLASMYTKC
FT                   VDMQVSENGTESATVKYTYELATRPVAHVVVTYTVTGDGVVKVDMDYKKVEGLPAIPDF
FT                   GMLFTLPVDYDQIKYYGLGPCDNYIDRKEGGKLGIFTTTTQDEIQPYLVPQECGNHCDV
FT                   RWFEVTDRRGRGVRISSATPFEASALPYNPHEIENARHHYDLARPHHTVLRASAGMYGV
FT                   GGDDSWGAPTLDEYITKNEDKHFSFEFKGI"
FT   CDS             complement(109625..110056)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05364"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGI5"
FT                   /protein_id="CBL05364.1"
FT                   /translation="MNLVLNGNFENETLNGWDIVGDSSAINLAWNQGDVRDKCAMHYWN
FT                   NKPFNVIIKQKLKGLSDGKYTLSCWTQGNGLASKYQLFVKQNGVEMTTDIKDDGWNRWH
FT                   QTSIKNIEVKNGEVEIGFILNGRPDTWGSIDDIEFYVQK"
FT   CDS             complement(110757..111005)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01600"
FT                   /product="Glycosyl hydrolase family 53."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05365"
FT                   /db_xref="GOA:D4KGI6"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGI6"
FT                   /protein_id="CBL05365.1"
FT                   /translation="MQDFNAQGVTPDMVQVGNELNNGMLWPEAQLTEDNPNGYKFLAKL
FT                   LNAGLQAVHDNDKDNKVKTMIHLAGVDVNLYHTFLII"
FT   CDS             complement(111513..112895)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05366"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGI7"
FT                   /protein_id="CBL05366.1"
FT                   /translation="MINSTAFASENPFATVPKDYWAYTAVEHLVETGLVDGYNLTDFHD
FT                   KKVVARYDLAQFVARAMANENRATAEDKVILNKLQQEYSNELKIMMVMPAEPAPVKEEP
FT                   QATNNFFDNGKIKWFGDARIRYQTNYKADTPKGYTANVDDKDRKDKRSNRIQERLRLGF
FT                   YAEPDENLSVLGRVKLENTTNDDNGYTNNIDKEAHGSANLDLLALTWKQMDTSVTLGRQ
FT                   NLNIGQGLIWWDNPVDGIMVTQDLGNNSLISAGWGNLTAENWKDYSMNAFIANAQIGVD
FT                   DNTKFTLGYLKTNSNENTLWNNHKNQWNWIKSSENPYMLEQIAYGINTQLSDKWNLTAE
FT                   AVTNRASGLPDGAQKNGWWTRLTYGNLKWDTKDTWKVYADYMSLGNYSVDSTGWAHILN
FT                   TPGGDGLGGNGEKGYGLGISYMLADNTNLEFNWYKLRPYDSNYSGFSDYYDMYNLALNY
FT                   SF"
FT   CDS             complement(116369..116614)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01680"
FT                   /product="LacY proton/sugar symporter."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05367"
FT                   /db_xref="GOA:D4KGI8"
FT                   /db_xref="InterPro:IPR000576"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGI8"
FT                   /protein_id="CBL05367.1"
FT                   /translation="MQISIKNRNYFALSAVSFLHLFAWSAAMSFFAIWLGQHLGIGATK
FT                   TGLLYSANALAALCMQPVLGFISDKIGLKKHCYLLF"
FT   CDS             complement(117664..118584)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01700"
FT                   /product="protein translocase subunit secF"
FT                   /function="protein translocase subunit secF"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05368"
FT                   /db_xref="GOA:D4KGI9"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGI9"
FT                   /protein_id="CBL05368.1"
FT                   /translation="MARFDIIGKRKIWYAISSLLIIASLFFMVTRGFNMGIDFTGGTIM
FT                   DLRFEKAVNINDVRAVLNEYNLSNSTIQLSGESSSSTESENVMIRTVDLEEQERKEVMA
FT                   GLTDKLGAYQVLREEKVGATMGTELIMNAIYATIISWLLIIAYVSYRFEFKFGISAVLG
FT                   LAHNVIIVLGAFALTQRQIDSSFVAALLTIIGYSINDTIVIFDRIRENLKLHFRKNGDI
FT                   VELVNTSIYQTMTRSIYTVSTVLFATFALYFFGGDTTKDFAFALLIGFFCGAYTSIFIA
FT                   SPLWVTFRRYSDKKRLAKRMADTGK"
FT   CDS             complement(119852..120439)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01720"
FT                   /product="5,10-methenyltetrahydrofolate synthetase"
FT                   /EC_number="6.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05369"
FT                   /db_xref="GOA:D4KGJ0"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGJ0"
FT                   /protein_id="CBL05369.1"
FT                   /translation="MLTQLTNNKKVQRKELLAKRRALTLIQKNEYSAVITKKIVELEEY
FT                   KNSQICFLYASMPDEFQTKELIVNALKAGKQICLPYITDKNMKIMQATLIKSLDELVVG
FT                   AYNILTVKEENLRIVKPQDIDFILVPAVGLDKKGYRLGMGGGYYDRYLVKAINAKKIAA
FT                   VYDCQLVDEVIKDDYDFKVDMILTENTTIKYR"
FT   CDS             complement(120417..120614)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01730"
FT                   /product="Preprotein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05370"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGJ1"
FT                   /protein_id="CBL05370.1"
FT                   /translation="MMDNLKVGHRILTIGGIHGEITYIDLEKSDFIRIRIADNVEIKIS
FT                   SAAVARDLTQEKTNANPANK"
FT   CDS             complement(120830..121960)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01740"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /function="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05371"
FT                   /db_xref="GOA:D4KGJ2"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGJ2"
FT                   /protein_id="CBL05371.1"
FT                   /translation="MKPAITYELIKQCPHTGARAGRIHTPHGSFDTPIFMPVGTQASVK
FT                   TLAPEELKEMGAGIILSNNYHLFLRPGSKLVKEAGGLHKFMNWDRAILTDSGGFQVFSL
FT                   GDLRKISEEGVTFRSHIDGSKKFLSPEIATQSQMDLGADIIMAFDECVPYPADFKYTRE
FT                   SMELTLRWAQRCKDTMTNPNQGLFGIVQGGMYKDLRIECANRLVDMDFPGYAVGGLSVG
FT                   EPKELMYEMLDITLEHLPQNKARYLMGVGTPDCLVEGVMRGIDMFDCVYPTRVARNGTA
FT                   MTWNGRLVIKNAQYEHDFHPIDEHCNCYTCRNYSRAYIRHLVRVNEIFGLRLLTIHNLH
FT                   FLIDFMRQMRQSIMEDRFTEFYRKFTANFSFNAKSV"
FT   CDS             complement(122049..122159)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05372"
FT                   /db_xref="GOA:D4KGJ3"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGJ3"
FT                   /protein_id="CBL05372.1"
FT                   /translation="MLISAFAGREYVLSAYEEAVKEKYRFFSFGDAMFIE"
FT   CDS             complement(123095..124291)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01770"
FT                   /product="SpoIID/LytB domain"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05373"
FT                   /db_xref="GOA:D4KGJ4"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGJ4"
FT                   /protein_id="CBL05373.1"
FT                   /translation="MKKYLYLICLLCCCAFVSNMQVVSAQSSAPYVRVGLLQGVQEIVI
FT                   TANDDFVVKDVDNKVNYKFKKMNEVNIRQKDRTVYVNKKGKETTTLVVAVKDNAPVIVN
FT                   GKRYRGNLIIQPHKAGLTVINRLLIDEYLYGVVPEEMPASWNIEALKAQAVAARTFALY
FT                   DKLDRKHTKEGFDVCVTTDCQVYGGMDSEAATTNKAIDATKGEVIVYLNQPICSVFHAA
FT                   SGGQTDDSINVWNVNVPYLRAVEDKEEQSPYQSWAVSVTVDNLSKSIKNSYSDIGTIKE
FT                   IDFSGLKKNPNKASKSQVVKFIGSNKKSVELTKTQLRSLLGLKSSNFTIELEGNKKAKG
FT                   DTLKIDKDDKKLIFKGSGFGHRLGMSQWGAKSLADKGKKYQQILYHYYNDVNIKDMYK"
FT   CDS             complement(125140..125592)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01790"
FT                   /product="[SSU ribosomal protein S18P]-alanine
FT                   acetyltransferase"
FT                   /function="[SSU ribosomal protein S18P]-alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05374"
FT                   /db_xref="GOA:D4KGJ5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGJ5"
FT                   /protein_id="CBL05374.1"
FT                   /translation="MQINFRKMTPEDASAVEIVEKSCFDMPWSRQSFWQEASNDKAYYL
FT                   LALDGERVIGYVGVWILFDEAQITNVAITPEYQNKGIGRLMMKEIIKISQERKANAMTL
FT                   EVRPSNKGAIHLYESLGFKSVGRRRGYYEDGEDAEIMWITDLTNIK"
FT   CDS             complement(126296..126775)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01810"
FT                   /product="conserved hypothetical nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05375"
FT                   /db_xref="GOA:D4KGJ6"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGJ6"
FT                   /protein_id="CBL05375.1"
FT                   /translation="MFTITTNSPEQTSLLGEKIANLIQDNLIICLEGDLGAGKTLFTQS
FT                   LCKALKVKEIVTSPTFNLMNVYEGKKRIYHFDLYRLEQPEDLEEIGFYEYTDVEDEVVL
FT                   IEWPDRFFAYMPEDYLHLKIERGDSEQKRIITINLEGQKYKNIYEELKHCGNISD"
FT   CDS             complement(126806..127300)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01820"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /EC_number="5.4.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05376"
FT                   /db_xref="GOA:D4KGJ7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGJ7"
FT                   /protein_id="CBL05376.1"
FT                   /translation="MAYREAIERAGLPVIFDYDIYVEKCWGPTYRGFLPIMGVPENRFE
FT                   EIHDAKKLYYEENLKYAAENTHLFNIIKAMKNEYHTAVVTSGSSNSKDILRYFGRLELF
FT                   DVIFTIDDVKNGKPDPEGFLKAMEYFKVKPENTIIFEDSDVGLAAARKTGASICVVDDF
FT                   K"
FT   CDS             complement(127561..127995)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01840"
FT                   /product="Malate/lactate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05377"
FT                   /db_xref="GOA:D4KGJ8"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGJ8"
FT                   /protein_id="CBL05377.1"
FT                   /translation="MLGEHGNSAFPAWSTISIGGVRLADLDKYYDHNSDFDKKAMAQEV
FT                   VNTAYDVLLSKGWTNTGIAMGACRLARAVMFNERCVTPVSTPLEGEYGLTDVALSLPSI
FT                   IGANGVEKRLAIDLPEDELKALHFSAESIKTVLRANKLID"
FT   CDS             complement(128064..128531)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01850"
FT                   /product="Malate/lactate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05378"
FT                   /db_xref="GOA:D4KGJ9"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGJ9"
FT                   /protein_id="CBL05378.1"
FT                   /translation="MGVIKMKMSKLAIIGLGHVGSAVLTQAMAMNLAAEIVCIDINEKV
FT                   AHGEALDATHATPCTYVPGMKVYSGDFSQCKDADIIICSGGPSILPGEKLDRLILAERN
FT                   VKVIGEIMTEVTKYTKNTPFIMITNPLDVTTYLAATKFGYEKENYSVQGLL"
FT   CDS             complement(128623..128730)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05379"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGK0"
FT                   /protein_id="CBL05379.1"
FT                   /translation="MESTTDLSDSDTEKFDQSVRLVKKMMAKIFEKQKG"
FT   CDS             132858..133253
FT                   /transl_table=11
FT                   /locus_tag="MHY_01900"
FT                   /product="Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05380"
FT                   /db_xref="GOA:D4KGK1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGK1"
FT                   /protein_id="CBL05380.1"
FT                   /translation="MQAESQFRDEADTTRFIFIRGSNGQMVPLNTLIKPKLNSGPAIIS
FT                   RFNASRSVTIQGSPKPGYSSGQAMAAIEEVIKQEAPNGFNIDWSGQSREERAATSSTAQ
FT                   VMVLALVSYSYVLQLFTKAGVYHMLYY"
FT   CDS             133841..134407
FT                   /transl_table=11
FT                   /locus_tag="MHY_01920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05381"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGK2"
FT                   /protein_id="CBL05381.1"
FT                   /translation="MSIFALVATLSITNISFAADGYLYTSERFGYSIKCPEKPLAVINL
FT                   SILSPQEQGDVLIFETDGHNPTKYWVISPNAFSNDTFPDLDNLTDEARQDLFTRLAIER
FT                   GYEAISLVPIQGHNAIYAVTAKTIQIDTDKDGQVDKTIEQEGQHIETYFKGAKSNYCIV
FT                   LSSKSALTEDDINNYQYGLLSFNDK"
FT   CDS             135893..136516
FT                   /transl_table=11
FT                   /locus_tag="MHY_01940"
FT                   /product="Molecular chaperone, HSP90 family"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05382"
FT                   /db_xref="GOA:D4KGK3"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGK3"
FT                   /protein_id="CBL05382.1"
FT                   /translation="MPESQKKIYYATGKDRASIDSLPQMEILRDKGIDVLYFLDNVDEF
FT                   AIEVMREYEGKPFHSISRGDLDLDDVESQEVKKETETIAKSNEDLIKDIKETLGDKVAE
FT                   VKISSRLKSSAVCLVADEQGPSFAMEQAFADANNPMFKARRILEINPKHDLFARLQKVH
FT                   EQGKESTAFKDYCSLLYAQALLIEGMMPEDPAAIANKIAELMAK"
FT   gap             136732..137012
FT                   /estimated_length=281
FT   CDS             complement(137520..137873)
FT                   /transl_table=11
FT                   /locus_tag="MHY_01970"
FT                   /product="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05383"
FT                   /db_xref="GOA:D4KGK4"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGK4"
FT                   /protein_id="CBL05383.1"
FT                   /translation="MKAVFFDVDGTLIEGTHPDYRYMRENVQKAIRKLQEQGHYVFIAS
FT                   GRSLAFLDEKIRNFGFDGYVLLNGSVIFFHDKIIYRAPLEKSFVEKITSICDEHDMQYS
FT                   LQGDFHTYVDKKI"
FT   CDS             137973..138314
FT                   /transl_table=11
FT                   /locus_tag="MHY_01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05384"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGK5"
FT                   /protein_id="CBL05384.1"
FT                   /translation="MSKEKIISNLDNLIFACLALYSLTFFTATPINFLVTAFILGIIKI
FT                   VFYENKNFLEIHSKHLIFISLFILCTFITVCINTDASFSYYRSYYISPLVALLLPLLFS
FT                   FTYKKLLLY"
FT   CDS             138415..139179
FT                   /transl_table=11
FT                   /locus_tag="MHY_01990"
FT                   /product="Lipid A core-O-antigen ligase and related
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_01990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05385"
FT                   /db_xref="GOA:D4KGK6"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGK6"
FT                   /protein_id="CBL05385.1"
FT                   /translation="MLLCGMNLLILPILLTLSIHKNNLPKYMRIFFFITILVNIPAIVF
FT                   ENTRIVWISLSFVFPFIIFLSIKNKIKAFLLIIIMFFYSFCCFQFSPHSTQRLETISST
FT                   SSTVQPNYERILMWNSATNMFLDHPITGVGIGNYHKEYVSHYQSPLSKENQYHPHNVLL
FT                   SMLAQSGLIGTIGYLLLFIYLYYKSISNYIKDKNIIDLTFLSSLLAFSLNGLTDCNFVG
FT                   HNLKELTYMFYFITGMYLACKKYIIHTKIDSI"
FT   CDS             complement(139176..139889)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02000"
FT                   /product="Bacterial protein of unknown function
FT                   (HtrL_YibB)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05386"
FT                   /db_xref="InterPro:IPR011735"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGK7"
FT                   /protein_id="CBL05386.1"
FT                   /translation="MKRVMKNEILLDFHFPKERKRLNVWNVNYNYITYLKTYFINRAIE
FT                   DYNIEGLVAWWDFGLNHGGKLGILDPNDFDFEWKYNFSNKIHLFSINYYKVLEKDRPIF
FT                   DMVRAIDSYIWGGIVVAPVNLWKIFAGLVRESMLSLLRCGLCETEELCYLMAYYEKPEI
FT                   FHLHDINCYYDAIKCFGGEHLKVKNEKLINKYYQIYRYRARILWGYGYYKLALKYYMKY
FT                   IKIKLRVYKTLNFLI"
FT   CDS             complement(139937..140146)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02010"
FT                   /product="Bacterial protein of unknown function
FT                   (HtrL_YibB)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05387"
FT                   /db_xref="InterPro:IPR011735"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGK8"
FT                   /protein_id="CBL05387.1"
FT                   /translation="MIRDITIVTAYFDINRKNWKGFERSNNDYINYFKFWARIKNNLIV
FT                   YTSKEFVEDILNIRKNFGLEKIRK"
FT   CDS             complement(140263..141093)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02020"
FT                   /product="Bacterial protein of unknown function
FT                   (HtrL_YibB)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05388"
FT                   /db_xref="InterPro:IPR011735"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGK9"
FT                   /protein_id="CBL05388.1"
FT                   /translation="MSEITLVTAYFDIGRGLWKKQERDNNKYIEYFRFWARIKNRLIIY
FT                   TTREFRKELWEIRKDFGLEDRTKIIVIDDFRDFDKEMYNKIKKTMNHELAKTFYFKHDI
FT                   KRPEVWNWEYNYVVMLKFYCMLDVVKNKYAEGMLAWIDFGFNHGGNDGIINTSEFNFEW
FT                   KYNFTNKIHLFISKSIDDRPIFDIIKSLDVYIRGNIMIAPDFLWEKYFYLIKESMLSLL
FT                   RCGLCDDDQTIELMAYKENPEIFETHITSSWIEGLVKFSEQDFQLKNRKKKYKL"
FT   CDS             complement(142064..142258)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05389"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGL0"
FT                   /protein_id="CBL05389.1"
FT                   /translation="MQAQKLLYKEKQYIEGIKLFFKYLWLKLQKNSEGIKMINKETVSN
FT                   IIIDKKILGKIILIIMMNI"
FT   CDS             complement(142261..142938)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02060"
FT                   /product="Bacterial protein of unknown function
FT                   (HtrL_YibB)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05390"
FT                   /db_xref="InterPro:IPR011735"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGL1"
FT                   /protein_id="CBL05390.1"
FT                   /translation="MAETVKKIRSEYNLLDKTTVVVIEDVRKVDEYVYNLIKQAIEQKL
FT                   AVKYRRHPWMPEACNHLYNYVTYLKAHFTADAINRGLITTDTVAWIDFGFNHSGATYPI
FT                   SEEFNVVLTDEGLSDKIHIFAVDELDDVPIFEIVRNMHTYIAGAVTIAPKNLWQNLADL
FT                   YRQAAISLGQCGFADDDQTLAVMAYRANPEIFEVHYIDNMYGALDIFKNIKLTKIETKE
FT                   YKK"
FT   CDS             complement(142959..143084)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02070"
FT                   /product="Bacterial protein of unknown function
FT                   (HtrL_YibB)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05391"
FT                   /db_xref="InterPro:IPR011735"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGL2"
FT                   /protein_id="CBL05391.1"
FT                   /translation="MKEISIVTWFFDIGRKDWKGFERDNSTYANYFKFWARVKII"
FT   CDS             complement(143567..143701)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05392"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGL3"
FT                   /protein_id="CBL05392.1"
FT                   /translation="MYAKTLLNIDYDKNELYPLIGKCDNGKEEIIKNWVESTKKKQRI"
FT   CDS             complement(143883..144083)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05393"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGL4"
FT                   /protein_id="CBL05393.1"
FT                   /translation="MQKILIVNRLGIGDVVLTTPLAQIIKENLKNVKIGFLVASKSIDI
FT                   LRNHPYIDEIFAYKNKQEKNK"
FT   CDS             complement(144094..144624)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02110"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05394"
FT                   /db_xref="GOA:D4KGL5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGL5"
FT                   /protein_id="CBL05394.1"
FT                   /translation="MAIVARIKNLRNKGHQDLLEMMNKYTDARNWHLLVIGKGKGMFKL
FT                   KSLIKEYKLENNVHCIGHVDNVEDFVRLSDVVVLPSDFETFGLALAEGMAMGKAGVAYN
FT                   IGGIPEIIKDKENGFLVKYKDIDDLYDKLSLLAEDRLLCKSLGENAYNDIKNNLSVERM
FT                   MDKIENTYKNFIK"
FT   CDS             complement(144653..145000)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05395"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGL6"
FT                   /protein_id="CBL05395.1"
FT                   /translation="MRFSTDISAYLLKYIVKKYNIDLIHANSAAAGITAMKYKQRYNKN
FT                   MPVVFTVHGKFGDLKKENILKDCDKLIYVSQFVKDDSIKKDLGKIMLVLYTQALICKNL
FT                   IKLKRCTNNKR"
FT   CDS             complement(144997..145173)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05396"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGL7"
FT                   /protein_id="CBL05396.1"
FT                   /translation="MKNILLMVPRLNIGGAETYTKLVAENLQKRGYNVHIASGGGLLAN
FT                   KLAQKGIKIVGFP"
FT   CDS             complement(145596..146072)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05397"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGL8"
FT                   /protein_id="CBL05397.1"
FT                   /translation="MLKQIIRENNIEIISAQQRTAGIWAWLLSKDVNIKYTVTMHDPWH
FT                   RAKFKKIYAKIFPQMIVVSENLAQILYNEYGFFKDKVNLINNGVDFTFFKPMNKLIARR
FT                   SLLLDNERMILHVSRMSSVKGAVSLVIIDALEALANANIFYKLVIIGEGPFRKK"
FT   gap             146332..147290
FT                   /estimated_length=959
FT   CDS             147423..148160
FT                   /transl_table=11
FT                   /locus_tag="MHY_02170"
FT                   /product="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05398"
FT                   /db_xref="GOA:D4KGL9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGL9"
FT                   /protein_id="CBL05398.1"
FT                   /translation="MYHRIANIPGDRNALPKEKFAEQLEYLSTHNYHTITPEQLYNHFV
FT                   NKTKLPKNPILLTFDDGYQDNYLEALPLLKKYNMTAVVFPIYNWIGKPNKWENFGKQET
FT                   TTMNLTELKSWLNHGLDIQPHTADHPFLTQCNEEKLNLEIIDTKTKFEKLLDKPMDYLC
FT                   YPYGFFNQQVINIVKKANYKMAFAIFENVPLWHINLFALPRIPIPSHQKMWEFKLKVSS
FT                   MHIIFVAMRKWERQFKQLKNKFK"
FT   gap             148184..149937
FT                   /estimated_length=1754
FT   CDS             complement(149938..150585)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05399"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGM0"
FT                   /protein_id="CBL05399.1"
FT                   /translation="MLNFEIRYTKALVILCILAVIFIGLSFVLPIEYSYENHFLENLEV
FT                   VILFLGIVICIGKIRDFILYDSIKFYVASIIIYILMIGRELSWGRVFYPIGIDKNGEQI
FT                   FVKVHELWYGSVVYPIVGILILIALILLVVYFYQSRRQGICWYIPLGEFLFFIVTSILG
FT                   QCVFDRGLVQFGNYNQLLEESCEIIAYIALICCTYDISFKRRYIHIRYFSIR"
FT   CDS             complement(150599..151228)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05400"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGM1"
FT                   /protein_id="CBL05400.1"
FT                   /translation="MVLMLCVDKYMHKTYYILIGLMVLLLPQAFILPIECSYENHLLEN
FT                   LEVFILGIGFINMLYKTANLNKDKINKFYLACGIFYIVMIARELSYGRVFYPIGMDKNG
FT                   EQIFMNIHQIWYGPIVYPIIAVLVLIALFLMIQTYKYIKKEQIICSIPRYSIRLFIIMM
FT                   ILSQIVFEKNLIKFLADYGQLLEECTEILAYCSLVCFTYDISFKKK"
FT   gap             151333..152417
FT                   /estimated_length=1085
FT   CDS             complement(152490..152957)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05401"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGM2"
FT                   /protein_id="CBL05401.1"
FT                   /translation="MKKYFSKWINLEYGWNSLRNLILSGEHHFKCFANNHLAFSYLKTT
FT                   FIDLWDKEFDELDETCKHKFRNKTDENQWLMRYWQLAKGDFEPIGRHVKGKVYEIYNGV
FT                   EQNQELFKIIENQAMPMICINDNDNVDFEPMKERIKQAFDRILPEKSSFEK"
FT   CDS             complement(152954..153505)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05402"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGM3"
FT                   /protein_id="CBL05402.1"
FT                   /translation="MSENYPIDFVVTWVDGNDPVWQAEKAKYSPSKNADNRNVRFRDWD
FT                   NMQYWFRAVEKFAPWVNKIHFVTYGHLPKWLNINNPKLNIVKHSDFIPKEYLPTFSSHS
FT                   IELNLHRIESLAERFVYFNDDMFLIRPVKRELFFAGKNCLPTDFAIASTLSVADKRDTV
FT                   QYVKFNNIVILNTHFDKKNK"
FT   CDS             complement(153498..154526)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02220"
FT                   /product="ADP-heptose:LPS heptosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05403"
FT                   /db_xref="GOA:D4KGM4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGM4"
FT                   /protein_id="CBL05403.1"
FT                   /translation="MNILIVKLSAIGDVIHALPIAYVLKKRYPNAHITWVVEPTAYELV
FT                   KHNPYVDEIIIFYKKAFKSWNGFKENYRPFAKLLQKRKYDISIDLQGLFKSAAVVFTAK
FT                   AKRKIGYVDMREGSNLISRRIVGNNKNGHIVDRYLDTVKCLDCDTENIIFPLVNTQDEI
FT                   DFVDNLLIKENILNQKFIIFAVGTNWINKCWSVENFAKLSDLLAEYKLKVVLIGFGKDD
FT                   EQKSQAIIKLARENNIVNFVGKTSLMQTARLIKLSKAVVGGDTGNLHLAAALNIPAIML
FT                   MGPTDPNRNGPYRQSENVILAGHECDGCWKRICAKNIDCLASIKPNQVIEKLRQSELLK
FT                   DE"
FT   CDS             complement(154847..155176)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02230"
FT                   /product="cytidyltransferase-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05404"
FT                   /db_xref="GOA:D4KGM5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGM5"
FT                   /protein_id="CBL05404.1"
FT                   /translation="MIIDIQDIEKFCEILRKGNKTIALTNGTFDLIHAGHVRYLNEASK
FT                   LADYLILGLNSDQSVKQYKSDKRPIVPQKERAEVIDSLKAVDYVVIFDETTADKLISKV
FT                   NQISM"
FT   CDS             complement(155200..155739)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02240"
FT                   /product="ADP-heptose synthase, bifunctional sugar
FT                   kinase/adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05405"
FT                   /db_xref="GOA:D4KGM6"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGM6"
FT                   /protein_id="CBL05405.1"
FT                   /translation="MVMPQMQGVVMSDYGSGTITPKIRDLILSLSKEYDIPSIIDSRYA
FT                   IFNFVGTDYVKQNDAELASAVGYKIDNEEILYKAAQEFLVKMQAKGILVTRGEKGMTLF
FT                   EANGDVHNIPVSDKSEVFDVSGAGDTCVATFITALATGAMPSQAAELSNFASGIAVRKM
FT                   GTATVFDEELIAVLKK"
FT   gap             155909..156821
FT                   /estimated_length=913
FT   CDS             complement(158163..158516)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05406"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGM7"
FT                   /protein_id="CBL05406.1"
FT                   /translation="MYDSVTGEVYGKGNVKITQNYSRMTTEDANGNLNTGDVDIPVHAH
FT                   VMQVANPTLDINSEKTKYNYNEKTGVMNNVKGRVDNRYVSGEQVEFYPDYYIIYNGTMT
FT                   RCPAKKTRLLFDC"
FT   CDS             complement(158594..158776)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05407"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGM8"
FT                   /protein_id="CBL05407.1"
FT                   /translation="MKIEKKILWAISLSALSLCTYNQPVLASDTDVEILNYVEDQRHEA
FT                   RDKEKIELLMNLKQN"
FT   CDS             complement(158912..160360)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02300"
FT                   /product="4-alpha-glucanotransferase"
FT                   /function="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05408"
FT                   /db_xref="GOA:D4KGM9"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGM9"
FT                   /protein_id="CBL05408.1"
FT                   /translation="MHPTSLPSDYGIGDLGKEAYNFVDWLVKAKQKIWQVLPLNPVGYG
FT                   ASPYQSPSAFAGNTMLISPEKLVEINLLEAKDIVLDYKADADKVDFVKVEAYKEKILTK
FT                   AFVNFVTDADYTAFCQQQSYWLEDYALFMALKKYYKNLPWYEWNLDIKLRKPQALESCR
FT                   ISLAQDIAYAKFKQYIFFKQWQDLHAYANEKGIQIVGDVPIFPSHDSADVWVHQDLFNL
FT                   NADGTLKTAAGVPPDYFSEDGQLWGNPHYLWKVMQRDDYSWWRKRIATLLNLVDIIRID
FT                   HFRGFEAYWEVSGMATNARVGKWVKGPGKDLFDKIKEYLGDVPIIAEDLGVITPEVEAL
FT                   KNSCNFPGMKVLQFELYANKYHKLNFISPKNSIVYTGTHDNNTTLGWLKEDISPQDKAV
FT                   LADLLEVKVDDNEALLEELVKLAYASASKMAILPMQDVLKLDSNARMNLPGTVGTNWGW
FT                   RMQKDTLTDEKAMYLCSLVEKYNR"
FT   gap             162342..163369
FT                   /estimated_length=1028
FT   CDS             complement(165001..166611)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02330"
FT                   /product="alpha-1,4-glucan:alpha-1,4-glucan
FT                   6-glycosyltransferase"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05409"
FT                   /db_xref="GOA:D4KGN0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGN0"
FT                   /protein_id="CBL05409.1"
FT                   /translation="MAEKQQQEASYDKPMLIYEVHLGSWRHDAEGNYLTYREAAKQLIS
FT                   YVKEMNYTHIEFMPLCEHPFDGSWGYQATGYYAVTSRYGEPKDFMYLVDLAHQNGIAVI
FT                   MDWVPGHFCNDAHGLRRFDGETLYESDNEKRRENWQWGTTNFDYGRREVHSFLISNALF
FT                   WLNEYHIDGLRIDAVANMLYLNYGREEGQWEPNKYGDTGNLEAMELIKNLNEAIFKYHP
FT                   NALMMAEESTSWPMISRPTYMGGMGFNYKWNMGWMNDMLKYMSLDPIYRKWNHDKITFS
FT                   LMYAFSENFVLPLSHDEVVHGKCSLIEKMPGDYWRKFAGLRSFFGYWMTHPGKKLLFMG
FT                   GEFGQFIEWKYDDSLDWHLAELYPMHTKMQRFSKELNKFYCEHKALWQVDFDWRGFRWI
FT                   DCNDNENSVISFIRYAEDQDDFIIVVCNFTPEVRHGYRIGVPEKGIYQEVFNTDKEEYG
FT                   GSNVLNEGDFKSEDVFWHNLNQSIQITLPPLGTVYFRLKLRPVEAKKQTVIEAEKPEKV
FT                   KLNGNRSKQRQKAKAYALK"
FT   CDS             complement(166545..167012)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02340"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05410"
FT                   /db_xref="GOA:D4KGN1"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGN1"
FT                   /protein_id="CBL05410.1"
FT                   /translation="MEVSALKDFDLYLYHQGTNFYAYQMLGAHFVVEDGVEGVRFAVWA
FT                   PHAKAISVVGDFNNWDYNENPMQRISDGEIWVTFIPNLQQGEIYKYSIEPFNGGERFLK
FT                   ADPYAFYAEKKPKTASRVYDLCGYEWHDEKWQKNSNKKLLMINLCSSMKCI"
FT   CDS             complement(167038..167817)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02350"
FT                   /product="Glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05411"
FT                   /db_xref="GOA:D4KGN2"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGN2"
FT                   /protein_id="CBL05411.1"
FT                   /translation="MNILHVMHIYNLIKANPSIKSEMLPRTYMFAGKAAPGYHIAKETI
FT                   RLINNVANIVNNDKDVNDCLHVIFLENYGVTLAEKLFPAADVSEQISLAGKEASGTSNM
FT                   KFMMNGAITLGTLDGANVEICDAVGEDNCVIFGLKEHEVMEYYKNGLYSAWTEYNTNPA
FT                   IHNVVDELLTGPFVGNGDFHDLHNYLFNSNDEYFVFKDFNSYIDAHVKIRGKYLDRYGW
FT                   LKSSLINIAHSGIFSSDRTISEYAKDIWNVEPINLLK"
FT   CDS             complement(169675..170781)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02370"
FT                   /product="glucose-1-phosphate adenylyltransferase, GlgD
FT                   subunit"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05412"
FT                   /db_xref="GOA:D4KGN3"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGN3"
FT                   /protein_id="CBL05412.1"
FT                   /translation="MKNVLGIMDLYEDDKQIRTLTTKRPVATLPFAGRYRLLDFALSSM
FT                   VNSGITKIGMMMPAKSRSILDHLRSGKDWDLARRHDGLFYLPAIKMDKDSRNGNLQSFY
FT                   RHMSFIRQSEQEYVLICNSRFVYNIDFTTALRFHQNTGADITMVYHIENKERPDNATIL
FT                   QTGENGLVTEIANRPAVYENSKVFMGIYLMSRKKFMEIISTAYERGGYDFLIDGILRHQ
FT                   DNLNIYGFQHEGYVSEICSTSSYFKTNMDLLEPEIWEELFMGYNPIYTRVRDEAPVQYK
FT                   KQAKVNNSLVANGCVIEGSVENSILFRGVKIGKGVQVKNSVIMQNCELQDDALVENVIC
FT                   DKNVVVSDGKWLKGAENYPLIIEKNTVI"
FT   CDS             complement(170802..171971)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02380"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05413"
FT                   /db_xref="GOA:D4KGN4"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGN4"
FT                   /protein_id="CBL05413.1"
FT                   /translation="MRKTECLAMILAGGQGSRLGALTKNIAKPAVPFGGKYRIIDFPLS
FT                   NCANSGIETVGVLTQYRPLELHTYLGTGEAWNLDRKNGGVYILPPYAREKGADWYKGTA
FT                   DAIYQNINFINKANPEYVLILSGDHIYTMDYAKMIEAHKMNKAEATIGVIKVPMKEASR
FT                   FGIMSTDKEGRITKFAEKPAKPESNLASMGIYIFSWNFLREYLENDAKDETSSHDFGKN
FT                   IIPKMLADQARLYSYAFEGYWKDVGTIDSLWEANMDLLKEKQPFEMNGKWKIYSVDMAM
FT                   PPHYVGPKAKIKNSLVSEGSMICGEVKNSVIFPGVRIAKGAKVSNSVIMPFAKIEADAV
FT                   VEKAIVAQNSKIEATAQVGSDDGTIVVIPEGETVRPMVVSDATENVNVG"
FT   CDS             complement(172217..172906)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02390"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05414"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGN5"
FT                   /protein_id="CBL05414.1"
FT                   /translation="MNNQEIEVKMEIKDEAQIENIREFLQENKDQSWQRIDMKAIYYDT
FT                   EDNFYQKHKIAYRVRCENDCIVATYKSGKVNSDGLFERVEINKKVTKLTPDINVFAEDK
FT                   DIWSLIKTTKDKKFLPIVITDFVRECIELTWLDSKLEVALDLGFVQGRENKAPICEVEI
FT                   ELKQGKIEDLLSLKDELIKKFGLQISAISKYKKRVDFSRTNLMSCFFYYFLKNNKKSRI
FT                   YKIYIEL"
FT   CDS             complement(172899..174614)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02400"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease and ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05415"
FT                   /db_xref="GOA:D4KGN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGN6"
FT                   /protein_id="CBL05415.1"
FT                   /translation="MYYLQAFKILALGYWRSEQKWKAYGILVVVLILNLASVFLTVLIN
FT                   DWYKEFWDVLQAYEFDSFWYLVGKFSLIAAIYIAIGVYSVYLQQLLQIKWREWLTDKYL
FT                   VRWMENRAYYKLKLMGKDMDNPDQRISEDINQFVALTLSLTIGLVRQLITLVAFTVILW
FT                   NLSGIMTVPIGSYEFTIYGYMVWLSLVYSIVGTYLTHKVGKALINLNYEQQKYEADFRF
FT                   AMMRVRENTESIAFYRGEKPELENFLTRFKIVIGNFRDIMTRQKILNGFTSGYGQLAII
FT                   IPLLLAAPRWFAKEVQVGWIMQVSNAFGQVQGAMSYFVDAYTTIAQWCSVVRRLDGFNR
FT                   HVGEALDLKSDLMIDNASNITVGIENVDVFLPNKNKDILIKDCTIDLMKYQSLLIMGAS
FT                   GVGKSTLLRTLAGLWPYAKGNVYLPKEEEFLFLPQRPYLPLGSLRQAISYPVVEEVISE
FT                   KYSDEEIKEILIACKLENLADKLDIVDDWSRILSLGEQQRIAFVRILLYRPEFVFLDEA
FT                   TSALDEDLEGNLYDMLKIHLPNTKIISIAHRSSLIAKHQAILRLKEKGCWEIHE"
FT   CDS             175310..175963
FT                   /transl_table=11
FT                   /locus_tag="MHY_02410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05416"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGN7"
FT                   /protein_id="CBL05416.1"
FT                   /translation="MNILLAIAVMIIIIIASYLADRKYPTKRIFIIPCGIILLCFVAVY
FT                   SSLVIPSSSNSISTEQRLAILNEQPYFITWYNDYKEDINQLDRFATVYHKIISNYENQS
FT                   ISATEALSQLQRLYDETNAFNNSLQDALPPSELSQNNYTLVYNILEKTRVYSYKLNETV
FT                   RQSIVIINEGTYNQIEHKDIVNNLNRIYAIEAPIMLDINSEVSQIKDNLTIPEN"
FT   CDS             complement(176032..176907)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02420"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /function="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05417"
FT                   /db_xref="GOA:D4KGN8"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGN8"
FT                   /protein_id="CBL05417.1"
FT                   /translation="MKRIRKAVIPAAGFGTRFLPATKATPKEMLPIVDKPTIQYIVEEA
FT                   IASGIEDILIISGHAKRAIEDHFDSAPILEAELKAKGKTKLLEMVQETSEINVHYIRQK
FT                   HMRGLGDAILCARAFIDNEPFAVLLGDDIVYNPEMPALKQLMDMYTQTGATILGCQQVP
FT                   KEKVSSYGIVAGVPTINEQLMKVNDMIEKPSIEEAPSQMAVLGRYIITPDVFEVLQNTK
FT                   PGKGGEIQLTDALKVMAKRENVYAYNFTGKRYDVGDKLGFLKATVEFALRRDDLSGDFA
FT                   EYLKTIVKDL"
FT   CDS             complement(177061..177210)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05418"
FT                   /db_xref="InterPro:IPR024419"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGN9"
FT                   /protein_id="CBL05418.1"
FT                   /translation="MEYIFTYIANYGFPMVVASFLLFRMDKHLANLEEGIRRMNETLAK
FT                   QVNH"
FT   CDS             complement(177880..178101)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02450"
FT                   /product="Protein of unknown function (DUF1659)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05419"
FT                   /db_xref="InterPro:IPR012454"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGP0"
FT                   /protein_id="CBL05419.1"
FT                   /translation="MAVKKNAECEIIIKVETGTTSTGKASYSSRSFGYINPSLAEDDIL
FT                   DIGQKIAGLQKYNLGSVNRQDTTEIAAE"
FT   CDS             complement(178143..178361)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02460"
FT                   /product="Protein of unknown function (DUF2922)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05420"
FT                   /db_xref="InterPro:IPR021321"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGP1"
FT                   /protein_id="CBL05420.1"
FT                   /translation="MADTRKLTMVFTLDNGDDFKYNLAAPKDELTKSEVDVVMQKMIDT
FT                   QAIIKNNHKATAIKEAYITTTTQDVLA"
FT   CDS             179034..179627
FT                   /transl_table=11
FT                   /locus_tag="MHY_02480"
FT                   /product="Lyzozyme M1 (1,4-beta-N-acetylmuramidase)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05421"
FT                   /db_xref="GOA:D4KGP2"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGP2"
FT                   /protein_id="CBL05421.1"
FT                   /translation="MQNFQVVDISAWQEKLNWQKLKANNIQGVIIKIGEYTHLDEMFIS
FT                   HVNNAVTYNLPYGIYYYAHASTIDKAIAEANWVDKQIKTYLNGQNPPLGIWYDAEDKSI
FT                   LKNNINVAYMIGNFINQLNELDYNYVGLYSSYNWLTNIIDLNLLADYIPIWSAQYYHEN
FT                   SFKLEYPNRICKIWQYTDHKQIDDMILDCNIYYA"
FT   CDS             complement(179677..180696)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02490"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /function="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05422"
FT                   /db_xref="GOA:D4KGP3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGP3"
FT                   /protein_id="CBL05422.1"
FT                   /translation="MKILVTGGAGFIGSNFVYYELDNYPSDEVICLDKLTYAGNLETLE
FT                   VAIKNPKFKFVKGDIADRAFVDDLFSSEQPDVVVNFAAESHVDRSIENPEIFLQTNVMG
FT                   TSVLMDACRKYGNIRYHQVSTDEVYGDLPLDRPDLFFTETTPLHTSSPYSASKASADLL
FT                   VQAYYRTYKLPVTISRCSNNYGPYHFPEKLIPLMIANALNDKKLPVYGKGENVRDWLYV
FT                   EDHCSAIDLIIRKGKIGEVYNIGGHNERTNLEVVKTIIKELGKSEDLIEFVTDRPGHDR
FT                   RYAIDPTKIHNELGWLPATKFDDGIKKTIEWYLTHKSWWEKIISGEYKDYYFRMYNNR"
FT   CDS             complement(181626..181793)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05423"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGP4"
FT                   /protein_id="CBL05423.1"
FT                   /translation="MKYFILNNGIKMPVIGLGTFPMRRLELFKVFFKLLLVVTQVLILH
FT                   QHMVMKDGWD"
FT   CDS             complement(182069..182284)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05424"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGP5"
FT                   /protein_id="CBL05424.1"
FT                   /translation="MILIIMVGQFISLIQNSGIAILQAMNLNRYRMTIYTIIAVINIFT
FT                   SFQLAKLYGGLGCAISTSVAIFLVQV"
FT   CDS             complement(182338..182601)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05425"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGP6"
FT                   /protein_id="CBL05425.1"
FT                   /translation="MDKIYWGTGQFILGMVSGTIQVAIYAIAMQFMNMYMQFSNAISGV
FT                   LLPKVTMMVTNGATKKELTMLMIKVGRLQYIVMSYILIMFFY"
FT   CDS             complement(182810..183310)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02560"
FT                   /product="Polysaccharide biosynthesis protein."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05426"
FT                   /db_xref="GOA:D4KGP7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGP7"
FT                   /protein_id="CBL05426.1"
FT                   /translation="MKNQLKIGAILSYVNILAGLIVGLGYTPVMIRLLGQSEFGLYSLI
FT                   GSLVAYLSVLDMGLGNTIVRYVSRNRAIGDKKSESELNGLFLAIYSVIGLITLIVGSIL
FT                   YFNVDNMFGATLSADQIERAKIMMILLIFNIAISFPLSVFASLMQAYERFIFYVYLILL
FT                   VYY"
FT   CDS             complement(184060..184506)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02580"
FT                   /product="Formate hydrogenlyase subunit 6/NADH:ubiquinone
FT                   oxidoreductase 23 kD subunit (chain I)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05427"
FT                   /db_xref="GOA:D4KGP8"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGP8"
FT                   /protein_id="CBL05427.1"
FT                   /translation="MIDNLDKNKCTGCSACYNICPKDAIIMKKDRAEFLFPEIDYDKCI
FT                   KCNLCEKVCPSMSKFECLEDRFKEPIVKAAWSKDENIRINSTSGGLFSELAKGFLKETE
FT                   TFVVGAIYNKKFLVEHYITNKTKDLELLRQSKYVQSDKKMYLVK"
FT   CDS             complement(184516..184746)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02590"
FT                   /product="Bacterial transferase hexapeptide (three
FT                   repeats)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05428"
FT                   /db_xref="GOA:D4KGP9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGP9"
FT                   /protein_id="CBL05428.1"
FT                   /translation="MDSDAHEGLWEGYEKTKPIKIGNHVWIGTRVTILKGVTIGDNAII
FT                   AAGSVVTKDVPNNTIVAGVPAKVIKTDINWK"
FT   CDS             complement(185191..185361)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05429"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGQ0"
FT                   /protein_id="CBL05429.1"
FT                   /translation="MADMTSRIDTLLELFGYQNRYIVNGECDLSDEEILHMDFSKVKDI
FT                   QEREKNVQKIF"
FT   CDS             complement(185385..186251)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02620"
FT                   /product="Polysaccharide pyruvyl transferase."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05430"
FT                   /db_xref="GOA:D4KGQ1"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGQ1"
FT                   /protein_id="CBL05430.1"
FT                   /translation="MKMAIVTIDDNNNYGNRLQNYALQSFLKCYISEVKTIWYDKLTSF
FT                   ELKSIMSLKSIIKFMINRNSYRYYLNECIRIYNIKKFSQKYIDIDFVNDLSKISNEYDF
FT                   FITGSDQVWNPNFWFREKLYSTARFLKFAPKEKRVAYAASIAIPSIPKDKEQFFRDSLN
FT                   EMKAISMREKSGAELVKNLTGKDVPVVVDPTILLSKEEWQKIELVPEWYNGEKYILTYF
FT                   LGNPSPIIENLAKKNNWKIYNLMDKSNLDLYASRVEEFVYLIEHAELVATDSFHACVFS
FT                   ILMNTSF"
FT   CDS             complement(186399..186890)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05431"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGQ2"
FT                   /protein_id="CBL05431.1"
FT                   /translation="MKKNQKMIDKEIFLKETCLEQKIQNQLWRNIYKKELMIGIKFPLG
FT                   INLMEDYAVLYKIILNAKNIYYLSKNIYFYRLRDNSLVSKVDINTVYKCYLISKERYDF
FT                   IKKIGINITKLTYLLKLIRICVLYHKVDKENEKRCIERYTQKLKNKIRDNIVYILKEKI
FT                   "
FT   CDS             complement(186865..187281)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02640"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05432"
FT                   /db_xref="GOA:D4KGQ3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGQ3"
FT                   /protein_id="CBL05432.1"
FT                   /translation="MKYLISIIIPVFNVEAYIKECFESIRRIRSNDIEIICIDDGSTDN
FT                   SGMICDEYSKKDKRFKIVHKTNGGVSSARNIGIEIAKGKYIAWVDPDDYVGNDWYQSVK
FT                   DVLNNNVDFIFFDYYELKNKKIKAISYEKKSKND"
FT   CDS             complement(187373..187525)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05433"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGQ4"
FT                   /protein_id="CBL05433.1"
FT                   /translation="MDSFEDIILLHFANQPKPWNKLWYLNIMCNKFTKNIYSHYEKKRH
FT                   GKIIN"
FT   CDS             complement(187656..188243)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02660"
FT                   /product="Lipopolysaccharide biosynthesis proteins,
FT                   LPS:glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05434"
FT                   /db_xref="GOA:D4KGQ5"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGQ5"
FT                   /protein_id="CBL05434.1"
FT                   /translation="MNMNIDKIDSVVQNIIQYKYRINNNNKLVNVSYGIDDNYGRCAAT
FT                   SIASICINNLDYDFNFYIIAAGLSERTKNNIKLLAKSFSINIIIYEIDKKFFEKLPIKA
FT                   HIPISTYFRLILPILLKDSVDKLYYIDADVVCLKNAGQLFDFELKDNIVAAVPDINRIA
FT                   NNRIKILKLKKHIYFNAGVLVINVKNGMNLIY"
FT   CDS             complement(188362..188928)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05435"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGQ6"
FT                   /protein_id="CBL05435.1"
FT                   /translation="MIIIYDFFYNNNYIYKKIILVLSYFSLLMLHPGIIFIIFFRVLLV
FT                   LPVKLYFLAIIIVIIMANAFLEDIIFMLMGSSIPFLGLLGDKYTSYSEIDLVEFNFLNI
FT                   VVCVITNFVVIVMSLILKKYLLNNIYIKYNKFILFNFSLSILAFIFAITESQFMHRLDE
FT                   FVIYLSVIYIYIIAHKNNFKLKKDI"
FT   CDS             complement(189059..189214)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05436"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGQ7"
FT                   /protein_id="CBL05436.1"
FT                   /translation="MELFRLYGWNAITTYDGAILSKIYIFLYSLLNVDELLPIMNCFCL
FT                   FLFCIQ"
FT   CDS             complement(189483..190592)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02690"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05437"
FT                   /db_xref="GOA:D4KGQ8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGQ8"
FT                   /protein_id="CBL05437.1"
FT                   /translation="MKQEPIRVLQIIGFVCGGGVEAVIMNYYRNIDRNKIQFDFVIDGY
FT                   EKTALDNEILSLGGKVYKVEPYTKNPLKNIYQIYRVIKDNNYQIVHSNMNTLSVFSLFA
FT                   AWLAGAKVRILHNHSTAVKSEKLRSAMKYILRPFAPVFANRYMACSKLAGEWMYGKKNM
FT                   QSGEVKVLNNAIDVDAFAYNENLRKKLRQDLNIDEDTLVIGHVGRFMYQKNHDFLIDIF
FT                   NEIHKQKSNSLLLLIGDGPLRQSIEEKVKNYNLQDSVNFLGLRKDVKDLYNAMDVFVLP
FT                   SWYEGLPVVSVEAQANGLPCFVSDKVSKECYLSSSMHFISLDKNADIWSKEILNSKLTR
FT                   NKSAKQELIANNFEIKNEAKKLIGLYTIN"
FT   CDS             complement(190592..191938)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02700"
FT                   /product="Undecaprenyl-phosphate galactose
FT                   phosphotransferase, WbaP/exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05438"
FT                   /db_xref="GOA:D4KGQ9"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017472"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGQ9"
FT                   /protein_id="CBL05438.1"
FT                   /translation="MADYLAVLLAEMIAIYFSEENLRHIDLFIVIPFIYIAFIAAARTY
FT                   RRTIPFWQRIESLFYSSIYSIIAILLFFFVRASSTEHSIAFLALLWLASFICLVIMRYI
FT                   LKRILDEREMFKIPLLIIGAQEEALAFTRSINNDIGMSSYKIVGLISDKIPVKGLENYS
FT                   LLGDFKDIEKIIKTTGINNVLIAIPYLEQVKMQNIIHRVQPLVKNICIIPNLTSIPMGG
FT                   IDVETFFTEKIMLIRVRNNLERRLNRIIKYLFDMVLTIVGTICISPLLVIIAIWIYKDS
FT                   PGPVIFKHMRVGKDGKEFPCYKFRSMCVDAKEKLEELLKNDPVARAEWEKDFKLKHDPR
FT                   ITRSGAFLRKTSLDELPQIFNVLKGEMSLVGPRPIIKAEMERYKEHIADYLMVKPGIAG
FT                   MWQCSGRSDIDYAERVELDSWYVHNWSVWLDIMILWQTLKAVFAKKGAY"
FT   CDS             complement(192185..193474)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02710"
FT                   /product="Uncharacterized protein involved in
FT                   exopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05439"
FT                   /db_xref="GOA:D4KGR0"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGR0"
FT                   /protein_id="CBL05439.1"
FT                   /translation="MDINNANDNDTIDLRKLFSLMIEKKKIVLAIVVICTIIATIVAFV
FT                   LPKSYQSTTLVRVKSNNSSTMAGYAAMAAGFGIDIGGSSSASPESYIELMKSREVLEPI
FT                   IAELDLPDEDKEKLTVEDFAKKNLEVINIKKTDLITIAAYGKTPEEAQMISQGVADNFL
FT                   ALMTKLNKEDNSTTLKFLDERIKIAKEEMETAENKLQAYQQEHKIYAPDEQAKAIITNL
FT                   NTYDTTIAQLQAQSEGDSAKLAGVTSQLEQQNASLLEYNVSDNTNIGNIRESIVNKRVE
FT                   LVGLQQQFTDEHPDVIKAKEELNSLERSLSDEIAKAVNSQSVTLSPVQSNLLKDKISTE
FT                   VQISVNNASLEALKAKQAEAQESIATLSADSVEYMRLERNAKITGQVYTSLVQNYEQTR
FT                   IQEAKDSMDIQIIDAADLPKEDMPAKPNKN"
FT   CDS             complement(193489..193665)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05440"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGR1"
FT                   /protein_id="CBL05440.1"
FT                   /translation="MYVKEANIKDYIEKHDISQNFALEDGDILYIPKSNKIDFHKDVLP
FT                   LINVYSTYRALID"
FT   CDS             complement(193677..194237)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02730"
FT                   /product="Periplasmic protein involved in polysaccharide
FT                   export"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05441"
FT                   /db_xref="GOA:D4KGR2"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGR2"
FT                   /protein_id="CBL05441.1"
FT                   /translation="MGRFYKKAIVTALLVSALSTTAFAAPEDVYTNIADSAVIMDATDT
FT                   SVFKPAAIKSLTDYDEHYRLYKYDTISIRIIGYKDAQGLDSIMIGTDGYVNLPYAGSVK
FT                   LAGLTIEEAKQVLTAKFGRYIKIPDMSIIVTNYGPRKVQVLGEVNVPGTVELASDDMNV
FT                   LSAISRAGWVTTYGRIKKYRPFA"
FT   CDS             complement(196770..197477)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02760"
FT                   /product="Tellurite resistance protein and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05442"
FT                   /db_xref="GOA:D4KGR3"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGR3"
FT                   /protein_id="CBL05442.1"
FT                   /translation="MIRKVPVPTAGVMLGLAALGNLLAPYSMILKYACGISSAFLGVLL
FT                   FSKIILHPQMMKNDLNGNSIFASVFATFFMAIMQLCTYTFPFAPIASEVVWYGAICGHF
FT                   MLMAWFTYRYIINFELRDVFPTYFIAYVGIVVASVTAPTFNHHNLGEYIFWFGFTMYMI
FT                   LFALVTIRYCSKHAIAEPAKPLFCIYTAPMSLSLAGYLACVADKSLIMIVIMQILAQGL
FT                   FVAVLTQMPKLLN"
FT   CDS             complement(198099..198260)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05443"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGR4"
FT                   /protein_id="CBL05443.1"
FT                   /translation="MLKTRFAQTVKQKAYSMIMFFNNLAITAKFYNAEIDYVLLEKFPH
FT                   SIDIIFIV"
FT   CDS             complement(198362..199813)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02780"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /EC_number="3.4.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05444"
FT                   /db_xref="GOA:D4KGR5"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGR5"
FT                   /protein_id="CBL05444.1"
FT                   /translation="MSLTDKEIMDGVLAEFSNLAAIPRKSNHEEAVSNFLKERALSFGC
FT                   KVVQDEKFNLIIDKEAAKGCEAWPRVIIQGHMDMVCVAAEGVQYDPLTSPIKIINDGEF
FT                   LRADGTSLGADDGIGVAAAMYLLQQDFNHGPIRAIFTVDEEQGMTGAKALDAKYLLDAK
FT                   YLINCDSEAFDMLTLSSAGSVNVDAERRITWHKPEHRSAYKFVVKDLHGGHSGEAINCG
FT                   YANAVKIIAQAINSIMKKTEIELASISSLKARNVIPSEAEFVFTSPLSNVKVFDVVVAE
FT                   ITDYLKAAYGNVEKNFTVTCVPCELPERVMSEEDASSIVDFINLSMTGVLKMSQVEEGL
FT                   VELSANIGPVVTKENAVEISVFPRSAVDALTREIANIYIQLGKRCGIRVVSGEPAPGWP
FT                   ANSDSQLKHVVLETFKEQNGFDMKAKSIHAGLECSYFYAKNPNLDIISIGPNNIDIHSP
FT                   NERLELKTLVPHVKLIKGVMEKLDK"
FT   CDS             complement(200076..200438)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02790"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /function="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05445"
FT                   /db_xref="GOA:D4KGR6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGR6"
FT                   /protein_id="CBL05445.1"
FT                   /translation="MRKITKIEIITRASKLEELKEALNKIGVQGMTVSQVYGCGLQKGH
FT                   TEVYRGKQYSVNLVPKVKIETIVCAVPVELVLETARKALQTGHIGDGKIFVYDVENAMR
FT                   IRTGTMGDKAITDDEA"
FT   CDS             complement(200520..201911)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02800"
FT                   /product="ammonium transporter"
FT                   /function="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05446"
FT                   /db_xref="GOA:D4KGR7"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGR7"
FT                   /protein_id="CBL05446.1"
FT                   /translation="MKKLASILSMTAMFIAMMASVAFAADDTTAAIDTGDTAWVLISAA
FT                   LVFIMTPGLAFFYGGMVRSKNVLSTIMHSFFIVAMISVEWVLIGYAMTFGSDIGGFIGS
FT                   LDKVGLTGVGMQVMANGTIPELAFVAFQCMFAIITPALITGAFAERMKFGAFVVFILLW
FT                   AILIYNPMAHWVWGGGFLAKLGALDFAGGLVIHILSGVSGLTVCILLGKRHGYGKVPML
FT                   PHHLPMTVLGAALLWFGWFGFNAGSALGANALAANAFVTTQAAAAMATVSWVACEWMHH
FT                   GKPTILGAASGCVAGLVAITPAAGFVAPLPAVFIGLIGGIVCYFAVAVVKEKFGYDDSL
FT                   DAFGVHGIGGTWGAVATGLWCSTEINPDGADGLFYGSADTLIAQLISIVVAYVLAIVGS
FT                   YILFKVVSCFMQVRASENEEVSGIDICEHGERAYNQSIMSANTLLSSNAEAFASENFTK
FT                   PVDLK"
FT   CDS             202375..203829
FT                   /transl_table=11
FT                   /locus_tag="MHY_02810"
FT                   /product="sodium/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05447"
FT                   /db_xref="GOA:D4KGR8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGR8"
FT                   /protein_id="CBL05447.1"
FT                   /translation="MMAIGVYFYYRTHNMSDYILGGRKLGAWVTSMSAEASDMSGWMLM
FT                   GLPGFAYLAGLNAGWIAVGLALGTWANWQFIARRLRKYTELANNSLTLPDFLQNRYHDK
FT                   SPLIRVVMAIFILIFFIIYTSSGFVAGGKLFNTIFGIPYEYALCLGAFVIVFYTFVGGF
FT                   LAVCWTDFIQGVMMFFAILIVPIAAAFTLGGFGDTYTAISITNPEFFNPFTKPDGSYTT
FT                   VLELISLLAWGLGYFGQPHILVRFMAITSSSELKKATRIAMTWVVISLTAAVCVGMVGS
FT                   VYLTTPLNGTNSETVFLVMTDHLFSPFWAGIVLSAVLAAIMSTASAQLLVGASAVAQDL
FT                   YKQFIHKDINPRELVLVTRLSVIGIALIAIALGLDPNNSILNIVAYAWAGFGATFGPAL
FT                   LFSLFWRRTTRNGILAGMIVGGITVLVWKQITLLDIATVYPILQLYEIVPGFILSSLAI
FT                   IIGSKLDKAPSKEITDIFDSVKHSNI"
FT   gap             204070..204349
FT                   /estimated_length=280
FT   CDS             complement(204407..205555)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02820"
FT                   /product="possible tyrosine transporter P-protein (TC
FT                   2.A.45.2.1)"
FT                   /function="possible tyrosine transporter P-protein (TC
FT                   2.A.45.2.1)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05448"
FT                   /db_xref="GOA:D4KGR9"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGR9"
FT                   /protein_id="CBL05448.1"
FT                   /translation="MAIHHIDFNTIGLLAGMMVVVNITGETGLFNYLAVWSAKKVKAEP
FT                   LKLLVALSFLTAICSAFLDNVTTVLLTVPLTFSITRQLNVPVKPFLVAQILASNIGGTS
FT                   TLIGDPPNIMIGSAVPEMDFMAFLTNLSGVCIVTFIVTIAILLFLYRKQLVTTDELRAK
FT                   VMAMDERQEIKDSTLLKKCLVVLAMIIVTFTMHAQLHLESATVALTGACILMLISMARY
FT                   EKKIANVLSHIEWLAIFFFAGLFILVGGLVETGVIKLLAEKVLEITAGDLTSTTMLILW
FT                   LSAIASAFIDNIPFVATLIPMIKDMGAMGMTNLEPLWWALSLGACLGGNGTLIGASANV
FT                   VVASMAAIHGEKISFAKYFMVAFPIMILSIIISSIYLYLFYL"
FT   CDS             complement(205760..207430)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02830"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /function="glutaminyl-tRNA synthetase"
FT                   /EC_number="6.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05449"
FT                   /db_xref="GOA:D4KGS0"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGS0"
FT                   /protein_id="CBL05449.1"
FT                   /translation="MAELMASNFVHNAIDEDLKEGKYTEGIHTRFPPEPNGYLHIGHAK
FT                   SICLNFGTAQKYNGLCNLRFDDTNPVKEDVEYVDSIQEDVKWLGFTWKDRKYYASDYFE
FT                   KLYDYAVELIKRGKAYVDDLTADEIREYRGNLTEAGKESPYRNRSVEENLDLFTRMKNG
FT                   EFADGEKVLRAKIDMASPNITMRDPVIYRIAHISHHRTGDAWCIYPMYDFAHPLSDAIE
FT                   GITHSICTLEFEDHRPLYDWLLDSLGFDVNTRPRQIEFARLNITKMVMSKRKLRQLVEG
FT                   GYVSGWDDPRMPTISGLRRRGYTAAAIRDFCERIGVAKANSLVDVAMLEHCVREDLNAH
FT                   ANRIMAVLDPIKVVITNYPEDKTEMLACENLPNTDAKHYMPFSREIYIEREDFMEEAPK
FT                   KFFRLKPEGEVRLKNAYIIKCEEVIKDEQGNIVELHCSYDPDSKTGGKTAGRKIKGTIH
FT                   WVNASTALDAQVRLYDYLLNDEEGAVNGDFIASLNPNSLVVLDNCKVEPSVKWAAPGTK
FT                   FQFLRQGYFCVDKDSTMDNLVFNRVVGLRDTWSKVAKKG"
FT   CDS             complement(207765..208349)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02850"
FT                   /product="HD domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05450"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGS1"
FT                   /protein_id="CBL05450.1"
FT                   /translation="MMNDIAKMQDLWQEMSSWMTTYMKSFYSPEAAKTAKSHLEIKSAK
FT                   TIFFDDAQIVDGIILKEKHTWKVVKNCENLAKHLNLNEHDSLLAKMIGLFHDVGRFYQF
FT                   TVYRTFNDALSENHAKLGLKVIKDLPFMAKLDEEDLATLKFAIGNHNAKEIAPTENQRH
FT                   LAFAKLIRDADKIDIYRVLKPFFRTYRWYRL"
FT   CDS             complement(209413..209511)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05451"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGS2"
FT                   /protein_id="CBL05451.1"
FT                   /translation="MMALVMAVIACSSILLAKEYISANVYKSARKN"
FT   CDS             209875..210318
FT                   /transl_table=11
FT                   /locus_tag="MHY_02880"
FT                   /product="Fe2+/Zn2+ uptake regulation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05452"
FT                   /db_xref="GOA:D4KGS3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGS3"
FT                   /protein_id="CBL05452.1"
FT                   /translation="MLDNKKVTELLRKKGFKVTPQRLAIYNALCNTKAHPNAEMIFNKL
FT                   QPYYPTMSLATIYKTVDILHEIGLINILNVGEDSFRYDANTSSHAHICCTECSRVDDIM
FT                   IDFAKCVEEVASQSSYDVHRHQFYFYGTCAECKAKLNSKAKVS"
FT   CDS             210483..211229
FT                   /transl_table=11
FT                   /locus_tag="MHY_02890"
FT                   /product="Metal-dependent hydrolases of the beta-lactamase
FT                   superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05453"
FT                   /db_xref="GOA:D4KGS4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGS4"
FT                   /protein_id="CBL05453.1"
FT                   /translation="MNISVLASGSRGNCTLIYDDNNAILIDMGISTRKLKQALAQLHLN
FT                   IEDLDAIFITHEHIDHIRGLKTLTKNYNVPIYSKTATLKQIAITQKFTDINLKNCQALT
FT                   TNNIDIGNLAIKIFNISHDAIDPVGYTISKYKDNAKTKKFTEKITLATDLGFVSETVQS
FT                   ALENSDILVLEANHDLKLLQNGQYPWSLKKRILSTKGHLSNIDAGFAINRLQAKPQQII
FT                   LAHLSEQNNSPDIALNTIKQIFKKII"
FT   CDS             211339..212433
FT                   /transl_table=11
FT                   /locus_tag="MHY_02900"
FT                   /product="Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /EC_number="1.3.1.74"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05454"
FT                   /db_xref="GOA:D4KGS5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGS5"
FT                   /protein_id="CBL05454.1"
FT                   /translation="MRSPLSILGICLITMSIFLGGCTNNEQSAVSSSSAAASSASSEKS
FT                   TAPISDARNTPIVQAAKKVGPAVVGITNKAVARDWFNRQVEIDKGTGSGVIFRSDGYIV
FT                   TNNHVIEGAKDITVALADGRTLPATLVGTDPYSDLAVIKVDATDLPTAEFGNSDDIMVG
FT                   EPAIAIGNPLGLEFQGSVTAGVISALNRTLTIGDNRLKLLQTDAAINPGNSGGALVNAD
FT                   GQVIGINSAKLAATGVEGIGFAIPINTAKPIIDELINKGHVTYPYLGVGVLDKQTAAQA
FT                   GYKLNVDAGVIVMQLELGSPADQAGIRQRDLILKIDGKDTNTVADLRSIIAEHKVGDNI
FT                   TITISRNGQVGDVTATLAEMPTNN"
FT   CDS             212436..212915
FT                   /transl_table=11
FT                   /locus_tag="MHY_02910"
FT                   /product="conserved hypothetical protein TIGR00246"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05455"
FT                   /db_xref="GOA:D4KGS6"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR016051"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGS6"
FT                   /protein_id="CBL05455.1"
FT                   /translation="MKISIVASGKIKEKYLRDGINEFVKRLKPFTQLEFIEINEEKMKD
FT                   NPSPAEKKATLTAEGERLLKKVPANSYLIVLDVFGKDISSEELSAKIDKLTLSGQSHIT
FT                   FLIGGAFGLSEEVRKRADERISFSRMTFTHQMIRLLLVEQIYRAFKISRGEKYHW"
FT   gap             213932..214157
FT                   /estimated_length=226
FT   CDS             complement(214171..215574)
FT                   /transl_table=11
FT                   /locus_tag="MHY_02930"
FT                   /product="Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05456"
FT                   /db_xref="GOA:D4KGS7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGS7"
FT                   /protein_id="CBL05456.1"
FT                   /translation="MVIALYAVLLIAVGVIISRKVKGADDFFVGGRKMAPFLLFITLVA
FT                   PNIGAGSTVGVAGMGFTSGISAAWWIIASAVGTFILAFVIGPKIWEIAKNRGFYTLGDY
FT                   LEYRYNRYFRGLISLMMAIGTLAIFAGQLMGIAWILSVVAEIDKTTGVLIASVVVVLYF
FT                   CAGGFLSAVYANLIEAGVKLVGFIVAVPLVLSFVGGLDGLQAKVVANMADVAKSTAYFS
FT                   FDGLGNTVIMGFFLMLMPSFFLSPALIGKVYSARDKNTVRISTFACGLVMLLFSIIPVT
FT                   LGMAAYAIAPDLPQQDLALPYVMKECMPFWASALALAAIFSAEISAADAVLYMITTSFT
FT                   KDLYKSFINPNVSDESLIKGSRFVTVMAGIIGIGLAIVLPNVISALSIFYSLMSVSITA
FT                   PLLFGLFTKRSSASAAIISTIVGIIVTVGLDLFNGNKGIWILNAQSTAIMLTLIIMFIM
FT                   MFVSPNKKY"
FT   CDS             215772..216251
FT                   /transl_table=11
FT                   /locus_tag="MHY_02940"
FT                   /product="tRNA-adenosine deaminase"
FT                   /function="tRNA-adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05457"
FT                   /db_xref="GOA:D4KGS8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGS8"
FT                   /protein_id="CBL05457.1"
FT                   /translation="MERLQIKNDIEGMKEALIEAKKAFAIGEIPIGAIICDDKGNIISR
FT                   GHNLREKTFDATAHAEIVAIRKACTKLQNWRLSDLTLYVTVEPCPMCAGAIFSSRLKRL
FT                   VYGATDWRAGGCESVFNIVNNHWLNHQTQIRAGVLEDECSLLVKKFFQTRRQNHN"
FT   CDS             216371..216808
FT                   /transl_table=11
FT                   /locus_tag="MHY_02950"
FT                   /product="Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05458"
FT                   /db_xref="GOA:D4KGS9"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGS9"
FT                   /protein_id="CBL05458.1"
FT                   /translation="MPNIQQIVVPINGTAESFKALSLASDLAKIYQVQICLLLVTYFST
FT                   ETDDKSTYSSWLATPLTGSVSRYAESVFLRAKDLLPANIDISTHHLSGQPASKILEFTK
FT                   AHNTDLIIMGCRKLNLFSSILNGSTSRQILEKSTCPVIIVK"
FT   CDS             216827..217249
FT                   /transl_table=11
FT                   /locus_tag="MHY_02960"
FT                   /product="Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05459"
FT                   /db_xref="GOA:D4KGT0"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGT0"
FT                   /protein_id="CBL05459.1"
FT                   /translation="MTDIKRILVPVDGSETSDRAIEEAIKIAEVYNSDIHILYVANINQ
FT                   LAINACLSDAILEAVTKAGNEILEKAANKVPEKINVITTSETGSPSVTITDFADEIKAD
FT                   LVVIGSRGLGLVKGVLLGSVSQYVVEHAPCPALVVK"
FT   CDS             217584..217745
FT                   /transl_table=11
FT                   /locus_tag="MHY_02980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05460"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGT1"
FT                   /protein_id="CBL05460.1"
FT                   /translation="MYLSTRKDAAKDFVSVDKALERNTISTNQATKLKKKSSVFIKTDK
FT                   NMKIKLVN"
FT   CDS             217991..218194
FT                   /transl_table=11
FT                   /locus_tag="MHY_02990"
FT                   /product="Signal peptide binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_02990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05461"
FT                   /db_xref="GOA:D4KGT2"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGT2"
FT                   /protein_id="CBL05461.1"
FT                   /translation="MQSGRDKLANMTKEERHEYLDDYRQLTDEQRLAKISEGTGISTER
FT                   LQEIFSTFKDAVKNKLQHKIQD"
FT   CDS             complement(218251..219537)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03000"
FT                   /product="possible tyrosine transporter P-protein (TC
FT                   2.A.45.2.1)"
FT                   /function="possible tyrosine transporter P-protein (TC
FT                   2.A.45.2.1)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05462"
FT                   /db_xref="GOA:D4KGT3"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGT3"
FT                   /protein_id="CBL05462.1"
FT                   /translation="MDSSAYIAIAVFVIAYMLIISEKIHRTIVALTGAMVMIIMGILSQ
FT                   DQAIHHIDFNTIGLLTGMMIMVNITSETGLFNYLAIWAAKKVKANPVKLLVALSALTAV
FT                   CSAFLDNVTTVLLTVPVTFSITAQLKIPVQPFLIAQIMSSNIGGTATLIGDPPNIMIGS
FT                   AVPEMDFMAFLTNLGDICIVIFAITIAIIIAIYHKKLHTTTALQEQVMGMNEKEELKDT
FT                   LLLKKCLTVLFLTIITFMFHAQLGLESATVALAGASLLMLITVSRREKRIANILSRLEW
FT                   LAIFFFVGLFILVGGLVETGVIKAMAAEAIKITSGNVTASTMLILWLSAIASAFIDNIP
FT                   FVATLIPMIKEMGAMGMTNLEPLWWALSLGACLGGNGTLIGASANVVVAGMASAHGEKL
FT                   SFISYLKIAFPLMILSIIVASIYVYIRYL"
FT   CDS             complement(220852..221499)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03020"
FT                   /product="Radical SAM superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05463"
FT                   /db_xref="GOA:D4KGT4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023821"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGT4"
FT                   /protein_id="CBL05463.1"
FT                   /translation="MILYTLHNNGYIDFSEKVKLFPKEKFNMYVNFTNRCNCNCTFCLR
FT                   HLKDDHKLWLKDGEPSLEEIKQAFLNAPMENVADIVICGFGEPTMRLDDLVKLLTFIHQ
FT                   TYPSIKVRMNTNGLSDLEYGKKTAMLFKGLLNTISISLNESTSEKYLEVTRSRFGIKSY
FT                   KAMLDFAVDCKNYIPNVVVTIVDIIGEDEINACKKVCEEYSLNLRIRRYEAN"
FT   CDS             complement(222482..224134)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03040"
FT                   /product="dihydroxyacid dehydratase"
FT                   /function="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05464"
FT                   /db_xref="GOA:D4KGT5"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGT5"
FT                   /protein_id="CBL05464.1"
FT                   /translation="MRSDLVKKGATRSAHRALFNAMGYGPEDLKKPLVGIVNAFNEIIP
FT                   GHIHLRTIADAAKLGVAAAGGTPIEFPAIGVCDGIAMGHPGMKFSLASRELIADSIEAV
FT                   ATAHAFDGLVLIPNCDKIVPGMLMAAARLNIPCVVVSGGPMLAGRYQGKDVSVSTTFEA
FT                   AGKFTAGKITEDEMYDLEAKACPGCGSCSGLFTANTMNTLTEVLGMGLPGNGTIPAAYT
FT                   GARISLAKQAGHVIMDLIAKDIKPRDILTQKAFENAITVDMGIGGSSNTVLHLTAIAHE
FT                   AGIKLPAPLFDEISAKTPYITKLSPAGTHHMQDLNEAGGVCAVMHELSKKGLIHLDALT
FT                   VTGTVEDRIKNSEIQRADVIKTVEAPYRPTGGIAILQGNLAPDYAVVKASAVTEDMLCY
FT                   KGTAKCFNSEEEAIEAITGGKIKDGDVVVIRYEGPKGGPGMREMLNPTAVIAGMGLKVA
FT                   LITDGRFSGATRGACIGHVSPEAMAGGPIAYLEDGDIIDIDILNRKLNVLISDEEMDKR
FT                   KANWVKPEPKVKTGYLSRYAKLTTSASTGAVLE"
FT   CDS             complement(224346..226007)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03050"
FT                   /product="Isopropylmalate/homocitrate/citramalate
FT                   synthases"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05465"
FT                   /db_xref="GOA:D4KGT6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGT6"
FT                   /protein_id="CBL05465.1"
FT                   /translation="MMNVNKYTKGYFMPPTVDMSWTQKEYVDKAPTWCSVDLRDGNQSL
FT                   IIPMSLEEKIEFYKRLVEIGFKEIEVGFPAASETEFEFLRTLVEQDLIPDDVTVQVLTQ
FT                   AREHIIKRTFEALKGVKNAIVHVYNSTSVAQRQQVFRKSKEEIKQIAIDGAKLLKDLTE
FT                   QAGANYRFEYSPESFTGTEPEFALEVCNAVLDVWQPTSDRKAIINLPATVQMSMPHVYA
FT                   SQIAYISQNLKYRENVVLSLHPHNDRGTGVADSEMGLLAGADRIEGTLFGNGERTGNAD
FT                   IITIAMNMFALGVDPKLDFSNMPEIIEMYERVTRMHVYERQPYAGKLVFAAFSGSHQDA
FT                   IAKGMKWREENDEPHWTVPYLLIDPQDVGRQYDADVIRINSQSGKGGVAYVMEQKYGLN
FT                   MPKKMREDFGYCVKGVSDHKHKELMPEEIYQIFQDNYVNVEEPYKLIDFVLNKQADGTF
FT                   KGNVHLMKHGHEVVVETQGNGRFDAASNAIQKEFGIKYDNLIYSEHAMEIGATSRAMAY
FT                   VGITAENGKTYWGAGMDTDIITASIKALISAVNRMD"
FT   CDS             226689..227951
FT                   /transl_table=11
FT                   /locus_tag="MHY_03060"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /function="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05466"
FT                   /db_xref="GOA:D4KGT7"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGT7"
FT                   /protein_id="CBL05466.1"
FT                   /translation="MGMTMTEKILAKHAGIDVVKPGQLINCKLDMVLANDVTAPPAIKE
FT                   FEKIGKPVFDNTKIALVPDHFTPNKDIKSAGLAKIVRDFAHKHNIVNYFEIGRVGIEHV
FT                   ILPEKGIVAPGMVTIGADSHTCTYGALGGFSTGVGSTDLGVALATGEAWFKVPETIKVN
FT                   ITGKKPKYICGKDVMLTLIGMIGVDGALYKALEFAGEGVKELNITDRLTIANMAIEAGA
FT                   KNGIFPVDDETLNYIKDRVTKPYEIVEADSDATYCQTVEINLSELKPVVAFPHLPENTH
FT                   SVESIKEPITIDQVVIGSCTNGRLEDLAIAASILKGHKVHPNVRCIIIPGSQQVYLDAI
FT                   HNGYVDTFIEAGAAVSTPTCGPCLGAHMGIMTAGERCVSTTNRNFRGRMGHVDSEVYLA
FT                   SPYVAAASAILGKIATPEEVE"
FT   CDS             227953..228447
FT                   /transl_table=11
FT                   /locus_tag="MHY_03070"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /function="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05467"
FT                   /db_xref="GOA:D4KGT8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGT8"
FT                   /protein_id="CBL05467.1"
FT                   /translation="MAEKLEGKVWRYGDNIDTDVIIPARYLNSFDPKELASHCMVDIDE
FT                   TFAQNVVEGDIMVGGKNFGCGSSREHAPIAIKASGVPVVIASSFARIFYRNAINTGLPL
FT                   LEIGDDVEKIHANDKLRVDLSTGTIENLTTGDTFHAVPLPGFIQDIAKAGGLINYIKQK
FT                   G"
FT   CDS             complement(229677..230510)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03090"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05468"
FT                   /db_xref="GOA:D4KGT9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGT9"
FT                   /protein_id="CBL05468.1"
FT                   /translation="MEIRKIYSEFNTPVYLSKALNLYYGGWEICCPMHTFGPAIRQHYL
FT                   VHYVTRGKGRLWMNDTCYVIEKDTMFLIRPGITCVYQADKDDPWEYCWICIDGYDVENM
FT                   LNNSGFDKVNPLFFDKSNGEVRDAMLNFIFYFSKYKNNEYMLLSRLYNIFGHMKIQMKK
FT                   QQAKSIHVERAIDYIYENYSKNISVTDIAEYLGIDRTYLYRLFKEEYDMSPQKYLLNFR
FT                   LKTAMNKLEGGNMYIADIAYSCGFNDASAFCHQFKKVYKDTPLNYRRYPQLAIRE"
FT   gap             230887..231426
FT                   /estimated_length=540
FT   CDS             231785..232162
FT                   /transl_table=11
FT                   /locus_tag="MHY_03110"
FT                   /product="Phosphotransferase system IIC components,
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05469"
FT                   /db_xref="GOA:D4KGU0"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGU0"
FT                   /protein_id="CBL05469.1"
FT                   /translation="MFNDIITGAIVAQGGVAIAVALRTQNKKKRAMYISSIIPAFLGIT
FT                   EPVIFSINLRFVKPFICGLIGGACAGATASIMQLAGTGMGITVIPGILLYMDRLPAYLL
FT                   VNFIGLAVAFALTMVCFKPEE"
FT   CDS             232186..233181
FT                   /transl_table=11
FT                   /locus_tag="MHY_03120"
FT                   /product="transcriptional regulator, LacI family"
FT                   /function="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05470"
FT                   /db_xref="GOA:D4KGU1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGU1"
FT                   /protein_id="CBL05470.1"
FT                   /translation="MTQKLTIQDIANLAGVAKSTVSRYLNNGYVSKEKAMLIDKVIRET
FT                   GYKSNFFAKRLKTKQSKLIGIVMPRLDSFSAGKLLTGFNIILQQMGYQALILISELNSQ
FT                   KELDNISQLIQQGVDGIIVDSININDNHLKLINQANIPIIFTGQSHDKVNFIKVDDINA
FT                   GKLMGEYIASLNHQQVVFLGVSPQDNAVGVDRYEGFKQGFLANNPQGKISFVQTDYSLE
FT                   QAYNLGDTIVSFNPSAVICATDNIALGLLRYFHEKKIHVPQDISLAGFGGYPVGSISYP
FT                   SLTSLAFDYKHLGIKTVEKLLSMLQNQPVTSEYDHNMNLIIRESTRLAKI"
FT   CDS             233318..233674
FT                   /transl_table=11
FT                   /locus_tag="MHY_03130"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05471"
FT                   /db_xref="GOA:D4KGU2"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGU2"
FT                   /protein_id="CBL05471.1"
FT                   /translation="MNLDNNAHSVFWLNYHLVLVIKYRRKVFDDNISSRAKEIFEYISP
FT                   KYNITLQEWNHDEDHVHILFRAHPKSEISKFINAYKSASSRLIKKSFQVFVKNYGKNIF
FT                   GVKVFVCSLQAVRQ"
FT   CDS             233881..234063
FT                   /transl_table=11
FT                   /locus_tag="MHY_03140"
FT                   /product="Probable transposase."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05472"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGU3"
FT                   /protein_id="CBL05472.1"
FT                   /translation="MLHNTPAQYKEKYLWLKEVDSLALTNAQKNLETAYDNFFKNTKIG
FT                   FPKFKAKRKQKSIYH"
FT   CDS             complement(235013..235648)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03160"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 1 with third motif having Dx(3-4)D or Dx(3-4)E"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05473"
FT                   /db_xref="GOA:D4KGU4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGU4"
FT                   /protein_id="CBL05473.1"
FT                   /translation="MSYKVYLFDFDYTLANSEVGIVKCFELLMEQEGYPLRPKDEIKRT
FT                   IGLPMSEALSILTEEVDEAKIQELKDKYTVFADLYMTENTYLYDDTKMVLKTLKERGAK
FT                   IAIISSKTRRRIMQTLTRDKIDDLVEFIIGSEDKYAYKPAPDGILEAVKRLNVDKKDVI
FT                   YIGDNIVDAQAAQNAQVDFAGVLTGNNIKADFAKFPHVKIMNCLQELI"
FT   CDS             236749..236853
FT                   /transl_table=11
FT                   /locus_tag="MHY_03180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05474"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGU5"
FT                   /protein_id="CBL05474.1"
FT                   /translation="MCNIIDKNKGNDTFVTNFGNRALLSLFIQPILAR"
FT   CDS             complement(236955..238085)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03190"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05475"
FT                   /db_xref="GOA:D4KGU6"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGU6"
FT                   /protein_id="CBL05475.1"
FT                   /translation="MDSIVDDAPPVDESKPYIPVTADNLQDMTAQAAILIDATTGRVLY
FT                   EKNPDAKAMPASTTKMMTCILGLENANDDDIVEVDKRAVGVEGSAIYINEGDKIKMSEL
FT                   LQATMLASGNDGAAAIAYYVGKGSLETFVQMMNDKAKEIGATNTHFNNPHGLTDPNHYT
FT                   TARDLAKIARYAYQNEKFRKIVSTKEQEIQWVNPAERKDIYGSTNRLLWNYDDVTGIKT
FT                   GYTDAAGGCLVASAQKNGITLIAVVLKTSDSRARFVEGRALLDYGFKHIKEMKTVDEQK
FT                   LISSIYTHNSTNYKTTVKPVQPFTYLVMDTDNVNDFSWKMNLPAYIDAPLKQGAKVGTI
FT                   DLLYQGNVVGSVDMVTTEEVTEGFNLLGFLHKLFFS"
FT   CDS             238975..239238
FT                   /transl_table=11
FT                   /locus_tag="MHY_03210"
FT                   /product="Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05476"
FT                   /db_xref="GOA:D4KGU7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGU7"
FT                   /protein_id="CBL05476.1"
FT                   /translation="METTLIIENKTGLHARPASMFVQEANKFSSKIKLTAKGKTVDAKS
FT                   ILMIMSLGLTQGTELTISAEGDDAQAALDALTGLIKNKFGEE"
FT   CDS             240988..241350
FT                   /transl_table=11
FT                   /locus_tag="MHY_03230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05477"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGU8"
FT                   /protein_id="CBL05477.1"
FT                   /translation="MTDNINSAHGKEQNIKMNLLKWLNEGKDPYSIIYELAKYLETVSS
FT                   EPGYADIILNDIRTVYGIGLNEKTVLSDELLEVRTRLAKLEEAFKQATSDEVQSHLKFA
FT                   IEHHKKKIQELEHKLM"
FT   CDS             244079..245353
FT                   /transl_table=11
FT                   /locus_tag="MHY_03260"
FT                   /product="S-layer homology domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05478"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGU9"
FT                   /protein_id="CBL05478.1"
FT                   /translation="MSKKTLVSAITAALVVGAASTTFAAANPFSDVPADSWAYDAVTTL
FT                   AADGVIDGYPDGTYKGQNTMTRYEMAQIVARAMAKTDLEKADKALVDKLAAEFAEELDN
FT                   LGVRVADLEKKSDNVKWGGELRYRYYDIDRDSKAGDETHNKVLFRLEPKAYIGNSGWTA
FT                   NARLDYEMNLSTDENDKNVEVDRAYVEGPLFGATVTAGRTPVFTAQGLLFDDRISGGTV
FT                   AFGSDEFKTTLAAGRYSEVDHDPTVNFANAKDVTAEYYGVQFDYTPNDSLALNAGYTAL
FT                   TGIDASDVALEAIGYGSDNTANIWYVGGKYAFDKNVAFVGEYAQNTDADTEDQAWTAEL
FT                   QYKGANAADAGSWGMYAGYRQIETFASIAPTYDDIIGAGYKGAVVGASYVPAENILATI
FT                   EYFDGEETISGQDASKFFANVDFFF"
FT   CDS             246194..246766
FT                   /transl_table=11
FT                   /locus_tag="MHY_03280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05479"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGV0"
FT                   /protein_id="CBL05479.1"
FT                   /translation="MMAMIKINAKNITAEYYGVQFDYAPTEKIAVNAGYTALTGIEAAS
FT                   WETLGGYNDNSASIWTVGGSYAFDSNVKLVGQYAENTDADAYEKAGIVKVQYKGTDVAD
FT                   AGSWGAYAGYRHLGDNVAIAPTYDDAAANQKGYVVGASYVPAENILATIEYFDGKDMDT
FT                   DTDASKFFANGNIQRADLMSALFYIYF"
FT   CDS             247124..248446
FT                   /transl_table=11
FT                   /locus_tag="MHY_03290"
FT                   /product="S-layer homology domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05480"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGV1"
FT                   /protein_id="CBL05480.1"
FT                   /translation="MSKKTLVSAITAALVVGAASTTFAANNPFSDVPADSWAYDAVSTL
FT                   AADGVIDGYPDGTYQGQNTMTRYEMAQIVARAMAKTDLEKADKALVDKLAAEFADELDN
FT                   LGVRVADLEKKSDNVVWKGELRYRYVDASSDATDRMSGHTKKYNDNDTSQVMFRLEPKA
FT                   YIGDTGWTANVRVDYEMKADEDANGKTVVARAYAKGPIGHNTTVTAGRIPLLDTYGMLL
FT                   DEHMSGAQIDIASGSDKNFTTSLLAGRYNPGHDNPDILPGQTLKDFTADFYATQFNYKS
FT                   EKFDANAMYAVMTNIEPGSTNWGTWAGQTVYDYDKMNIWSVGGLYRFDNNWGLLGQYAV
FT                   NTESDNSDDKQAYMAELQYKNANIADPGSWGAYVAYRHFGKDVTIATTYKDVFNNQKGF
FT                   AIGASYVPVENLLASVKYFDGKDIDSDTDADRFYLNLDFFY"
FT   CDS             248880..250892
FT                   /transl_table=11
FT                   /locus_tag="MHY_03300"
FT                   /product="ribonucleoside-triphosphate reductase class III
FT                   catalytic subunit"
FT                   /function="ribonucleoside-triphosphate reductase class III
FT                   catalytic subunit"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05481"
FT                   /db_xref="GOA:D4KGV2"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGV2"
FT                   /protein_id="CBL05481.1"
FT                   /translation="MIKTIKKRTGDIVKFNAQKITDAIKKANMESIDETFSKEQLSTIT
FT                   NNVIKALKNLKTPGVEQIQDAVEKVLIAGNFASTAKAYILYRAEHTKLRQAKADLMDIY
FT                   DELTFTKAKDADIKRENANIDADTAMGTMLKYGSEGSKYFITSHILPKDIAVAHMDGDI
FT                   HIHDMDFYMLTETCCQIDLLKLFKNGFSTGHGYLREPNDIRSYAALACIAIQANQNEMH
FT                   GGQAVPMFDYCMAPGVAKTYHKQYYKALGYYFNAMLDMKLEDASLLCKKIEQSLPIKIS
FT                   MSTADKFGKLLVDFLPKHQREHNYQEINEQTTQMAHKFAINTAWNETNAATYQAMEAFI
FT                   HNLNTMNSRAGAQVPFSSINYGTDTSPEGRMAMRNLLLATDAGLGDGETPIFPVQIFKV
FT                   KEGVNYEKDDPNYDLFRLAMKTSAKRLFPNFSFLDAPFNKKYYKPNDYNSEVAYMGCRT
FT                   RVMGNVYDPTREVTCGRGNLSFTSINLPRLAIEAKGDINKFYKSLDDMIDLVIRQLLHR
FT                   FKIQCAKIGKNYPFLMGQNIWLDSDNIGEYDTVSEVLRHGTLTVGFIGLAETLKALIDK
FT                   HHGESAEAQKLGLAIIGHMRKRMDDEAQKTKLNFSLIATPAEGLSGRFVKIDRKIYGSI
FT                   PGVTDREYYTNSFHIPVYYPISAYKKYNLKHLTII"
FT   CDS             250922..251158
FT                   /transl_table=11
FT                   /locus_tag="MHY_03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05482"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGV3"
FT                   /protein_id="CBL05482.1"
FT                   /translation="MDGDPTKNLTAFEAIIRCMHDNGIGYGSVNHPVDRDPVCGYTGII
FT                   NGVCPKCGRSEAAHKRHVILKRMRDNCCSATSI"
FT   CDS             251207..251491
FT                   /transl_table=11
FT                   /locus_tag="MHY_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05483"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGV4"
FT                   /protein_id="CBL05483.1"
FT                   /translation="MLVNGVEVKVNGLTDITEKEIVNYINYIKENSSETLASLTISDAG
FT                   DGEVALDYRTQPAQFERIRRITGYLVGTVDRFNNAKRAEEHDRVKHGLN"
FT   CDS             251478..251888
FT                   /transl_table=11
FT                   /locus_tag="MHY_03330"
FT                   /product="Pyruvate-formate lyase-activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05484"
FT                   /db_xref="GOA:D4KGV5"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGV5"
FT                   /protein_id="CBL05484.1"
FT                   /translation="MALIKIAGVVNDSIVDGEGFRFTIFTQGCYHNCPQCHNPQTHDVN
FT                   GGHEVDTDDLLSQICENPLLNGVTFSGGEPFLQAKPLAQLAKEVHKRGLNITTFTGYTL
FT                   EQLQNMHNPDIDELLNQTDVLIDGPFLIEKKT"
FT   CDS             252161..252865
FT                   /transl_table=11
FT                   /locus_tag="MHY_03340"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05485"
FT                   /db_xref="GOA:D4KGV6"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGV6"
FT                   /protein_id="CBL05485.1"
FT                   /translation="MLEDLKKIVFEANLMLPKYHMVTFTWGNVSGIDREKGLMVIKPSG
FT                   VEYDTMKAEDMVVVDINTGKVVEGNYNPSSDTDTHIKIYQACPEIGGVVHTHSRYATSW
FT                   AQARCDIPALGTTHADDFYGPIPCTRPMTAEEIAGSYEAETGNVIVETFKERGIKMMDV
FT                   PGVIVYSHGPFTWEKDPIKAVKKAVVLEEVAMMAYHAVTIGNNFEPMQQELLDKHYLRK
FT                   HGANAYYGQKKK"
FT   CDS             253299..253646
FT                   /transl_table=11
FT                   /locus_tag="MHY_03360"
FT                   /product="Uncharacterized membrane protein, possible Na+
FT                   channel or pump"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05486"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGV7"
FT                   /protein_id="CBL05486.1"
FT                   /translation="MAIIGALQDGLSGDYSLLLTKAFLDGVICMVFASTMGAGVLLAAL
FT                   PLFIYQGLITLCASFISPYLTTAMINDICYIGNILITIIGINLTFNNIIHIRVGNMLLA
FT                   LIVPVVYHIFS"
FT   CDS             complement(254613..256283)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03380"
FT                   /product="Glycosidases"
FT                   /EC_number="3.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05487"
FT                   /db_xref="GOA:D4KGV8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGV8"
FT                   /protein_id="CBL05487.1"
FT                   /translation="MGELKWWQKTVVYQIYPKSFCDSNGDGIGDIPGIISKLDYLQDLG
FT                   VGAIWLCPIYPSPLVDNGYDISDYCSVAKEYGTMEDMERLISEADKRNIKIVMDLVFNH
FT                   TSNKHKWFEESRSSKDNPKRDWYIWRDGKEDGSAPTNWRSIFGGSAWTLDEKTNQYYLH
FT                   TFASAQPDLNWENKEVRQALFDAANFWLDKGVRGFRIDAIVYIKKPSEFKDLPVDGADN
FT                   LASIAKATTYQDGILDFLHEFREKVFNRADIFTVAEADGVYPSDFDKWIGENGAFDMSF
FT                   DFSHIRLGFDEDCTWHKRKSWKLIDIRKCFTEDEEATKDNGWVPVYFENHDLPRCTNYF
FT                   FPQGTDTKLAAKFIATILLTMRGTPFIYEGQELGMTNIKWPSIKMYNDISSIGQYELAL
FT                   KDKLTPKEAMKGVWKYSRDNARSPMTWNSGSKAGFTTGRPWLPLNDEYPNLNVETETED
FT                   ENSVLNYYKNLIKLRKQYPALIEGDYEELLSYSPGIYAYARTTKDKSERIIVIANTTAK
FT                   IRGYKIPELKGATLLASTYGNREATLLRSYEVRVYKVKK"
FT   CDS             complement(256360..256800)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03400"
FT                   /product="Outer membrane protein (OmpH-like)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05488"
FT                   /db_xref="GOA:D4KGV9"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGV9"
FT                   /protein_id="CBL05488.1"
FT                   /translation="MKKQLLAMICSALFMLGIGGTASAAEVYQPATTASVATINYQYVL
FT                   ANIPESKSIQENMNKLTEEAQKEFEKSVNEKMSPADIQKVRARVATDLRQKQINLVKPV
FT                   QEKINNAIKQVAQEHGYSVVITSDVALFTAVDITEEVLNAAK"
FT   CDS             256957..257247
FT                   /transl_table=11
FT                   /locus_tag="MHY_03410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05489"
FT                   /db_xref="GOA:D4KGW0"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGW0"
FT                   /protein_id="CBL05489.1"
FT                   /translation="MISYTKYQTLRKDLLCILYPKIKSKQIKVKNRQTKEKATIEAEKV
FT                   LYLCLEQGLSFKISQGCVLTLAPPLIISPEELNLAMDKLEYALTQVFRHNI"
FT   CDS             complement(257302..257922)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05490"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGW1"
FT                   /protein_id="CBL05490.1"
FT                   /translation="MKSVHDIEFKQYGRVLDVDTAEFVATMKAKEAIKEGVVYEPSDAD
FT                   LEALPLFKQMQDEVYGGLEVEFGFCSGYNNKLNAVEYHRSSEIDIAATDLILMLGRQQD
FT                   IDYTNNTYETKNIECFFVPAGTAVELYATTLHYAPCKENNEEFRCGVVLPKGTNLPLQV
FT                   KPVENKGENQLLFAANKWLIGHSESGVDKDGGFIGLIGENTTI"
FT   CDS             complement(259112..260140)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03440"
FT                   /product="Beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05491"
FT                   /db_xref="GOA:D4KGW2"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGW2"
FT                   /protein_id="CBL05491.1"
FT                   /translation="MYYLFVAEGGTTYQHSETVARCKTIDGEYETDPNYPLLSAWKEPT
FT                   NKLQKCGHASLIETQNGEWYLAHLTGRPLAFDKYPIREREQHAYCPLGRETAIQKITWE
FT                   NGWPVVVGGKAGLEEVEAPNLPEQKWEKTYPEKDDFDDDTLNINFASLRVPLTEDMATL
FT                   KARKGFLRLYGKESLTSLFKQSFVARRWQAFNFDAATSVEFEPDTFQQMAGMVCYYNTE
FT                   NWTTVHITWKENVGRIIDIVCADNGNFTMPLAGNEIAIPEDVKAVHFKVEVRYDKYYYL
FT                   YSFDGKTYNKIPLAFDSYKLSDDYIRGGGFFTGAFVGINCVDISGMNKPADFDYFMYKE
FT                   LE"
FT   CDS             complement(260193..260723)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03450"
FT                   /product="Beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05492"
FT                   /db_xref="GOA:D4KGW3"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGW3"
FT                   /protein_id="CBL05492.1"
FT                   /translation="MKIQNPVLRGFNPDPSICRAGDDYYIATSTFEWFPGVQIHHSKDL
FT                   VNWHLVAHPLNEVKYLDMKGNPNSGGIWAPDLSYADGKFWLIYTDVKVVDGMWKDCKNY
FT                   LTTCDTVDGVWSDPIELNGSGFDASLFHDIDGKKYLVNMYWDHRVYNHNFYGICLQEYS
FT                   VEEKRLIGNQNYL"
FT   CDS             complement(260737..261339)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03460"
FT                   /product="Cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05493"
FT                   /db_xref="GOA:D4KGW4"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGW4"
FT                   /protein_id="CBL05493.1"
FT                   /translation="MNNHTVITISRQYGSGGRELANKIAEKLGYKLFDRQIVHLAAAQI
FT                   GIDDLSEDNLRNLENNVTPLSLSFIPFFNFGSRNTGFNNDIFINEAKAIRKLASDNDCV
FT                   ILGRCADFILEDLPNHYSFFICANDDYREKRGKEVYDGKSLKELNEEDNKRANYYKYYT
FT                   KQNWGDPKNYDMIINTSKVSLDKAADIIISYVKSNKK"
FT   CDS             complement(261397..262014)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05494"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGW5"
FT                   /protein_id="CBL05494.1"
FT                   /translation="MFAVNGSSGMYYVKYIFHDENIFGMLVLFGNVPMMLSCLFFPVIA
FT                   NRFGKWNCMIGGYVVMIIGFGIIALFPDNYYCALLGNVIAGIGRAPHNAGLFALVADVV
FT                   DYGEWKTNKRIEGVTYSVTSFGMKVGAGLGGAVTGIVLAMGNYDGSLAVQSDSAITAIM
FT                   AICAYIPIGICVLGILIMLTANIDKIYPQVVRDLAIRHAKEN"
FT   CDS             complement(262316..262729)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05495"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGW6"
FT                   /protein_id="CBL05495.1"
FT                   /translation="MATQKISLGEKLAFGAGDCGCNFVWNVLALFMTIYYTDSVMISAA
FT                   AVGGIMLASRIFDGISDLVMGAILDKTKTRWGKARPWILWSAPFMAIALILTFSVPDIS
FT                   ETGKVIYAFCTYFSLQLLFIQHLTCHIMHYYHL"
FT   CDS             complement(262765..264291)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03500"
FT                   /product="xylulokinase"
FT                   /function="xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05496"
FT                   /db_xref="GOA:D4KGW7"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGW7"
FT                   /protein_id="CBL05496.1"
FT                   /translation="MMKYLLGLDIGTSATKTVLFDETMKVIASASEEYPMYQPQNGWAE
FT                   QNPKDWYNASLHTIQEVLAKSKINPEDVKGVGLSGQMHGLVMLDENNEVIRPSIIWCDQ
FT                   RTVKECEEITAKVGAERLIEITANPALTGFTASKILWVRNNEPENYARCKHILLPKDYV
FT                   RFCMTGEYATEVSDASGMQLLDIPKRQWSDEILEKLDIDKNLLAKVYESPEVTGHINDE
FT                   FAKLSGLSTDTVVVGGAGDNAAAAIGTGIVKDGKAFTTIGTSGVVFAHTDKLSIDPKGR
FT                   VHTFCCAVPGCWHVMGVTLAAGLSLKWFRDNIADNYKAKAEELGKDPYVLMNEAVAKIP
FT                   CGSDRLMYLPYLMGERTPHLDPNCRGVFFGLSAIHTKENMMRAVMEGVAYSLSDCYDIL
FT                   KEMGVTVDEMMACGGGGKSPVWRQMLADMFECEVKTLTSEEGPALGVAILAGVGAGIFK
FT                   DVVSACDEFIKTGTNCSPIKEESEYYKQGHALYKKVYAQLKDCYQDLAKL"
FT   CDS             264640..266127
FT                   /transl_table=11
FT                   /locus_tag="MHY_03510"
FT                   /product="L-fucose isomerase and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05497"
FT                   /db_xref="GOA:D4KGW8"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGW8"
FT                   /protein_id="CBL05497.1"
FT                   /translation="MFNNIPDVKLGIIAVSRDCFIVSLSENRRKAIVETYTKQYGEIFE
FT                   AQTVVENEIDMLKAVEEVKTAGCNALVVFLGNFGPETPETLIAQKFDGPVMYVAAAEET
FT                   GKDLINGRGDAYCGMLNCSYNLGLRKIKAFIPEYPVGTADEIAEMINEFNPVARALIGV
FT                   ANLKIITFGPRPQDFFACNAPIKPLYDLGVEIEENSELDLLVSYKEHADDPRIDDIVKD
FT                   MAEEMGTANPYPDLLKRMAQYELTLLDWAEKHKGSRKYVVFANKCWPAFPSQFGFEPCY
FT                   VNSRLVSRGIPVACEVDIYGALSEYIGTCVSGDAVTLLDINNSVPKDLFEEDIAPKYKN
FT                   YTLKDTFMGFHCGNTPMCKLAKGAIKYQLIQNRLLENGGTPDITRGTLEGDIAPGKITF
FT                   YRLQSNAAGQLRSYIAQGEVLPVATRSFGGIGIFAIPEMGRFYRHVLIEKQYPHHGAVA
FT                   FGHYGKALFSIFKFLGVEDVAFNQPKTMMYPTENPFA"
FT   gap             266278..267212
FT                   /estimated_length=935
FT   CDS             complement(267498..268481)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03530"
FT                   /product="Predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05498"
FT                   /db_xref="GOA:D4KGW9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGW9"
FT                   /protein_id="CBL05498.1"
FT                   /translation="MKIGIAGNGKIVHEMIGVTKNIQDLEIVAICSRPQSRQKAEEIAD
FT                   KFNIDKIYTDYNQMLEDGEIDFIYVAVANSVHYEYTKKALEAGKNVICEKPFTITAKQI
FT                   QELIDLAKAKNLFLFEAITILYAPNYQYIKENLKQIGQLRYVHANYAQYSSRYDRYLNK
FT                   DVAPAFSPEHAGGALYDLNIYNLHFVMGVLGTPKEVIYRPNLGFNGIDISGTALLDYDD
FT                   YTVVCSAAKDSESISGIVFQGEKGYMELVGAPNACALVKVHKKGEEEILINKEKYNHRM
FT                   VNEFVAFTEIFKQQDLTTCYKTLEHSLNVMKVLEQARISGKVEFNI"
FT   CDS             complement(269406..269933)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03550"
FT                   /product="Bacterial regulatory proteins, gntR family."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05499"
FT                   /db_xref="GOA:D4KGX0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGX0"
FT                   /protein_id="CBL05499.1"
FT                   /translation="MKDKLIEFVSIQLDKDLKEPLYVQLYEQIKLMIKQHLLSPGYKLP
FT                   AVRNLAQNLQVNPSTVVNAYKELEKNGFIFSKRGSGSYVAEQVINTIDELEENNHIPID
FT                   LTDDLKILQGQKNVINMSTISLNPDMISIETFKQVVNKILERDKGYAFTYQDSQGYLPL
FT                   RQSITQELAKKG"
FT   CDS             270050..270928
FT                   /transl_table=11
FT                   /locus_tag="MHY_03560"
FT                   /product="pyridoxal phosphate synthase yaaD subunit"
FT                   /function="pyridoxal phosphate synthase yaaD subunit"
FT                   /EC_number="4.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05500"
FT                   /db_xref="GOA:D4KGX1"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGX1"
FT                   /protein_id="CBL05500.1"
FT                   /translation="MNNRYNLNKNLAQMLKGGVIMDVTNVEQAKIAQEAGAVAVMALER
FT                   VPADIRREGGVARMSDPKMIREIKEAVSIPVMAKARIGHFVEAQILQAIGIDYIDESEV
FT                   LTPADDENHIYKQDFDIPFVCGARNLGEALRRIGEGASMIRTKGEAGTGNVIEAVRHFR
FT                   TMQKDINRVKSATSSELMHIAKEMGAPFDLVCYVHEHGKLPVVNFAAGGIATPADAALM
FT                   MQLGVDGVFVGSGIFKSGDPQKRAKAIVEATTFYNDPEKLAKISENLGEAMVGIEIDTI
FT                   PQEQQMAKRGW"
FT   CDS             270935..271510
FT                   /transl_table=11
FT                   /locus_tag="MHY_03570"
FT                   /product="pyridoxal phosphate synthase yaaE subunit"
FT                   /function="pyridoxal phosphate synthase yaaE subunit"
FT                   /EC_number="2.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05501"
FT                   /db_xref="GOA:D4KGX2"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGX2"
FT                   /protein_id="CBL05501.1"
FT                   /translation="MNKIIGILGMQGAIAEHQEILLQIPHTKTRIVKTAKDLDCIDGLI
FT                   LPGGESTAIGKLLDYFSLKEILRQKIISGLPVFGTCAGLILLAKNIENQTNTHLATMDI
FT                   TVKRNGYGSQLDSFSTNLLIPTIDKNMPIPLVFIRAPYITKTDKDVQILATLDNKIIAA
FT                   RQKNMLVSSFHPELTCDLRFHQYFLSMI"
FT   CDS             complement(271570..272799)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03580"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05502"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGX3"
FT                   /protein_id="CBL05502.1"
FT                   /translation="MDLHNLLVFQDLFNDDVFRDIEKTISRENLNKGAVAAKLINKAEQ
FT                   LGLSGNIIRSYMIYTVAHQSNCVSYAVEKSGGKIGKSLYQAFCHDIELIEKLLLLKPSL
FT                   LLDCDLLDDYEPTNINQSTAFNLLVENLDKAQTSKDKADVFINYYRTFGSGDMADYRAF
FT                   RWDSDEDSLVGIKHFEMMKLQDLIGYEYQKQELLANTKAFVEDKPANNVLLVGARGTGK
FT                   SSGVKAVVNSFFDKGLRLVQLTKEQLIDLPVIMEHLRDFSSKKFIIFLDDLSFEEFEVE
FT                   YKYLKSAIEGGASAKPENVLIYATSNRRHLIKESYKDRGANDDDMHRSDTLNETISLSD
FT                   RFGLIIYYMAPNQQEYLDIVDGLLKQHGIELSKEELRVKAGAWEKEHSGRSGRIAQQFV
FT                   THYLGQVYNK"
FT   CDS             complement(273296..274519)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03600"
FT                   /product="Phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05503"
FT                   /db_xref="GOA:D4KGX4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGX4"
FT                   /protein_id="CBL05503.1"
FT                   /translation="MDPILKLQNGSDVRGVAVEGVADEPVTLIPEYANRIVQAFVLWLS
FT                   QKSGKKASELKIAVGHDSRISAPMLKQQALMAIVAQGATAVDCSMATTPAMFMSLVYEE
FT                   TKYDGSMMITASHLPFNRNGIKFFEPENGGMEKKDLTDMLKIACELTEQTVDISNVEKF
FT                   DLVSLYAENLCTKIREGINSKDNYDKPLTGNHIVVDAGNGAGGFFAQKVLAQLGADTTG
FT                   SLYLDPDGHFPNHIPNPENKEAMDAIRGAVLNNKADLGLIFDTDVDRMSAVFSDGQEVN
FT                   RDALIAMMAAILVKDYPNSTIVTDSVTSDKLTAFLEGELQLKHHRFQRGYKNVINECKR
FT                   LNEEGVVSPLAIETSGHGALKENYYLDDGAYMAVKLLIAAAKTKAEGKTLNSLIENLNH
FT                   NLKQQNIA"
FT   CDS             complement(274780..276330)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03620"
FT                   /product="ATP-dependent DNA helicase, RecQ-like"
FT                   /function="ATP-dependent DNA helicase, RecQ-like"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05504"
FT                   /db_xref="GOA:D4KGX5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGX5"
FT                   /protein_id="CBL05504.1"
FT                   /translation="MMLSKARQILQKFYGYEDFRPGQKKVVESLLNKNDTVAIMPTGAG
FT                   KSICFQIPALLFEGVTLVISPLISLMKDQVDSLRQLGIAAVYINSSVSKAQLYKDLQDI
FT                   SAGFYKIIYIAPERLTSEYLPDSFKNLNISMVAVDEAHCLSQWGHDFRPSYRNILNFTN
FT                   SLRIKPIISAFTATATPEVKTDIINLLGLKQPNVFVTGFDRPNLYFSVLRGEVKDKFVI
FT                   DYVKKHQDEAGIIYVGTRKDVDALQVLLEIKGIKAGRYHAGMTDEERNQMQEDFLYDNL
FT                   SVMVATNAFGMGIDKPNVRYVIHYNMPKNMEAYYQEAGRAGRDGLSGNCILLYSPQDTQ
FT                   LQKFLISKSTESEIRQQLEYKRLQSMVDYCHTPQCLRAFILHYFGEFDVEEHCDNCSNC
FT                   KLEGELIDITIDAQKVLSCVYRMHERFGVKMIAEVLKGSKSAKVKQFNFERLSTYGLMK
FT                   ERKLKDISDLILRLSAMQYLDITESQYPVVTLNELSWQVLRGQKKVWQKMVIVKKSQG"
FT   CDS             complement(276317..276778)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05505"
FT                   /db_xref="GOA:D4KGX6"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGX6"
FT                   /protein_id="CBL05505.1"
FT                   /translation="MVGGDKEVYEEVLPIFEAMGKTICYFGKAGSGQYAKMSNQIAIAS
FT                   NMMGVCEAVAYAKKCGLNPQDLLDVISTGAAGSWSLSNLAPRMLKGDFAPGFFIKHFIK
FT                   DMKIAIESADEMNLDLPGLKLAKSLYEKLAKEGYENNGTQALLKYYDAE"
FT   CDS             complement(276762..277190)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03640"
FT                   /product="NAD binding domain of 6-phosphogluconate
FT                   dehydrogenase."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05506"
FT                   /db_xref="GOA:D4KGX7"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGX7"
FT                   /protein_id="CBL05506.1"
FT                   /translation="MQKLKIGFIGIGVMGKSMADNLLKAGYEVMVYTRTKQKAESLLAK
FT                   GAKWFDSAKALAQNVDVIISMVGYPQDVAEIYLGENGVIKNLKPQSIIIDMTTSSPKLA
FT                   QEIYQEAQKYEIKSLDAPVSGGDVGAKKWYTCHYGRWR"
FT   CDS             complement(277699..278160)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03660"
FT                   /product="CBS-domain-containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05507"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGX8"
FT                   /protein_id="CBL05507.1"
FT                   /translation="MKKDEILSAIGIFFGIGIVALVSKSIDNNLLLAPFGATSIIAFLL
FT                   YDSEYAQPRNIILGYIITSIVGILMAYILGHNWIVYALGVAIAMLVKSWFKAIHPPSAA
FT                   MPIILLKANEQGIINYFLFDVIPGICLLVFIAIVYNRFILHRDYPLWHR"
FT   CDS             279105..280322
FT                   /transl_table=11
FT                   /locus_tag="MHY_03690"
FT                   /product="Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05508"
FT                   /db_xref="GOA:D4KGX9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGX9"
FT                   /protein_id="CBL05508.1"
FT                   /translation="MMTAKMIINKLGTLILIAMILGIAVGLALGETAQIFAPIGDLFMQ
FT                   LIKMVVVPMVLFSLIGGAASLGNSSSAGKIGLLTFIYYTITTIIATVIGLIFSVVFKPG
FT                   EGISLASLGVQASSEYADKGGIPGFWETLIGFVPANPFEALVSGNILQIIVFSLFIGFA
FT                   IANLSGEKKEFLLKFFNYMTEVTVNIMTAIMCIAPLGVFGLMAGSIGKFGSEILVKLAY
FT                   LVVLYIIVLLIVNYGVIGGSVAMFSKCTTFKQFFKSMYKVQLFAFTTASSMATLPLNMK
FT                   TTIEELHVSKETTSFALPLGATINMNGNAAYYAMAAIFFAQMFGIELTITQYIAIIFTS
FT                   TVGAVGQAGVPGPTLLVVAVLMSANIPIEALPILFGVDRIFDMLRTAVNITGDAACATI
FT                   VDRFRE"
FT   gap             280333..281442
FT                   /estimated_length=1110
FT   CDS             complement(282155..282763)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03710"
FT                   /product="Lysine efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05509"
FT                   /db_xref="GOA:D4KGY0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGY0"
FT                   /protein_id="CBL05509.1"
FT                   /translation="MIYFMQGLLFGLAYVMPIGIQNMYVINSAMQRNVKIICLTTIFVI
FT                   IFDISLAISCYLGIGILLDKYKFLRDFVRFIGAMVIFYIAFDLWRTNSKLEIKSTHDYR
FT                   LSKIIISAFSVAWLNPQAIIDGSLILGSFRTSLAGDSSIYFIIGVCIASGLWFSVLAFI
FT                   AHKFINKLYRFVKYINLICAIILFLYGLNLLYMFCLDLL"
FT   CDS             complement(282977..283771)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03720"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /function="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.1.1.158"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05510"
FT                   /db_xref="GOA:D4KGY1"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGY1"
FT                   /protein_id="CBL05510.1"
FT                   /translation="MQNLNECIAKLKQILPEDSVLIDEPMSKHTTFQIGGPADCFVMPS
FT                   TVEEAIAVIKIVKEYDVPLTMLGNGSNLLVMDKGIRGIVVNLNERFAKITRDGNFIKAQ
FT                   CGALMVDVSKFAGEASLTGLEFAVGIPGSIGGCIFMNAGAYDGEIKNVVHRVSAIDKEG
FT                   NLVYYTNEEAQFSYRHSIFQDNDNLILEVELELQEGNQDEILAKMADLTNRRETKQPLE
FT                   YPSAGSTFKRPPGYFAGTLIDQTGLKGLTVGGAQVSKNMLVL"
FT   CDS             complement(284287..284538)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03740"
FT                   /product="Polyribonucleotide nucleotidyltransferase
FT                   (polynucleotide phosphorylase)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05511"
FT                   /db_xref="GOA:D4KGY2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGY2"
FT                   /protein_id="CBL05511.1"
FT                   /translation="MINALTAEVEVGAVYKGKVTRIMNFGAFVEILPGKEGLCHISQLA
FT                   KERVGKVEDVVNIGDELEVKVTEIDRQGRVNLSHKVLL"
FT   CDS             complement(284631..286355)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03750"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05512"
FT                   /db_xref="GOA:D4KGY3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGY3"
FT                   /protein_id="CBL05512.1"
FT                   /translation="MYTFETTLGGRSFVVETGKMAKQANGAVLVRYGETVVLVTATASA
FT                   EPREGVDFFPLTVDYEEKMYAVGKIPGGFIKREGRPAESAILNSRLIDRPIRPLFPEGY
FT                   RNDVQIVATVLSVEQDNAPEIAGMIGASCALSISDIPFLGPIAGVRVGRIDGEFVINPT
FT                   VEQREKSDLNLTVAGSYDAVMMVEAGANELSEEVVLDAILFGHEEIKRLVKFQQEMMEK
FT                   CGKEKHQPKLFTVPEELVNAIHEYTYDKFDAAVRDADKLRRDEHVAEVKAQAKEHFLEL
FT                   YPEMDMEIDYVLYKTLKGIVRHMITHEKIRPDGRGLEEVRPISCEVGILPRTHGSALFT
FT                   RGQTQILNVTTLGALGDEQVIDGIGDDTSKRYIHHYNFPGYSVGEARPMRSPGRREIGH
FT                   GALAERALVPVIPSVEEFPYTLRLVSEVLESNGSSSMGSVCGSTLSLMHAGVPIKKPVS
FT                   GCAMGLVKDGDAYTILTDIQGMEDALGDMDFKVAGTPDGITAIQMDIKVDGLSREILAA
FT                   ALAQAKRGREFILSKMLECISEPNKELSPYAPRVNSMKIPTDKIRDVIGPGGKTIKK"
FT   CDS             complement(286474..286569)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03760"
FT                   /product="Ribosomal protein S15."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05513"
FT                   /db_xref="GOA:D4KGY4"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGY4"
FT                   /protein_id="CBL05513.1"
FT                   /translation="MVGHRRRLLSYLYDIDVERYRALIAKLNLRK"
FT   CDS             complement(286572..286739)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03770"
FT                   /product="Ribosomal protein S15P/S13E"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05514"
FT                   /db_xref="GOA:D4KGY5"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGY5"
FT                   /protein_id="CBL05514.1"
FT                   /translation="MLTQEQKLQIIQDNATHEGDTGSPEVQVALLTARIAYLTEHLKNN
FT                   KKTIIPVVAY"
FT   CDS             286970..287686
FT                   /transl_table=11
FT                   /locus_tag="MHY_03780"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05515"
FT                   /db_xref="GOA:D4KGY6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGY6"
FT                   /protein_id="CBL05515.1"
FT                   /translation="MLKNKKFAFFDMDGTLIDSVGIWNQIDQKLIEKLANKTIDETTVQ
FT                   NDRDTQLKKFNAQPNPYLCYCQYLKDKYSAQISAEEIIKLRYEIAQDFLQNIIDYKPQA
FT                   DLVIKKLKAKNFMLAITTTTKRTNMDIYRTLNKNINAKAPLDEYFDLIYTREDVSKIKP
FT                   DPEVYQKAMQKFNAKPEECIVFEDSLIGIEAAKKAGIETIAIYDKYSDADTKAIKSQAD
FT                   FYLHDYTELLSSIDEL"
FT   CDS             complement(287721..289007)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03790"
FT                   /product="Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05516"
FT                   /db_xref="GOA:D4KGY7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGY7"
FT                   /protein_id="CBL05516.1"
FT                   /translation="MAKEKHVEGEADHYIKTLIGAVLGYAADGLDMFLLSFILVFIIKD
FT                   FGLTTAEAGNLTLATTIGMWIGSYIFGLLADKYGRTKILSFSIILFAVATFLMYFVDNY
FT                   TVLLVLRFIIGLGIGGEFGIGMAIVTETWAPDMRARATSWVALGWQGGVLLAAVIPAII
FT                   VPMFGWRAVFLVGLVPALIAIYVRMHLKEPILWQRKKQRQQELIAKKENGTITEKEQKE
FT                   YYYLAGMPLKKLFTTKRITATTIGLTVMCLVQNFGYYAIFSWMPTILSQKYGYSLAQTS
FT                   GWMVISIAGMVLGIILFGILADKIGRKKTFALWYIGGTIYCVIYFFFFTSQASLLWGSF
FT                   LLGFTVNGMMGGYGAVIAENYPSEARSTAENIIFGTGRGLSGFGPAIIGYLATGGSLIG
FT                   AMSLVFVIYPIALIFMWFTVPETKGIEID"
FT   CDS             complement(289113..289778)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05517"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGY8"
FT                   /protein_id="CBL05517.1"
FT                   /translation="MDSPASPPASLFAGGFDDWRSRARLAHFLAMPELKKHDEAIELFR
FT                   SVVEVEIDEENPEQVEEKVYALQRLSSCLREDKKYDDALHYINLAVQLVESTDYLYKYI
FT                   LRGEVWADRWNLLYNKQDIETAENEIDEKIRVFENLDVKHNSYLYYGYRFKAQLMATGL
FT                   MKEEALNYMRKALSFMDIPEKYKPAIEKAFSATHNNVAWILNTIDHACPSPEKIHWDI"
FT   CDS             289942..290802
FT                   /transl_table=11
FT                   /locus_tag="MHY_03810"
FT                   /product="3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases"
FT                   /EC_number="1.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05518"
FT                   /db_xref="GOA:D4KGY9"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGY9"
FT                   /protein_id="CBL05518.1"
FT                   /translation="MKIGFIGIGLMGGPLARNLIRAGKEVYIYGRNQQHINKVLSAGTT
FT                   GKAVKNINDLAICDIIFTCLPLPQTVKSIMIENNGLLNQLKSGSIYIDTSTIDPSTAIE
FT                   IEQYAIHHNVHYIACTLGLGPAQAETASEPLFVGGNKEIFTKIMPILNLIGSPVHYLGG
FT                   VVQAYAFKIISNMIGMTNLAILAEGIHLAQKANIDIEQFLTLLAQPGGDSNQLSRRGPA
FT                   IANNDFSNRFAVDLTLKDLTLGCNMAKDFNYTPIFSQKSRELYQKASEQGYGAEDCCAI
FT                   YKVLE"
FT   CDS             complement(291380..292015)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03830"
FT                   /product="YibE/F-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05519"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGZ0"
FT                   /protein_id="CBL05519.1"
FT                   /translation="MNLLKNIWVRGIIIICILIGGFFFLQSYNQVEKPTLVNTQGRAFE
FT                   KATVVEVLKDNIQEDGSRVGDQVVLLQMETGPQKGQILEANSPNGLLFGTACKPGLEVI
FT                   TISSVVGQLHVTTVYNVDRSMPIYIFIAIFLISLCIIGGKKGVKSAIALIFSFICFVFV
FT                   FFPMIMKGTSPSLAAIFTATIVTAMTICLINGFTIKALSAILATFLVY"
FT   CDS             complement(292118..293647)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03840"
FT                   /product="Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05520"
FT                   /db_xref="GOA:D4KGZ1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGZ1"
FT                   /protein_id="CBL05520.1"
FT                   /translation="MLALCLSAALSVGSLTVYAATEQWNDASLTPAFTTKTAVSEHTDW
FT                   ADWKANWDKIKTNYEQVALIPGSDFSKLNFGWYSKEKANEAVVRIADNKDMKNAKEFKG
FT                   TCTEGTVINGVQYYSNKVTADGFEPNTTYYYQVKLNGKWQQAHEYKTGDPHNFSFMYVG
FT                   DPQIGASKGQVPNESAVEQSEDVAARNDAYNWNKTLNSALAQHPEINFLVSPGDQINEP
FT                   AGNNAEKHLLQEYEYSGYLSATAFRNLPQAVAIGNHDCLTTSYQNHFNVPNPFTAETNS
FT                   TVAGHGYYYTYGSALFIVINANNYNAADHKALVEKAVKENPNAKWRIVVMHQDIYGSGL
FT                   DHSDSDGIILRNQLTPIFDANDIDVVLQGHDHTYARTYQLTSDGKQYDDFAEYKVGQHG
FT                   QDHKVLDNKLKSDSAFKEYYTSQNRCYTIADMKQGTLVNPEGVFYMTSNSATGSKFYNL
FT                   IEQQQDYVAARSQTWRPTYSVINITDDKFTINTYDAQTGTPIDEAYSIIKR"
FT   CDS             complement(293850..295397)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03850"
FT                   /product="Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05521"
FT                   /db_xref="GOA:D4KGZ2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGZ2"
FT                   /protein_id="CBL05521.1"
FT                   /translation="MIALCLSAALSVGSLTAYAATEYWNDASTKPMVETKTPISDNTNW
FT                   EQWKAGWDNLKTNYEQVALTPGADFSKLNFGWYSKEKTDKAMVRIADNKEMKNAKEFKG
FT                   TCTEGTVINGVQYYSNKVTADGFKPNSTYYYQVKLNGEWQQAQEYKTGDPDNFSFMFVG
FT                   DPQIGSSYKQKNAESNGKKLGNDLAARNDSYNWNVTLNKAMEQHPEIDFLVSPGDQVSV
FT                   KGNEDAKDLKEQEDQYSGYLSASVLRNLPQAVAIGNHDCSSASYQNHFNNPNPFLEEST
FT                   PTPAGNGYFYSYGNALFIVINANNYNAADHKALIEKAIKENPNAKWRIVVMHQDIYGSG
FT                   LDHSDSDGIILRTQLTPIFDANDIDVVLQGHDHSYARTYQLTSDGQAHDEFLEYKQDQG
FT                   GFNHDNFDERFEKDGVFRAYYKSQNLCYNIADKSQGTVVNPEGVFYLTSNSATGSKFYN
FT                   LIPEQQDYVAARSQNWRPSYSVINITKDSFTVNTYDVETGEAIDSSYTIIKINDDLI"
FT   CDS             complement(295528..296748)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03860"
FT                   /product="S-layer homology domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05522"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGZ3"
FT                   /protein_id="CBL05522.1"
FT                   /translation="MMGIASTSFAATNPFSDVPADSWAYDAVTTLANDGVIDGYPDGTY
FT                   QGQNTMTRYEMAQIVARAMARTDLEKADKAIVDKLAAEFAEELDNLGVRVSDLEKKSDN
FT                   IKWKGELKYKYVQANHDAKKDKRSNKLEFKLEPKAYIGNSDWTANAKIEYTMYPETDSN
FT                   ADGVKVSKAYVEGPLFGATVTAGRTSLDICQGMIFDDEISGMTADFGSDVFNTNIAIGR
FT                   YSENDHDGEIPDGKTAKDITADYYGVQFDYTPNDNLAFNAGYILLSGLDKDVELDLDVD
FT                   DNKANLWYAGGKYNFDKNVALVGQYLQNADANSYDKAGSVEVQYKGANAKDAGSWGAYI
FT                   GYRHLGENVTIETGYDEAAEGQKGLVAGVEYVFTQNVIGSLLYFDGKDLKTDTDANTVY
FT                   TSLKFKF"
FT   CDS             297253..297774
FT                   /transl_table=11
FT                   /locus_tag="MHY_03870"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05523"
FT                   /db_xref="GOA:D4KGZ4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGZ4"
FT                   /protein_id="CBL05523.1"
FT                   /translation="MMPLKSGIEVCRYLRAKNNQTAILMLTARDSLEDKIDGLDSGADD
FT                   YLAKPFEFPELLARIRALSRRINKTFYNDIIEYNNLKLNCCNAILTYKQIEVSLSPREN
FT                   QLMELLIRNTHQILPREQIIDKIWGYDTNINSNTLDVTIKSLRQKLTKLSLSDCIHTIR
FT                   GIGYKFEMDI"
FT   CDS             300124..300825
FT                   /transl_table=11
FT                   /locus_tag="MHY_03900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05524"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGZ5"
FT                   /protein_id="CBL05524.1"
FT                   /translation="MSDSKLVPYIVPCLMPMAILISRHLNHISYQTKIALFINAFISLL
FT                   IIVALIVIAIKSDFISLEEFIFSGSFIILVLFISNLIIFISWYKYKNFSQIIAIYAISS
FT                   ILFSFSLQPIITQVAQHRTGKEIAQVVNTLKTKDTLIISYKDYLQDLPFYTKSRIAIYD
FT                   YLGELEFGSKHDSGQGWFFNKEEFLSTWQQNPHAILVVPQKYKQECLAELNDENAVIYF
FT                   ETNKYLIITHN"
FT   CDS             complement(301316..301642)
FT                   /transl_table=11
FT                   /locus_tag="MHY_03920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05525"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGZ6"
FT                   /protein_id="CBL05525.1"
FT                   /translation="MMKAKDYVKVGLVISIVLHVGIFALGGYVMNNITKELNEKSMLQS
FT                   SADEDITYVDIGITQEDESNDIVVEEAEDSNAQSEIVVDEEELEKQKPPIETINPPEEK
FT                   SQNL"
FT   CDS             303941..305107
FT                   /transl_table=11
FT                   /locus_tag="MHY_03950"
FT                   /product="Predicted pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05526"
FT                   /db_xref="GOA:D4KGZ7"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGZ7"
FT                   /protein_id="CBL05526.1"
FT                   /translation="MRKEFLPFAKPMVSEEAIADVADSIRKGWLAMGPKTVDFEQKFAN
FT                   YVGCKFGISVNSATAGLHLAAMALIEPGDEVITTPMTFASTVNAIVFAGGKPVLVDIDP
FT                   HTFNIDINKIEEAITPKTKAIIPVHFAGRPCDMDALEALAQKYNLGIIEDSAHALGAEY
FT                   RGKKIGFGRGARHIAVFSFHPTKNITTGEGGMICTNDEEAAELMSMQRQNGMSKGAWNR
FT                   YQANGKAHYDIFRPGLKYQMMDIQAAIGRDQLTHLEEFNDRRREIVARYQRELKDVRGL
FT                   ILPPEIEEGNVHSWHIYTPLIDIDELGFSRDDFMAKMSAKNIGTAYHYQALHLFTCFGE
FT                   LTGLKAGDLPNSEYVSERIVSLPLFPAMTDEDVTDVIEAIKEICGMKG"
FT   CDS             305118..306071
FT                   /transl_table=11
FT                   /locus_tag="MHY_03960"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05527"
FT                   /db_xref="GOA:D4KGZ8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGZ8"
FT                   /protein_id="CBL05527.1"
FT                   /translation="MLGSPEISIVIPVYNEEESLPQLFKELYPVMENLQRSFEIIFIND
FT                   GSRDKSFAMLYDFQKEHEKTVRVIDLNGNFGQHMAITSGFANVRGKYIITLDADLQNPP
FT                   EEIPKIIAKMDEGYDVIGTCRQNRHDPLFRKVASRFVNRMTNRISGLHISDYGCMLRGY
FT                   SRRIVDIIVQSRESTTFIPALGQKFAVNPIEIPVSHREREFGESKYSFFRLLRLNFDLM
FT                   TSFSIAPLQMVTMSGMGISLLSIIFFLYLILRRIVVGPEAGGVFTLMAINFFLIGVTIM
FT                   ALGIIGEYTGRIYKQIQQRPHYIIRKIYEDGAKEDE"
FT   CDS             306064..306258
FT                   /transl_table=11
FT                   /locus_tag="MHY_03970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05528"
FT                   /db_xref="GOA:D4KGZ9"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="UniProtKB/TrEMBL:D4KGZ9"
FT                   /protein_id="CBL05528.1"
FT                   /translation="MNRPSIVVFAYSEPGYTCLKALIEAKANILAVYTHQDDPDEKIWF
FT                   HSVYDLAKANNIPVFRPKK"
FT   CDS             307017..308048
FT                   /transl_table=11
FT                   /locus_tag="MHY_04000"
FT                   /product="Nucleoside-diphosphate-sugar epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05529"
FT                   /db_xref="GOA:D4KH00"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH00"
FT                   /protein_id="CBL05529.1"
FT                   /translation="MKIFVTGVNGFIGSHFLEMALAQTDWEIQGFDLADNNITQFLDNP
FT                   RFSMKKGDIFKEEAWLNEQIKECDVLLPLIGIARPAYYITRPLWTFELDFEQNLKMVRK
FT                   CAEYGKRVIFPSTSEVYGMPDPNNKVMDEDNSNLILGPVSKSRWIYSCSKQMMDRVIFA
FT                   FGQEMGLKFTLFRPFNWVGPRLDSFKDASEHKGRSITQFIYDVLYTGKITLVNGGAQRR
FT                   SFTWVGDGVQGLIDIITNKDNQAEGQIFNIGNPENNYSIKEMAEIVVDEMKKFPEFKDK
FT                   ADKVEFIVMDSDKYYGKNYDDMQDRLPSVKKMETRLGWKSKATLREAIHYTLEWYAKNL
FT                   DKA"
FT   CDS             308136..309029
FT                   /transl_table=11
FT                   /locus_tag="MHY_04010"
FT                   /product="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05530"
FT                   /db_xref="GOA:D4KH01"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH01"
FT                   /protein_id="CBL05530.1"
FT                   /translation="MAKKIAIKIDVDTKRGYDEGVPRMLDVFKQENIKATFFFSMGTDN
FT                   SGKAIRRIFRKGFLTKMLRTKAPSTYGFKTMMYGTLLPAPHIVEPNPMPFLRAIKENHE
FT                   CGIHCWDHVYWQDKLPFLSEDTIKEELTKAINLFEKIAGFKAKACAAPGWQVTPRSLKV
FT                   QQELGFDYCSDVRGYYPFYPIMNDKKYLPLQIPGTLLTMDECLGSTLDNKLITEENIND
FT                   YWLSHCDQEFNVLTIHSEMEGLKQLPILHDFIKKAKKLGYEFVKLEEGKYVPNIKECEV
FT                   YHGYLPGRAGTVARQR"
FT   gap             309045..309278
FT                   /estimated_length=234
FT   CDS             complement(309307..309651)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05531"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH02"
FT                   /protein_id="CBL05531.1"
FT                   /translation="MSIPAILGVYEKQGIKDGAPNNVMKGPAFKTELATAYPDCRLVVT
FT                   KETMTVEGMIKIVYELLKDKLNIVKLTFFSGINLASEEYEPHLEVDRCPLCGIALNEDG
FT                   VCPKCGYKKP"
FT   CDS             309925..310776
FT                   /transl_table=11
FT                   /locus_tag="MHY_04030"
FT                   /product="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05532"
FT                   /db_xref="GOA:D4KH03"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH03"
FT                   /protein_id="CBL05532.1"
FT                   /translation="MTDFSNVFLISDMDGTLINSKSQISTINKYALNEFTKAGGTFAVA
FT                   TGRTLHSCKQYIPELPINAPSIFYNGTILQDTNNNVVLKTLSLQTKILFNFLKQCLIHC
FT                   PNTCIELHTKDTFHIITKEEFDDPVIKRENLSYIRSNLDDLYDLDILKVQFYTTNTHTI
FT                   SWLHIFAKSMEMDKIAKYFTSWSSYFELIPKNTSKGIMLDNLRKMPMYKDKIFIAVGDF
FT                   DNDIEMLLFADYGIAAQNATQNLKQVADIIGVSCDGHLLFHVINKIIPNLDKLMITTLQ
FT                   TA"
FT   CDS             complement(310835..311107)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05533"
FT                   /db_xref="GOA:D4KH04"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH04"
FT                   /protein_id="CBL05533.1"
FT                   /translation="MDFMQEYFPQVKITQLQATYLLWLDFRAFNLTNEELEMRNRQKAC
FT                   LYFDEGYIFGKAGSGFERWNLACPTKYIHWALERLYQAYKEFAVK"
FT   CDS             complement(311110..311676)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04050"
FT                   /product="Bifunctional PLP-dependent enzyme with
FT                   beta-cystathionase and maltose regulon repressor
FT                   activities"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05534"
FT                   /db_xref="GOA:D4KH05"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH05"
FT                   /protein_id="CBL05534.1"
FT                   /translation="MLFTPVYYPMYKAIEINQRKLVEIPLINNGMTYDIDWDLFTKKAK
FT                   AIDTKMLILCSPHNPCGRIWTREELTKISEICLANDILVVADEIHADLIMPGFKHVSYG
FT                   TISKEALEHSIICTAPSKTFNLAGMQLSNVFIANENYRNLFKAEQATDADFACSILSYE
FT                   ACRLAYEYGEEWLTEVINIIDTNKK"
FT   CDS             complement(311852..312019)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05535"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH06"
FT                   /protein_id="CBL05535.1"
FT                   /translation="MKYDLENINARFGIGSQKWQDMKNNPLVDEKVIPFSVADMEFRLA
FT                   PEITEGLKNL"
FT   CDS             312186..313253
FT                   /transl_table=11
FT                   /locus_tag="MHY_04070"
FT                   /product="ABC-type Co2+ transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05536"
FT                   /db_xref="GOA:D4KH07"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR025937"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH07"
FT                   /protein_id="CBL05536.1"
FT                   /translation="MMANNIIYKEDFIMHIPDNYLSPSTCATLFVAMTPIWYYSIRKIN
FT                   KTLSADKIPLIGIGGAFAFILMMFNLPIPDGTTAHAVGGTLIALLLGPYAACIAISVAL
FT                   FIQAIIFGDGGILSFGANCFNIAFILPFTGFFIYKILNKIHLSPFYHKCTIFLSAYISI
FT                   NLAAFFTALELGIQPLLFVDNLGQPLYCPYPLWISIPAMALSHLTIAGIAEGLFTLSLY
FT                   LFILKTSPNIIYDCQQIKLNSIFSLLAFLIIISPLGLIAEGTAWGEWAPEEILNDTSSG
FT                   VPLGFIPEKLLNGFNYEAFFPDYTMSGTTDILAYIASAIIGVALLIIIFKMLGNIIYAK
FT                   KTITLIILLKFLNGF"
FT   CDS             complement(313351..313509)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05537"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH08"
FT                   /protein_id="CBL05537.1"
FT                   /translation="MMSLVFKVDRQIRLKAKIIKGKNIFCAEFIKIMVRKMNNNFSLGF
FT                   SQLFLWG"
FT   CDS             314026..314700
FT                   /transl_table=11
FT                   /locus_tag="MHY_04100"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05538"
FT                   /db_xref="GOA:D4KH09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH09"
FT                   /protein_id="CBL05538.1"
FT                   /translation="MTPIINLSHISYNYEEVSALNDISLEIYAGELIFFTGPNGCGKST
FT                   LFKLLNGLIFPTKGEYYFDNKKIDKNTLQDNIFAKNFHKRIGYIFQNPDVQLFNATVYD
FT                   EIAFGPRQMNLNEEIIHQRINELLIYLNIQHLQDRPPYHLSGGEQKKVALAAILALNPD
FT                   VLMIDEPLNGLDNKTRQWFKEFLMDFIKANKTILISTHEQELLSLPHSRIIKFNDEHTI
FT                   LN"
FT   CDS             complement(314752..315348)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05539"
FT                   /db_xref="GOA:D4KH10"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH10"
FT                   /protein_id="CBL05539.1"
FT                   /translation="MRNCRKVGLPFQIHTTVMDWNQHELEALTDFAVKEGAVAHHIFFL
FT                   VPTGRGKNIEAETLRAKEYEDVITRIMKKQQEVDIELKPTCAPQFMRIADQMGMKLRFR
FT                   RGCLAGTSYCIISPRGKVQPCAYLNMELGDVRKTPFDEIWKNSEVLNKLRTFEFEGNCG
FT                   KCKYKFSCGGCRARAAYYNDGNYMAEEPWCLYSHK"
FT   CDS             complement(315345..315737)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04120"
FT                   /product="Radical SAM superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05540"
FT                   /db_xref="GOA:D4KH11"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH11"
FT                   /protein_id="CBL05540.1"
FT                   /translation="MIISWNTTNACNMFCDHCYRDAGCKADEELNTQEAKTLLEQIAKA
FT                   GFKIMIFSGGEPLMRPDIVELVEYATKLGLRSVFGTNGTLITEEMALKLKMLALWAWEF
FT                   LLIPWMQKSIIISVNSLMLGKALFVV"
FT   CDS             complement(318185..318751)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04170"
FT                   /product="Chromate transport protein ChrA"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05541"
FT                   /db_xref="GOA:D4KH12"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH12"
FT                   /protein_id="CBL05541.1"
FT                   /translation="MIYLELFWSFVQVGLFCVGGGYASMPLIQAQVIDVHGWLSISEFI
FT                   DIFTISQMTPGPIGINAATFVGMKVAGFLGAIVATLGFVTPSFILGIILAKLFFKYGNI
FT                   GVIKGILNGLRPAVVALICSAGMSFIFLALFNTEKMPINVADIDYLGLFVLIVAFIAVR
FT                   KKVGIIKILAGSGVLGLILGLIGKF"
FT   CDS             complement(318934..319350)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04180"
FT                   /product="Chromate transport protein ChrA"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05542"
FT                   /db_xref="GOA:D4KH13"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH13"
FT                   /protein_id="CBL05542.1"
FT                   /translation="MEKAENFYWKLFKSTFIISAFTVGGGFVIIPLLKAKYVDEYKWIK
FT                   EKDALDLVAIAQSMPGVVAINSAVILGYKMRGVKGTLTALLATVLPPLITLSLICIFYN
FT                   LFATNPYVKLLLKGMQCGATALIINVAYDLLKKN"
FT   CDS             complement(320063..320434)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04200"
FT                   /product="L-asparaginase II"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05543"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH14"
FT                   /protein_id="CBL05543.1"
FT                   /translation="MSVELLHYTRGKYVENIHRGDAVCVGVDGNIIDKVGNAHLPMFWR
FT                   SAAKPFQLLQFVKLGGVEKYNLTQQELAILASSHSGEDIHVETVKSILHKLGLTEEVLN
FT                   CGSARPMSGKAFKELVKII"
FT   CDS             320580..321560
FT                   /transl_table=11
FT                   /locus_tag="MHY_04210"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /EC_number="6.3.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05544"
FT                   /db_xref="GOA:D4KH15"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH15"
FT                   /protein_id="CBL05544.1"
FT                   /translation="MEIALIAFLAFVIDCIIGDPNSKYHPVALMGKLIDILDKLLRKDN
FT                   ATEPTKLVCGFILVAILLSFSYGITYGIITLLDIFNCPSWLNIFIQAVILSFMISPKAL
FT                   AKAGKDIYDELINHNLDQAREKVNYIVSRDANRMNEQDITRATVETVAENIVDGIISPL
FT                   FYFFIGGLPLAVLYRMSNTMDAMIGYKNDKYLYFGRTAARIDDVLNFIPARITGLLLIV
FT                   VAFYSKLNAKGALKMMMRDAKKHPSPNGGYTEATVAGALDIRLGGINYYFGRQSFRAYM
FT                   GEAINELNAQHIQQTIKLMYNVSTLFLIIMCVGYIIITKYQELSL"
FT   CDS             321586..322125
FT                   /transl_table=11
FT                   /locus_tag="MHY_04220"
FT                   /product="cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /function="cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05545"
FT                   /db_xref="GOA:D4KH16"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH16"
FT                   /protein_id="CBL05545.1"
FT                   /translation="MQDTQYKKGLVIVHTGNGKGKTTAALGLAIRAWGEGLKVLILQFI
FT                   KGSWKYGELKALAKFAPDITVKQCGEGFTRRGNTDIKIHQEAAKKALQEAKMEMISNKW
FT                   DMIILDEINYAIDFDLVNLKDALDLIAEKPADLHLVMTGRNAKEEIIQKANLVTEMKEI
FT                   KHPYKEGIKAQKGIEF"
FT   CDS             complement(322177..322914)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04230"
FT                   /product="ABC-2 type transporter."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05546"
FT                   /db_xref="GOA:D4KH17"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR005981"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH17"
FT                   /protein_id="CBL05546.1"
FT                   /translation="MLYDIWTVFWRDWVVLKHRMIKFILSRMVAPILYMVAFGWGLGRS
FT                   INTGTGSYLDFLVPGILALNSMNIAFNSLTPVHAERIYHKSLEEYLVSPIRPIAFVAGK
FT                   ILAAVLRGMISSAIIVVLAYLFGAKFAITPLFIIVLIINCIIFAEIGFSAAMTVQTFED
FT                   MARFNTYILLPMSFLCGTFFSTDKLPLLLHYFIEALPLTHTSTLLRAITHNQEISILSI
FT                   GILCLYMVVLFIICNRILGKIKN"
FT   CDS             complement(322917..323780)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04240"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05547"
FT                   /db_xref="GOA:D4KH18"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH18"
FT                   /protein_id="CBL05547.1"
FT                   /translation="MLEIKSLKKNFVSKNKQGKNIEKTAVRDLNLTIDEGEIFGLLGPN
FT                   GAGKTTTIRMLTMLTKPTAGEILYKGKDIFSDELNVKKYIGVVPQHINFDQDLTVWENM
FT                   ELHGRLHHIPKSERHARIEELLNYVELQDRVNDKVKSLSGGMKRRLLIVRALMHNPKIL
FT                   FLDEPTVALDPQVRRRIWDLIRRLPKDGVTVVLTTHYIEEAENLCNRVAILNKGSLIKL
FT                   DTPKALCEQIGKYVVEWDSEESREYKFFNSRKECADFAGTLDVATTIRHSNLEDVFVEL
FT                   TGRTVS"
FT   CDS             complement(323800..324594)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04250"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems, ATPase components"
FT                   /EC_number="3.6.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05548"
FT                   /db_xref="GOA:D4KH19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH19"
FT                   /protein_id="CBL05548.1"
FT                   /translation="MVNLKVSDLMIKIYDKLILDGINIDFKAEKKTAIIGPNGCGKSTL
FT                   LKAISGLNRQYKGEILIDGENILHLSRKNLAKKMAILPQGATTPTDLTVKELVSYGRFP
FT                   YRSMFKSLNSRKEQAIIEEAMEKTHITSFSHRLVSTLSGGERQRTWIAMALAQQPKILL
FT                   LDEPTTYLDIAHQIEVMQIVDELNKREKMTVIMVLHDINHARMYADDIVILKDKHVFEQ
FT                   GEPNTVLDVENLAKVFGVNAKMYQNCQNPEDKIIFPVSLVKN"
FT   CDS             complement(324596..325621)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04260"
FT                   /product="ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05549"
FT                   /db_xref="GOA:D4KH20"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH20"
FT                   /protein_id="CBL05549.1"
FT                   /translation="MTMQKQEVLQTTKFGIAINKWRILMMIVFAILACSGIICSIISGA
FT                   VAIPISELKNIFIDGVNSPHQQILYNIRLPRTIVAGLVGMNLAMAGAILQAVMKNPLAD
FT                   PHIIGISSGAGLTGILVIVLFPAMEYLITPIAFVGAMIAAICIYLLAWKNGIRPLRIIL
FT                   AGVAVSAFLGAGISAILVLYSDRIHGALMWMVGGLSARSWPHVDIIWPYALIGFILAML
FT                   GSRHLNILQLGDDIAKALGVNVELTRIYLTAIGALLAASAVSVAGLLGFVGLIVPHTAR
FT                   LLVGSDYRYLIPSSALLGIAVVTYSDTFARVAFAPLELPVGIFMAILGAPFFLFLLRKE
FT                   L"
FT   CDS             complement(327185..327322)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04290"
FT                   /product="Precorrin-2 methylase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05550"
FT                   /db_xref="GOA:D4KH21"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH21"
FT                   /protein_id="CBL05550.1"
FT                   /translation="MAGTFYGIGVGPGDPELLTMKAIKAIEKADVLIAPKTEKKMVAWL
FT                   "
FT   CDS             complement(327495..328502)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04300"
FT                   /product="Cobalamin biosynthesis protein CbiK, Co2+
FT                   chelatase"
FT                   /EC_number="4.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05551"
FT                   /db_xref="GOA:D4KH22"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH22"
FT                   /protein_id="CBL05551.1"
FT                   /translation="MKSNWKKMLIASMACVALTGVSATSFAAGYSLNPEVKTATPALLQ
FT                   ASEIGVRTYNTTDAELQKAPNKDAIVVMSFGTTYKDTRAKTIEATVEEIQKAHPNTKVV
FT                   LAFTSHIIIDRVKANEGITIPTPEEALAQLKAEGYNRIALTSLDIIPGMEYAYKTAVYD
FT                   IYKTQFKKMTIGTPLMYWMGQEGQRDDVEAVMQAIGSQMPKLGKKDAVLVMAHGTPDPS
FT                   NAYYSVMQDRLNKLYDGKVMIYTVEGWPSLEDIIPQLKAKGINHVTMMPLMMVAGDHAN
FT                   NDMAGAEEDSHKSILEKEGIKVDAYIHGLGENQNVRQLFVDRANEAWNALEAEK"
FT   CDS             complement(328965..329384)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04310"
FT                   /product="Biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05552"
FT                   /db_xref="GOA:D4KH23"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH23"
FT                   /protein_id="CBL05552.1"
FT                   /translation="MRLKDRRAFSKPEVMIIPMIDIMFFLLVFFMLSTLYMVDLKTIPV
FT                   NMPKVQNAQSQTNVNYLVTMKADGTLYLENKLIDEDTLLQGAKEKYEENNNFAVVIRAD
FT                   ENVDYGKIMALLDKFKAVGITKFGLATETMVDEHK"
FT   CDS             complement(329387..330004)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04320"
FT                   /product="Biopolymer transport proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05553"
FT                   /db_xref="GOA:D4KH24"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH24"
FT                   /protein_id="CBL05553.1"
FT                   /translation="MDLLMQGVEYFHKGGLVMYILLICSIFIITIGVERLLYFMKADSG
FT                   RAFAQNFYKLMINNKIEEARNLAQNSKGDLAFLVDFAFNKMQNKNINLMMLLEVQSGIS
FT                   ISKFRERLYYLNVIVTMAPLLGLLGTIIGMISAFSVFNLEEGQAIAITGGVGEALIATA
FT                   TGLCVAIVSLAIHAYFVQRIDRIVTDMEQAFSLIEGYITRGE"
FT   CDS             330127..330720
FT                   /transl_table=11
FT                   /locus_tag="MHY_04330"
FT                   /product="Predicted metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05554"
FT                   /db_xref="InterPro:IPR019271"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH25"
FT                   /protein_id="CBL05554.1"
FT                   /translation="MFTTKVQVAHHDMQDFISNYQDIDKFLTYCQQCNNYNHKWSCPPL
FT                   SFNPKTYLSQYKSIYLVAVQINYSEDTINSLTTKEEISTFTRKTLRKLKNEIATALLNL
FT                   ENDNTISLSSDGCSYCCKCSRTVNQPCKKPDKMRHSLDSFGVDLGKVMEDIFNIKLLWG
FT                   LDKLPKYHVLIHALISNETISATTISDIISKNSV"
FT   CDS             complement(330819..332303)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04340"
FT                   /product="L-arabinose isomerase"
FT                   /function="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05555"
FT                   /db_xref="GOA:D4KH26"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH26"
FT                   /protein_id="CBL05555.1"
FT                   /translation="MKKLQDYKFWFIVGSQFLYGPEALKAVEEDAKKMVEGLNASGKLP
FT                   AKIEFKAVGTTAEVIDRFVMDANYDDTCAGIITWMHTFSPSKMWIRGLKKLQKPYLHLH
FT                   TQYNREIPNEEIDMDFMNLNQSAHGDREHGFIGTRMRLARKIVVGYWETEAVQNKIATW
FT                   MRTAIGVIASADLKVIRFGDNMRNVAVTEGDKVEAEIKFGWSVNTHAVGDLVQYINAVT
FT                   EEQIDAQVAEYQTKYEMNTDNIASVRYQAKVEVAIKKFLEDNKADGFVNTFEDLYGMDQ
FT                   LPGLATQDLTGQGYGFGPEGDWKIACLTAVMKTMAQGVDKGTALMEDYTYHFGKDGEDS
FT                   YNLGAHMLEVCPSVAEGTPKIEVHELGIGGKDAPARLVFEGKAGSAIVATLVDMGGRMR
FT                   LIVNDVECVKPIMPMPNLPVARVMWKPMPSLEEAGEAWILAGGAHHSVISYTVTAEQLR
FT                   DWANMMGIEFVHITKDLDMDKFKDQLMLSDIMWKLK"
FT   CDS             332763..334166
FT                   /transl_table=11
FT                   /locus_tag="MHY_04350"
FT                   /product="MFS transporter, sugar porter (SP) family"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05556"
FT                   /db_xref="GOA:D4KH27"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH27"
FT                   /protein_id="CBL05556.1"
FT                   /translation="MSTAIDTEALQQSKHMRKLVSVAAGMAGLLFGLDIGVIAGALPFI
FT                   TDQLSLTSQMQEWIVSSMMFGAAIGSIITLWISSKLGRKKSILTAGLLFIIGCFGSSFA
FT                   PNYEILLISRIILGFSIGVASYVAPLYLSEMSEKEHRGRLISMYQLMINFGIVIAFISD
FT                   TLLAPTESWRLMLGIISIPAFLLIIAVAKLPDSPRWLASKGFTTEAQKVLNVLRGNKEK
FT                   AHEELQDITDSLKVKQAGFSLFRANKNVRRVVFLGMFLQFMQQFTGQNIIMYYAPKIFS
FT                   LAGFESHTDQMFATILDGMTFVIFTWISMQFIDKTGRKIALKIGFGIMALALIVLGWCL
FT                   MQFEGGNTAQWISYTAVGMTILSIAGYAMSAAPVIWILCSEIQPLKSRDFGIACSTTTN
FT                   WVSNMIIGATFLSLLEGIGSAQTFWLYGILNVIFIFCTIYIVPETKGVSLEKIESNLME
FT                   GKKLRDIGC"
FT   CDS             334206..334706
FT                   /transl_table=11
FT                   /locus_tag="MHY_04360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05557"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH28"
FT                   /protein_id="CBL05557.1"
FT                   /translation="MLITIGRQYGAGGREVAEILAKELQIPLYDRKLIALIAEHLEKGC
FT                   NLEELNLTYTNLYGDESPYEHIFDNVVQNDDMFMFKPQSNAIKQLADYYKSGIFVGRCA
FT                   NYILNDYNAYSFFIVADDDFRTTRGQLVYHKSLSELKKKTKNVLLTIITIQDLTGANLK
FT                   IMI"
FT   CDS             334853..335569
FT                   /transl_table=11
FT                   /locus_tag="MHY_04370"
FT                   /product="Uncharacterized membrane protein, possible Na+
FT                   channel or pump"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05558"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH29"
FT                   /protein_id="CBL05558.1"
FT                   /translation="MPYGVLADIFCIILGGIIGPNLNIKITYKYREPLIKIFGISALAI
FT                   GIISFIKVNCLPCVILALILGFILGEFFDLDTKLKNLLAKIIYKLNFKHKFKNEEEKNL
FT                   YMDFYLLVAATFCASGTNIFGAFNEGLSGDTTILFSKAVIDIFASIIFATRLGYPMLLI
FT                   TIPQFIIMGGLFFCSQFLMVFISNTMILDFISIGGLLTIILSLNMIGISIVSIVNILPT
FT                   LIIIFPISYLFSFIFL"
FT   CDS             complement(336201..336686)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04400"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05559"
FT                   /db_xref="GOA:D4KH30"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH30"
FT                   /protein_id="CBL05559.1"
FT                   /translation="MATADAPKYIDLMNWIREQILSGEFSVGMRLPSENELGKKFSISR
FT                   QTVRQATSVLENEGLLERRRGSGTYVCASKSAIKKTTRNIGVVLTYLDDYIFPSIVQGI
FT                   EKVLTKNGYFMQLAFTYNRVEKEAYILDTMLKNNIDGLIIEPSKSGIPYINTDFYQK"
FT   CDS             complement(336856..337227)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04410"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05560"
FT                   /db_xref="GOA:D4KH31"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH31"
FT                   /protein_id="CBL05560.1"
FT                   /translation="MVSIAEGVRDMAKKVVPNELKIIAAGGTADGSFGTDSAKICRAIE
FT                   EADDGQNGVIIITDVGSSIISAGLAIEGLSMQLHQRVKIADAPIVEGAIAAASEAAKGS
FT                   DLMTVLNVTETAKSVSKRG"
FT   CDS             complement(337273..338295)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04420"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05561"
FT                   /db_xref="GOA:D4KH32"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH32"
FT                   /protein_id="CBL05561.1"
FT                   /translation="MNMKQYINSAIASRYFQFFVTIILFIVLYGIGVAMYNGFSRPQVF
FT                   WNLLIDNASLIIVTVGVTFTIITGGGGIDISVGAVVALVCMCLAYLLQNTELAIPVVIC
FT                   LVLLIGIVIGFVQGYLISVFKMQPFIVTLAGMFFCRGMTAVISRDTINIDNPSYVAIAS
FT                   ERINMFGTGFISVGALVALIILIIAIIVLKYTKFGRTIFAIGGNENSASLMGLPVTKTK
FT                   ILAYVISGFCAALGGVVYSWTMLSGYTLHAMGMEMDAIASSVIGGTLLTGGVAFMPGTI
FT                   FGVLIQGIILTFITFQGTLSAWWTKIVVGALLCIFIIMQALITEHKNKLTSKSSMESNK
FT                   "
FT   CDS             complement(338312..339328)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04430"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05562"
FT                   /db_xref="GOA:D4KH33"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH33"
FT                   /protein_id="CBL05562.1"
FT                   /translation="MDKLKSFKSSSIFLPLVALAILVIFNIIFVPGFLDVEITQDGRLY
FT                   GRVFDILNRSSSLIILSLGMTFVIATAGIDISVGAVVAISGAVCCSLIGGRGDGVAEYP
FT                   MVVAMIAAIATGVVCGMWNGFLVAKIKIQPMVVTLILMVAGRGIAQLLTEGQIITVYYA
FT                   PFSYIGGNIPGNIIPSPIIIAILMIALVVFILKKTSLGLFIQSVGINPTASRYAGINVA
FT                   LIIFLVYAFSGFCAGVSGLIESSLIRAADANNAGLNMEMDAILAVALGGTLLSGGKFYI
FT                   GGSIIGAITIQTLTTTMYAMGVASDQLPVVKAIVVIILCLIQSKHFREIFNKSKKIQ"
FT   CDS             complement(339387..340835)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04440"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05563"
FT                   /db_xref="GOA:D4KH34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH34"
FT                   /protein_id="CBL05563.1"
FT                   /translation="MGDVLLKMRNIDKIFPGVKALSNVDFTLRAGEIHSLMGENGAGKS
FT                   TLIKVLTGVYHRDGGTITLNGKEISPNNPKEAQECGISTVYQEVNLCPNLTVAENIFIG
FT                   REPKKFGFIDWKQINKRSADLLNSLNIHIDVTKTLDHYSVAIQQMIAIARAVDVDAKIL
FT                   ILDEPTSSLDEEETKRLFSIIRQLQKKGMGIIFISHFLEQIYELCSRITILRNGELVGA
FT                   YDIDKLPQVELIAKMVGKDLDSVKEFDKMGAKSVPSDEVFLEAKNIGCTGKLNSVDLTI
FT                   HKGEVIGLGGLLGSGRTETAELLFGVNPITKGEIVINGKKVNLKNPIEAMNEKIAFCPE
FT                   DRKVQGIIGSLSVRENIILALQAKKGMFKYIPYKEQVVFADDCIQLLKIKVSDREQLVS
FT                   NLSGGNQQKVIIARWLITEPNLLILDEPTRGIDVGTKSEIQKMAVALAKSKGMSVIFIS
FT                   SEMDEMIRTCTKITVIRDRKKSQK"
FT   CDS             complement(340939..341928)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04450"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05564"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH35"
FT                   /protein_id="CBL05564.1"
FT                   /translation="MLAFCVGCGSDNSSSSGTESGAAKDGKEITIGYSQLGAESEWRTA
FT                   QTESIKQAAKDAGINLQFSDAQQKQENQIKAIRSFIAQGVDLIAFTPIVETGWDTVLQE
FT                   AKDAGIPVVIVDRDAKVSEDLYVAKIGTDSKAEGKKAFEWIDQYMKAQNKTPRDGGSVY
FT                   NIAVLEGTVGSSVAIGRSEGFEEAMKASPDASKYQILMSQTGEFTRQKGQEVMESFLKS
FT                   GGRDKIDILFSQNDDMALGAIQAIEAAGLQPGKDIVIVSVDGVKGAFQAMIEGKSNCTV
FT                   ECNPLQGPLLMETAKKILNGEQVDKMVYMEEGVFPADVAEKTLPERKY"
FT   CDS             complement(342227..342874)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04460"
FT                   /product="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05565"
FT                   /db_xref="GOA:D4KH36"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH36"
FT                   /protein_id="CBL05565.1"
FT                   /translation="MHEVNNQELTYDFVICNNGGTIFDKNLKLIKSFPLDKIQLEKFVH
FT                   SDIAKESWHILFSSAEKMRTTINSPKSQLLKYFESEKYKNQDIIQRITVEQALSEMNVI
FT                   QISLAYETEEIANNYAKRINNEFEGAFLANMNLNCIDICAKGINKAQGVKELLNLQKDK
FT                   YFEQVLTIGDAQNDVPMIKEFEGYSLNSATMHAKNVATKLYDSVGEMLLDNL"
FT   gap             343262..344392
FT                   /estimated_length=1131
FT   CDS             complement(344669..345877)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04480"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /function="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05566"
FT                   /db_xref="GOA:D4KH37"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH37"
FT                   /protein_id="CBL05566.1"
FT                   /translation="MKSNIAVIGMGVMGSCLALNMANHNFKVAVYNYTPDLTEAFVKNH
FT                   PHDNITAFYDVKSLVEGMTRPRKFFIMVTAGKAVDSVIESLLPYLDKEDIIMDGGNSFF
FT                   KDTQRRYEYVTSKGFKYFGVGVSGGEEGALNGPALMPGGNKESYKEIKEVLEAISAKAE
FT                   DGKPCCTYIGENGAGHYVKMVHNGIEYADMQLIAEAYLLLKHVGGYENSQIADIFNEWN
FT                   QGELNSFLIGITADIFKEKDDLGEGELVDKILDSAGQKGTGRWTSLAALEQGVNTSIMT
FT                   SACNARNISSFYEKRQQLAESGLKKVLPVEIDADFVEDVRRSLYTAKIAAYAQGLALYK
FT                   SASETYDWNLNLGDIASIFRAGCIIQARFLNNITNAYQQEPNLDNLIENEFFAEKVKII
FT                   SNV"
FT   CDS             complement(347643..348020)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04510"
FT                   /product="Sugar (pentulose and hexulose) kinases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05567"
FT                   /db_xref="GOA:D4KH38"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH38"
FT                   /protein_id="CBL05567.1"
FT                   /translation="MLDFSNTRSCIWIGVDVGTTGVRAIAYQKDGLSLCSADEFYPLET
FT                   PYPDWAEQNPEIIYKAIEKVVREVANTLIYKGKNVSGIAISTVMHSFAPANENRELLSN
FT                   MITWADSRSVGIVNELKKMKP"
FT   CDS             348255..349106
FT                   /transl_table=11
FT                   /locus_tag="MHY_04520"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05568"
FT                   /db_xref="GOA:D4KH39"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH39"
FT                   /protein_id="CBL05568.1"
FT                   /translation="METNTSILTLMRSNYNNMTKSEKRIIDYILANLKTVMSQTISDLA
FT                   SNTQSSEITISRFCKKLGFSGLQSLKIALASEVYSQDELVSQEINPNDSYKLIAEKLFS
FT                   SITDGLQDTLKLIDFEQLEKAVQLIKNAHQICVYGFGNSFTVCQDIETRFMRFGIPIKA
FT                   YNDLHMQVTASSLLTEKDLIICVSHTGANIDLLQAIELAHNNNVPIIAITSYMNSPLCK
FT                   LADVVLHGMGREIAYKSEAVASRLIHMAIVDILYMGVYQKNVTKNFTNIKKMRNAIAKR
FT                   RL"
FT   CDS             349242..350081
FT                   /transl_table=11
FT                   /locus_tag="MHY_04530"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05569"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH40"
FT                   /protein_id="CBL05569.1"
FT                   /translation="MKKYIIQYAMIVIGALISAISCNLFLIPNHFLSGGLTGIAIILHY
FT                   LFDLPIGIQNIIFNIPILYIAYHFFGRLYFFNTILGTGLYSFFIDLTSFLTPYTPLHNN
FT                   PMLSAIVAGVVSGIGFGLILRANANTGGADVIAALIKKLYSYNIGTMIFALNCIIVLCG
FT                   LCLFNFEVAIYTLIYMYIMGEVDNRIVTGFNKRKSIMIISDKSEQIAGLIMLELGRGVT
FT                   LINGEGGYTHTKKKILYIVVNLTQLSKIKEIALNIDKKAFFIISNASEVNGKGFSYH"
FT   CDS             complement(350182..351006)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04540"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /function="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05570"
FT                   /db_xref="GOA:D4KH41"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH41"
FT                   /protein_id="CBL05570.1"
FT                   /translation="MFTLEIIKAIVLGIVEGLTEWLPVSSTGHMILVDEFMSLNVSKAF
FT                   MDMFLVVIQLGAILAVVALNFDRLNPFSKRKTYLKKRQTISLWGKVIVGCIPAAVIGLA
FT                   FNDYMEEHFMNAQVVAFTLILYGVLFIIVENYNKHRTPSIKDIDYLDYKTALIIGFFQV
FT                   LSLVPGTSRSGSTILGGILFGTSRVVATEYTFFLAIPVMFGASALKLFKFGFNYTFEEV
FT                   ILLLVGMVVAFIVSIISIKFLLRYVRTNDFKAFGWYRIILGLIVFVYFYFQG"
FT   CDS             complement(351154..352128)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04550"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05571"
FT                   /db_xref="GOA:D4KH42"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH42"
FT                   /protein_id="CBL05571.1"
FT                   /translation="MNFDTSKLCILTGNANPKLAEEVAQYIGVELCHAFVGHFNNGETQ
FT                   VMISDSIRGKDVFIIQPTSQPVNDNLMELLVMADACRRASAQSINAVVPYYAYSRQDRK
FT                   TRGREPISAKLVANLMTTAGIDRVITVDLHAGQIQGFFDIPVDHLAAAPLLAAYIQAKN
FT                   LEDVVVVSPDLGGVTRARALADRLKAPIAIIEKRRPMPGCAKVMNLIGEVKDKNCVIID
FT                   DIVDTAGSLCEGAKALVKHGAKSVYACCTHGILSDPAVQRIEDSPMEELIITNTIPLPE
FT                   EKHSSKIVSVSMAPPIGEVISRIYQKKSVSKLFDAIDIVKGKG"
FT   CDS             complement(353665..353763)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05572"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH43"
FT                   /protein_id="CBL05572.1"
FT                   /translation="MNFIDNKPWDAWGLLDMKTSRSFYFIIANEMR"
FT   CDS             complement(353873..354166)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04580"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05573"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH44"
FT                   /protein_id="CBL05573.1"
FT                   /translation="MEKIVEADTKFHDILYQASRNNRLVGIIYNLREQLTSFRAKSMAY
FT                   PGRLEETLEEHRRIVDTIAQGDAVAAQKASEYHMERSEHTLLLSMEDKDGNM"
FT   CDS             complement(354094..354714)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04590"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05574"
FT                   /db_xref="GOA:D4KH45"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH45"
FT                   /protein_id="CBL05574.1"
FT                   /translation="MAAMMSGSGPTVFAIVEDSQKAKDIVSKIQLDFDADVFAVKTAEK
FT                   IFNGGINMSNKLTPIKLDSYQPLREVVFETLRDAIRKGILKPGERLMEIHLAEQLGVSR
FT                   TPVREAIRKLELEGYVIMMPRRGTYVSNLSIKDINEVFEIRTSLDSLASGLAAERITDE
FT                   ELEHLQRLLVVIGEAIKEKIWKKSLKLIRNSMIFYIKQAEIIV"
FT   CDS             complement(354795..355439)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04600"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05575"
FT                   /db_xref="GOA:D4KH46"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH46"
FT                   /protein_id="CBL05575.1"
FT                   /translation="MVTINANAKINLTLDILGKRTDGYHEVSMVMQSINLFDTLTFTKL
FT                   DTEEGIILHGDVKGVAKPEDNLIYKAAKLFLDTYKINSGVEINLIKRIPVAAGLAGGST
FT                   DAAAVFRGLNELFEMNLGINALCKMAEQLGSDISFCLMGGTMLATGRGEILQEISAMPK
FT                   TNIVLVKPKVDVSTAWVYKNYHKVQDSVIHPDNKAMRKSLIKKIYKVFVNL"
FT   CDS             complement(355639..355989)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04610"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05576"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH47"
FT                   /protein_id="CBL05576.1"
FT                   /translation="MEINDNDKEINSAWHVHEDGTVHAHHGHTHTHTQTKAVLNRLSRA
FT                   IGHLSAVKRMVEQNRDCSDVLIQLSAVNSAIKNVSKIILQDHIEHCLVEAVKENDQEAI
FT                   DKLKEAIDKFVK"
FT   CDS             complement(355980..356189)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04620"
FT                   /product="prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05577"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH48"
FT                   /protein_id="CBL05577.1"
FT                   /translation="MMAISSSDLLNEFTIYADKVVDEKETLIVQRSSGKNIVVMSMEQF
FT                   NELQKEIFLAKNAQEKSEVFAKWK"
FT   CDS             complement(356238..356468)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05578"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH49"
FT                   /protein_id="CBL05578.1"
FT                   /translation="MRTLIEANLCDGVIYGDNVNLEYVYMPASEIGVKNPICVFEENSS
FT                   REDISMSEALTIIRKRSLKPVKHPRLGISSC"
FT   CDS             complement(356484..357437)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04640"
FT                   /product="Mg2+ and Co2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05579"
FT                   /db_xref="GOA:D4KH50"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH50"
FT                   /protein_id="CBL05579.1"
FT                   /translation="MLKIYKSMETGPLKELTLKSLEKGAWINIVAPTPYELKVVGNLTQ
FT                   VEPDFLRSALDNEERSHTDIEDNSIMILTNVPVMRTFESYDTLPLAIILTPDYIITVCL
FT                   EDTPVISDFNERTYRSFRTFKKTRFLFQILYKSVTYYLKYLRQIDKLSDEIEARLREST
FT                   ENREILRLLELQKALTYFNASLRSNGAVLEKLMRLRSNHSLQNIIKLYEEDEDLLEDVI
FT                   IENKQAREMVEMYSTILARLADTFSSIMSNNLNLVMRFLAAMTIILAIPTVISSFFGMN
FT                   VEVPMSENPLAFLDICILAVLLAGICATVLWRKNMF"
FT   tRNA            357756..357844
FT                   /locus_tag="MHY_T_29250"
FT   CDS             358182..358451
FT                   /transl_table=11
FT                   /locus_tag="MHY_04650"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05580"
FT                   /db_xref="GOA:D4KH51"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH51"
FT                   /protein_id="CBL05580.1"
FT                   /translation="MLPVLATQLAIIGMNFFDATMSGHAGAEQLAGSSIGGSLMMPIIA
FT                   SSTGILMAATPIIAHLIGKNEKDGIATVIHSGLILSIIIELIYF"
FT   CDS             358529..359467
FT                   /transl_table=11
FT                   /locus_tag="MHY_04660"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05581"
FT                   /db_xref="GOA:D4KH52"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH52"
FT                   /protein_id="CBL05581.1"
FT                   /translation="MLALIIGLSGGLLTFPLRSLTDTVAGTAVSMKIYLLALPINAFLN
FT                   YCFIYGNFGAPKLGGIGAGVATAITYYILLFIFITIIINNPQFKNLALFNFKFSLKSIK
FT                   EYLGIGIPNGMGIFMEASLFGFIIIFISKFGTNYIAAHQAAMSFSSVLYMLPLSFSLAL
FT                   TIIIGIEVGAKRYLEARKYAYLGLIVSFLCVLSIVGLVFYFRDYIALLYATDTTLLTYI
FT                   AHFLIYTAAWQLFDAIACPIQGILRGYKDVKAAFYVSMLAYWGICLPLGMFLDYFMTQG
FT                   AFAYWQSMVLGVATSAVLLFFRLRYIEKRFI"
FT   gap             359510..359766
FT                   /estimated_length=257
FT   CDS             complement(359793..360734)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04670"
FT                   /product="L-asparaginases, type I"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05582"
FT                   /db_xref="GOA:D4KH53"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH53"
FT                   /protein_id="CBL05582.1"
FT                   /translation="MKRICWLATGGTIASRPSENGLVPGFTAKEMLEMVPNLNDYGHID
FT                   CYDIMQLDSTNLQPEDWQYIAGYIEKLYEQYDGFVITHGTDTLNWTCCALHYMLENLAK
FT                   PVVVIGSQLTIEEENTDAKFNLNAAFAIASLEKIGVFAVCGGQIIEGLWAKKLYSEDMR
FT                   SIQSINKMPVATFEGNNIKWNEYENPQVNGIFKVHSDLELKVAQIKIMPGLDSELLFNL
FT                   VKMGYKGIVIEAYGAGGIPFAKDKQRDIVGAIEELSKQGVKIVCTTQCLFDGVHMDRYE
FT                   VGIKACKAGVIPAGKLSVEAATVKLMVDLAKK"
FT   CDS             complement(360748..360939)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05583"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH54"
FT                   /protein_id="CBL05583.1"
FT                   /translation="MATVEQVRKALVAVEELCGKCPVCTPDCPVAIAKRALSGLKYDIE
FT                   AYEQYQSELDNEMNNELK"
FT   CDS             complement(360966..362153)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04690"
FT                   /product="Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05584"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH55"
FT                   /protein_id="CBL05584.1"
FT                   /translation="MYELIVKNIDTQEVLFTKYNIYASGYQLDNSEVNLSQNLKWQVRG
FT                   LDENKVPVSDYTKPRLLHKGEMYKLNWQNKGDEYKLEDFSRREYTTYLVTKDVEISPLK
FT                   ITTHFDKMDYMPVYPVYSWVPVKNADHYKIDVFYVPKYDFNNIEKIASYTCPQGMDYYD
FT                   NKAYTKKGLYFFNVQAYDKNNHKLAEAKNSYFTVKQDNVKVAALGDSITHGGGAVSTPP
FT                   SATLYNWETYANLPVLNIGFSGNLTSNMLNRFDNDVLSFNPKILVIMGGVNDIRTGVKA
FT                   ETVINNLTSIKQKCQQHNIIPVFLTVTSVNPPRMKSVINLDISEGWDKERLKINEWIEK
FT                   QPYHVDVASGLMDEQGYLADNMTTDGLHPDFEGKKHIGELVGDYLRANFPDIVNN"
FT   CDS             complement(362543..363853)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04710"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05585"
FT                   /db_xref="GOA:D4KH56"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH56"
FT                   /protein_id="CBL05585.1"
FT                   /translation="MTPKLQQSINILQLSAHELGELIEKEYMENPTLEIDSSSEHELEP
FT                   ASNFDKTMDFLEYLNKDDEKPEPVANDDDFKVKEFTRNNQTLEEYLSEQVDFTFNDKKE
FT                   IKVARYIIGLLDTAGYLRVSTAEISSLLKINEKIIENVLAKIQILEPIGIAARDLPECL
FT                   AIQAKKINVYDGIIKAIIDKYLPKVAEGKIKEIATLENVEPIQVQEAIDIIRTFNPKPG
FT                   ASFGKENLEYIVPDVVVRDINGQLEVIINETNVPKLRVNSLCYKRDILDTHSKKYIEQH
FT                   VNSAIWLIKSIEQRRITLLKVVNEIVKQQEMVFYKGLSYMKPLLMKTVAENIGVHESTV
FT                   SRTVANKYMEMPYGIVALKKFFAGSVSKQNGEEDIIADKVKAKIKELIENENKAKPLSD
FT                   QQLTNILNENGMKISRRTVMKYREQLGFASSSKRKRY"
FT   CDS             complement(363913..365196)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04720"
FT                   /product="Hexokinase"
FT                   /EC_number="2.7.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05586"
FT                   /db_xref="GOA:D4KH57"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH57"
FT                   /protein_id="CBL05586.1"
FT                   /translation="MDNKKFQEMIDEFTLDSDAIKDVAASFRYDIEHGVKETGESSLRM
FT                   LPSYIGLPTGKETGEYLALDFGGTNLRVVLIRLDGEGKFEVIKKVAKPLVVPGEYDFIC
FT                   ADANADELFDFIADMVEEAVDGNRDKKYLLGHTFSFPSSQTNIYNARLIIWTKEFATKG
FT                   VEGEVVNDLLKAALARKNLTNVEPTAVINDTVAVLLAAAYKLGNVNIGSIYATGHNTCY
FT                   YETFTGMDKPAMVINMESGGFNKLAINKYDYKLDMESEKPYEQRLEKMVSGRYMGELLS
FT                   YCLDDAWNIGKVEFTSIDISTILADNSDSLDGVCDLLKAKINADITTDDAIWVKALAET
FT                   IASRSARLVVATYCGIMWHLYPNGGIPKQFVAVDGSVYEKMPTIKDNMQKAIYEILGEE
FT                   ADKLELVLENGGSALGAALAAAMEPVEC"
FT   CDS             365983..366942
FT                   /transl_table=11
FT                   /locus_tag="MHY_04740"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05587"
FT                   /db_xref="GOA:D4KH58"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH58"
FT                   /protein_id="CBL05587.1"
FT                   /translation="MNISVLGCGRWASFHAWYANHIGHNVKIWGREGSKHLEQLQTTHQ
FT                   NEYLSLSPDITYTNDLKLALNFADTIIISISSQQLRNLAKEIKKTDLYMQKTFILCMKG
FT                   LEISTGKRLSEVFTEEIGEDCNVGVWVGPGHVQDFLKGIPNCMVISAKNTDISKHIINI
FT                   FSSDLIRFYYSEDLIGTEIGAAAKNVVGIAAGMLDGMHYTSLKGALMARGTYELSNLIK
FT                   ALGGNNMTVYGLSHLGDYEATLFSAYSNNRCFGEDFVLNKPFSKLAEGIYTMQALLKLA
FT                   DKHHVELPICAVINEIVINHKNPKEELLNLFMRPLKAE"
FT   CDS             367005..367544
FT                   /transl_table=11
FT                   /locus_tag="MHY_04750"
FT                   /product="SOS-response transcriptional repressors
FT                   (RecA-mediated autopeptidases)"
FT                   /EC_number="3.4.21.88"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05588"
FT                   /db_xref="GOA:D4KH59"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH59"
FT                   /protein_id="CBL05588.1"
FT                   /translation="MKQNELARLTKINKSSISEYLSGNYQPKYKNILKIAEVLNVSPNI
FT                   FLEDTSSEENIKRLPILGKIAAGIPILAQENIEGYLPYDDNDADFCLRIHGDSMINARI
FT                   NDGDIVFIKQQSTVENGEIAAVLVNDSATLKRVYFVDDTVQLRSENPKYKPMIFSKNNC
FT                   DNFRILGKAIALYTKF"
FT   CDS             complement(367622..368983)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04760"
FT                   /product="NADPH-dependent glutamate synthase beta chain and
FT                   related oxidoreductases"
FT                   /EC_number="1.4.1.13"
FT                   /EC_number="1.4.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05589"
FT                   /db_xref="GOA:D4KH60"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH60"
FT                   /protein_id="CBL05589.1"
FT                   /translation="MSNTADVGYETNGYTLREAIVEAKRCLNCKKPMCRTGCPISNNIP
FT                   EFIDALSHGDLGKASMIIAQRSNLPAVCGRVCPHERQCEGSCILGRKGQGIKIGKLERF
FT                   IADMDGELELVAPNVAKSQPGNIAVIGSGPAGLTVAGDLAKMGFKVTVFDSQPEAGGVL
FT                   MYGIPEFRLPKQVVRREVKRIKKLGVDFKLNIMVGTEITVDELFNQGFDAIFIGTGNAL
FT                   SKSLPIDGAKLKGVIQATYFLQMVELSNSNSVDPNEVPIKEGDEVVVIGGGNTAMDAAR
FT                   TAMRCGAKSVKVVNRRREEDMAALKSEIDAAKEEGVEIHALRGPVEITGEDAVTGIKCS
FT                   VREFDEALDKVVDTDGREYFSANKIIIAIGQKPASRIVDSTSGIDVDENGFVKTREKPY
FT                   GMTMRHGVFSGGDVVNGPATVVVAMKDAQKVAQGIAQYVEAKKLMEECGMKMVD"
FT   CDS             complement(369124..369474)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04770"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05590"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH61"
FT                   /protein_id="CBL05590.1"
FT                   /translation="MKKMLAVVLSLVAVFVLGTAVVFAAKHHNSAQVTTIADIKANGWD
FT                   EQRVLVDGEFTEHIYKDLYTFTDNEGNSMTVEVDDDIWYQLSMDTPVRIYAEVDKDWHG
FT                   GIELEVKNIEKR"
FT   CDS             369690..370274
FT                   /transl_table=11
FT                   /locus_tag="MHY_04780"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05591"
FT                   /db_xref="GOA:D4KH62"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH62"
FT                   /protein_id="CBL05591.1"
FT                   /translation="MSKILIVEDEHRIARFLQMELEHEGFSTASESNGLRAYERIIQED
FT                   YDLVLLDIMLPDMDGLTICQNVRKLSDIPIIMLTAKDEINDKVTGLDIGADDYITKPFA
FT                   IQELLARIRATLRKHNNSTTKPAEEPSVFKFKNIHVYLDRHEVKVHNQLVELTKKNMIY
FT                   FYIYYTIMTMFYLESKSSNPSGAMNIWVIPM"
FT   CDS             370256..370375
FT                   /transl_table=11
FT                   /locus_tag="MHY_04790"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05592"
FT                   /db_xref="GOA:D4KH63"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH63"
FT                   /protein_id="CBL05592.1"
FT                   /translation="MGDTNVVDVYIRYLRAKIDDNFNEKYIYTVRGIGYVIKT"
FT   CDS             370359..371822
FT                   /transl_table=11
FT                   /locus_tag="MHY_04800"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05593"
FT                   /db_xref="GOA:D4KH64"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH64"
FT                   /protein_id="CBL05593.1"
FT                   /translation="MLSKLKNYLDLYIHTRIKYLPISLKLAFIYSIMLCLILFITLSST
FT                   LIGIHYVLYHEAEVSITLSANYIEKKANNEDVSNLLQDVKSSALMPGVVMRVTDSNDNI
FT                   IYDSLPMYISINQVHDTLVHQQQDPDWGDYIRNALLPADLKFVNFKHFWIFYTHRTITK
FT                   NNETYTLHFLRTITAEKAFLEELSKTIFYAGLVGISISIVCGFLLSRRLLKPLRDITST
FT                   VKNIEIQDLNQRIKVQPTHDELEELANTFNLMLERLQKGFEQQRQFVSDASHELRTPAT
FT                   VICGYSDMLARWGKDDPQTADECITAIHSEAINMQRLIEKLLFLARADQKRQVLHKESL
FT                   NLKPLIADIAKDTQLIAPQHTITCTHNDDGYIFADELVIRQMLRIFLDNSIKYTPDGGK
FT                   ITISSENKVKHMIVKISDTGIGIAKDKQDKIFERFYRVDSARTRNGVGGTGLGLSIAKW
FT                   IADAHDIEIRLSSKLNKGTTIILIIPKDN"
FT   CDS             complement(371890..372642)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05594"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH65"
FT                   /protein_id="CBL05594.1"
FT                   /translation="MKKLKVFLAVGLLCCGLSMSMAEAKTMTLDKTKVLVPQGFSVAND
FT                   DLKFKKGTVVELNENNEVITGVLNRDIALRPTGWRNVINDYYEESNNSIFYPRIFHPFT
FT                   SVSIPFPTYAHVRYKGNKPVTFATDGTVLSGTIDEEVTVSVNKDKYGLITFEDQYELGF
FT                   YPDGSVKNGRLRDDALLRPYGFKTGLAGDEMAGFVEFAGGKDISFSKEGYVTSGVLKKA
FT                   ISWQQPDGTMVTLPAKTMISFINGQARY"
FT   CDS             complement(372725..373933)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04820"
FT                   /product="seryl-tRNA synthetase"
FT                   /function="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05595"
FT                   /db_xref="GOA:D4KH66"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH66"
FT                   /protein_id="CBL05595.1"
FT                   /translation="MNLDRFMELEKQRREIIAETENLKSQKNAVSKKISEMKKNKENAD
FT                   AVILEMRQVGEKISQLDKQLREVQDELHDILLRIPNMCHESVPVGKDDSDNPEVRRWGT
FT                   PREFDFEPKAHWDIGADLDILDPERAAKVTGTRFTFYKGLGARLERALINFMMDLHVDK
FT                   QGYTEMLAPFIANKDSMTGTGQLPKFSEDMFKLEGLDYYLVPTGEVPATNYHRDEILDG
FT                   DKLPEYYSVYTACFRAEAGSAGRDTRGLIRQHQFNKVEMIKFVKPETSYDELEKMVNNA
FT                   EEVLQLLEIPYHVVKLCTGDIGFTAAMTYDIEVWLPSYNTYREISSCSNVCDYQARRAN
FT                   IKFRRSAGAKPEFVHTLNGSGLAVGRTVAAVLENYQQADGSVVIPKVLRPYMGGIEVIK
FT                   KPE"
FT   CDS             complement(374137..374796)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04830"
FT                   /product="Cell division protein FtsI/penicillin-binding
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05596"
FT                   /db_xref="GOA:D4KH67"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH67"
FT                   /protein_id="CBL05596.1"
FT                   /translation="MNYARKFGFGERTGIELPGEESGILFNPKDMVASDVATSSIGQSI
FT                   AVTPLQMITAMSAIANDGVLLKPHIVKAIYNADGTVYQQMEREEVRRCIDSDVDKTLKS
FT                   VLEQVVSTGGGSKASIEGYHIAGKTGTAQKIDMVNGGYLPGHYIASFCGFGPVEDPQFT
FT                   VLVIINDPAGGEYYGGQVAAPIAHDIFLQLFRYANVKPINGNQSLLDDIKGTEAKN"
FT   CDS             complement(374780..375829)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04840"
FT                   /product="Cell division protein FtsI/penicillin-binding
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05597"
FT                   /db_xref="GOA:D4KH68"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH68"
FT                   /protein_id="CBL05597.1"
FT                   /translation="MARYVWVQIVRGDEMLSRLESQVQESSVLHVPRGTIYDAEMKELA
FT                   ISTMVSSLYIDPNHVEDPEQTARDVAPLIGLTEKDILDDIAQGGGFVWVKRQMEPEETK
FT                   ALKNLMKEKPEYVACLGFIQESKRYYPNDMLAANVIGFVGTDDKGLDGIEQQFDGMIKG
FT                   EEQTSSIFTDALARPIMDSVFLKNSPVDANCKNIQLTINAQYQFIIEKALDKAMMDHGA
FT                   ESVTAIVMNPKNGDILAMASRPSYDPNNFHKYDPNVWKNRAVSDIYEPGSTFKSIVAAA
FT                   GFQEKLVSPTDIFVDPGTIEVSGRTIQNWSGDSFGTVTFLDVVKKFYQYRFCSIRFGIR
FT                   WRALDELCS"
FT   CDS             376145..376516
FT                   /transl_table=11
FT                   /locus_tag="MHY_04850"
FT                   /product="endoribonuclease L-PSP"
FT                   /function="endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05598"
FT                   /db_xref="GOA:D4KH69"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH69"
FT                   /protein_id="CBL05598.1"
FT                   /translation="MKVIKTTNAPGAVGPYSQAIEIDNLVFASGQIALDPATGEMAEGI
FT                   EAQAHQALKNAQAVINASGAKWENVIKTTVFITNIDDFTKVNEIYATYFTQPYPARSCV
FT                   EVSKLPKGALIEIEVIAKK"
FT   CDS             complement(376564..377019)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04860"
FT                   /product="Protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05599"
FT                   /db_xref="GOA:D4KH70"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH70"
FT                   /protein_id="CBL05599.1"
FT                   /translation="MFVCHGNICRSTMAEFVMKDLVRKAGLADKFIINSSATSREEIGC
FT                   DTHYGTKAKLREMNIPFSKRKAVQITKQDYDMYDYIIVMDNNNLRNLSYIIGEDTEHKV
FT                   YKMMSFVGENRDVKDPWYTDNFDETYADIDKACRALLAKLIKEYSLA"
FT   CDS             complement(377492..378736)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05600"
FT                   /db_xref="GOA:D4KH71"
FT                   /db_xref="InterPro:IPR006116"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH71"
FT                   /protein_id="CBL05600.1"
FT                   /translation="MKTTTKEIAKKLNKIYYDLDDNTSEHMYIVGSVGRGTSIKGASDL
FT                   DLLFDLPSDIYKKYDNYGENSNGQSVLLQEVKNVLLERYPKTKISGDGQVVVIEFINYT
FT                   VELVPGFKQNDGSFKYPDTHDKGSWKITNPMPEIKESRKMAEDTNNNFVYICNMVRSWK
FT                   NHIGFKLGGLLIDTLVYKFLNENNKYKTINYDKYFDMIKCLFAYLKDLNKEQSYWYALG
FT                   SNQKVYNCDNGKFITNARKAYDKISSYEGTESDVNNKLREIFGNDFSESISVVENQSEL
FT                   NVYRTEQFIEKMFPVDIRYNLNIDCEVTQKGFRSYCLRYMLANNIKLMKNKSLKFEIKG
FT                   CDIPGGAKTCDIYWKVRNVGAEAIRLDRIRGQVIKTNSKIHREHTSFQGAHYVECYLVK
FT                   NGVCIAKDRIEVPIN"
FT   CDS             complement(378798..379358)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05601"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH72"
FT                   /protein_id="CBL05601.1"
FT                   /translation="MINRKIIEAEIEQLLGKSAWTHKIQEKQADIYHSYRIWIECIRII
FT                   VSACTASGILIILFDEQTFIFKLITAIIALINTGINLYFKNFNFQSLERIHKENAVKWL
FT                   GLREDYIALISEMRAGVLSDEEVIDRKRILLERYKLISKETPITTNGAYKRAKKALNIN
FT                   MDDIISQDEIDKFLPEELRKESK"
FT   CDS             complement(379697..379906)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05602"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH73"
FT                   /protein_id="CBL05602.1"
FT                   /translation="MVPKWIVRKNYLFNVDRYLYTVIAERIKIDNDWQNMTKEDVIKNM
FT                   SKNNDDKYWRYATAIEYSKNIQRF"
FT   CDS             complement(379976..380485)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05603"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH74"
FT                   /protein_id="CBL05603.1"
FT                   /translation="MYLNNYIKLNCKGHENFEFVDVNLNTDNCIFIDPALIERADDEWC
FT                   INANKYIQSFFDCLFVALKNDHINDLFDHVHEQNATKLGYGNGNNGKGKTANGLEVSLK
FT                   ELKTLVHEIPTISKGEDVCIFIKNFAKDGMSDLLTNILHEQLNEFTAQQMEKFGIVSSG
FT                   EKTFWT"
FT   CDS             complement(380712..381257)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05604"
FT                   /db_xref="GOA:D4KH75"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH75"
FT                   /protein_id="CBL05604.1"
FT                   /translation="MHINYKEEEVARQKIESDDFENREIIQKKTTVGVKTEHALYDHGL
FT                   EIKSGTDQIEFFKDESLGTIKLFTALPYLFDILEKGGVLVLDEIENGLHLSLVKEIISL
FT                   FINEKTNPHNAQLICTTHQPLLVSNDVKKDQVWVISKDKFGKSFLKRLSDKNFSRAKVN
FT                   LTNKILEGALGCNPEKFF"
FT   CDS             complement(381292..381996)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05605"
FT                   /db_xref="GOA:D4KH76"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH76"
FT                   /protein_id="CBL05605.1"
FT                   /translation="MERAILKSISAENFASFAEKIVFSCIADESKKEHKMNTFKIGDNI
FT                   INKVSYIYGANGSGKTFFCKVFREIQRMVVLSPLFMMKKLPIKDLFPSEDLLKPMPKFA
FT                   FDIAYKDLPTTLGIDIIIDEITYHYEFSVFNQMVVYELLTKKYRRTEKILERTSPSFED
FT                   IILKSELKSFEDNKHVVKKEALCLAMAAMLNNDLADTIVNAIKEINVVNMTYPRLDPTE
FT                   IEAFSEERIKNT"
FT   CDS             complement(383497..384591)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04950"
FT                   /product="Predicted HKD family nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05606"
FT                   /db_xref="GOA:D4KH77"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH77"
FT                   /protein_id="CBL05606.1"
FT                   /translation="MAQSNLKEEIRDFTNVLTGGQTKSKQLYFQLKNSIEKAKRIDIIV
FT                   SFLMESGVRLLLKDLKQAVAKKIPIRILTGNYLNITQPSALYLIKQELNNQVDLRFYDD
FT                   NTHSFHPKAYFFHYDEYSEIYIGSSNISRSALTSGIEWNYRFNDLLDKDSFQQFFKTFE
FT                   DLFYNHAIAITDEELYRYAKYWRKPAIIKDLEQYKTENKNITPLIQPREVQIEALYALN
FT                   NSRNEGATKALIHAATGIGKTYLSAFDSANYKRILFVAHREEILYQAIEAFKNVRKSDD
FT                   YGLFYGKQKDKDKSMIFASIMTLAKDEYLNEAYFPRDYFEYIIIDEFHHAVTTQYKKIS
FT                   ELFQTKISFRFNCHPRAIRWEKYI"
FT   CDS             complement(385405..386103)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04970"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05607"
FT                   /db_xref="GOA:D4KH78"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH78"
FT                   /protein_id="CBL05607.1"
FT                   /translation="MNKPMILIVEDDAAVRNLISTTLKMQNYKFHVATTGSQALLEAVS
FT                   NQPDIMLLDLGLPDMDGVEIITKVRSWSNMPIIVISARCEDRDKIEALDAGADDYITKP
FT                   FSVEEFLARLRVTIRRINYVQTPHKENSIFVNGELKIDYVSGCAYCRGKELHLTPIEYK
FT                   LLCLLAKNIGKVLTHTYITREVWGNAWDNNVASLRVFMATLRKKIEIDTANPEYIQTHI
FT                   GIGYRMLKLD"
FT   CDS             complement(387268..388818)
FT                   /transl_table=11
FT                   /locus_tag="MHY_04990"
FT                   /product="Universal stress protein family./Osmosensitive K+
FT                   channel His kinase sensor domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_04990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05608"
FT                   /db_xref="GOA:D4KH79"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH79"
FT                   /protein_id="CBL05608.1"
FT                   /translation="MQLGGAYMPIIRKSPEKILEQIHIEEHESKRGKLKIFFGYAAGVG
FT                   KTYAMLEAAHEAKKQGIDVVAGYIEPHARPATAALVNSLEVISPLVINHKDITLNEFNL
FT                   DAAIKRNPQLILVDELAHTNADGCRHIKRYQDIEELLKAGIDVYTTINVQHIESLNDIV
FT                   ASITKIIVRERIPDRIFDEAEQVELVDIEPSDLVTRLSEGKIYQKEQADRALGNFFTVE
FT                   NLTALREIALRRMADRVNKISLKVKNENNKDYYTNEHILVCLSSSPSNSKIIRTAARMA
FT                   NAFKAQFTALFVQTSSFEKTSLENKKRLKENIHLAEQLGAKIEMVVGEDIPFQIAEFAR
FT                   LAGVSKLVIGRSIARNGFMRLMRKSFTDKLIEQLPNLDIHVIPDNKALFYKNFWKKSVN
FT                   EREICNTSDIITILVILIITSMIGMLFYSMNLGEANIMTVYILGVLIAALKTSKRLYSV
FT                   VLSVLNVLAFDFLFIEPRYTFTAYDPVYIITFSVMFVSAFVTGGLTNKIKNKLYSLLN"
FT   CDS             complement(388897..389487)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05000"
FT                   /product="K+-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05609"
FT                   /db_xref="GOA:D4KH80"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH80"
FT                   /protein_id="CBL05609.1"
FT                   /translation="MDNFKKALLSVIIFTVFCGFIYTMVMTGICQVLFPNSANGKIIEV
FT                   NGVKYGSELLGQQYTSDRYMWGRITKIDVSTYKDTEGNQLAYAAPSNLSPASEDYEKLI
FT                   AQRVEKIRKANPEKGNEPIPVDLVTNSGSGLDPDISVAAAKYQVERLARENNMTKEEVN
FT                   AIIDKCTNHKVLGLFGEETVNVLKVNLMLDKII"
FT   CDS             complement(389504..391570)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05010"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05610"
FT                   /db_xref="GOA:D4KH81"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH81"
FT                   /protein_id="CBL05610.1"
FT                   /translation="MIKTKSALSDNQMVVRAIKDSFVKLSPKVQAENPVMLLVYISAIL
FT                   TSLLWVASLSGVQDVSSGYTLAIAIILWLTCIFANFAEAIAEGRGKAQADALRAAKKDV
FT                   EAYKLHDANNKENYEVVVSSSLKKGDIVIVKAGQQIPADGEVIEGAASVDESAITGESA
FT                   PVIRESGGDRSAVTGGTTVTSDWLVVRVTCDSGESFLDKMISMVEGAARKKTPNEMALQ
FT                   IFLIALSIIFILVTMSLYTYSDFSAKQAGMENPSSITTLVALLVCLAPTTIGALLSAIG
FT                   IAGMSRLNQANVLAMSGRAIEAAGDVDILMLDKTGTITLGNRQASEFIPVDGIDEKTLA
FT                   NAAQLSSLADETPEGRSIVILAKEKFGIRGRNIEENHMEFIPFTAKTRMSGVNYDGHEI
FT                   RKGAADAVKSYVIENGGIYSAQCEEAVKRVAQIGGTPLVVAQDYKILGVINLKDIVKDG
FT                   VAEKFADLRKMGIKTIMITGDNPLTAAAIAAEAGVDDFLAEATPEGKLAMIRDFQAKGH
FT                   LVAMTGDGTNDAPALAQADVAVAMNTGTQAAKEAGNMVDLDSSPTKLIEVVRIGKQLLM
FT                   TRGSLTTFSIANDLAKYFAIIPSLFLSLYPGLSALNIMNLHSPQSAVLSAIIYNALIIV
FT                   ALIPLALKGVKYREVPAGELLKRNLLIYGLGGIIVPFICIKIIDVILVGLGLV"
FT   CDS             complement(391588..393411)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05020"
FT                   /product="K+-transporting ATPase, KdpA"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05611"
FT                   /db_xref="GOA:D4KH82"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH82"
FT                   /protein_id="CBL05611.1"
FT                   /translation="MSADIIMQYIVFLVVLVVLSIPLGTYMAKVMNGEHVFLSKILLPI
FT                   ENLIYKIIGVKKDEEMTWKTYLSSVIWFFFIGLGFLYIFQCFQDKLPFNPQNIDPMSWH
FT                   LSFNTAASFATNTNWQSYSGEAQLSYFSQFMGLTTQNFVSAATGIAVLFALIRAFVRAK
FT                   SHTIGNFWVDLTRSTIYILLPLSVVVTMALASQGVVQNLSPGQAVQLVEPIAVDSEGNI
FT                   IENATIDKDNNIVFVDGEKVEGATIVTKQFVPMGPGASQIAIKQLGTNGGGFFGVNSAH
FT                   PLENPNSLTNMIECTALLLIPAGLCFTFGRNIRDKKQGIAIFAAMYIMLIAFLSIIAIN
FT                   EQNGTPQLAQNAAVDIVSTDYQAGGNMEGKEARFGIVQSSTWAAYTTAASNGSVNSMHD
FT                   SYTPLGGLVTMLQMQLGEVIFGGVGCGLYGMLAFAILTVFIAGLMVGRTPEYLCKKIEP
FT                   FEMKWAVLVCLATPIGILVASGIAAIVPSVADSLNNVGAHGFSEVLYAYSSAGGNNGSA
FT                   FAGFNANTPFLNTSIGLTMIFARLLPIVGILAIAGSLVQKKKVAVTAGTLSTSNAMFVF
FT                   LLIFIVILVGALNFFPALSLGPIAEYFSMIS"
FT   CDS             complement(393411..393518)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05612"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH83"
FT                   /protein_id="CBL05612.1"
FT                   /translation="MQGGIKMEIWIWISGIVATLLLIYYFYILMKGDEQ"
FT   CDS             complement(393849..395162)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05040"
FT                   /product="Sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05613"
FT                   /db_xref="GOA:D4KH84"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH84"
FT                   /protein_id="CBL05613.1"
FT                   /translation="MLLQRLEALPVGSFHYKLLVITGLGWLFDAMDTGLIAFVLPVLGK
FT                   EWGLSAGQMGAIGSIGLVGMAIGAVIAGSIADKFGRKAVFSATVILYSIATGLCAVSWS
FT                   YESLLIFRFFVGFGLGGELPVAATLMSEYAPTNLRGRFIVLLESFWGVGWIAAACIAYL
FT                   FIPVYGWHYAFIIGALPAIYVFFIRLHMPESVRYLLSKGKVEEAQKIVDDLEMRLGVKY
FT                   KGDLKVTTDDTPTEKPKLKDLWSGKYLARTIMLWIVWFGIVYSYYGIFTWLPAIVYQQG
FT                   FAFVKTFEYVLLITFAQLPGYFCAAWLVDKLGRKYTLSLFLCMSGVASYFFGQAQSAEL
FT                   IIFWGCVMSFFNLGAWGVVYTYTPELYPTAIRAMGSGWAAGVGRIGGMAAPLVVGMMIE
FT                   AGRDMHTVFYMFASVFIIIAVAVFALGVETKQKNLENI"
FT   CDS             complement(395186..396037)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05050"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05614"
FT                   /db_xref="GOA:D4KH85"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH85"
FT                   /protein_id="CBL05614.1"
FT                   /translation="MNEITMKMNADKLILMALQEDITSEDVTTNAIMPEKVLGEVDLIC
FT                   KGEGVIAGLNVFARTFELLDKDTEIIFMAKDGDKVNKGDLLAKVKGDIRVLLSGERVAL
FT                   NYLQRMSGIATYTNQVVNLLVGSKTKLLDTRKTTPNMRIFEKYAVIVGGGNNHRYNLSD
FT                   GILLKDNHIGAAGSVKKAIELARAYAPFVRKIEVETENLDMVKEAIEARADIIMLDNMS
FT                   IDMMEEAIKLIDGKAQTECSGNVTKENIQALAKIGVDFISSGALTHSAPILDLSLKHLH
FT                   RI"
FT   CDS             complement(396034..397347)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05060"
FT                   /product="Aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05615"
FT                   /db_xref="GOA:D4KH86"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH86"
FT                   /protein_id="CBL05615.1"
FT                   /translation="MQNYKTDILIVGTGASGLFAALHCPIDKNILMITKDAVENSDSFL
FT                   AQGGICVLRDENDYDSFMEDTLKAGHYENRRESVDIMIRSSREVINELIGYGVDFAKQA
FT                   NGELNYTREGCHSKARILFHEDITGKEITRNLLKAVQKLPNVHILEYVTMLDLIEQDNT
FT                   CFGILAKDKNDEYLTIEADNTILASGGIGGLYEHSTNYPHLTGDAIAIALRHNIKLENP
FT                   DYVQIHPTSLYTNKPGRSFLISESVRGEGAKLYGKDGRRFANEVLPRDLMTAEIKKQMA
FT                   KDNMPYVWLDMTVLGKDVILNHFPHIYEKCFEEGFDVTKQWIPIVPAQHYYMGGIHVDK
FT                   YSKTTMNNLYAVGETSCNGVHGANRLASNSLLEGLVFAKRAVNKIHDGENAQHKKYDID
FT                   FAQLANNVQQNIDREKIILAQEYKKAIFNEMDKVRSAR"
FT   CDS             complement(397361..397978)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05070"
FT                   /product="Quinolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05616"
FT                   /db_xref="GOA:D4KH87"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH87"
FT                   /protein_id="CBL05616.1"
FT                   /translation="MREQVEDLAVVCYINSTAELKAVSDVCVTSSNAVEIVKKLSNKNI
FT                   FFIPDGNLGAYVASKVPEKNIICNDGYCPIHRKISVNLVIETKRAHPNALFLVHPECSE
FT                   EVTNLADFVGSTSEIIKFATNSEEKEFIIGTENGVMYELKQKNPDKLFLPAIPRQYCDD
FT                   MKKVTLTKVKNSLVNERYVVEVDEELSIKAMKPLEKMLELAK"
FT   CDS             400319..402028
FT                   /transl_table=11
FT                   /locus_tag="MHY_05110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05617"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH88"
FT                   /protein_id="CBL05617.1"
FT                   /translation="MPRHSKTEGILSDAERLLMASLGLNISSGTMEDNFAERYLLYKGF
FT                   SLATDYLWVSYALADGEGAGLNKSILITRLQKILPKAKFTAIPLDKIISYPSDFTLEEN
FT                   PLDSSFAIKTMQVSTTRKTLSHLTSALRQARDGEDLASFWQDVYNYLLTADVPLSTALQ
FT                   SIFAQAPKPVLPADLASKLYTKRKTLRGSVTRFEQFFNCPFKHFAHYALNLQERKEFKF
FT                   AAPDLGILLHAIMHQFGEILVKRQISWQDVTHEQCQQICKQIIKTIAPKLQNEILLSSN
FT                   RYRHLLQRIEQLSIDSLMRLVEFAKHSEFSPKALEQDFGANSSMPPLLFTDEDNHKIEI
FT                   IGQIDRIDFNDNYYLVIDYKSGNAFINLLQVYYGLKLQLLTYLLVAQNTTLQLYNIENA
FT                   IPAGILYCFLKTPIITGTNKLSVQQIKTEIEKKMRMPGWVLADPEIIKKIDDSSNFIKV
FT                   RLNKNQDDISAQSRSYVKTAEEFDLLMKHIENTLKEAGSEILKGNADIAPYKLKDETAC
FT                   KYCPYIAICRFDKYISGYNYREINPLNDEEIIEKLKQKEGIPCLGQHSNNKL"
FT   CDS             401995..405000
FT                   /transl_table=11
FT                   /locus_tag="MHY_05120"
FT                   /product="recombination helicase AddA, Firmicutes type"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05618"
FT                   /db_xref="GOA:D4KH89"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH89"
FT                   /protein_id="CBL05618.1"
FT                   /translation="MPWSAQQQQAINTYDKNILVAAAAGSGKTSVLVERVIQRIVNKTC
FT                   DINQILVVTFTNAAAAEMRERIASAITEKLSDKDKERQLVLLNASSISTLHAFCQNIIR
FT                   QYFHQLGLDPKFRLANPQEIELLKLDVLEELFETNYDKDDNEDFLEFTDTYGNERGDDS
FT                   TYDIILKLYEYSRSQPFPLQWLKALPSYFQINNADELNDCPWLQIIKDNVKDGLNIAID
FT                   NSQKMYQLATDLNLPPYADIASEDLAFLYDLNNLIDTSWQEFFNLINKFKFKALRISKK
FT                   FSVSEEDKSTISALRDETKKIIKQLKEHYFTQTIEDTLSDMPQLYKQANSLCNITIEFS
FT                   QAFSKAKNERSLVDFSDLEHFTLKLLAEENSTAEKLIPSPIAQTLQEKYVEIMVDEYQD
FT                   TNGVQEAILKLIASRTKPNLFFVGDVKQSIYKFRLAEPELFLAKYHQYPHEEDCLRIDL
FT                   AQNFRSRKEILDGVNFIFSQIMTTKAGELSYGKDEALYCGFDYPESEFLTLKSPIELTL
FT                   LDKQQKLTLTENDDIDNEDTVQGFQAEAKYIAVRIKELMNKQPLVFDKHTKTYRPIKWK
FT                   DIVILLRSVQDKAKILADVLREDNIPVYATIETGYFQETEVRIMLSLLQIIDNPQQDIP
FT                   LTAILYSPIFNFTVEDLAHIRLINPQLNMYETLLFMTSINELQEQLLPVDKKVFAKLQI
FT                   KVNDFLTKLHYWRDYARSHSVPELIWLLLNDTGYYDYVGGLPEGSVRQANLRALYDRAF
FT                   NYEQTSFRGLFRFLRFIHKMQHMGNDLAVARNLSDSEDVVRIMSIHKSKGLEFPVVILA
FT                   DIGKQFNLKDVQESVLFHKKLGLGLYVNDVKHHYRYQNLSRQAIIQQIVKEYKAEEMRI
FT                   LYVAMTRAREKLILTGTVRNMEKFAQYACSQLQTTTKTLPDYFIMQAKSYLDWLAPAIA
FT                   RHHDGLTLRQSATNESAVLLDDPSQWQISLINSLDITDKTIISTVNEDIINKVKNYSHC
FT                   QLQSKKTILINY"
FT   gap             406532..407307
FT                   /estimated_length=776
FT   CDS             complement(407396..407632)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05619"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH90"
FT                   /protein_id="CBL05619.1"
FT                   /translation="MSSEFNYYTITQCKLNIEQTSICFGDESYYTKKDKFRWTDTPMYL
FT                   TWITVSRDSIGGLRFIQIVEYARAHDDILTSRA"
FT   CDS             complement(407710..407877)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05620"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH91"
FT                   /protein_id="CBL05620.1"
FT                   /translation="MNKTIKVIYLLMMLLIVNTCVAFAQSEEKIHKHIIGKPLILDLQK
FT                   IIIMLLMQIA"
FT   CDS             407930..408142
FT                   /transl_table=11
FT                   /locus_tag="MHY_05170"
FT                   /product="Putative F0F1-ATPase subunit (ATPase_gene1)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05621"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH92"
FT                   /protein_id="CBL05621.1"
FT                   /translation="MAPKSTWETFTFVSGIGFHFVITIGVCIFLGQKADIYFDSTPIFT
FT                   LIGIILGVITAVYTAYRKIKDVNKS"
FT   CDS             408152..409018
FT                   /transl_table=11
FT                   /locus_tag="MHY_05180"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05622"
FT                   /db_xref="GOA:D4KH93"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH93"
FT                   /protein_id="CBL05622.1"
FT                   /translation="MIKYIVKADVKEQLAKDYLKRHENISSTLWKKIKRQDEFFVNGQK
FT                   VRATQAIVKPNDIIEYNLPVTSKVEAIQIPLNIVFEDDYFLIVDKIAGMLTHPLTFENT
FT                   QTLANGVMYHFAKTNQNVGCHPLYRLDRNTSGLVVFAKMPQLQHQLANNHQKFQRYYYA
FT                   LVHGKLSQKQGQINAPIGRKKDSIILHEVNDEGKHAITNYHVIKEFENYSLIELWLETG
FT                   RTHQIRVHMSYLGHPLLGDDLYGGKLNLIARHALHAYKLKFTHPFTHEEICLSSSLPDD
FT                   MAKLIID"
FT   CDS             complement(409008..409166)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05623"
FT                   /db_xref="GOA:D4KH94"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH94"
FT                   /protein_id="CBL05623.1"
FT                   /translation="MITNPKHFIVESAHPSPLSAFNGFFGSRPFSKVNAFLENVGEKPI
FT                   NWQIPNL"
FT   CDS             complement(409163..409681)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05200"
FT                   /product="Uracil-DNA glycosylase"
FT                   /function="Uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05624"
FT                   /db_xref="GOA:D4KH95"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH95"
FT                   /protein_id="CBL05624.1"
FT                   /translation="MEIFHNDWAEFLNPELKKPYYLELRKFLVDEYKTRQIFPDMYDIF
FT                   NALHYTSYHDTKVVILGQDPYHGDGQAHGLSFSVKPGVKAPPSLVNIFKELKEDLGCEI
FT                   PNNGCLKPWTQQGVLLLNTVLTVRAHQANSHRNMGWEKFTDRIIEILNEREKPIAFVLW
FT                   GAPARKKKK"
FT   gap             409854..410750
FT                   /estimated_length=897
FT   CDS             complement(411338..411730)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05230"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05625"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH96"
FT                   /protein_id="CBL05625.1"
FT                   /translation="MRCKVELSNKILMRYFWISLGCISFILGTIGIILPLLPTVPFYLL
FT                   TLYCFSKGSQRLHQWFRQTDLYKKHLADFVQKRTMSIKAKFKVLFMVTVIMSIGYYFMP
FT                   AEFFWVQYVMLTVWIIHIIYLFWGGA"
FT   CDS             complement(411802..412020)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05240"
FT                   /product="Major Facilitator Superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05626"
FT                   /db_xref="GOA:D4KH97"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH97"
FT                   /protein_id="CBL05626.1"
FT                   /translation="MKNVPIEKRSTAMGYYQAIYAVGMTIVPMIAGNIAEIYNLNIAFY
FT                   LEGIIAVVATVASMIYFKYDNRKTIKG"
FT   CDS             complement(412481..412981)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05260"
FT                   /product="Major Facilitator Superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05627"
FT                   /db_xref="GOA:D4KH98"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH98"
FT                   /protein_id="CBL05627.1"
FT                   /translation="MDKSKLNYQKNLLLVIVVLFWFAQYVYVPFQTPYLSTMQVSSSMI
FT                   GIIIGIYGFSQMVLRMPIGIMADKNGRHKLFIILGVTASALASVFRIILEPQTGFLVGN
FT                   ILSGFASAMWISFMVLYASYFTCENLQRAMGLIMAANNIGVLGGFVLSTLSYNHLGMNF
FT                   YVY"
FT   CDS             complement(413059..413856)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05270"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05628"
FT                   /db_xref="GOA:D4KH99"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4KH99"
FT                   /protein_id="CBL05628.1"
FT                   /translation="MIEMNEMKKVLTIAGSDCSGGAGIQADIKTITAHKMYAMSAITAL
FT                   TAQNTTGVYGILDAGADFVGRQLDCIFQDIYPDAVKIGMVANKEIIEMIAHKLVEYKAK
FT                   NIVSDPVMVSTAGSRLMEEDAANTLIEKLLPLATVITPNLAEAEVLCGFAIKTKEDCIK
FT                   AAQTISQKIPTAILIKGGHLEDTADDLLWDHGEIHWFEGKRIDNPNTHGTGCTLSSAIA
FT                   SNLAAGHDLVTSIKNAKDYITGALKANLDLGKGSGPLNHMYNL"
FT   CDS             415267..415557
FT                   /transl_table=11
FT                   /locus_tag="MHY_05300"
FT                   /product="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05629"
FT                   /db_xref="GOA:D4KHA0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHA0"
FT                   /protein_id="CBL05629.1"
FT                   /translation="MYQEERLYQIMNLLRKKKSLSKQEIMSTFNISRDTARRDIICLVE
FT                   QKIALRTHGGITLPTVQLRQSFKERANLKNSNKDLLGKVASSYIKKMLFAI"
FT   CDS             415581..415706
FT                   /transl_table=11
FT                   /locus_tag="MHY_05310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05630"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHA1"
FT                   /protein_id="CBL05630.1"
FT                   /translation="MCKYIKEKSTIYSNSIDIIEQLKDNATLDLHLLGGKLNPVN"
FT   CDS             415828..416622
FT                   /transl_table=11
FT                   /locus_tag="MHY_05330"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05631"
FT                   /db_xref="GOA:D4KHA2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHA2"
FT                   /protein_id="CBL05631.1"
FT                   /translation="MSIKLIALDMDGTLLNRQKLVSEENASAIKRAMDKGIYVTIATGR
FT                   MPASAVYFAKQLNMNCPVISCNGGVVKDLNTGKSIYEAHFPKDTITKLISICYQKNWYI
FT                   RWYIGDTIYIRYVDMDMFLAYKTTKGLNIVEVGDEFEKYTENVTQLVVCDLNGNIQKIQ
FT                   DELSNIFKDKIGLQQNTEYTMDITLPNINKAVGLSKLAQYLQIDKSEIMACGDGDNDLA
FT                   MIEYAGLGVAMGNAIDDVKNIAQFITKDCDENGIAYVIDKFI"
FT   CDS             complement(416655..418553)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05340"
FT                   /product="Response regulator containing CheY-like receiver,
FT                   AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05632"
FT                   /db_xref="GOA:D4KHA3"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHA3"
FT                   /protein_id="CBL05632.1"
FT                   /translation="MIREHRNREKLINYYKIFINKGITDPNVHPWIKESWELSKQYQVN
FT                   PKKIPATARLSAYELAQLQSKHSDAIEYLDNFIDSIVDFLHEYNLCLTIMDSECTVLKK
FT                   YANPTSRLIDRLEGVSLTTKNVGTLSCNIVKEHKVPFWVFGPEVWLEELHEMNSGSVPI
FT                   MVNGELTYIVSLTVMEYEKIPQDVVLALLFTLKTALELNIRQSLNIKAQKAILDAAPFA
FT                   VYHIMSEDKIVYANRMGEERLSAINAINENKETAHLKDVVLNYTHTPIYDGFQGVSCYN
FT                   RETTWITNNKTYEDITTVVPLKNSEDVQSVVTVSMPIEDLRTLVAHASGYTAKYSLSSM
FT                   VGESKAFVQMKERAYRLARNKNHILLQGEAGIGKQRLAHGIHMASMRMAGPLISINCAD
FT                   STPELLEQDIFGAATDSDVSHPGKLELASKGTLFIDEIEKLPSSIAKMLAKALSEKKTH
FT                   RIGESLERSIDVRIIAASDANLRRLTEKGQFDEKLFNIISRSIIRVPSLRSRRDDIPML
FT                   SVNIIEELSKQHQMEPKVLLPESLEVLKNYDWPGNIKQLQSVLEYSFFNTSGHEIYPTD
FT                   INLMGSVKPDNKWKTDKEIFLKAWKAAGGNVSRLSNLLSVSRVTLYRYIKKYGLEK"
FT   CDS             418750..419103
FT                   /transl_table=11
FT                   /locus_tag="MHY_05350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05633"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHA4"
FT                   /protein_id="CBL05633.1"
FT                   /translation="MVFSMARMSKRISNKITKTKEQQNAPKEQKKYGKDIWLILLIVIN
FT                   FLLLVTMWESLILAPISFATYLVLEIALVIMYANRHAKVSDNVREWLYKAQIFFMGIIL
FT                   LLFLYTVVAYIFG"
FT   CDS             complement(419166..419699)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05360"
FT                   /product="Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05634"
FT                   /db_xref="GOA:D4KHA5"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHA5"
FT                   /protein_id="CBL05634.1"
FT                   /translation="MELKGSKTEQNLWAAFAGESQARNKYTYYASKAKKDGYVQIAKIF
FT                   EETAANEKEHAKIWFKLVDKVGTTEENLKAAAAGEHEEWTSMYPEFAKVAREEGFTRIA
FT                   NLFEMVAKIEQEHDARYNLLLANIQEDKVFKRNEKMIWMCSNCGHVYEGTEAPEICPVC
FT                   AHPKAFFEIKANNY"
FT   gap             419814..420596
FT                   /estimated_length=783
FT   CDS             420966..422108
FT                   /transl_table=11
FT                   /locus_tag="MHY_05380"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /function="2-oxoglutarate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05635"
FT                   /db_xref="GOA:D4KHA6"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHA6"
FT                   /protein_id="CBL05635.1"
FT                   /translation="MIKLMQGNEACSYGALAAGVRFFAGYPITPSTEIAETMAKLLPKM
FT                   GGKFVQMEDEIASMGAILGASLAGDKVLTATSGPGFSLKQELIGYACAAEIPVVIANVQ
FT                   RVGPSTGQPTSPAQGDIMQARWGTHGDHSIIVLSPWSVRETFDVTVMAVNYAERFRTPV
FT                   ILLMDEIVGHLRENIDVPEKDDIEIYSRRQPKMAPSPEYKAYTPDTDLVPNIADFGKGY
FT                   HIHVTGLIHDETGFPSGSPMVTREVIDRLHKKIDIARDEICHYEAYNMEDAQYAIVSYG
FT                   GTARTAYEAMLEARKKGYKVGMVRLITIWPFADKVIADLADKVDAILVPELNYGQLVHE
FT                   VQRVSEGKCKVEFLGKYDTQIFTPAEIETAIIKMCEGGNN"
FT   CDS             422108..422932
FT                   /transl_table=11
FT                   /locus_tag="MHY_05390"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /function="2-oxoglutarate ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05636"
FT                   /db_xref="GOA:D4KHA7"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHA7"
FT                   /protein_id="CBL05636.1"
FT                   /translation="MKPRVYEQHFRQNRLPHLWCPGCGNGIVMKAIVEAIVKKNLDPDK
FT                   TVIVSGIGCSSRASGYMDFDTLHTAHGRAIPFATGIKLARPELNVIVITGDGDCMAIGG
FT                   NHFIHGARRNVDLTVVLFNNNIYGMTGGQASPTTPLDKKATTAPYGCVDNPFDPCNLSA
FT                   AAGATYVARSTAYHVPHLINMIAGGIENKGFSLIEAIVQCPTAFGRKNKMADPAQMMMW
FT                   MRDNAIMKPAFDKLADDKKIGKFPIGLLHQHQSIDYDHAYDKVIEIAGGVEK"
FT   CDS             422929..423453
FT                   /transl_table=11
FT                   /locus_tag="MHY_05400"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /function="2-oxoglutarate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05637"
FT                   /db_xref="GOA:D4KHA8"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHA8"
FT                   /protein_id="CBL05637.1"
FT                   /translation="MMKQLRLSGSGGQGVITAAIIFAEAAVSEDKQAVQSQSYGPEARG
FT                   GASKAEVIISDNPIYHPKVINPDIVLAMTQKAADKYYGDLDKDNGLLIVDEDLVPNAPD
FT                   FPHIIKVPITKMASEKLGKLLFANIVALGIMVKLSGIVSLETVKQSVAHRVPPHTVDKN
FT                   MQALELGYNAV"
FT   CDS             complement(423510..424286)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05410"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /function="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05638"
FT                   /db_xref="GOA:D4KHA9"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHA9"
FT                   /protein_id="CBL05638.1"
FT                   /translation="MIKIEEVFKNKKAFIPFVLAGYPNLEATEKFIIKMAEAGADLIEI
FT                   GIPFSDPVAEGTVIQAASKVALSGNMTTNDIFYMAEKLKGKVNIPLVFMTYINPIFVYG
FT                   KDKFFARCKQCNISGVIVADLPFEEKDEILTQANENDVEVISLIAPTSENRIGMIANEA
FT                   QGFIYCVSSLGVTGIRKEIKTDIQSIVDTVRKYTDKPVAVGFGISTPQQAYDMAKIADG
FT                   AIVGSAVIRIIDKYGKEATPYLVDYVKSMKEAISKA"
FT   CDS             complement(424279..425481)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05420"
FT                   /product="tryptophan synthase, beta chain"
FT                   /function="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05639"
FT                   /db_xref="GOA:D4KHB0"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHB0"
FT                   /protein_id="CBL05639.1"
FT                   /translation="MSVNKINKKGRFGKYGGQYMPETLMNAVNQLEEAYLKYKDDPDFV
FT                   RELEDLQRKYTGRPSLLYFAEKMTNDLGGAKIYLKREDLNHTGSHKINNVLGQILLAKR
FT                   MGKTRVIAETGAGQHGVATATVAALMNMECEIFMGEEDTKRQALNVYRMELLGAKVHSV
FT                   TKGTRTLKDAVNEALREWTSRIDDTHYVLGSVMGPHPFPTIVRDFQSIISREAREQILD
FT                   MENRLPDVVMACVGGGSNAMGMFYNFIPDKQVRLIGCEAAGKGLDTEEHAATISKGTEG
FT                   IFHGMKSYFCQDKYGQIAPVYSISAGLDYPGIGPEHAYLHDSGRAEYVAITDDEAVDAF
FT                   EYLSRTEGIIPAIESAHAIAQVMKIAPKMKKDEIIIVCLSGRGDKDVAAMARYRGVKIN
FT                   D"
FT   CDS             complement(426415..426879)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05450"
FT                   /product="Indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05640"
FT                   /db_xref="GOA:D4KHB1"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHB1"
FT                   /protein_id="CBL05640.1"
FT                   /translation="MILDEIVEKRKINIAKQKQIKSLAMLKKEAEALLQNRDFPLEKAL
FT                   TKQDINFICEVKKASPSKGIIAQDFPYLTIAKEYELAGASAISVLTEPDYFLGEDKYLQ
FT                   EIAQNVSIPVLCKDFIIDEYQIYKAKILGASAILLICAILDDETLKKFLL"
FT   CDS             complement(426880..427134)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05460"
FT                   /product="Anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05641"
FT                   /db_xref="GOA:D4KHB2"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHB2"
FT                   /protein_id="CBL05641.1"
FT                   /translation="MEYANSAELVGGDKNENAQITRDILAGTLGAKRNAVLLNAGMSIY
FT                   LAKDGLSIQDGINIAKDTIDTGKAKYQMERFIKYSNEVC"
FT   CDS             complement(427167..427892)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05470"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /function="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05642"
FT                   /db_xref="GOA:D4KHB3"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHB3"
FT                   /protein_id="CBL05642.1"
FT                   /translation="MIKQAIYQLSNKQDLTTEQAIVSMQEIMSGTASNIQIASFLTALR
FT                   LKGETIDEITAFAQVMREKAQSIDYKDDLFEIVGTGGDEANTFNISTTAGFVISASGIK
FT                   VAKHGNRSVSSKCGAADCLEALGTKLELDAKQNEKMLDEIGMCFMFAPKYHSSMKYASP
FT                   VRRELGIRTVFNILGPLANPANANRQLMGVYQEELVEPLAKVLSNLGVKRGAVVYGYDG
FT                   LDEITACNKTLVCEIKDKN"
FT   CDS             complement(427858..428142)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05480"
FT                   /product="Anthranilate/para-aminobenzoate synthases
FT                   component II"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05643"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHB4"
FT                   /protein_id="CBL05643.1"
FT                   /translation="MEKSPLFKGIDKEFMGARYHSLAIKRETLGEDLKLIATTDDGEIM
FT                   AIEHRKYPIYGLQFHPESILSDNGKKLIQNFLDIRGGQNDKTSNISIEQ"
FT   CDS             complement(428210..428470)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05490"
FT                   /product="Anthranilate/para-aminobenzoate synthases
FT                   component II"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05644"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHB5"
FT                   /protein_id="CBL05644.1"
FT                   /translation="MILLVDNYDSFVYNLYQLIGSINPEIKVIRNDELNIEQIKKLNPS
FT                   HIVLSPGPGKPSEVGICSEIVKVFQGEIPIFRDLFRSSSHS"
FT   CDS             complement(428451..429956)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05500"
FT                   /product="anthranilate synthase, component I"
FT                   /function="anthranilate synthase, component I"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05645"
FT                   /db_xref="GOA:D4KHB6"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHB6"
FT                   /protein_id="CBL05645.1"
FT                   /translation="MYKPTLAELEAIKTEYKIVPVSKEIFADLTTPIKVLKILKNISDN
FT                   VYLFESVENTHHWGRYSFLGFNPSLEISCKNHLLKINKAINNEIQGIKTDNPNIEIREI
FT                   LKAYKSPKFEYLPSFTGGLVGYFAYEYLRYQESKLDFVDETVNKDEVSFNDVDLMLFDK
FT                   VIAFDHYTKKIILIVNIKTDDLEANYAKAIDDLEKLAKLIIYGKEKEIPSGKLLSDFKR
FT                   EFSKDEYIDVVKKTQHYIKEGDIFQAVISNRIEADFSGSLLNAYRILRTINPSPYMFYL
FT                   SSKQIELTGASPETLIKLEDKELKTFPIAGTMPRGKDGREDDLLKTRLLSDEKELAEHN
FT                   MLVDLGRNDISKISKFNSVTVENMHKVEFFSHVMHITTTVKGKIKDDCDALDAIVATLP
FT                   AGTLSGAPKIRAMEIIHELEKSPRGIYGGAVGYIDFAGNMDMCIGIRMAVAKQGKVFVR
FT                   SGGGIVKDSIPENEYQETINKAQSMIEAITKAQEVETYDFVSR"
FT   CDS             430471..431580
FT                   /transl_table=11
FT                   /locus_tag="MHY_05510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05646"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHB7"
FT                   /protein_id="CBL05646.1"
FT                   /translation="MNDDKWQRTVAKRRRQRRIQNLFACFIVLLVLLILSIIGGYYYYQ
FT                   RTNSPEHALEELQTAFEHRDIDTIHKYVDFKTLLPPNYKILTNDIFINDKIYTEKEHSI
FT                   YQTFYALIEPIIIDGTIQSIDKYIQTGNWQRFNYDSMLKGRQLGIDYTELINRSLLFNI
FT                   SFKEIKSIETIDDNSVMATILVADKYTDTNFDLKLKLVKNEEGIWQVSEVTNYQDYLTM
FT                   ISNLYRQDINTYLTNTKSDLDRNNAQFKQLQSEFIVLAENFKNNPSSSQRALLKSFIDN
FT                   KIVPTYQDWYNYLQSYQIPTGARHLHELRMESTTYTIQAWKAYAIGIQDNKPKDLAKAE
FT                   RLHRKAMETEQKVTDTINNMPALFMPTVD"
FT   CDS             complement(431680..432183)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05647"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHB8"
FT                   /protein_id="CBL05647.1"
FT                   /translation="MDFSMLNQIFQDNLAIILTVIVVLLVLLIILSIVMLVKLSKAKKR
FT                   YNSLVNGATGESLEDIIADNIAQMNELVVKNNKIDADYAEMKSLFTKSIQKVAVHRFCA
FT                   FADMGGDLSYAVALLDNQNNGVIFSSIFGRQDSCTYVKPIENGVSKYPLTQEENKVLLE
FT                   AMSK"
FT   CDS             complement(432301..433134)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05530"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /function="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05648"
FT                   /db_xref="GOA:D4KHB9"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHB9"
FT                   /protein_id="CBL05648.1"
FT                   /translation="MEFLNIDEILPNPFQPRKEFDMEQLAQLAKSIKEYGIIEPLIVRI
FT                   NDNDEFELIAGERRLRAAKMAGLDKVPIILKDYDDDKVAQIALIENLQRSNLNVIEEAN
FT                   AYQLLLHKFNLKQEEVAQKVGKSRSHIANFVRLLNLAKEVQCLLQDNKLNMGQAKPLLA
FT                   IEDEKLQVKLANLIIERELSARKAEALVKKVLAGDNVIEQIEQVKEAKMYLNDVQERLK
FT                   QILGTNVNIKQGKKKSRIEIEFYNDDDLARLVELLMEKQESPQMNKSRIIKDFNI"
FT   CDS             433323..433424
FT                   /transl_table=11
FT                   /locus_tag="MHY_05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05649"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHC0"
FT                   /protein_id="CBL05649.1"
FT                   /translation="MPKYNAALMSIDPSETRRYAGLNKAPNFNKKLF"
FT   CDS             433663..434022
FT                   /transl_table=11
FT                   /locus_tag="MHY_05550"
FT                   /product="Vitamin B12 dependent methionine synthase,
FT                   activation domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05650"
FT                   /db_xref="GOA:D4KHC1"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHC1"
FT                   /protein_id="CBL05650.1"
FT                   /translation="MDAAATTAVEHVADGIEQAIDQKFNMQGLVRRWRFSPGYGDWPIQ
FT                   AQPEMLRLAKAHEIGISLTSSLMLTPRKSVTAIIGLIPKTQDVEPEKQSCKYCPNPNCN
FT                   FRIKPFDSELLNKNS"
FT   CDS             434082..436454
FT                   /transl_table=11
FT                   /locus_tag="MHY_05560"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /function="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05651"
FT                   /db_xref="GOA:D4KHC2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017215"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHC2"
FT                   /protein_id="CBL05651.1"
FT                   /translation="MIHIFDGATGTMLQKSVLKPGMCPELLNIEAPEAIQNVHRAYVEA
FT                   GSNIVETNTFGASRIKLNEYNLGDKVEAINIAAVKNAKIATAGKAKVAGSMGPTGAFIE
FT                   PLGELTFDKVYANYYEQAKILADAGVDYILIETCIEIQEMRAALLAAKDACDLPVICQL
FT                   SFSEDGRTVTGTDPQSAAIILEAMGADIIGANCSLGPEQLVPIIKELADNCSCPISVQA
FT                   NAGMPHLENGQTIFPLTPEDMAKWAPKLVEAGATYIGGCCGTTPAHIKAIKEALANVSE
FT                   PIRKAPNPNLALASRSKTVFIGKDLPTRLIGERINPTGRKKLAEEIKNGSFISVKREAI
FT                   EQTQAGAQILDVNMGVAGIDQAKAMHKAITEISQLVNTPLAIDTSDVKALEAGLKAYPG
FT                   RALINSVSAEPDRLKYFIPLARRYGAAILCLPLSDEGIPKTAKERLALAQKIIAEAKAQ
FT                   GLKDNDFLLDALVMTIAADKNACNEVLNTLKLYREHIGAPSTMGLSNISFGLPNRPLIN
FT                   STFFTMCLAMGLDAPIMNPYDDSMQNALSASNALLAKDPNGRDYSLNHSGQNIPVAKAK
FT                   NTVSSGDIIEDIKSAIISGEKESIAQMVEQALTEGHKPNEITDKALSAAMNVVGKDFGA
FT                   KKIFLPQVMLSAEAMREAFIKIKERIPSDSVSNKGTIVIATVKGDIHDLGKNIVSALLE
FT                   NNGFKVIDLGKDIDKEEIIKAAIDNKADMIGLCSLMTTTITQIDEVIAELNKSDYSTKV
FT                   MIGGAVVTQEYADNVGANAYAPDGVEAVEIAKKLINK"
FT   CDS             complement(437155..438039)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05580"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05652"
FT                   /db_xref="GOA:D4KHC3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHC3"
FT                   /protein_id="CBL05652.1"
FT                   /translation="MHMVSRYGIFCKVIENGNFTKVAKEVGYSQSAISQSIKALEQELG
FT                   TILIDRKKEGITLTDDGKSFYPYIQAIFHAELSLKQKQQEMKGLEHSVIRIGTFTSVSR
FT                   NILPQLMKSFKSLYPTVNFVLKQGEYTSIKKWILHGEIDFGFVNSDVVSGINMEFLYRD
FT                   EMMAVLPKHHKLANLSIISLDQLAKESFILLDEGRHSVIMHAFTDYKLEPQIEYKVYDD
FT                   YSILAMVKQGLGISAMYSLVLNGFEDGLAIRPIKEHPERNVALAWQNWDTMSLASRKFV
FT                   EFIKENFVFVQEK"
FT   CDS             438152..438934
FT                   /transl_table=11
FT                   /locus_tag="MHY_05590"
FT                   /product="Predicted branched-chain amino acid permease
FT                   (azaleucine resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05653"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHC4"
FT                   /protein_id="CBL05653.1"
FT                   /translation="MEEIAMNELDIADDVYPVDNISVKKQAFKDGIRDGFPIALGYLAV
FT                   SFSLGITAKNAGLTAFQGFLTSFLVNASAGEYAGFTSIATMATYIEVFLVILIANSRYL
FT                   IMSCALSQKLSPDIPWYQRILIGFDITDELFAISIARPNYLNPFYYFGAMFITMPCWAG
FT                   GTALGIVVGNLLPIQLISAFSVALYGMFLAVIIPPARKNKVIGVFVIISFIASYLSTYL
FT                   PYISELSSATRIIILTIVLSLIASILYPVKTKDGEENV"
FT   CDS             438927..439232
FT                   /transl_table=11
FT                   /locus_tag="MHY_05600"
FT                   /product="Branched-chain amino acid transport protein
FT                   (AzlD)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05654"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHC5"
FT                   /protein_id="CBL05654.1"
FT                   /translation="MSEVYIYILVMALTSFAIRVLPLTLIQTEIKNPLIKSFLYYVPYI
FT                   TLAVMTFPAIIQVTQTPLSGAIALVIGIVLSWFGANLFQVASSCCLSVFVVELLLL"
FT   CDS             complement(439259..439798)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05610"
FT                   /product="Transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05655"
FT                   /db_xref="GOA:D4KHC6"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHC6"
FT                   /protein_id="CBL05655.1"
FT                   /translation="MQDRYYILAVVGTIDPILPIPFFPINQLMQSEIQQVFFHLLDGNI
FT                   NGIFMLPENKANYTIFETAKDLLEKYVKFINPKYAITKIRKFIEKIEYNPKNEEYVLDL
FT                   MIHMGCMLDRCLSKIDIKYNNLDLYKEKEKLLFDKIIIALKDIEQDYNIKISDDEVAYI
FT                   VKIITTKNKKGILIIY"
FT   CDS             complement(440546..441730)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05630"
FT                   /product="Transcriptional regulators containing an AAA-type
FT                   ATPase domain and a DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05656"
FT                   /db_xref="GOA:D4KHC7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHC7"
FT                   /protein_id="CBL05656.1"
FT                   /translation="MLLGYNSSLLSQVRQAKAAIVYPPKGLHTLLLGESGVGKTTFAQA
FT                   MHAYGLLMNNKENKDYPFVTFNCADYFNNPQLLLSQLFGHVKGAFTGADTDKIGLVEKA
FT                   NGGILFLDEVHRLPPDGQEMLFYLMDKGEYNRLGDGSKRKSNVLIIAATTEDPSTTLLN
FT                   TFIRRVPVNIILPRYKDKPIAEKIELIEQFFRFEAINLQQEILIAPEVLKALALFDFIG
FT                   GNIGQLRSEIKLLCANAFLQYLQNNQRIYVGYQMLNKEIRDVLLNYLKLDKSITSYLNM
FT                   FSEDIVIRPNSKNIEYEETNDIYEIITKKLDSLKQKGVALENITDVLKTDIDNYLCSVS
FT                   KHFNNTNSNLNNLYKLVSKDIVLATMQFIEYAREKLQVNFSNHFYLVYHYIFKN"
FT   CDS             complement(441972..442118)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05657"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHC8"
FT                   /protein_id="CBL05657.1"
FT                   /translation="MNSVYIIFFIKILINKEYKMSQANDILDFIKRNCKVEVFIKGLKM
FT                   VKI"
FT   CDS             442462..442731
FT                   /transl_table=11
FT                   /locus_tag="MHY_05650"
FT                   /product="Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05658"
FT                   /db_xref="GOA:D4KHC9"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHC9"
FT                   /protein_id="CBL05658.1"
FT                   /translation="MPHTYPEHVIKPAILVATLENPIDFHEMGNSSNTVPAKLIFMLAV
FT                   TDPKGHLEILSKLMSIFSQEDKLIDLYNSTQAKEIIDKLNKVLN"
FT   CDS             442748..443008
FT                   /transl_table=11
FT                   /locus_tag="MHY_05660"
FT                   /product="Phosphotransferase system, galactitol-specific
FT                   IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05659"
FT                   /db_xref="GOA:D4KHD0"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHD0"
FT                   /protein_id="CBL05659.1"
FT                   /translation="MKRIFVACGSGVATSQTVASKIQSMCEDEGLDVSVEAVDIKSLES
FT                   IIDQCDIYVSIVSDNADEWDVPTIKGIPFLTGVGMDEEFEN"
FT   CDS             443142..443804
FT                   /transl_table=11
FT                   /locus_tag="MHY_05670"
FT                   /product="Phosphotransferase system, galactitol-specific
FT                   IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05660"
FT                   /db_xref="GOA:D4KHD1"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHD1"
FT                   /protein_id="CBL05660.1"
FT                   /translation="MFNDILNYILGLGAAIFLPIIMIILGLCVKMKLKKAIMAGLTLGI
FT                   AFTGMNVVLGFMFSSISPAAQALVERTGLELTAIDVGWSPIAAIAWAWPFALFMFPLQI
FT                   GINLVMLALKLTNCLNVDLWNVWGKILTATLVAYITGNIAFGFIAGAIQIILELISGDL
FT                   IQKRCYEATKIPGVTCTHPMFLQGPILFLINRILDFIPGINKVNIDANELKTYWYIW"
FT   CDS             443815..444489
FT                   /transl_table=11
FT                   /locus_tag="MHY_05680"
FT                   /product="Phosphotransferase system, galactitol-specific
FT                   IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05661"
FT                   /db_xref="GOA:D4KHD2"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHD2"
FT                   /protein_id="CBL05661.1"
FT                   /translation="MGFIVGGLIAFLGGYAIKEILITAMSVATAMILFPMVAKLFMQAL
FT                   APIADAAGAFMKSKFKGRDFYVGLDWPFMAGCSEVWVIAIVLVPIELILAVVLSQLGLN
FT                   TLIPLASIINVVLTPPAMIIARKNLVRMFLISIIATPSYLIAATQFAPQITKMAADTNT
FT                   LHAEAGQFISWMQVEAPEFRWSIVHAFNGDLTGIIGIIIFAILFAWYFLSMKKSNAQDS
FT                   AK"
FT   CDS             444564..444683
FT                   /transl_table=11
FT                   /locus_tag="MHY_05690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05662"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHD3"
FT                   /protein_id="CBL05662.1"
FT                   /translation="MLFKLIEVVYVNIDLVILAFVILKQDMYVLLLLEWIEKK"
FT   CDS             444665..445219
FT                   /transl_table=11
FT                   /locus_tag="MHY_05700"
FT                   /product="Ribulose-5-phosphate 4-epimerase and related
FT                   epimerases and aldolases"
FT                   /EC_number="4.1.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05663"
FT                   /db_xref="GOA:D4KHD4"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHD4"
FT                   /protein_id="CBL05663.1"
FT                   /translation="MDRKEMTYHDVVVIDLDANVIEAETAQRRPTSESLMHLEVYKQHP
FT                   DINAVAHTHSKYATAFAVLKKPLPAVVYEILGLGCKEGIVPVADFGRPGTPELAINTVK
FT                   ALEKSDVALMQAHGVIAIDKDLKEALLKASYVEELAEIYYHTLVINNGNEPPYVSDSEL
FT                   QKWEYPKEIKLLDSLTRTSSK"
FT   CDS             445243..446247
FT                   /transl_table=11
FT                   /locus_tag="MHY_05710"
FT                   /product="dihydroxyacetone kinase DhaK subunit"
FT                   /function="dihydroxyacetone kinase DhaK subunit"
FT                   /EC_number="2.7.1.-"
FT                   /EC_number="2.7.1.29"
FT                   /EC_number="2.7.1.121"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05664"
FT                   /db_xref="GOA:D4KHD5"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHD5"
FT                   /protein_id="CBL05664.1"
FT                   /translation="MKKLINKPEDFARETIEGIVLAHPESLKMVNNSWHCLVRADEKKE
FT                   GKVAIATGGGSGHLPVFLGYVGYGLADGVTVGNVFASPSAEAMHEVDKAINSGAGVLHL
FT                   YGRYGGDIMNFGMASDLDEMEDIPVKEVLVTDDIASAPKGSESKRRGVAGLVFAYKCAG
FT                   AAAEKMYNLDEVARIAQKTVDNTRTMGVALTPCIVPEAGKATFSIAEDEMEIGMGIHGE
FT                   PGIHRTKLMKIDDVVSNIMEKILEDLPFEDGCEVAVLVNGLGGTPKEELYLAYRKLYQI
FT                   LSDKNISIHRKYIGEYATSLEMAGMSISLLKLDDELKEMIDAPCYSPFFEQNH"
FT   CDS             446265..446894
FT                   /transl_table=11
FT                   /locus_tag="MHY_05720"
FT                   /product="dihydroxyacetone kinase,
FT                   phosphoprotein-dependent, L subunit"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05665"
FT                   /db_xref="GOA:D4KHD6"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHD6"
FT                   /protein_id="CBL05665.1"
FT                   /translation="METINKLKLKEILGNILESMQDAKDELIALDGAMGDGDLGLTMCK
FT                   GFEAIYQEIDILEETDMGKLMMKLGMKMNSVVPSTMGTLISTCFVKSAPKAKGKSELNL
FT                   TDLVEMGKAAVDGVMQRGGSKIGDKTMLDALAPAINALEQSLSENKTLAEAQQAAYQAS
FT                   IEGVEKTKTLKSVHGRAAYYNEQSIGKQDPGATAVMYIFRGIAKSF"
FT   CDS             complement(446965..447933)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05730"
FT                   /product="6-phosphofructokinase"
FT                   /function="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05666"
FT                   /db_xref="GOA:D4KHD7"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHD7"
FT                   /protein_id="CBL05666.1"
FT                   /translation="MSVENIAVLTSGTDAPGMNAAIRAVVRTAINNNVRIWGVYDGYRG
FT                   LVDDNMEELTSISVADIIQRGGTFLGTSFCKRFRTKEGRQLAYENLKKHNIDALIVIGG
FT                   DGSLRGAEEFERETGFSVIGIPATIENDIWGTDYAIGTDTAVNTILQAINEIRDTAKAH
FT                   RRTFIIEVMGNKCGWLATYSAVAGGGNMVIVPEEEFDKEKIINKVQKLHDGGKSYLVIL
FT                   ASEGTGNMQELVKELEARTGISTRLTVLGLVQRGGSPTANDRVFASVLGEQATLAAVSG
FT                   LHNIVFGMQRGNIVCIDLRDAITNKKEYPEDLRHLAEVISL"
FT   CDS             448202..449377
FT                   /transl_table=11
FT                   /locus_tag="MHY_05740"
FT                   /product="AICAR transformylase/IMP cyclohydrolase PurH
FT                   (only IMP cyclohydrolase domain in Aful)"
FT                   /EC_number="2.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05667"
FT                   /db_xref="GOA:D4KHD8"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024050"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHD8"
FT                   /protein_id="CBL05667.1"
FT                   /translation="MNSMELKYGCNPNQKPARVFMKDGQDLPFTVLNGRPGYINLLDAF
FT                   NSWQLVRELREATGLPSAASFKHVSPAGAAVAVPLSETLKKMYFVEGIELTPMATAYIR
FT                   ARGADRMSSYGDFAALSDECDAATARFLAREVSDGVIAPSYSAEALEILKTKRKGNYLV
FT                   IQMNPDYKAPELETKEVFGVTFEQKRNDIKITEELFNNIPTKNKNITDEAKRDLLIALI
FT                   TLKYTQSNSVCYAKDGQAIGIGAGQQSRVHCTRLAGNKADIWHLRQAPQVLNLPFKPDV
FT                   RRPDRDNAIDVYISDEYMDLLGGDDWKRVFTEKPPVFTKEEKDAWLAQVKGVALGSDAF
FT                   FPFGDNIERAHKSGVEFVAQSGGSIRDDNVIETCDKYNMAMAFVGIRLFHH"
FT   CDS             complement(449932..450699)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05760"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05668"
FT                   /db_xref="GOA:D4KHD9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHD9"
FT                   /protein_id="CBL05668.1"
FT                   /translation="MNSIYEQLKIDRTVPIPLYYQIKTFMIKHIEDNSLKDGELVPPEE
FT                   ELCAYLNVSRPTVRQAFLELVHEGYLNRIKSKGTFVTRPKIAGDFIQKIQTYNQEMQYY
FT                   GLKPKTKLLSISEIDVFAEVMEKLKLTEKDKVICLERLRYADDKPIVYVKTFIPVKLCK
FT                   GLIDEDLEQNSLYDTLKTKYNIEIAHINRQIHATVADPYLSDLLGIMENAPLLYITTVA
FT                   YNQNDIPFEYSLASYRADMYKMNVDLYKDKYYK"
FT   CDS             450828..451157
FT                   /transl_table=11
FT                   /locus_tag="MHY_05770"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05669"
FT                   /db_xref="GOA:D4KHE0"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHE0"
FT                   /protein_id="CBL05669.1"
FT                   /translation="MNKFSKYFDHTCLKPYATREDMAKLCEEAKKYDFMMVAINSTQTK
FT                   LCKELLKGTDIHVGAAISFPLGQTTIETKVFETKDAIANGADEIDYVINITELKEKIMT
FT                   ISKKK"
FT   CDS             451154..451258
FT                   /transl_table=11
FT                   /locus_tag="MHY_05780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05670"
FT                   /db_xref="GOA:D4KHE1"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHE1"
FT                   /protein_id="CBL05670.1"
FT                   /translation="MTQIVDVCRKHNVISKVIFENCYLTDEEKLNYAK"
FT   CDS             451339..451488
FT                   /transl_table=11
FT                   /locus_tag="MHY_05790"
FT                   /product="Deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05671"
FT                   /db_xref="GOA:D4KHE2"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHE2"
FT                   /protein_id="CBL05671.1"
FT                   /translation="MKSIVKNTVKVKAAGGIRDLDTCLKMIEAGAEKIGTSSAIKITEA
FT                   YNNK"
FT   gap             451614..452910
FT                   /estimated_length=1297
FT   CDS             453243..454301
FT                   /transl_table=11
FT                   /locus_tag="MHY_05810"
FT                   /product="Phosphotransferase system IIC components,
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05672"
FT                   /db_xref="GOA:D4KHE3"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHE3"
FT                   /protein_id="CBL05672.1"
FT                   /translation="MINTIIDGIAGIFLPIVSLLSAAGILKGVIAVLIATDVLIKESDN
FT                   YLVLNAMTDSLFYFLPMLLAYTSAKKFGANPFTAVVIAGIFLYPSLNHILESGQTVEFF
FT                   HIPLKGVTYHSSVIPIILASALLTFVEKFLNKIFPDMVKGFLTPLLCIIFVGFVTLFLF
FT                   GPIGMVIGDFLANIYEYIYKFSPIISGALLGTVIQPMVIFGFHWSFILIGMNNIAVLGS
FT                   DTVLALMGPAVFAQAGAGLAVFLKSKDTKFKSICASSILSALFGITEPIMFGVNLPRKK
FT                   PMIAVCIGGGIGGAIAGYSGAKAIAFAFPSLASLPVFYGDGFLLYILSDVIAAIIAFII
FT                   AYCLKFKVDLAK"
FT   CDS             complement(454640..455071)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05830"
FT                   /product="16S rRNA methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05673"
FT                   /db_xref="GOA:D4KHE4"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHE4"
FT                   /protein_id="CBL05673.1"
FT                   /translation="MSFVNDLSEVAKEYGLELTSDQISAFNKYYELLVEWNEKINLTAI
FT                   TEPREVAIKHIVDSLSCYQKELFTGQVSLIDVGTGAGFPGLPLKIFCPELKLTLLDSLN
FT                   KRVKFLQLVVDELGLKDVEVIHARSEEAARNKNIVKNLT"
FT   CDS             complement(456976..458373)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05860"
FT                   /product="tRNA modification GTPase trmE"
FT                   /function="tRNA modification GTPase trmE"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05674"
FT                   /db_xref="GOA:D4KHE5"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHE5"
FT                   /protein_id="CBL05674.1"
FT                   /translation="MKNFGENDTIVAISTPPGEGGIGIIRISGENSGIVASKLFKCAKK
FT                   DLTVGNFESHKVVYGKIVDEKGNVIDEALCIAMWAPNSYTKENVVEIQSHGGALVVRRI
FT                   LELALQNGARMAEPGEFTKRAFLNGRLDLSQAQSVMDIIKARTDASLRMAAGHLQGKFS
FT                   DEIKAMRHDILEVIAHLEASIDFPEDDIEDVAKDEASAKVRSIKNRIEEMLSTFNTGRI
FT                   LRDGLVTAIIGKPNVGKSSLLNTLLREDRAIVTDIPGTTRDSLEEYANIGGVPLKIIDT
FT                   AGIRETEDKVEQIGVEKSMSYVQKADLILALFDTSSDLTKEDEEIINLLQGKEGIVLLT
FT                   KNDLSCVLDIEDLQKRLQGNFKYMQISTFNNDGIKELEQEIVNRVYSGTVKQTEGVFVN
FT                   NVRQANALKEAQKYLEDCLNTIEMDMAEDFIVIDIRSAWEKLGEITGDTVDEDIIDQIF
FT                   SQFCIGK"
FT   CDS             complement(458460..459113)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05870"
FT                   /product="Predicted RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05675"
FT                   /db_xref="GOA:D4KHE6"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHE6"
FT                   /protein_id="CBL05675.1"
FT                   /translation="MARVIEVTGKDIEEAKKLALSQLDLPQERVIFEVLEEPSKGFFGL
FT                   IGARVAKIRATEKELTPLEKGQEFLKKIFKSMHKDIQIECIEEDINYKFNLIGDDLGVL
FT                   IGKHGQTLDSLQYLTNMAANKNVTGARVRIVLDVENYRKRREETLCQLAERLANKARKY
FT                   RTKVVLEPMNRHERKIIHMALQDYVDIITYSDGVEPHRKIVVDIKHNKNEDLVI"
FT   CDS             complement(460061..460426)
FT                   /transl_table=11
FT                   /locus_tag="MHY_05900"
FT                   /product="ribonuclease P protein component, eubacterial"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05676"
FT                   /db_xref="GOA:D4KHE7"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHE7"
FT                   /protein_id="CBL05676.1"
FT                   /translation="MKYSLQKKLIVKENSDFQKIYRCGRSLANKNMVMYYCKAFHPSHK
FT                   VAFAAGKKLGNAVTRNRVKRLLREVYRLHRHEIKDDYCLLLVGRAAAVDLKSTALEKSF
FT                   YSLCKRANILKKEVEKK"
FT   CDS             460919..461239
FT                   /transl_table=11
FT                   /locus_tag="MHY_05920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05677"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHE8"
FT                   /protein_id="CBL05677.1"
FT                   /translation="MTDIQLQATWEEILKNLENSLSTRVCNNWLKPLKPIKLTTEMLEL
FT                   GAPNVFTKNWVEKYYLPFLTDSCYEITKAHLEISITNLESTKDTETIYPDELKQQQLKT
FT                   QY"
FT   CDS             461913..462404
FT                   /transl_table=11
FT                   /locus_tag="MHY_05950"
FT                   /product="ATPase involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05678"
FT                   /db_xref="GOA:D4KHE9"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHE9"
FT                   /protein_id="CBL05678.1"
FT                   /translation="MDNLDVPLDVMTYIASHIDNNVRELEGALTRVVAYASFKHYPVTN
FT                   ELAVDVLKNTITKQEPTVKQADKIINIALIQETVAKYFKLTLADLNGKKRNRNIAFPRQ
FT                   IAMFLAREMTDASLPRIGGNFGGRDHTTVMHAHDKIKKQYQDNPKTASVIDEIRKLITS
FT                   "
FT   CDS             462662..463702
FT                   /transl_table=11
FT                   /locus_tag="MHY_05960"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05679"
FT                   /db_xref="GOA:D4KHF0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHF0"
FT                   /protein_id="CBL05679.1"
FT                   /translation="MKITCEKKELVQAIQTVLKAVPSRPQMPILSGIYIKAHQNYIELQ
FT                   GTDYEISIICKIKAIIETEGTIVLPGKYLYEVVRTLPGEYVEIKNNDSDNSVNIRSNSA
FT                   QFNLLNMQENEFPIIEPLKGQIDFNLKNDIFLNFIKKTSFACATDESRPVFTGCLMDIT
FT                   DENIVMAATNMHRLALIKENINYISDNNIKIIIPAKILNEFTHIFNSEIPTDIQISCTH
FT                   NKISFSYENIYVISRLIEGQFPDYNRVIPKEFKTHVNINKNEFQSALDRVSLISRSGDY
FT                   NIIHFEFVDNIVRISSDNPNIGKAEETINVDIEGPGINISFNAKYIIDVLKAIDAENFI
FT                   FPLINH"
FT   CDS             463785..464315
FT                   /transl_table=11
FT                   /locus_tag="MHY_05970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05680"
FT                   /db_xref="GOA:D4KHF1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHF1"
FT                   /protein_id="CBL05680.1"
FT                   /translation="MKIDLLTLYNYRNYNNLNLKLSSNINIFTGFNAQGKTNIIEAIYF
FT                   SSLGISHRTRTEGDLILWGKDEASINVKFSKRDINSILKIILKKNKRKELNFNGEIIKQ
FT                   KDLPGLLTMILFSPEDLMLIKGSPLLRRRFIDIELSQISRIYYNELVQYNRLLLQRNNL
FT                   LKKSVKIKSLYLC"
FT   CDS             464309..464893
FT                   /transl_table=11
FT                   /locus_tag="MHY_05980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05681"
FT                   /db_xref="GOA:D4KHF2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHF2"
FT                   /protein_id="CBL05681.1"
FT                   /translation="MLDTWDEQIAKTAAFIVEKRLRSIEKLSKLAQKIHYEISQKMEIL
FT                   NIRYNIHNYKNEALNSFDDLFNFYIQALSKYRDNDIYRGSTSIGPHRDDIDFFINDISL
FT                   KSFGSQGQQRSSVLSLKLAELEFLKLETGEYPILLLDDVMSELDTRRRDNLLSLLQDNN
FT                   VQTLITATDINLFNSHPKNKFFKVEKGIVSE"
FT   CDS             464937..465191
FT                   /transl_table=11
FT                   /locus_tag="MHY_05990"
FT                   /product="Protein of unknown function (DUF721)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05682"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHF3"
FT                   /protein_id="CBL05682.1"
FT                   /translation="MKRAYSNNLFETGNTIIPKTMKNLGLLKEYKKNQIFYKWGDIVGK
FT                   EIEKHISPQEINFGVLYVYANSSVWANNFQYLKIEIIEK"
FT   CDS             465464..465832
FT                   /transl_table=11
FT                   /locus_tag="MHY_06000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05683"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHF4"
FT                   /protein_id="CBL05683.1"
FT                   /translation="MWQINAKRKPICFNCLREIKEEKEVTIIEIFEEMPWANYQDISQY
FT                   VDCNMDMVKKMRDKLIQMIASKLSPDDYTSVEAIKLVMLYKAISPEKLNEYIIKDTLNK
FT                   LRFDMAFWDNNKIKAKRK"
FT   CDS             complement(465948..466130)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05684"
FT                   /db_xref="GOA:D4KHF5"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHF5"
FT                   /protein_id="CBL05684.1"
FT                   /translation="MKILLKYCAQHQTNLIINSDAHIANDVGNHKYVHQILTEVNFPST
FT                   LIVNTSVDKFKKFID"
FT   CDS             complement(466265..466654)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06020"
FT                   /product="Histidinol phosphatase and related hydrolases of
FT                   the PHP family"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05685"
FT                   /db_xref="GOA:D4KHF6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHF6"
FT                   /protein_id="CBL05685.1"
FT                   /translation="MIDILDVHTHTIASGHAYSTLQEMIDSAKTKGLKLLGITEHTNKM
FT                   PGTCSEIYFYNFKVIPRKQDDLLIRMGAEINIIDYDGTMDLSTKAFSKIDYGIASLHDI
FT                   CIKPGSQEENTSAIINAMKHDKIKL"
FT   CDS             466975..468399
FT                   /transl_table=11
FT                   /locus_tag="MHY_06030"
FT                   /product="biotin carboxylase /acetyl-CoA carboxylase
FT                   carboxyltransferase subunit alpha"
FT                   /function="biotin carboxylase"
FT                   /function="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05686"
FT                   /db_xref="GOA:D4KHF7"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHF7"
FT                   /protein_id="CBL05686.1"
FT                   /translation="MFKRVLIANRGEIAVRIIRACQEMGIETVAVYSDEDADAMHVRLA
FT                   DYSYNIGPADASESYLNIDALMEAAERTEADAVHPGYGFLSEDADFAEMVTKAGMTWIG
FT                   PWADTIRKVGDKDEARAAMIPSGIPMSKGSTPLTSVEDAVEQAKDVGYPIILKPVAGGG
FT                   GKGMLIANSEDDLRNILTIIDINKVKYYFEHYIEHSRHIEVQIVADNYGHVIHLGEREC
FT                   SLQRRNQKLLEESPSIALTPDRRAEVGALAIKAAKSVHYNNIGTVEFLLDLKTNQFNFM
FT                   EINPRIQVEHGVTEAVTGIDLVRTQIRIAAGESLDLQQEDVKFTGHAIECRINAEDPDN
FT                   NFMPSPGKIDFFLEPGGPRVRVDSGVCAGLSISPYYDSLIAKIVVRGRTRGDAIKIMRR
FT                   ALNEFKVGGIKTTIPLHQRILKNEYFCTGDIDTRFIRNHFSKYVQPMTPAQLKASKTAK
FT                   TEKEIINAINASMYYA"
FT   CDS             468541..469173
FT                   /transl_table=11
FT                   /locus_tag="MHY_06040"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05687"
FT                   /db_xref="GOA:D4KHF8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHF8"
FT                   /protein_id="CBL05687.1"
FT                   /translation="MSNSRVRIIKDPEERKQEIIEAALHLFSQKGYEHTTIQDIAKYLN
FT                   ISQGLCYRYFKSKAEIFTATAEFYAQQILIQIRQPFPENMKAIDKFNITIKRLFQYIIK
FT                   HGEFEANSEVSALRADRLDSISRQIIEVIIPIIKQGNEEKIFNCYDIEKTTKIFIFGLV
FT                   HTFHEEMPKQNIKNYIKSFLKYLKINLVLILNIKEPELLGEGWENIL"
FT   CDS             470455..471036
FT                   /transl_table=11
FT                   /locus_tag="MHY_06060"
FT                   /product="Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05688"
FT                   /db_xref="GOA:D4KHF9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHF9"
FT                   /protein_id="CBL05688.1"
FT                   /translation="MRNLTEVSLKNKNLVWYFIVVIFFAGIFSYTKLGRMEDPSFTIRQ
FT                   MVVSVAWPGATASQMEEQVTDKIEKKLQDTPGLDYVKSFSRSGEAVIYVNLRDDIDNDK
FT                   IRPTWLEVRNMVDDIKKDLPEGVYGPYYNDRFDDVYGSIYAITGDGYSYEEMREKAEKI
FT                   RRILLTVDNVSKVELVGEQPEKNIYRSFIR"
FT   CDS             472078..473499
FT                   /transl_table=11
FT                   /locus_tag="MHY_06080"
FT                   /product="Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05689"
FT                   /db_xref="GOA:D4KHG0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHG0"
FT                   /protein_id="CBL05689.1"
FT                   /translation="MKFISQEFFPPSQRPELVVELTLPEGSSIKATEEQAEKLADVLSE
FT                   EQDKIDNFAYYTGQGSPRFVLTFDPVLPKDNYAQFVITAKDVEAREYLNQKLFKILNED
FT                   FPAVQSNIKFLQMGPPADYPVMIRVSGYDVDKVKNIADEVAMKMRQDSNIYNVNFDWQE
FT                   KAKTLHLELDQDKLRAMGISSQMVAQTLYTELTGATAAQFYQGDRTIDIVMRLSDDDRD
FT                   NLEKVRNLPIYLGQYGYVPLEQIAKISYRAEDGVIWRRDLKPTITVRGSIYQGTANDAT
FT                   EKIYNQLADLQKDLPFGYSIEPDGAMSDSQTAMEHLLKPIPVMVIAVITILMFQLRSVQ
FT                   LMIMTVLTAPLGLIGVSFGMLLFDKPIGFVAVLGILALFGMIIRNSIILIDQIKKHMLD
FT                   GEKPWNAIIDSAVLRFRPIMLTAAAAILGMMPLVPSTLWGSMAIAISCGLVVATILTLL
FT                   ILPTMYAAWFKNHTR"
FT   CDS             complement(473589..474437)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06090"
FT                   /product="Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05690"
FT                   /db_xref="GOA:D4KHG1"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHG1"
FT                   /protein_id="CBL05690.1"
FT                   /translation="MSSYAPKEKLGFCMGVMQGALTAGGVIGPLLGGVLASVFGMRVSF
FT                   FISAGALALITLITLIFIKEPPREAKTPEQLALAKEAEKVNLLKVPMIRRMLECAVVIQ
FT                   MAILILQPILTLYVAELHHSMDNVIMLSGMVFSLGGFAGAISAPLWGRYGQSHGFFRTM
FT                   CITLAGTGFILIIQSIPSTLTPFAILQFVCGLFYAGVYPSINSILVKKSPAEQRGRIFG
FT                   LMFAAQQIGSTIGPLVGGFIGTFFGLKFVFIFAGILMFITSALMYLKPPISRKPRKRFA
FT                   N"
FT   CDS             475295..475639
FT                   /transl_table=11
FT                   /locus_tag="MHY_06120"
FT                   /product="Pentose-5-phosphate-3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05691"
FT                   /db_xref="GOA:D4KHG2"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHG2"
FT                   /protein_id="CBL05691.1"
FT                   /translation="MKAAIAVKPATPISEIKDLLGELDMVLVMTVEPGFGGQKFMEDQM
FT                   EKVKELVKLREENNYKYDIEVDGGVNPETIKTCFASGANVIVAGSAVLGAKDISARVEE
FT                   FAQIAKEYNI"
FT   CDS             complement(475697..476323)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06130"
FT                   /product="Nitrate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05692"
FT                   /db_xref="GOA:D4KHG3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHG3"
FT                   /protein_id="CBL05692.1"
FT                   /translation="MQAFTDKKVLKLCFIYFMWVIGFWGFNFWMPTVLKSISGWSTSLL
FT                   GGAIAIPMTVALIVQIIAGYTSTKTGDKVWHVAIAMFIGAIGLGLSPFASNPSVALFLI
FT                   CLSAIGIYASMGVWWTVPTTFLTGPAAAGAIGLINSCGNLGGWVGPYMMGFIKTETGSF
FT                   DLGYFAMALFMLIAGITTLTIKYGWTGQKNRQPVTENTTTDTVAN"
FT   CDS             complement(476293..477027)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06140"
FT                   /product="Sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05693"
FT                   /db_xref="GOA:D4KHG4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHG4"
FT                   /protein_id="CBL05693.1"
FT                   /translation="MEQINFASLKRKRDLHIILPVFLVSIIACIDRVNIAYAALTMTED
FT                   LPWLTPEIFGAGAGIFFMGYLLLEIPGSLIAAKYSASKWIARIMFTWGLVCVLMAFMST
FT                   QTEFYIYRFLLGASEASLYPVIYSVLFPRWFTPKERARATSLMLTSLLLSTIIGAPLAG
FT                   VLLNTSILGMHGWQELFILEAVPALLFAVVFFFWVKDRPDQVSWLNDAEKKYLTEAFEA
FT                   EQARLQKVKNILLCKLLLIKKF"
FT   CDS             477477..478589
FT                   /transl_table=11
FT                   /locus_tag="MHY_06150"
FT                   /product="Leucyl aminopeptidase (aminopeptidase T)"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05694"
FT                   /db_xref="GOA:D4KHG5"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHG5"
FT                   /protein_id="CBL05694.1"
FT                   /translation="MDSRNLQLAHNLINYSVRLQKGEKLLIELIDEGMELAQALIQEAY
FT                   KVGGIPFLTIKNLKMQRELLLNATTEQMKLCAEYESLRMKNMDAYIAIRGSENVSQLSD
FT                   VPADKMEIYSKYWMKPVHSDIRVPKTKWCVLRYPNGSMAQLANMSTDAFTDFYYNVCNL
FT                   DYAKMGKAMDSLVKRMESVDKVRIKGKGTDITFSIKNMPAVKCAGDCNIPDGEVYTAPI
FT                   KDSVNGTITYNTPSIYQGTTFENVSFTFENGKIVKATANHTEALNKILDTDEGARYIGE
FT                   FSFGLNPYVTFPMKDILFDEKISGSLHFTPGCAYEDADNTNRSAVHWDLVLIQTPEYGG
FT                   GEIYLDDELIRKDGLFVVEDLFCLNPENLK"
FT   CDS             478792..479025
FT                   /transl_table=11
FT                   /locus_tag="MHY_06160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05695"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHG6"
FT                   /protein_id="CBL05695.1"
FT                   /translation="MLFYDGIKVYMQNGKLDDVEIAYYINKIRKTHKGKILKRISFILG
FT                   EGYIDLRYMFQSYPFERIWRISTKDRLIESVV"
FT   CDS             479126..480487
FT                   /transl_table=11
FT                   /locus_tag="MHY_06170"
FT                   /product="Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05696"
FT                   /db_xref="GOA:D4KHG7"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHG7"
FT                   /protein_id="CBL05696.1"
FT                   /translation="MTEQKRILIAVMITSFIGPFMGSSVNIAVPAMAEDFNMMPDELTW
FT                   AVTAFLIGSAATLLPFGRLADIKGRRRIYLQGLACICATTLVCAVVQNFLAFIFVRFLQ
FT                   GLSMSMIFGTSMALLVSCCGAENRGKTIGLSAACVYSGVSLGPFIGGFITDYLGWRMIF
FT                   GLIGIALLINFFLIFKVKIDWYGAKDKKFDYIGSIIYLVMIVLFLYGLSDWTRHEFVHY
FT                   MPFIAFILFLLFIYEQKKVASPLVDLSIFKNIVFTMSNIAALIHYSATFALGFVLSLYL
FT                   QLVRGMDAFTAGGFLLIQPFIMTIVSPKAGALSDKFSSRLITSLGMGMMMIGLFAFSFL
FT                   DKDTSFYLIGINLAFIGLGFGLFASPNNNAIMGDVEAKFYGVASSILAVMRLTGQAISM
FT                   SLVTLLLSIFTAEAIESNYVDILLHSFKYIFILFGFLCIIALFASLMRGKENVK"
FT   CDS             480644..480895
FT                   /transl_table=11
FT                   /locus_tag="MHY_06180"
FT                   /product="SSU ribosomal protein S6P"
FT                   /function="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05697"
FT                   /db_xref="GOA:D4KHG8"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHG8"
FT                   /protein_id="CBL05697.1"
FT                   /translation="MEEEATNAVIEKFSNLIVANGGTIDKEDRWGKKRLAYEIKDCTDG
FT                   FYCLFEYTAEPTCSAELDRVMKITDEVLKHMIVREDEK"
FT   CDS             480926..481372
FT                   /transl_table=11
FT                   /locus_tag="MHY_06190"
FT                   /product="single-strand binding protein"
FT                   /function="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05698"
FT                   /db_xref="GOA:D4KHG9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHG9"
FT                   /protein_id="CBL05698.1"
FT                   /translation="MNKVILAGRLVRDPEVRYTQTGKAVASFTLAVNRRFSRGADQQQT
FT                   ADFIPIVVWDKLAEVCGNNLVKGSQVLIEGRIQIRSYDAQDGSKRYVTEVIAQELEFMG
FT                   SRPTSAPAPTQQFGGAQMQTSSPMMGGAAASFGSEVPPDEEIPF"
FT   CDS             complement(482237..482497)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05699"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHH0"
FT                   /protein_id="CBL05699.1"
FT                   /translation="MLQALSQNFYVCGSTLTDDLKAKHIIINKIEDYPLLIGSKYVQSF
FT                   IGTTYKDIRKLLLQGEKYYFPVHLVKLLVYMLFSKNAINAI"
FT   CDS             complement(484191..484943)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06240"
FT                   /product="Membrane protein TerC, possibly involved in
FT                   tellurium resistance"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05700"
FT                   /db_xref="GOA:D4KHH1"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHH1"
FT                   /protein_id="CBL05700.1"
FT                   /translation="MEILSTQFLLALGSIILLDLVLAGDNAVVIAMASRKLPENMRKRA
FT                   IYIGTAGAVVIRAIMTLIATYLLTIPFLQAIGGLILLPIAFKLLKPEKHNLEDTNSLSA
FT                   STGFATAIKTIIIADAAMGIDNVLAIAGVAHGDMMLVLLGLAISIPIVVWGSQIISNLM
FT                   DRLPILITLGSAILAYTSASMILHDKIIGNFLLSLTEYMNYILPVLFIGAIIVYSQKVA
FT                   KNKIYLKALLVIKKLIELFYFYSKSLCL"
FT   CDS             complement(485189..486070)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06250"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05701"
FT                   /db_xref="GOA:D4KHH2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHH2"
FT                   /protein_id="CBL05701.1"
FT                   /translation="MTLRHLAIFIKVCEENGITAAAKKLHMTQPSVSQVIQELEAHYQT
FT                   LLFERLGRRIFITEAGRRLLRYSRNLINLNAQTEQAMRAFNEVYHLRIGASITIGSNFL
FT                   IDLIQHISHNGSGKEIFSEIHNTSELEEMLLNDSLDLALVEGEIHSEYLITKPFMNDEL
FT                   VFIIGQNHPLADKEITLEDLTKLRFFVRETGSGTRELFEQVMHRHNIYYQTAGIYNSME
FT                   AIKKAVISGLGVSVISTEAIKDELKEGKLKTFTMPELVFKRQFNIVYHKNKFIPPEMQE
FT                   VIDECLQLSSNK"
FT   CDS             complement(486129..486431)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06260"
FT                   /product="Phosphoribosyltransferase."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05702"
FT                   /db_xref="GOA:D4KHH3"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHH3"
FT                   /protein_id="CBL05702.1"
FT                   /translation="MAGIAIGAASNGILTLSDDLVSTIALKYALVLAPAINPYLMFVCP
FT                   DYLDLNITTGGGCICSLGMKLIDASLQMMKDMKTFAEAGVAIATDGPGAGIQVDK"
FT   CDS             complement(486767..488050)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06270"
FT                   /product="nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05703"
FT                   /db_xref="GOA:D4KHH4"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHH4"
FT                   /protein_id="CBL05703.1"
FT                   /translation="MSLLNQTIKKILPPDQRAIKFVENKLAQTMTNADGLGELKNLLLR
FT                   YVGITGQIHPEIPKKFTIITCGDHGVAEMNVSAYPQETTAHMTKNYLVSKGAVANCMSN
FT                   FCGSDMIVVDMGIKASVDDIPGLIDRKIAHGTQNCAKGPAMTREQAIRAIETGIELVNE
FT                   YAKQGYRCFLPGEMGIANTTSSAAMVTCLCNLTPKQATGRGTNISDERLAIKIEVVKQA
FT                   LKINKPNPNDGIDVISKLGGFELACITGIILGAAANRCFVVLDGFNTGSAALVAQAICP
FT                   EITNYLMASHLAAEPAHNAILKKLNLSPYMDLQFRLGEATGSSIAVNILDCAIEAYQSV
FT                   YQAALAETDKLIRPNIPQADLNTKTTLLKRTRNIPALDADIQKQCRFRIDNLTKPIYSL
FT                   GRLEEIAEHISGIVKKVKPTSVRKKSLF"
FT   CDS             complement(488037..490223)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06280"
FT                   /product="Transcriptional accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05704"
FT                   /db_xref="GOA:D4KHH5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023097"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHH5"
FT                   /protein_id="CBL05704.1"
FT                   /translation="MLEQNITAYLANLLKLKTSQINAAIKLIDEGNTIPFIARYRKEAT
FT                   GDMKDEQLRDLNDKLIYVRNLIKRQNEIKNNIEEQGKMTPELSLAIDKVEKLQELEDIY
FT                   LPYKQKKRTRAMIAKEKGLEPLAQFILKQEDSSEKLEDIALKYLNDEVTSSDEALAGAS
FT                   DIIAETISDSTDIRAKLRQHLWQTSSLSITRDKEADSDEAFLMYEDYTEPIKHLPSHRI
FT                   LAINRGERKDILKVKLISDIDKDIAIITKFILKQNSPYKEFLTNAIIDAYKRLIFPALE
FT                   REIRNQLTETAQTQAIHVFASNLKQLLLQAPLAGYTVMGLDPGYRTGCKMAIVDATGQV
FT                   LDHGVLYITMSDDAKAKSAQKLLYYIQKYQVNLISIGNGTASYETEEFVANLINEHKLP
FT                   VHYLITNEAGASVYSASKLAVEELPEYDVTIRGAISIARRIQDPLAELVKIEPKAIGVG
FT                   QYQHDVNQKELANTLDAVIEAAVNHVGVELNTASATLLKHIAGINATVAKNIIKYRDEH
FT                   GIFASRKELLKVSRLGPTAYTQCAGFLRINGATCPLDNTPVHPESYPLAEQILAELGFS
FT                   LEDLADKNKLDLLKAKIKLVDIDKLATKLNAGVFTVKDILDALTKPGRDPREDLPAPLT
FT                   RQNIIKLEDIKVGTIMRGTVRNITDFGVFVDIGIKTAGLIHISELSNKHVKHPLDVVSV
FT                   GDILNVLVISVDAKRNRIGLSLKQVTKENNNVLA"
FT   CDS             490415..491347
FT                   /transl_table=11
FT                   /locus_tag="MHY_06290"
FT                   /product="homoserine O-succinyltransferase"
FT                   /function="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05705"
FT                   /db_xref="GOA:D4KHH6"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHH6"
FT                   /protein_id="CBL05705.1"
FT                   /translation="MPIKIPSTLPASQILESENIFVMDTERAYTQDIRPLKILILNLMP
FT                   NKTVTETQLLRLLGNTPLQIEVDFIYTESYLPKHTSIQYLSQFYGTFEDVKDKYYDGFI
FT                   ITGAPVERMEYEEVAYWKEVCEIMDWSRKHAWSTFHICWGAFAGLYHHYGIKKYYEPKK
FT                   VFGVYKHHLNVKHEKLFRGFDDEFYVPHSRHIGMKREDIEKVKDLTIMAEGDAGVYIVA
FT                   NLKDNEFFITGHAEYDPYSLKSEYDRDIKAGMDMHIPINYYPDDDPTKEPIVRWRSVAN
FT                   LLFNNWLNYYVYQETPYDIDTLKQNPRRK"
FT   CDS             491307..492581
FT                   /transl_table=11
FT                   /locus_tag="MHY_06300"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05706"
FT                   /db_xref="GOA:D4KHH7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHH7"
FT                   /protein_id="CBL05706.1"
FT                   /translation="MILIHLNKILDVNKLDKERSVYFYVFKKIAIIFSLCLLICNIALA
FT                   KTLPNPDTSAVSACLIDADDNGVLYGKDEDKIMHPASTTKIMTAILALESGKLDEPLVI
FT                   TPEAVNTEPSSLGLRLGDKITLREALTGMMIVSGNDAAVAVAQTVAGSVPAFAKMMNDK
FT                   AKELGAVNTHFLNPHGLTAQGHYSTAHDMAIIASYAMKKPEFREIVSKKAYNMKYMDGH
FT                   TEYVTTTNRFLKSGFEGANGIKTGFTNAAGDCLVASATRGQKTLIAVFYNDDYRWDDAP
FT                   TWLEFGFSFYDPSELQDKTVVSKQNVIKLNKITEQRIKHSRETNKNLAALDAAIVNKAK
FT                   SLNNKTIDVVDTAQQTKAKDVDVAENTKVEVSSDVDNNINNDEYKENNSSEENVEVVSD
FT                   VTADMNTTEITTPEELNPSLEKYVY"
FT   CDS             complement(492733..493488)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06310"
FT                   /product="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05707"
FT                   /db_xref="GOA:D4KHH8"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHH8"
FT                   /protein_id="CBL05707.1"
FT                   /translation="MKATRLNDIENLLEEQNTLSINHLCEIFNVSKNTIRRDIAELEKR
FT                   GTIKKVYGGIMRNQTNIPEPFAAREIKNKTKKKQLAKLAANLVDDNDIIYIDSGTTTMH
FT                   MIPYLAEKKNLTILTANVYVINEAFHYPQMNIIATGGTLYRPSNAFVGASVLQFLEGFN
FT                   ISKCFLAATGISIENGATNASPMEGDIKKYLTSNSKTKILLVDSTKIDQVSLVTFAKLK
FT                   DMDYIISDNKFSSKYNDYFKHNNVHLVTP"
FT   CDS             493811..494974
FT                   /transl_table=11
FT                   /locus_tag="MHY_06320"
FT                   /product="Alcohol dehydrogenase, class IV"
FT                   /EC_number="1.1.1.202"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05708"
FT                   /db_xref="GOA:D4KHH9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHH9"
FT                   /protein_id="CBL05708.1"
FT                   /translation="MGVFLVPSKILSGVGAINELGANIKGKGNKALIVTDKFMVQFGNV
FT                   AKVTNALDACNIEYVVYDGISGEPTDKMVAEGVKLYQENECDFLIGLGGGSPMDSAKAI
FT                   GVMVASDAKKISDFMHKSITVNVPYLVAIPTTAGTGSEATQFTIIADTENNVKMLLAGP
FT                   SVLPALAVVDPAFTMTAPPSVTAATGVDALCHAVEAYTSRKAQPLSDTFALSAIKKIHK
FT                   NLPICFADGKNEQARMQMALGATEAGIAFNNSSVTIVHGMSRPIGALFHIAHGVSNAVL
FT                   LPACMEFAIQENTARFAEIARIMEVATDETDDMTAAKAFVAEVTRFCKELNIPSVEEIL
FT                   NKNGFTKDDFLAQLDKMATDALDSGSPANTMRQPTKEEIIEIYKKLF"
FT   CDS             495002..495847
FT                   /transl_table=11
FT                   /locus_tag="MHY_06330"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /function="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05709"
FT                   /db_xref="GOA:D4KHI0"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHI0"
FT                   /protein_id="CBL05709.1"
FT                   /translation="MALAKLSELLSSVKDNSYAIGSFNVSNMEMAMGAIKAAEKMQAPI
FT                   IIQIAEGRLRYSPLEILGPIMMAAAKNTTVPIAVHLDHGGTMETIKLALELGFTSVMFD
FT                   GSKYPLEENIARTKEVIALAKSYGADVEAEIGRVGGAEGDYKAVDIALTSVEEAKCFAE
FT                   ETKVDALAVAIGTAHGNYKETPKLRIDRLKEIADEVSCPLVLHGGTGLTEQDFKNCIAG
FT                   GIKKINIATASYDSVAKRFKEVAKEVPDANYFTFSDAAVNATCENIMRHMEIFGLKNKL
FT                   "
FT   CDS             495881..496912
FT                   /transl_table=11
FT                   /locus_tag="MHY_06340"
FT                   /product="5-dehydro-2-deoxygluconokinase"
FT                   /function="5-dehydro-2-deoxygluconokinase"
FT                   /EC_number="2.7.1.92"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05710"
FT                   /db_xref="GOA:D4KHI1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR022841"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHI1"
FT                   /protein_id="CBL05710.1"
FT                   /translation="MALIEFDQNKPMDIVLIGRAAIDFNPNEIHRTLDKVRTFTMYVGG
FT                   SPANIAVGVNKLGKKVGFIGAVSDDQFGDFIINFFNDRGIDTTQIVRAKNGEKLGLTFT
FT                   EIKSPTESSILMYRNMAADFVITPEDVSEEYIAQSKILLVSGTALAASPSREACLMAIN
FT                   YAKKHGTKVIFDIDYREYNWRSKADIAVYYSLVGRMSDVIIGSREEFNLTEYLPEENDV
FT                   ADYEIAEKYLNYGNQIVIIKHGKKGSVAYGADKEAFKVDSYKIKLLKSFGGGDAYASAF
FT                   IYGLLEGWSLADSLRHGTAHAAMVVASHSCSEAMQDAPAIDAFIQEHADEQVITPVEWK
FT                   VVL"
FT   CDS             496912..497721
FT                   /transl_table=11
FT                   /locus_tag="MHY_06350"
FT                   /product="5-deoxyglucuronate isomerase"
FT                   /function="5-deoxyglucuronate isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05711"
FT                   /db_xref="GOA:D4KHI2"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHI2"
FT                   /protein_id="CBL05711.1"
FT                   /translation="MAEAKFGKMGAQLKHGYNSATICESNMMMDIGIQVMSAGEKLTFN
FT                   EQAKEVAYVILTGEVKISWENNTEVMKRTSLFDENPTCLHVPLATEVTIEAVVDSEVLI
FT                   QKTENDTKFAPKFYHPEDVQADVFGGGVWSGTATRTVRTIFDYENAPYSNMVNGEVINS
FT                   PGRWSSYIPHFHPQPEVYVYKFDRPQGFGAAFIGEDTFRTETNAYVAIPGGNIHPQVTA
FT                   PGYAMWYSWMIRHLPDDPWAKTRIVCEEHAWLEEDGAEAKIWDPLKK"
FT   CDS             497997..498719
FT                   /transl_table=11
FT                   /locus_tag="MHY_06360"
FT                   /product="Acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05712"
FT                   /db_xref="GOA:D4KHI3"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHI3"
FT                   /protein_id="CBL05712.1"
FT                   /translation="MANTVRLTVAQALVKFLNNQYIEFDGKQNKMFKGIFTIFGHGNVV
FT                   GLGEALENDPGDLIVHQGRNEQGMAHAAMGYAKQKRRKQIYACTSSVGPGAANMVTAAA
FT                   TATANCIPVLFLPGDVYATRQPDPVLQQMEQPHDLSISTNDAFRAVSKYWDRVTRPEQL
FT                   MSACINAMRVLTDPADTGAVTIALPQDVEGEAYDYPEYFFQKRVHRIDRRPATKAMVED
FT                   AIKLITAKKNQCSFVVVV"
FT   CDS             498695..499939
FT                   /transl_table=11
FT                   /locus_tag="MHY_06370"
FT                   /product="Acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05713"
FT                   /db_xref="GOA:D4KHI4"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHI4"
FT                   /protein_id="CBL05713.1"
FT                   /translation="MLICGGGVKYSEAWDTFREFAHKYNIPFGETQAGKGVIVWDDPMN
FT                   LNGLGETGCIAANEIAKEADLVIGVGTRYTDFTTSSKWIFQNPEVSFLNINVSEFHAYK
FT                   LDGVQVVADAKVALEAIDAELEKTGWKSSYTTEIAEAKAKYDAEVDRLYHIEYTGKDFV
FT                   PEVNDALDTDKVYEEFHNITGSYLTQSRALGIVNETIGKDAVIIGASGSLPGDLQRAWR
FT                   VQSENGYHVEYGFSCMGYEVNAALGVKMAEPDKEVYSMVGDGSYMMLHSELPTSIQERQ
FT                   KINVVLFDNMTFGCINNLQIGHGMGSFGTEFRFRNEKTGKLDGGFVPVDFAMNAASYGC
FT                   KTYKVTTAEELKAALEDAKKQTVSTLIDIKVLPKTMIHGYGDWWRVGQPQVSKSETVRK
FT                   AYEALKVELAKARQY"
FT   CDS             499992..500639
FT                   /transl_table=11
FT                   /locus_tag="MHY_06380"
FT                   /product="Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05714"
FT                   /db_xref="GOA:D4KHI5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHI5"
FT                   /protein_id="CBL05714.1"
FT                   /translation="MIYWSVIKMKVVAFNGSPRKGGNCEQALNFMGEAFNNNGIDFEIV
FT                   QVGNKMIRGCLACYHCLQTDSGYCVQKDDVNEWIDKMVEADGIILASPVYYGGISGTMK
FT                   CFLDRAFLAAGHKLHHKVGASIVTARRSGALETFQQLNAYLNTMEMIMPTADYWNNLHG
FT                   LDVGEINQDIEGIEVIQKLARNMAWIMKVIEASKGKIDPPETKPRTKTNFIR"
FT   CDS             500725..502527
FT                   /transl_table=11
FT                   /locus_tag="MHY_06390"
FT                   /product="Acetyltransferase (isoleucine patch superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05715"
FT                   /db_xref="GOA:D4KHI6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHI6"
FT                   /protein_id="CBL05715.1"
FT                   /translation="MTKTARELQEEGLLYDVFEQELTDIKDKTYGLVSELSRASHFDTE
FT                   YVMSLVRKIVAKIGQDSYIVPPFRCDYGDHVFIGNNTYINYNCCFLDSAKVTIGDYVYM
FT                   GPNCNIFTPCHPIHHELRKEKVTEYALPVTVGSHSWIGGDVVITPGVTIGENCVIGAGS
FT                   VVTKDIPDNSIAVGNPCKVIRQINDKDREYINSLILDDETKDSKYKQENGYIYSAKDEA
FT                   IFNIVKDTVHYVEILNKLSNSEIQRRRDFLRTFVAKLDEGAMINSPFYMEFANHLEMGV
FT                   NSFINYDCIMLNNAMVKLGDNVLVGPKVSFYTAMHPIDAKQREQWLVYAKPITVEDNVW
FT                   IGGSATILGGVTIAKNAIVGAGAVVTKDVEPNTIVVGNPARVLRKITAEDSKKYQEELA
FT                   KQKDINKSEFNKMMAGQWYNAMDYSMLKMRQENNKKTEAYSRITINTLSYKDRMAKAIV
FT                   KEFGENANIIPPFTCDYGCNVKVGDNTVINHSGVFLDTNEINIGKHALIGPKSGLYGAI
FT                   HPFDVEARNEGIEKAKTINIGDGAWLGGKVTVVPGVSIGKHSVIGAGSVVTKDIPDDVV
FT                   AVGNPCRVIRKITEDDKINPIRKK"
FT   CDS             complement(502578..502949)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06400"
FT                   /product="EamA-like transporter family."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05716"
FT                   /db_xref="GOA:D4KHI7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHI7"
FT                   /protein_id="CBL05716.1"
FT                   /translation="MNYLSAIAVTAWSGLIGAIEVAIYAYFSGQLYYTPLDSLGYMSFA
FT                   FVVICGGVGSMLFWNIGVKNAGPSIAAIFSNLTPIFGMICSAIFLKEEIGYIQLSGALF
FT                   IFLGVYITTHSQKIIKCFT"
FT   CDS             complement(502961..503473)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06410"
FT                   /product="EamA-like transporter family."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05717"
FT                   /db_xref="GOA:D4KHI8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHI8"
FT                   /protein_id="CBL05717.1"
FT                   /translation="MLKQTYLLLSLATIFWGIQPLCIKILVQNWTPPALTTFRYLLIST
FT                   ILFIIIYLRKEQKFIPPKHCIVPLILMGLTGIGINNVAQFTGLHYSSITNCTLIAATGP
FT                   AITALIATIFIHERLNFIQWIGIFISFIGVIFLITKGSIDVLLNFNFNPGDTLFLFVKS
FT                   FGHYIPF"
FT   CDS             complement(503497..504912)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06420"
FT                   /product="H+/gluconate symporter and related permeases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05718"
FT                   /db_xref="GOA:D4KHI9"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHI9"
FT                   /protein_id="CBL05718.1"
FT                   /translation="MDLAIIFISLLLLMFFAYRGFSLIFIAPIFAVLAAITSDYTSMPV
FT                   YSELYMTKAAEYIKSYYPVFLLGAVFAKIMEEGGLAASVAAKIVSVLGKERAILAVLLG
FT                   CGVLTYGGLSVFVVAFVMYPFAAILFKQADIPKRLLPAILWMGIFTYSMVSLPGTPQIQ
FT                   NIIPAAVFGTTTWAGIGQGLLASILFFIIAYVWISYRSKSLKAKGEGYGKHTLNEPENT
FT                   NDELPDWRLSSIPLLMVIIINLYVSNPFNWSWAFHWDQNSLLAFAPLKLSLIASSVAKV
FT                   QAIWSINVALLISSIVAAYIGRKKLRRLGGVIHPINTGAIGSTSAVLNVASGYAFGCVI
FT                   AALPAFAMIKSALLGLSFGDGPLFSSIITTNIMVGITGSSSAGLMITVGTFGQEWLTWA
FT                   QQIGMSPEVLHRIICIASEGFDTVPHAGALVTLMAVCGLTHKESYYDIFVLTLLKFSVA
FT                   FICLIAYMLFGLV"
FT   CDS             complement(504978..505184)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHJ0"
FT                   /protein_id="CBL05719.1"
FT                   /translation="MSFLDGVRMGMFTVPGDGCIDFKPVYDILKENNYEGWTMVEAEQD
FT                   PAIANPLEYAQKARKYIHEVSGL"
FT   CDS             complement(505181..505864)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06440"
FT                   /product="2-keto-myo-inositol dehydratase"
FT                   /function="2-keto-myo-inositol dehydratase"
FT                   /EC_number="4.2.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05720"
FT                   /db_xref="GOA:D4KHJ1"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHJ1"
FT                   /protein_id="CBL05720.1"
FT                   /translation="MTNIKLGICPIGWTNDDMPDLGKENTFQQCVSEMALAGFTGCEMG
FT                   GKFPKDVDVLKKALALRGLSVASAWFSSFLTTKPYEETAAAFKAHRDFLHAMGAKVVVV
FT                   SEQGNSIQGQLSTPLFANKPHNTDEEWKLVAEGLNKLGALAAEKDMKLVYHHHMGTGVQ
FT                   TEAEIDKLMEMTDPNLVFLLYDTGHLVCSGEDYIGILKKYVNRIKHVHLKDVRKELVEK
FT                   VKTKI"
FT   CDS             506308..507159
FT                   /transl_table=11
FT                   /locus_tag="MHY_06450"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05721"
FT                   /db_xref="GOA:D4KHJ2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHJ2"
FT                   /protein_id="CBL05721.1"
FT                   /translation="MLQYFMPHKYKHILNRDCTPKLEYFCKVDEVSSVMPRAMHVHENL
FT                   VEVLLVYEGSGIYTIDNNKYIAKKGDLIFYNSGVVHDEFGGNGSNLGTYCLGISNLKIV
FT                   KLGNNKIIEDNYCPIINCNEYFDDILSMFDIIRKSIDIDGIHVAEFSNFLVQALVVKFR
FT                   IIIEKNGDVKQIKEPSLATKVKIYIDKNYNENISLKSIAEAVNANQYYLSHIFKMEMGM
FT                   SPIRYVTRRRIGEAQNLLINTNLNITEIALNVGYTNSNYFQNVFRKAVGLTPGNYRKKW
FT                   KL"
FT   CDS             complement(507218..507850)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06460"
FT                   /product="Cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05722"
FT                   /db_xref="GOA:D4KHJ3"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHJ3"
FT                   /protein_id="CBL05722.1"
FT                   /translation="MLKDNTYITITRQYGSGGKEVANIVAKKLGINCYDRKIVHLAAER
FT                   FHNSTEPISNEVMEDLITTSYSMPGSLGDYSFESIPFYNKMFKEQSIAILKLAQKGSAV
FT                   FLGRCSDYILKDYPNTFSFFIYADDDFRQNRAKDHYGNNTLEQLDKEDKNRKRYYAYYT
FT                   GQTWGEAQNYDLMINVSNISLEKAADLIIEYIKLQQNNKRDKVLYVR"
FT   CDS             complement(507879..508523)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05723"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHJ4"
FT                   /protein_id="CBL05723.1"
FT                   /translation="MQNVIACITGIILPYYCKYIFFDDSLYGLLYLVETIVMIAVILLV
FT                   CPTLLRKYGKRNMSLVGIILALIGHLIYLINPMDFNWVVASCVIRGIFFAPLCSVIFGF
FT                   FGDCIEYSQWKFHVRQEGLIFSGGSVGTKIGSGVTSAALTGLLSYAGYVSSASGLITQP
FT                   QSAIDMIVSLYMYGPILVWIVLIIVLLAYNLDKIYPQIMKDLAKREAEGKL"
FT   CDS             complement(508599..509255)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05724"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHJ5"
FT                   /protein_id="CBL05724.1"
FT                   /translation="MNNAQASSGKLSWTTRVAYGLGDTAQNVVWGAMSILTFFYTDYAG
FT                   IDASVVGLVMLLSRCFDGVSDVIMGFLVEKTNSKWGKSRPWILWTSLPFAISIVLIYTV
FT                   PQTTSALQFAYIFVTYNLCTTVCYTALNLPYGSLSAMMTRISKERDMLSIFRMALSPFG
FT                   KILAVSATLPLIKVFGDNQLAWVKVMSIWAVFALLLLLICFYKCKETVVLEKHKN"
FT   CDS             complement(509394..510419)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06490"
FT                   /product="myo-inositol 2-dehydrogenase"
FT                   /function="myo-inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05725"
FT                   /db_xref="GOA:D4KHJ6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHJ6"
FT                   /protein_id="CBL05725.1"
FT                   /translation="MINIGIIGAGRIGRVHGESISKFVPNAKVKAIADPFLNDNTIAWA
FT                   NALGITETYTDYKKILADKDIQAVLICASTDMHSPLSIEAIQAGKHVFCEKPIDHDVNK
FT                   IKEVLDVVNASGLKYQVGFNRRFDHNFRAIKEAVASGKIGKQQIIKVTSRDPEAPPIEY
FT                   VKVSGGIFLDMTIHDFDMVRYLSGSEVTEVFAVGSVTVDPAIGEAGDIDTAVITLKLAN
FT                   GATAVIDNCRKAVYGYDQRAEVFGTKGAIAISNDSNSNAVFSGEEGVVAEKPMYFFLER
FT                   YMMAYAHEVKSFVDAIENDTETEVNANDGLQPVLIGLAAKKSVQEGRPVTIKEIADEYN
FT                   L"
FT   CDS             complement(510762..511394)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06500"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05726"
FT                   /db_xref="GOA:D4KHJ7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHJ7"
FT                   /protein_id="CBL05726.1"
FT                   /translation="MIEKPYINHKWLTTAMEMQFIAQAGLAYTKDDFDYERFTRLSEMA
FT                   AEIMSEYVDLPVEKVKTLFCNETGYQTPKLDTRSVILKDDKILLVKERDGRWSLPGGWV
FT                   DVNQSICDNLIKEAKEEAGLDVVPTRLIAIHDRNRHNVPLYAYGITKIFMLCEVISGKF
FT                   NQNIETSASAYFTLDNLPNLSLGKNTKEQIELCFAAYKDKNWIPVID"
FT   CDS             511537..511632
FT                   /transl_table=11
FT                   /locus_tag="MHY_06510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05727"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHJ8"
FT                   /protein_id="CBL05727.1"
FT                   /translation="MNKALSLSVKSVLVSTNDIEIFFVLKGKLFA"
FT   CDS             511873..512442
FT                   /transl_table=11
FT                   /locus_tag="MHY_06520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05728"
FT                   /db_xref="InterPro:IPR024523"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHJ9"
FT                   /protein_id="CBL05728.1"
FT                   /translation="MRVCDNVETMLAFHGAPTLEGIKPGSLISFNKQRIKNCHLILKRY
FT                   KKCMECKGIRFFIISETDNWLLLFIYRQNALNQVIQEDKIQEFLSFYGYVNLKNLNQCL
FT                   NYLKTRMSLQKGFPHEIGIFLGYPLEDVKGFIENSGRHFKICGQWKVYSDTKRAEKLFA
FT                   KYAECSDRFCACLSQGQSIEDLVKAV"
FT   CDS             512466..512897
FT                   /transl_table=11
FT                   /locus_tag="MHY_06530"
FT                   /product="flavodoxin, short chain"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05729"
FT                   /db_xref="GOA:D4KHK0"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHK0"
FT                   /protein_id="CBL05729.1"
FT                   /translation="MNKIAIIYWSGSGNTEAMANAIKTGVDGAGVSCDLYFVSDFDVTS
FT                   INDYDGLILGCPAMGAEVLEECEFQPVFDEMINSLNGKSVALFGSYGWGSGEWMTTWEE
FT                   QVKEAGADLFENGLIINETPDEDGLNTCEDFGKRFAVSK"
FT   CDS             513045..514172
FT                   /transl_table=11
FT                   /locus_tag="MHY_06540"
FT                   /product="Uncharacterized Fe-S center protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05730"
FT                   /db_xref="GOA:D4KHK1"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHK1"
FT                   /protein_id="CBL05730.1"
FT                   /translation="MEKAKVYFTDMRAYPGKENLLQKLERLMVKAGIDKIDFKNRFVAI
FT                   KIHFGEPGNLAYLRPNYAKVVADVVKARGGKPFLTDCNTLYVGRRKNAIEHMDAAYENG
FT                   YNPFTTGCQVIIADGLKGTDEAYVPVPNGEYVKEAKVGQALMDADIIIDLSHFKGHEMT
FT                   GFGGAIKNIGMGGGSRAGKMEMHCDGKPSVDTDKCVGCGACSRICAHGAPIITDRKCYI
FT                   DPDKCLGCGRCIGACHFDAIKPTNWNAEDLLNRRMAEYAHAILHGRPNFHINIITDVSP
FT                   NCDCHGENDMAIVPNLGMLASFDPVAIDQASADLVNEAPVIAGSELADNILKDSVEAAK
FT                   HDHFHNTHPNTNWHVCLEHAEKIGLGTCEYELVKI"
FT   CDS             complement(516231..517709)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06570"
FT                   /product="Tetratricopeptide repeat."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05731"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHK2"
FT                   /protein_id="CBL05731.1"
FT                   /translation="MILLIYTKDIVYTYIIAKLEVLFVKKYITINSFILTVISFLFVEI
FT                   ILFPNILYEAIPYQSYKLINNKEILPFEKVWYDVWKNINNLTIREQITITTYIVNYINP
FT                   DFTPAYIVRGDAYFTNKDYINALQDYTIAIEQQPNNAEIYYKRGLTYNYLKDFYSNAIN
FT                   DFKQATDLNNNVANFWAEYSYALKFSHYGADEMLAKAIAINPQYKNFNYNELEQQRTTI
FT                   VYSSALEKALFYSYIGNYLLADKYFEIVNRLNYLPKQVNSNYNYIINMMKSAILSGHFE
FT                   SAFYTGKHFLYTNSNNLNNDKLAEVYMWEAFACAGIYKENLFVQYKNLALNLSPKNPQV
FT                   YCILGNIYWKIYDDTSNAIDNYQKALNLMPKENLDYFILSMELAQIYKNLGDITKAYAI
FT                   AYNMIISQKELPNIENINPLDTPIYLTYAKAYDILGNTQLAKIYYQIAFNLNPNIDIPE
FT                   KYYPNKVEKLQYLPSIIIDINDTTAIELKTNIFN"
FT   gap             518135..518992
FT                   /estimated_length=858
FT   CDS             complement(519014..520297)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06580"
FT                   /product="Adenylosuccinate synthetase"
FT                   /function="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05732"
FT                   /db_xref="GOA:D4KHK3"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHK3"
FT                   /protein_id="CBL05732.1"
FT                   /translation="MSTVVVTGTQWGDEGKGKIVDYLAEKADIVVRYQGGSNAGHTVTV
FT                   DGKEFKQRLMPSGMLYDSKICVIANGVAFDPEVILQEMEALKKDGYSVDGLRISNRAHV
FT                   VMPYHRLMDGLEEENKGELKIGTTKRGIGPCYMDRDNRIGIRVCDLIDEETFSEKLKTA
FT                   LETKNRELVKLYGKEPLNYEDIRTEYLGYAEKLRKHVIDTSAFLNREINAGKKVMFEGA
FT                   QATMLDIDHGTYPYVTASHPTAGGVSSGAGVGPNKIDKVVGIVKAYCTRVGEGPFPTEQ
FT                   LNEIGDKIRDCGHEYGTVTGRPRRTGWLDACVVRYAGYLSGIDYMAVTRLDILDTFDEI
FT                   KMCVAYKYNGEILDEMPASLKVLANVEPVYETFAGWKTDISGIRKYEDLPENARKYLER
FT                   MAQVTGIGLGFVSVGPNRDQTIILHDVF"
FT   CDS             complement(520340..521635)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06590"
FT                   /product="Adenylosuccinate lyase"
FT                   /function="Adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05733"
FT                   /db_xref="GOA:D4KHK4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHK4"
FT                   /protein_id="CBL05733.1"
FT                   /translation="MIERYTNPEMGRIWTLQHEFEVMLEVEITACEAMAELGQIPVEAA
FT                   KNIREKAQFNLERVKEIEKVTNHDIIAFLTNVAEYVGEDSKYIHKGLTSSDVKDTALGI
FT                   MMKKSAELILEDLKNLRDVLKRQAKKYKHTVCIGRTHGIHAEPMTLGLKFALWYDEVCR
FT                   DIERVEHAKKIVAVGKLSGAVGTYSNIDPRIEEITCKKLGIEPVKLATQVIQRDRHAEY
FT                   MTTLAIVASTFEKIATELRNLQRTDIREVEEYFQPGQKGSSAMPHKRNPITGERISGMA
FT                   RLVRGNAIAAMEDITLWHERDISHSSVERVILPDSTINVDYCCRKLTNLLDKLLVYPEA
FT                   MMENLNKTGGLIFSQRIMLAVVSKGVLREDAYKWVQRNAMARWLKGEDFRTNVEKDPDI
FT                   TKYLTKEEIDNCFDYQWFLRNVDMIMARFGIE"
FT   CDS             complement(523231..524646)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06610"
FT                   /product="ATP-dependent protease, Lon family"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05734"
FT                   /db_xref="GOA:D4KHK5"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014252"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHK5"
FT                   /protein_id="CBL05734.1"
FT                   /translation="MELLRPENLSEIIGQERAIKALKAKLSSPYPQHLILYGPPGVGKT
FT                   TAARLVLQEACTQPHTPFNADAPFVETDGTTLRYDPRGIANPLLGSVHDPIYQGARRDL
FT                   ADSGIPEPKPGLVTDAHGGILFIDEIGELDDTLQNELLKVLEDKRAYFDSAYFEPNDPN
FT                   VPEYIKKLFTEGAPADFVLIGATTRDSYYLNPALRSRCAEIYFEPLTPKHIETIVLNAA
FT                   HKLYAKLDDEVAQIISEYTIEGRKAINILADAYSNALVRQENDMDNILITKEDIYTVAQ
FT                   VSRLTPFITKKASDTSEIGKIFGLGVAGFIGSVIEIEAITFKAHEKGKGILRFNQTAGS
FT                   MAQDSVFNAAAVVRKLTNEDIHDYDIHINIIGGGNIDGPSAGTAILIALISAITQKPIR
FT                   QDIAITGEISIQGLVRPVGGVFEKAYGASQAGIKTLIIPEENAKDIPPDLHGLKVHPVK
FT                   TAQEALAFAFDKI"
FT   CDS             complement(524700..525209)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05735"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHK6"
FT                   /protein_id="CBL05735.1"
FT                   /translation="MSIFSRFFKSKKKSRTTKAAVKLQQPNISATKVENSPEEIVVEPI
FT                   DHDIDALYDILVDIEGADRLVLKASKLEALTLIRSNNRNQRILGLQKIVYENPTLDKLP
FT                   KDDEIPTLLKEMMDYLANIMARRSFEDELEKRISAKMEENHQDYIFDIKNKFLKKKVLL
FT                   KSLLNH"
FT   CDS             complement(525219..525461)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06630"
FT                   /product="ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05736"
FT                   /db_xref="GOA:D4KHK7"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHK7"
FT                   /protein_id="CBL05736.1"
FT                   /translation="MASQLSQVEITIPVRVGEGSRLFGSVTSKDVALTLKEKHNIDIDK
FT                   RKIDIKNITCLGDYTATIKVHPEITSTITVHVVEK"
FT   CDS             complement(525633..527642)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06640"
FT                   /product="Predicted signaling protein consisting of a
FT                   modified GGDEF domain and a DHH domain"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05737"
FT                   /db_xref="GOA:D4KHK8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHK8"
FT                   /protein_id="CBL05737.1"
FT                   /translation="MPNKLSTWIDICVTLIVSLILLVILFQYNWYIFSGGIVLWICLFF
FT                   YLKERSIERRKNLKAYYENVIKNVNELSNYALEQLPQVIMVINKDLRLEWYNHELERWL
FT                   KQPPEIGSFITDIWPNIPIDNIWNRNGQYIFSQDNKFYMVIYRPVNTDDDSHLMTLYIY
FT                   DISEYERFKLDTAMRTMVFGYIQIDNYDDVMQGLSEAQRTSILFEVNSLLDKWSHSLGG
FT                   LLRRISDDMYVIILERHALDLAVSEKFDILDKVRNLHGDNKFPVTLSIGLIQSRPKTSM
FT                   EELGALAQSHLDLVLGRGGDQVAVDLDGKVQFFGGKSKAVEKHTRVKARVVAHAVFERM
FT                   EAADVVFVMGHHNEDFDSLGSAIGVSRMARQMGKPVYIILSDMNEGVDKLISLCKTDKD
FT                   FENLFITQKEALAMTALNPVLFVVDTHIPHLVASPDLLQSINNVIVIDHHRRSENVIKN
FT                   ALLIYIEPYSSSTSELVTELLMYFNENIKLSRLEATALYSGIVVDTKNFRVNTGVRTFD
FT                   AVSHLRRCGADPEVVHYLFRTDYETNLAECTAIANSVFYPEGLVVAVCPDNANSIQAIS
FT                   GKIADDLLGIENVRVSIVFFRLKDNVIGVSARSTGEINVQVIMEQFGGGGHQNVAGSQV
FT                   KNRPLKELKQDVVNTTLSYMKEADKNESNNVARS"
FT   CDS             complement(528742..529896)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06660"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05738"
FT                   /db_xref="GOA:D4KHK9"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHK9"
FT                   /protein_id="CBL05738.1"
FT                   /translation="MTKIAIKAQKIFTADFIESNNYLIVEDNKFAGFLSKEDVEKENIP
FT                   VKEYNDAFIIPGLIDTHIHGAVGHDTMDSTPEALKSIGDYLLTQGTTTWMPTTVTAPLE
FT                   DIYKAIANVAECKDTLNSARILGMFIEGPYITSKHKGAHPEEHIRPLNKEEIEKMSEYN
FT                   TVKSIIIAPEKEDAPKFTKWITQDLKIKVSLGHSSANYEEACACFDMGADAGVHTYCAM
FT                   EQLHHRNPNLLGAIMTRNDVYAELIADGIHVSLPAMKILLQNKPKDKALLVSDAIQGTG
FT                   LKDGRYMLGTLPFNVKDGIARIDSGNLAGSTTTLLKEVRRLVLELHENPIHAVNMASLN
FT                   PAKRFGVDDELGSIAIGKKADFLIITPDYELKETWLDGKCVFKA"
FT   CDS             530678..531223
FT                   /transl_table=11
FT                   /locus_tag="MHY_06680"
FT                   /product="Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05739"
FT                   /db_xref="GOA:D4KHL0"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHL0"
FT                   /protein_id="CBL05739.1"
FT                   /translation="MKKWVCSICGYVYEGESAPEQCPICKAPADKFVEQSGELVFADEH
FT                   RVGVAKGADPRIIEGLQQNFTGECTEVGMYLAMSRVAEREGYPEIADAYKRYAFEEAEH
FT                   AAKFAELLGEVVTDSTKKNLELRVAAEHGACAGKKELATLAKELGLDAVHDTVHEMAKD
FT                   EARHGCGFNGLLKRYFGK"
FT   CDS             531366..532670
FT                   /transl_table=11
FT                   /locus_tag="MHY_06690"
FT                   /product="Aspartyl aminopeptidase"
FT                   /EC_number="3.4.11.21"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05740"
FT                   /db_xref="GOA:D4KHL1"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHL1"
FT                   /protein_id="CBL05740.1"
FT                   /translation="MSYTGSLFNFINNSTSSFHTVLNAQSYLIKNGFEEVDFNEDWQLK
FT                   ADKKYFTKIYDSTLIAFIPHQNLREGMKIAVSHTDFPCLKIKPSADIIQNDYGKLNVEI
FT                   YGGMILNTWFDRPLSIAGKVVLKGQNCYQPDVKFVDFKRPLMIIPNLAIHMDRSINSGK
FT                   SISKQKEMLPLAFMQTENNSEDELANDNSKLIKLLAEELSCAQEDILSYDLTVYQVETP
FT                   YYLGFAGELVTAPRLDNITSVKACIEGIIADKRKIGLDIAVLFDNEEVGSRTKQGGASN
FT                   VLANVIERIYMAFGYTRQAVLADLAKSFMLSIDVAHAMHPNYVEKNDLTNKPILNKGLA
FT                   IKMAASQSYAGDAEAIAIVRALCEKYKINYQMYVNNSDIPGGSTIGSMASALLTMRTLD
FT                   VGIPILAMHSARETMGKDDQKSLEKLVRVFFEGFY"
FT   CDS             532689..533639
FT                   /transl_table=11
FT                   /locus_tag="MHY_06700"
FT                   /product="Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05741"
FT                   /db_xref="GOA:D4KHL2"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHL2"
FT                   /protein_id="CBL05741.1"
FT                   /translation="MKVLVVMPFKDKHKALMAQNFPQVEFIYERNPGKELVENVEAIIG
FT                   NVKPSLLKDAKNLRWLQLNSAGTDGYCEKGILPMQTILTNATGAYGLALSEYMLAVLMA
FT                   MQKKLYSYHDNQKQSLWKDEGEVTSIFESTILVVGLGDIGSCFAKRVKALGAKVIGIKR
FT                   RLGEKPDYIDELVSLDKLNEYLPKVDIVATVLPGTKATYQIFDKEKFALMKKGAFFINA
FT                   GRGSAVVEDNLIEALNSNHLAGAAIDVTHIEPLPQTSALWQTKNLHITPHTAGQYHLAK
FT                   TLDNIVNIAKDNLQALIDDKELKILSILKLDIKIK"
FT   CDS             complement(533683..534057)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06710"
FT                   /product="desulfoferrodoxin ferrous iron-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05742"
FT                   /db_xref="GOA:D4KHL3"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR004462"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHL3"
FT                   /protein_id="CBL05742.1"
FT                   /translation="MSQKFYICSHCGNIIAFVKDKGVPIICCGEKMKEIIPGTTDAAVE
FT                   KHVPVISQEGNIVTVSVGSVEHPMIPEHYIEWISLETNKGNQRKVLQPNTSPTAQFALL
FT                   DGEEVITAYAYCNLHSLWKA"
FT   CDS             complement(534085..535419)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06720"
FT                   /product="Type II secretory pathway, pullulanase PulA and
FT                   related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05743"
FT                   /db_xref="GOA:D4KHL4"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHL4"
FT                   /protein_id="CBL05743.1"
FT                   /translation="MQNYEFKNLIKELHKNNIKVILDVVFNHTAEGDERGPYISFKGID
FT                   NKAYYILGPNGEYYNFSGCGNTLNCNNPIVRQMILNCLRHWTAEYHIDGFRFDLASILG
FT                   RNQDGSPMSNPPLLELLTFDPLLNNSILIAEAWDAGGLYQVGTFPAYGKWSEWNGHYRD
FT                   DVRHFLKGDLGFAQAIVNRITGSEDIYNPSNRGNYASINFITCHDGFTLWDLFSYNEKH
FT                   NEENGWNNTDGANDNISWNCGVEGETTDPEILTLRRKMVRNAATILFCSIGIPMLLAGD
FT                   EFCNSQFGNNNAYCQDNETSWLNWNQLQENHDMFLFFKQLIAFRKEHPLFRRASKSTPK
FT                   NYPAVSLHGINPWQFDSSHGNRVVCIMLTGKTEDGRDDFIYIAINAHWENHRINLPSLP
FT                   HDTPWQLIINTEFDDKAFIKPQNRPKIYQQNTLNSRSVSVYNAII"
FT   CDS             complement(535392..536180)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06730"
FT                   /product="Type II secretory pathway, pullulanase PulA and
FT                   related glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05744"
FT                   /db_xref="GOA:D4KHL5"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHL5"
FT                   /protein_id="CBL05744.1"
FT                   /translation="MQLDILPTDTFKQFKIRRGFFRLNGSSIVPGGVNFCIYSAGATSC
FT                   ELVLFKDRAPKPFAIIPYPENYHVGNVFAMIVLDLDYENIEYGFRIDGKYDKTTGDIYD
FT                   RHKIILDPYAKMVSGRNEWGKLPDKDNIFQYRSKVVISDFELDYDLPQKTDHGDLIIYE
FT                   THLRGFTRHESSKVKHPGTYAGFIEKIPYLKELGINAVEFLPIFEFDENEDVINDTIRY
FT                   DSKGNRLLNYWGYNPISFLRLKQAMLLVENTPCKIMNLKI"
FT   CDS             complement(536898..538802)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06750"
FT                   /product="PTS system D-fructose-specific IIA component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)/PTS system
FT                   D-fructose-specific IIB component (F1P-forming), Frc family
FT                   (TC 4.A.2.1.4)/PTS system D-fructose-specific IIC component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)"
FT                   /function="PTS system D-fructose-specific IIA component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)"
FT                   /function="PTS system D-fructose-specific IIB component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)"
FT                   /function="PTS system D-fructose-specific IIC component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05745"
FT                   /db_xref="GOA:D4KHL6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHL6"
FT                   /protein_id="CBL05745.1"
FT                   /translation="MKITDLLKPVSIQLNVAPPKSKTEAIEILADLMEKSGNLNNKEEY
FT                   LKAVIAREESGSTGLGDGIATPHAKSAAVKEAGLAAMVIPDGMDFEALDGNPSRLFFMI
FT                   AAPDTASDLHVELLSKLAMMVMDPDFKESLIAAKSVDEFLKLINDKENPPTEEETKAET
FT                   APAKEETSTGYDVLAVTACPTGIAHTYMAAESLEQHAKRKNISIKVETNGAGGRKNVLT
FT                   DEDIANAKCIIVAADKNVPMARFNGKHVIITKVANGINKADELLDKAMAQDAPIYKGSG
FT                   DDDSASTASSENESIGRQLYKHLMNGVSHMLPFVVGGGILIAIAFLVDVYDPANPSNFG
FT                   SNTPLAAFFKNVGGVSFGFMLPVLAGFIGMSIADRPGLVAGFVGGAMANTGGSGFLGAL
FT                   IAGFAAGYIILGLRKVCKVLPESLEGIKTILIYPLFGVLLMGIAITFIINPPVSAINTW
FT                   LVETLKGMDPSSRILIGIIVGGMMSIDMGGPFNKAAYVTGTALLADGEFGIMASVMAGG
FT                   MVPPIAIALCTTFFGNRFTEAERKSGITNYVMGLSFITEGAIPFAAADPARVIPSCVIG
FT                   SAVAGALSMAFECTLRAPHGGIFVVPTIGNPLMYLLAIAIGAVVSMILLAILKKPLNK"
FT   CDS             complement(538840..539751)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06760"
FT                   /product="fructose-1-phosphate kinase"
FT                   /function="fructose-1-phosphate kinase"
FT                   /EC_number="2.7.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05746"
FT                   /db_xref="GOA:D4KHL7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHL7"
FT                   /protein_id="CBL05746.1"
FT                   /translation="MIYTVTFNPAIDYIVRMPEFIAGATNRVNYEQVLGGGKGINVSIV
FT                   LKNLGIDSTALGFISGFTGKEIIRQLHSFGCKSDFIELPNGFSRINVKIKTNDEETEVN
FT                   GQGPDIPANAIEELFAKLDKLTAGDTLVLAGSIPKTLPDDIYEKIMARLENRNINIVVD
FT                   ATKNLLLNVLKYHPFLIKPNNHELAEMFNVTLTCNDDIITYAKKLQDMGAKNVLVSMGK
FT                   DGAILVAEDGSITYSPVPKGKLVNSIGAGDSMVAGFLTGYIETNSYEKAFYMGVATGSA
FT                   SAFSENLATRSEVEALLKTLNN"
FT   CDS             complement(539752..540495)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06770"
FT                   /product="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05747"
FT                   /db_xref="GOA:D4KHL8"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHL8"
FT                   /protein_id="CBL05747.1"
FT                   /translation="MLTQDRHCAILNLLKTKSSVTLLELTTLLNTSESTIRRDLTALDK
FT                   AGKLRKVYGGATSIDFYTADEKDIHTKHDLQITEKNLIAKKAASLVKPHDLIYIDAGTT
FT                   TELIIDHLTEKKATYITNGIIHAQKLTDKGFKAFIIGGQLKKSTGAIIGTTSIENLQPY
FT                   NFTKGFFGTNGISLQAGFSTPDSVEACVKKTALKHCQEAYVLADSTKFDQITPITFANL
FT                   EDAIIITDILKDKKYLDYTNIMEVL"
FT   CDS             542971..544872
FT                   /transl_table=11
FT                   /locus_tag="MHY_06800"
FT                   /product="Ni,Fe-hydrogenase I large subunit"
FT                   /EC_number="1.12.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05748"
FT                   /db_xref="GOA:D4KHL9"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHL9"
FT                   /protein_id="CBL05748.1"
FT                   /translation="MAHIVVDPITRIEGHLRVEIEVEGNKVTDAISSGTAWRGLEVIAK
FT                   NRDPRDLWAYIQRICGVCTSSHSLGCVRAVEDALGIKIPKNANYIRNIMAATLTVHDHL
FT                   VHFYHLHALDWVSPLEALKADPTATANLQNAVLANYKLPFNGPMEYDFSAYPKDFPKAT
FT                   PAYFQAIKDKVQALVSGGQLGIFAANWWDHPDYQILPPEVHLMAIAHYLNMLDKQREVV
FT                   IPHVIFGGKNPHPHYVVGGMPCAISMDEMNAPVNSQRLAAVDTSINLSMDLVNNFYLPD
FT                   LLAIGHIYAQKGLITGGAGLAKERVLGFGSFPEEPFAGTANGGDWFNQIMIHCNAVVEN
FT                   FGAGVMNAKVTEVTADDLKDPEVLTETTTHAWYKDGDALHPWDGKSEAEYTGDKNGNKS
FT                   HWEQLNEKGKYSWIKTPLWRGKMAEVGPLARYIIIYTKVKQNLLQPNWAEKMMVDQVDA
FT                   ISKLLNVAPEVWLPSTLGRTITRGLDAQLNACMNKYFFGKLIKNIANGDTDTANTTKWD
FT                   PSTWPTEEVKGVGLYEAPRGALSHWVAIKDKKCSNYQAVVPTTWNACPRDEVAGQGAFE
FT                   RAMMDTAVKIPEKPLEIVKAIRSFDPCIACATHLYDAKGRTISTVNTDPYIRGGLNG"
FT   CDS             544865..545605
FT                   /transl_table=11
FT                   /locus_tag="MHY_06810"
FT                   /product="Ni,Fe-hydrogenase I cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05749"
FT                   /db_xref="GOA:D4KHM0"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHM0"
FT                   /protein_id="CBL05749.1"
FT                   /translation="MAKLVHPKGQLKKYYIFSPFLRIFHWIMVWCIAGLFITGLLIMDP
FT                   ISGGPGHEPTFADWRLSVDLIRNIHFLLGFIFTASFTLRIYGWIINRGDRLLPKFWTTK
FT                   YMEETVEVALHYSLLKYSHKPYLRNPLARGSYLALYIMVLVEIVTGFAMYYMPNSTGVP
FT                   ASIFGWSIGMYGEMIFHWVHHYFAWFIMFFAMGHVYMVFRADLMEREGEAASMFSGTKT
FT                   LAHIPSDIDDLKDKKDMLQKIKEM"
FT   CDS             545611..545853
FT                   /transl_table=11
FT                   /locus_tag="MHY_06820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05750"
FT                   /db_xref="GOA:D4KHM1"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHM1"
FT                   /protein_id="CBL05750.1"
FT                   /translation="MCLTCGCLFGGKGNKLRFKVEGYTKENAKELKESLLGLPGVYNVH
FT                   IHAHNGETTINYNPAKTPLTQLTAEFAQRGLTALL"
FT   CDS             545904..546245
FT                   /transl_table=11
FT                   /locus_tag="MHY_06830"
FT                   /product="hydrogenase nickel insertion protein HypA"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05751"
FT                   /db_xref="GOA:D4KHM2"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHM2"
FT                   /protein_id="CBL05751.1"
FT                   /translation="MHEMALAEGILDIVLSYADKNEAKKVTEISVLVGEMTGVVDESLE
FT                   FCFTSIAKDTKAEGAKLILKRIPLVARCLECGKETKIERYNFTCPHCGSLRMETISGRE
FT                   LRVESLEAD"
FT   CDS             546246..546905
FT                   /transl_table=11
FT                   /locus_tag="MHY_06840"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05752"
FT                   /db_xref="GOA:D4KHM3"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHM3"
FT                   /protein_id="CBL05752.1"
FT                   /translation="MDIPVMQDILGRNDEIAGKNKSLFDKHGILAINLLGSPGSGKTTL
FT                   LERTIAHLKNDLRLAVIEGDLFTDKDADRIAQHNVPVIQINTNGGCHLDAPMVEEVLGD
FT                   LDLDKLDVVIIENVGNLVCPAEFVVGEDMKVTVLSITEGDDKPLKYPIIFKESKVAILN
FT                   KVDILPFTNFDMEAAKHDLKCIHPQLEIMETAASKDVGVDKWCDFIRSEFKKNKNS"
FT   CDS             546922..547398
FT                   /transl_table=11
FT                   /locus_tag="MHY_06850"
FT                   /product="hydrogenase maturation protease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05753"
FT                   /db_xref="GOA:D4KHM4"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHM4"
FT                   /protein_id="CBL05753.1"
FT                   /translation="MADISVVGIGNIIMQDEGFGVRCAEYLQKITDYPDFVQIIDGGTL
FT                   GMDLMPYIAGTKKLLLIDAMNIDAPVGSFHSFTGDELNAYFKDKISVHDLGVNDMLAVL
FT                   KLTDNPIEEVVVMGVKPEVVSMGLDMTEKIAEKVPEVAQKAKELVDKWVAEYQK"
FT   CDS             547374..549683
FT                   /transl_table=11
FT                   /locus_tag="MHY_06860"
FT                   /product="[NiFe] hydrogenase maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05754"
FT                   /db_xref="GOA:D4KHM5"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHM5"
FT                   /protein_id="CBL05754.1"
FT                   /translation="MGSRVSEIKRYQIRVEGIVQGVGFRPFIYGLAIQSCYSGYVLNDV
FT                   EGVLLEIQGQDIDIENFCQCIKTKAPKASYITNISYHEIDVICDDKEFIIQKSPQGLTK
FT                   ETLISPDLAICEDCKREIKDKNNRRYQYAFTNCTNCGPRFSIVQDIPYDRQNTTMKVFP
FT                   MCKKCEDEYTNPLDRRFHAQPNACDICGPQYKLVADKVYIANESIKKAHELIKKGAIVA
FT                   VKGIGGYHLVCDAFNEEAVANLRQRKIREDKPFAVMATNLDIVKKICEVNDKEEELLTS
FT                   MQAPIVLLHKAKAYNLASKVAPHNAYLGVMIAYAPIHYLLLNDDDVFVMTSANLSDEPI
FT                   VYQDEEAKSHLSTIADYILSHNRIIQTRVDDSVVRVFNDRQMLIRRSRGYAPSPVLLKG
FT                   DLISDIPVLACGPELKNTFCMTKGQKAFLSQHIGDLENMAVNNAYKNSIDLFKRLFTIK
FT                   PKLIACDMHPEYFSTKFAKSYAQDNDLPLVQVQHHHAHIASVMAEHDLKGDVIGVSLDG
FT                   TGFGDDGHIWGGEFFIANLSGYERRGHFQYMPLPSGAKAVKEPWRLGLWIAYNLYGEDI
FT                   KDKYPELLKVNWQLLIKATQKGFNAPFTSSAGRIFDTVASLLGICYQINYEGQAAIELE
FT                   KIAYDSDGEVLPFMINKELGQYIIDFMPMYQLLYDLKQKYSVAYIAKSFHLTMAKAICE
FT                   MIDLLGKESNLNKVVLSGGVCQNITLLDLIYKELQDRYDIYINEKVPSNDGGIALGQMA
FT                   VALTRYLQENDIEIVK"
FT   CDS             549740..549961
FT                   /transl_table=11
FT                   /locus_tag="MHY_06870"
FT                   /product="hydrogenase assembly chaperone HypC/HupF"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05755"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHM6"
FT                   /protein_id="CBL05755.1"
FT                   /translation="MVATVEVEGIRRDISLMLLPEANEGDYILMHAGFAIQVIDEEEAK
FT                   ITTELLKEVLGTNEPASGRNETDSSILA"
FT   tRNA            552137..552212
FT                   /locus_tag="MHY_T_29260"
FT   CDS             552576..552701
FT                   /transl_table=11
FT                   /locus_tag="MHY_06920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05756"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHM7"
FT                   /protein_id="CBL05756.1"
FT                   /translation="MAQFSVNSYSVEQIINWIRSKEIAIPEIQRPFVWDGKKLEI"
FT   CDS             554166..554372
FT                   /transl_table=11
FT                   /locus_tag="MHY_06940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05757"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHM8"
FT                   /protein_id="CBL05757.1"
FT                   /translation="MENVEKQIKSDTNFYGEIDSYSDLLANLKENCIPEDFIKMTIENY
FT                   EEFLKKRRLLMADYIKTYYESLS"
FT   CDS             complement(554467..555798)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06950"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05758"
FT                   /db_xref="GOA:D4KHM9"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHM9"
FT                   /protein_id="CBL05758.1"
FT                   /translation="MDFFSIISAIDSFLWGPPLIILLVGTGIYLTLRLKLLQVAKLPLA
FT                   MKLILSAKNKGDGDISSFKALCLALSATVGTGNIVGVATAVEVGGPGAIFWMWVAAFFG
FT                   MATKYAEGLLAIKYRSKDEIGQVAGGPMYYIELGMGKKYKPLAVIFAVFCILVAFFGIG
FT                   TFAQVNAIVDSVSLTFGVPVYITDIILTLLVAGITLGGLKSIARAASAIVPFMAVLYFV
FT                   TCLGIILLHISDVPAAVALIIDSAFNGHAAVGGFAGSTIMMAMKNGIARGVFSNESGLG
FT                   SAPIAAAAAKTHWPAEQGLISMTGTFIDTIIICSMTGLTLVLTGVWSGDLSGAAMTNTA
FT                   FSMDYGFMGGIFLTVSLALFAFTTILGWNYYGERACQYLFGIKGILPYRIIFICLVASG
FT                   AFLKLEAIWILADIVNGLMAIPNLIAIIALSGVISVETKNILNI"
FT   CDS             556158..558155
FT                   /transl_table=11
FT                   /locus_tag="MHY_06960"
FT                   /product="DNA gyrase subunit B"
FT                   /function="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05759"
FT                   /db_xref="GOA:D4KHN0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHN0"
FT                   /protein_id="CBL05759.1"
FT                   /translation="MANLEENINNEIDIKHDEPVKIHLDEESAEVTAVEGDYGANQIQI
FT                   LEGLEAVRKRPGMYIGSTSARGLHHLVYEVVDNSIDEALAGYCTHIEVTIHKDNSITVT
FT                   DNGRGIPVDMHESGKPAVEVVLTVLHAGGKFGGSGYKVSGGLHGVGVSVVNALSTNMEV
FT                   KVKRDGKIHEITFEKGVTKEPLKVVGQTDETGTLVHFVPDAEIFDETVYDYDTLRHRLR
FT                   ELSFLNRGITIILTDERPEEVRQETFYFEGGISSFVEHLNRNKEVINPEPVYFNGTKDT
FT                   TVVEIALQYNTSYSENIYSFVNNINTEEGGTHLAGFKSALTRAANDFARRQGIIKNNED
FT                   NLVGEDIREGLTCVISIKLREPQFEGQTKTKLGNSEVRGIVDSIVSEGLSEYFEENPVI
FT                   SKKIIEKSIMASRAREAARKARELTRRKNALEVSSLPGKLADCSVKDPEQAEIYLVEGD
FT                   SAGGSAKQGRDRRFQAILPLRGKILNVEKARLDKILNNEEIRTMITAFGSGIGSEFDIT
FT                   KRRYGKIIIMTDADVDGAHIRTLLLTFFYRYMRPLIENGHVYIAQPPLYQIRKGRSHWY
FT                   TYSDEELAQKLDEIGRDGITVQRYKGLGEMNPEQLWETTMDPEKRTVLQVHLREAEEAD
FT                   SIFTILMGDKVEPRRRFIEEHANLVRNLDL"
FT   gap             558181..559101
FT                   /estimated_length=921
FT   CDS             complement(561131..562126)
FT                   /transl_table=11
FT                   /locus_tag="MHY_06990"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_06990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05760"
FT                   /db_xref="GOA:D4KHN1"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHN1"
FT                   /protein_id="CBL05760.1"
FT                   /translation="MLTNVTPEKAVTTHPEVVRAVIKAVKNMGALPAVGDSPGISNLKS
FT                   TAKRTGILTICEEENVPFVYFKQSKAYNYMEGRFIKQFELVDCLSDFDKIISVAKMKTH
FT                   VFMGVTGAVKNLFGCIVGTDKARFHLRMQKHIDFAHVMVDLYQTIKPTLNIIDGITAME
FT                   GQGPMSGDVVDAKIIIASSDGFAADLIMADKMGLDAEAMPIAAAGIEEKRIIRLKDIKV
FT                   VGDGKDEQFHFAKPHTYKSMQDTYVPKFILKLGQNQLTSKPVINKNCVACGRCSHHCPP
FT                   KAITIIDKKVNIDYQKCIRCYCCQELCPHQAVDLKDGLILSLLKYIGIYK"
FT   CDS             complement(562160..562264)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05761"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHN2"
FT                   /protein_id="CBL05761.1"
FT                   /translation="MKVSVVKADNYNIETVDKAVNDAVNLIGGWKKFL"
FT   CDS             complement(562330..563490)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07010"
FT                   /product="UDP-N-Acetylglucosamine 2-epimerase"
FT                   /function="UDP-N-Acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05762"
FT                   /db_xref="GOA:D4KHN3"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHN3"
FT                   /protein_id="CBL05762.1"
FT                   /translation="MKKIKVMTVFGTRPEAIKMAPVVLELKKYPDLITPIVAVTAQHRD
FT                   MLDQVLNLFNIKPDYDLNIMAQGQTLFDITTKAMNGLNEVLSKEKPDIVLVHGDTTTTF
FT                   AGALAAYYHETAVGHVEAGLRTYNKYSPFPEEMNRKLTGAIADLHFAPTDTASGNLKAE
FT                   GTKEDKIFVTGNTVIDALHKTVTDDFKFDDEKLANIDYENKRIILVTTHRRENLGEPMR
FT                   HVYKALKDIVNEFDDVEIVFPVHKNPKVREVVNEELGNIKAVHLIDPLDYEPFANLMHR
FT                   AFLVLTDSGGIQEEAPSLGKPVLVLRDTTERPEAVKAGTVKLIGTERQKVYEETKYLLT
FT                   DHDEYQRMANTCNPYGDGKASKRIIEAILYHYGLSQEKPDSFIAGK"
FT   CDS             complement(563546..564574)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07020"
FT                   /product="UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05763"
FT                   /db_xref="GOA:D4KHN4"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHN4"
FT                   /protein_id="CBL05763.1"
FT                   /translation="MPSYFLAFITALIAVYALTPLVIKFAVKTGAMDKPDPRKVHKKPI
FT                   PRLGGLAIYLAFMIAVCSMLDFSKEIVGLLLGGTFIVIVGIIDDFISLPAKVKLLGQIL
FT                   AACILVAFDIRIDFITDPFGDFIFLEYLAIPVTIFWIVGITNTVNLIDGLDGLAAGVST
FT                   IATVTILLVALQSGDLPVVFLTAALAGSSLGFLHYNFNPARIFMGDTGSMFLGYMFAAI
FT                   SVIGAVKSAATIALIVPILALGLPILDTTFAIVRRYRGGVPIFKPDKGHLHHRLLAMGF
FT                   SQRQAVLLMYVFSAFLGLAAIALTEVSTSVAVMIVVFVAVIILFGAKKIGIFSMKNNAG
FT                   TH"
FT   CDS             complement(565134..565769)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07040"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /function="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05764"
FT                   /db_xref="GOA:D4KHN5"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHN5"
FT                   /protein_id="CBL05764.1"
FT                   /translation="MSDLKVNIIKHPLIQHKLTLMRKKETGAKDFRQLLDEISMLMAYE
FT                   VTRDFPTKDIEIETPVAKCVAKTLAGKKVAVVPILRAGLGMVNGIINLIPAAKIGHIGL
FT                   YRDEKTLEPVEYFCKMPKDIDERLLLVVDPMLATGGSAIEAVEMLKKRGAKSMIFMCLL
FT                   SAPEGIKAFNERHPDIPVYTACVDDHLNEHGYIVPGIGDAGDRIFGTI"
FT   CDS             complement(565788..566447)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07050"
FT                   /product="Glycine/serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05765"
FT                   /db_xref="GOA:D4KHN6"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHN6"
FT                   /protein_id="CBL05765.1"
FT                   /translation="MIDMAHIAGLVAAGLHPSPVPYADVVTTTTHKTLRGPRGGLILCR
FT                   DAEFGKQFNKAIFPGIQGGPLMHVIAAKAVAFKEALSDEFKVYQQQVLDNAKALADELV
FT                   KKGFRIVSGGTDNHLMLVDLRSKNITGKEAQFLLDEIGITANRNTIPFEPLSPFVTSGI
FT                   RLGTPALTTRGLKEEDIREVADIIADVIENREDSAVIETTKAKVQAICKKFPLYEE"
FT   gap             566461..566710
FT                   /estimated_length=250
FT   CDS             complement(567104..567550)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07070"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /function="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05766"
FT                   /db_xref="GOA:D4KHN7"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHN7"
FT                   /protein_id="CBL05766.1"
FT                   /translation="MKLIIGSDHGAVDLKEEVKRVLKEEFAEVEVEDVGTFGTESVDYP
FT                   DIAEKVCTPVANGEADRGIVLCGTGIGISIAANKIKGIRAALCHETYTAKMSREHNNAN
FT                   VLAMGGRTTGFEIADEIVRTWMKTEFAGGRHERRVNKIMALEAK"
FT   CDS             complement(567878..568693)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07090"
FT                   /product="translation factor SUA5"
FT                   /function="translation factor SUA5"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05767"
FT                   /db_xref="GOA:D4KHN8"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHN8"
FT                   /protein_id="CBL05767.1"
FT                   /translation="METELIKINSIDDEALKRAGQCIKDGGLVAFPTETVYGLGGDGLN
FT                   EVASKNIYLAKGRPSDNPLILHINDQKMLGRIVSEVTPMAKKIMTAFCPGPITIILPKS
FT                   NIVPKAVTGGLDTIAVRMPDNDIARALIKYADTPIAAPSANISGRPSPTTAQAVYKDLQ
FT                   SRIDMVLDGGACQFGVESTIVDCTEDVPIILRPGAITKEMLEEIFPVVKIDKAIVGANV
FT                   VPKAPGMKYKHYAPKVDMILIEGDNEKMSSSIKEILHKYENEGKKLAYL"
FT   CDS             complement(568678..569559)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07100"
FT                   /product="[protein release factor]-glutamine
FT                   N5-methyltransferase"
FT                   /function="[protein release factor]-glutamine
FT                   N5-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05768"
FT                   /db_xref="GOA:D4KHN9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHN9"
FT                   /protein_id="CBL05768.1"
FT                   /translation="MGKSRDVWTISYLLNWTINYFKSKGIESARLDAEVLLSHVLGQKR
FT                   IYLYVHFDEPMEAKELAKFREYVAKRARHIPVAYILGQREFMGLDFKVTKDTLIPRPDT
FT                   EILVENTIAKVNENFGDKQSYDIVDIGTGSGAIILSLLKNLPKAKGFTVDISANVVAVA
FT                   KENAQNLQVDDRCEFFVGDLFEPVKDKVFDVIVSNPPYIPQKDIATLEIDVKDYEPLSA
FT                   LTDNKDGLSFYQRLFTQGMKYLKNGGFMAVEIGIYQAEPVKQMAIDNGWQNIEIIKDYA
FT                   GIDRVVLAWKQN"
FT   CDS             complement(571781..571981)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07130"
FT                   /product="LSU ribosomal protein L31P"
FT                   /function="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05769"
FT                   /db_xref="GOA:D4KHP0"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHP0"
FT                   /protein_id="CBL05769.1"
FT                   /translation="MKQGIHPDYKETTVICGCGNTFKTGSVKGELRVDVCSKCHPFFTG
FT                   RQRDMAAGGRIEKFNKRYGKK"
FT   CDS             572200..572529
FT                   /transl_table=11
FT                   /locus_tag="MHY_07140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05770"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHP1"
FT                   /protein_id="CBL05770.1"
FT                   /translation="MKKNNNDLQHVCSFCKRNITIRSQYDMPIYDPQTGFAICKNCIKD
FT                   IYGYIVEHDKRDEKSQNRKFVNSLDDILAKNKPHVIKEFLDQYIINQDRAKKYYLLLYI
FT                   ITINA"
FT   CDS             572526..573518
FT                   /transl_table=11
FT                   /locus_tag="MHY_07150"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /function="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05771"
FT                   /db_xref="GOA:D4KHP2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHP2"
FT                   /protein_id="CBL05771.1"
FT                   /translation="MKYGYTHDKRDMNIEKSNVIMLGPSGCGKTAMLQHLSKLLDIPFA
FT                   VTDASSLTEAGFVGSDVEVAVRNLYYAADKNIEKAEHGIIYLDEFDKIARKSGANNSIT
FT                   ADPGHEGVQQGLLKMMEGGVVEFTAQGQRKHPEAPTIKVDTTNILFIVGGAFVGIEEII
FT                   AKRLKTDNSGIGFGANVKTKNDKPVFNDLIHKVRPEDLIKFGIIPEIIGRLPVICTLEE
FT                   LTEDDLLKILTEPKNAPVRQYQELLAMDKVKLEFEHDALLAVAKKAIERKTGARSLRGI
FT                   LEDVMLDIMYEIPQSDEPRKVIITKDCIENHTQPKIEPISTNDTQTKSE"
FT   CDS             complement(573600..574664)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07160"
FT                   /product="diaminopimelate decarboxylase"
FT                   /function="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05772"
FT                   /db_xref="GOA:D4KHP3"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHP3"
FT                   /protein_id="CBL05772.1"
FT                   /translation="MQEEGAGADCSSLPELLLADASGIHGEKIMLTSNDTPADEFQKAI
FT                   ELGAIINLDDITHIEYLEKNAGMPQVMSFRYNPGNLIEGNDIIGKPEEAKYGLTKEQML
FT                   EAYKIAMDKGVKRFGLHTMVISNETRLEGLLLNAKIVFDLAAEIATKLGIKFEFINLGG
FT                   GIGIPYRPEDNAVDLEALGEGVHKLYDEILVPAGLTTTAIAYESGRAITGPYGYLVSTV
FT                   LHQKNTYRNYIGLDSCMANLMRPALYGSYHHIVVVGKENEPCDHVYDVTGSLCENNDKF
FT                   AIDRKLPKIDIGDRIIMFDTGAHGHAMGFNYNGKLRSAELLLHEDGSVELIRRAETIED
FT                   YFATLYYDGSVLKK"
FT   CDS             575163..576389
FT                   /transl_table=11
FT                   /locus_tag="MHY_07170"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /EC_number="2.6.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05773"
FT                   /db_xref="GOA:D4KHP4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHP4"
FT                   /protein_id="CBL05773.1"
FT                   /translation="MVASHSTGKVLKDVIFGASAACNEAIQKYGADKVTNGTIGAIMDD
FT                   EGKLICIPTVEKVLRSLPTNELAAYAPIIGLPAYLEAVKNLTFADNKPDGYLEAVATAG
FT                   GTGAIHNTIWNYSEIGDSVLTSDWYWGTYNVLCQEAGRKLETYELFDENMNYNIESFTD
FT                   KVNTLLADQDSLLIIINTPAHNPTGYSLSEEDWDKVLDVCKEHAKGGNKKITLLVDIAY
FT                   IDYAGEKNECRKFMRKFSNLPENIFTIFAFSMSKGYTLYGQRTGAMVGLSSSKELTTEF
FT                   LNVCKYTSRATWSNINRGAMATLAAIDQDKTLLAQFEAERDAIYQTIKQRGAIFMEEAK
FT                   ACGLKALPYKAGFFLSIPSSDPAAVCDKLHDDLIFAVPLKRGVRIAVCSISAEKCMVLL
FT                   KNIKCFKLC"
FT   gap             576438..576440
FT                   /estimated_length=3
FT   CDS             complement(576512..576679)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05774"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHP5"
FT                   /protein_id="CBL05774.1"
FT                   /translation="MKQKRYHVIVSGTEFFLDVEQIGGTQDVPMIGRQENNISWNRYGR
FT                   EHINPSQKNS"
FT   CDS             complement(576703..577821)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07190"
FT                   /product="glutaconyl-CoA decarboxylase beta subunit"
FT                   /function="glutaconyl-CoA decarboxylase beta subunit"
FT                   /EC_number="4.1.1.70"
FT                   /EC_number="4.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05775"
FT                   /db_xref="GOA:D4KHP6"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHP6"
FT                   /protein_id="CBL05775.1"
FT                   /translation="MDAFLVAIQSVWTDSGYVALNMGNITMIVVGLILLYLAIGKGYEP
FT                   LLLTPIAFGCVLANFPNNGFHEGVMWAIGQGIQMEIFPPLIFLGVGAMTDFGPLIANPN
FT                   TLMLGAAAQFGVFVALGGAMLLGFNVQEAASIGIIGGADGPTAIYLATKLAPDLLGAIA
FT                   VAAYSYMSLVPLIQPPIMRLFTTKEERAIKMGQLREVTRFERIVFPIMATIIISLLLPP
FT                   IASLIGMLMLGNLFRESGVTDRLSDTSQNALCNIVTIFLALGTGLTMSADKFLRLQTVE
FT                   IIFLGLVAFAGGTAAGVLLGKVMCKLSGGKINPLIGSAGVSAVPMAARVSQIEGQKANP
FT                   SNYLLMHAMGPNVAGVIGTAVAAGTMLAMFGG"
FT   CDS             complement(577885..578160)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07200"
FT                   /product="Oxaloacetate decarboxylase, gamma chain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05776"
FT                   /db_xref="GOA:D4KHP7"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHP7"
FT                   /protein_id="CBL05776.1"
FT                   /translation="MDAPNPVLIMVINMTIVFVVLYILGLFIRLIHVIDPTRIRKAEPK
FT                   KEEVKPVEQVQVPKDDMADKTLAAIIVTSLMAYGCKDFEIKSIRKL"
FT   CDS             complement(578355..579029)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05777"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHP8"
FT                   /protein_id="CBL05777.1"
FT                   /translation="MKKEQLEKVQAEVSVWTYLQSLPPEKNNFKLKILMQEVADTFQIY
FT                   SYENDDLKRKTTIYYHEETKEYKLLVTIGLTEFCAIEYISESLDKLEVILKERFDNLLG
FT                   DISHFNREHISSIIEDKAIMDWEYIDNLPKEIDGFKLFINPKEPVKIINGSYIIIDYCD
FT                   FSKESNFIIYYNVFRDEFFGEARLHRIPEVTYEYDCSELKDLESLLAKNLQATLHKIRE
FT                   RI"
FT   CDS             complement(579036..579611)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07220"
FT                   /product="orotate phosphoribosyltransferase, Thermus
FT                   family"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05778"
FT                   /db_xref="GOA:D4KHP9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHP9"
FT                   /protein_id="CBL05778.1"
FT                   /translation="MTEQEVKDLLIKTNAIMEGHFLLTSGLHSPMYVEKFNVLQQPKYT
FT                   EQLCKALAEYFADKNIDTVVGPMTGGILLAHEVGKALGTRAIFTERVDGKMTFRRGFSL
FT                   KPGERVAIVEDIVTTGGSVREVIDVVKAEGAIPVGVGLLVDRSGGKATFEDVPAHALLH
FT                   LDVTTYKPEECPLCHDNVPMTKRGRTGK"
FT   CDS             complement(580150..580326)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07240"
FT                   /product="Orotidine-5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05779"
FT                   /db_xref="GOA:D4KHQ0"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHQ0"
FT                   /protein_id="CBL05779.1"
FT                   /translation="MVKDKLIVALDFHTKEDALALVDKLGDSVVFYKVGMELFYRVDSS
FT                   IIEELKKRNKKSF"
FT   CDS             complement(580457..583678)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07250"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /function="carbamoyl-phosphate synthase large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05780"
FT                   /db_xref="GOA:D4KHQ1"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHQ1"
FT                   /protein_id="CBL05780.1"
FT                   /translation="MVIGSGPIIIGQAAEFDYAGTQACRALKEEGLEVVLVNSNPATIM
FT                   TDKDIADRVYIEPLTVEFLDEILAKERPDGLLATLGGQAGLNLAVKLSEAGLLEKYNVE
FT                   LLGTSLEAIERAEDRELFKETMQKLGEPIPESTIVDDVASAVDFANQIGYPIIVRPAYT
FT                   LGGTGGGIAENEEELIEIVIRGLKYSMIGQVLIERSVAGWKEVEYEVMRDSNDNCIVVC
FT                   NMENLDPVGVHTGDSIVVAPSQTLTDHEYQMLRSASLRIIRELGIEGGCNAQFALDTKS
FT                   NQYYVIEVNPRVSRSSALASKATGYPIAKVSAKIAIGYTLDEITNAVTKKTKACFEPSL
FT                   DYCVVKFPRWPFDKFVYADRTLGTQMKATGEVMSIDRCFEGALLKAVRSLEIGVNRLHI
FT                   DKIDTWSDEELKNHLSRINDERLFVIAEVLRRGICDIDEINAITKIDKWFLRRIKNITD
FT                   TEIALAKDGLTEENLRRAKRYGLADRSIAEIVGKEMNEVRNMRKDINLLPCYKMVDTCA
FT                   AEFEAATPYYYSTFHAQEDEVQTTNKRKVIVLGSGPIRIGQGVEFDYCSVHSVWALRKM
FT                   GIEAIIINNNPETVSTDFDISDRLYFEPLTTEDVLNIIDKEQPEGVIVQFGGQTAINLA
FT                   ASLKAAGVKVFGTSVDDIDRAEDRERFDEVLEQTNIARPQGASVTNVEDAVKAAEKIGY
FT                   PSMVRPSYVLGGRAMEIVYNEDELRDYMNRAVKVTPDHPVLIDHYMQGTEVEVDAIADG
FT                   ETVVIPGIMEHIERAGVHSGDSIAVYPPQTLSSKVIFTIIDYTKRLGLNLNVKGLLNIQ
FT                   YVVVNDNVYVIEVNPRSSRTVPFLSKVTDINMVELATRAALGEKLTDLGLKSGLVEPKP
FT                   YVALKAPVFSFAKMQDVDISLGPEMKSTGEVMGIDYHYARALYKAITGAGMNIPHEGTI
FT                   LFTVANKDKEEMKQLGRAFAELGFKIAATEGTAKALKEVGVESSIVYKVHERGQNVGSD
FT                   RSSDIIKMIKAGGINMVITTQTPGQKFAKDGFRIRRATVEHGIACLTSLDTAWEVLRVL
FT                   SFIRERRLVYSLALQDYIGRGDELA"
FT   CDS             complement(583712..584407)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07260"
FT                   /product="Carbamoylphosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05781"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHQ2"
FT                   /protein_id="CBL05781.1"
FT                   /translation="MKGVLVPETATQEEIDALMRNEIPKEVVKIVTTPKTYKMENPGGP
FT                   HVVVMDFGIKQHILDSLHGIGCDLTIVPADTKADEIMALNPDGIFLSNGPGDPKDLPEI
FT                   IEVVREIAGKKPTFGICLGHQLLSLAFGADTYKLKFGHRGSNQPVKNLLTGRVHITSQN
FT                   HGYAVDEESLKGLPLEVTHRAVNDGTVEGIRHTQLPIFSVQYHPEASPGPDDNRYLFDQ
FT                   FWAMLQKGE"
FT   CDS             complement(584797..586089)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07280"
FT                   /product="dihydroorotase"
FT                   /function="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05782"
FT                   /db_xref="GOA:D4KHQ3"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHQ3"
FT                   /protein_id="CBL05782.1"
FT                   /translation="MKLLIKGGRVINPGKDFDAVSDVLVENGKIVAIGENLEASDAKVI
FT                   DAKGKVVAPGFIDMHTHLREPGQEAKEDFASGSKAAAAGGFTTVATMPNTKPVVDNAIL
FT                   VNGLKQRAQDEGVVHIEVIGALTKGQEGKELAEVGDMAQAGAVAFSDDGHFDNNCKLML
FT                   NAFDYLRTFDKAIMSHPEETSLVAEGVMNEGHRSAMLGMKGRPTVAEDIAVMREILLAE
FT                   YADAWVHISHISSKNAIDMVRQAKKRGVRVTAEVTPHHLTMTDEMVDPTDSSTKVNPPL
FT                   RGQADVNAALEGLKDGTIDIIATDHSPHAQEEKDREYKFAPSGFPGLETALGVLLTDLY
FT                   HKDLISLNELVAKMSYMPGKLFFDGKRGILEENAMADITIFDPELEWTVEKEKFYTKGS
FT                   HSPFVGRTLKGKAVMTIVEGNIVMDNGEIIA"
FT   CDS             complement(586073..587035)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07290"
FT                   /product="aspartate carbamoyltransferase"
FT                   /function="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05783"
FT                   /db_xref="GOA:D4KHQ4"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHQ4"
FT                   /protein_id="CBL05783.1"
FT                   /translation="MLSRNSVSLRGKNILGLEYFSPEEIELVLDTAKEMKNIIHRDIKK
FT                   LPTLRGKSVVTLFYEPSTRTRTSFELAGKYLSADVVNITSSTSSIVKGESLRDTLLTLE
FT                   DMGVDAIIMRHSAEGAAEYATKVVSPVIINAGDGAHAHPSQGLLNLFTIRQHKGTLKGL
FT                   KVAIIGDILHSRVARSDIWGMRKMGIEVHLAGPKTLLPRYLAEEPGIFVHDRVEDAIKD
FT                   ADVINVLRIQLERMKSGLFPSLREYARIFGLNKERLALAKKDVLILHPGPMNKGVEISP
FT                   EIAYGLNSAIQDQVQNGVAVRMALLTLTLTGGKDNEITD"
FT   CDS             complement(587365..587922)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07300"
FT                   /product="Soluble lytic murein transglycosylase and related
FT                   regulatory proteins (some contain LysM/invasin domains)"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05784"
FT                   /db_xref="GOA:D4KHQ5"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHQ5"
FT                   /protein_id="CBL05784.1"
FT                   /translation="MSFWKKLLLMILVLASLSYFVWQNEDFQRKYLYPYDYQDTINFYA
FT                   DRYEVDRNLVASVILAESKFRQDATSVHGARGLMQIMPETGSWIATQIEDDSFSVDKLY
FT                   NVNMNIKYGTWYLSELQTEFEGNEVLALAAYNAGRGNVYEWMEKYHWDINFKDYTKIPF
FT                   PETREYVKRVLENKKHYNKLYK"
FT   gap             588024..589435
FT                   /estimated_length=1412
FT   CDS             complement(589458..589805)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07310"
FT                   /product="Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05785"
FT                   /db_xref="GOA:D4KHQ6"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHQ6"
FT                   /protein_id="CBL05785.1"
FT                   /translation="MNTTMHPLIRDEIVKQIDECRQNGIEVVILDIPLLYEANWDKFAD
FT                   EVWVVKISRQLQIERIQNRDGLTKEEAISRIDAQMSLEEKAKRADVVIDSSNAPEVTLQ
FT                   LVEKIWNERLL"
FT   CDS             complement(589802..590050)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07320"
FT                   /product="Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05786"
FT                   /db_xref="GOA:D4KHQ7"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHQ7"
FT                   /protein_id="CBL05786.1"
FT                   /translation="MKIIGLTGGIACGKSTVSAYLKQKGAFIIDGDAIARQLSEPKKSI
FT                   WQAYVNHFGDKVLNADNILNRRLIGQIVFTDEKEKHG"
FT   CDS             complement(590953..591600)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07340"
FT                   /product="DNA polymerase I-3'-5' exonuclease and polymerase
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05787"
FT                   /db_xref="GOA:D4KHQ8"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHQ8"
FT                   /protein_id="CBL05787.1"
FT                   /translation="MAHMSEDKHFIDAFCHNQDIHTATAAQVFKVPIDEVTSELRGKAK
FT                   AVNFGIIYGISAFGLAKNLHISPKEAGEYIDNYLQECSGVKNFMHEIVEKAHQDGFVTT
FT                   LFGRRRYLPAIKSSNFNQRALAERMAMNTPIQGTAADIIKIAMNRASEAIKEAKLKSRI
FT                   LLQVHDELVLEVVKEEIEKVSEILTTAMQNTASLKVPLIIDINYGKNWAEAK"
FT   CDS             complement(592901..593623)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07360"
FT                   /product="5'-3' exonuclease (including N-terminal domain of
FT                   PolI)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05788"
FT                   /db_xref="GOA:D4KHQ9"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHQ9"
FT                   /protein_id="CBL05788.1"
FT                   /translation="MLKIMEVIVERGEDNKKRFIIIDGSSLMYRAFFALPLLTSSSGIY
FT                   TNAIMGFANMLGKILTEYKPDNIVVAFDKSRQTFRTQMYAEYKGQREKTPDELKSQIPL
FT                   LREFLEALGIAFIEKDNYEADDIIGTLATKAASQDYEALIVTGDKDALQLIRPNLKVML
FT                   TKRGIMDMQIFDEEAFKEKYAGLEPIKLIDIKALMGDSSDNIPGVPGIGEKTALKLLSQ
FT                   YQDLENLLNNIDNVSGKN"
FT   CDS             complement(593617..594804)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07370"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05789"
FT                   /db_xref="GOA:D4KHR0"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHR0"
FT                   /protein_id="CBL05789.1"
FT                   /translation="MKKFIVFLLLGVMFVFNTVAYAQAENTAQEKIGGADKATDIQVNN
FT                   NVNTVKRWILINIPARSLRLYDNDKCIEMYPVGVGKIETKTPVGFYKVVEKIVNPTWTD
FT                   PADVSVVIPSGEDNPLGYRWIGIGGNYGIHGTNRPDSVGHYVSNGCVRMVEADVEKVFD
FT                   KVDVGTEVQIIYNRLVIDKTFDGRVAYYIYPDGYDMQNLTVDFVKQGLKGYGIADFITD
FT                   EAVEKSIELSNGQPNYVAAPVNIMFNGKKLNYKAVNYKNLIYVPVKVLATTLNTPITMD
FT                   NNLVKTQKGEADISLYSNVAYMRLTDIANIFDYDYSLNKNVTEIALNKITADKNVVDIP
FT                   VNTTNKEIVVPKKQTDEKINLMENDNKNLEQDNNTQSDKKTVADKKINRKSKYRC"
FT   CDS             595184..595438
FT                   /transl_table=11
FT                   /locus_tag="MHY_07380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05790"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHR1"
FT                   /protein_id="CBL05790.1"
FT                   /translation="MALTILFTYVFAIQTTFIRVDFAFIPICLYAMRFGTTKTIIMSAL
FT                   ADIIGSNLFMPGLYFPGFTISAIASSFIYGKFLYKKLSL"
FT   CDS             595453..595647
FT                   /transl_table=11
FT                   /locus_tag="MHY_07390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05791"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHR2"
FT                   /protein_id="CBL05791.1"
FT                   /translation="MNLTIFLFVDCILNNIWLTLMYKDAATSFYIMRIVKSVLLLPIKA
FT                   AILYNIYKPLRYFILKYNN"
FT   CDS             complement(595811..596581)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07400"
FT                   /product="Dissimilatory sulfite reductase (desulfoviridin),
FT                   alpha and beta subunits"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05792"
FT                   /db_xref="GOA:D4KHR3"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHR3"
FT                   /protein_id="CBL05792.1"
FT                   /translation="MDIDKVYNLFFSPTDTTKFVLQFLSEQISPNYKNINLTSRNTNLD
FT                   DVSLAENDLVFLGVPSYAGRVPITFKERFSKIKGNNALAIVVVTYGNRAQEDTLIELFD
FT                   MAKEQGFRILAGSAVVTEHSIIHDFGKGRPDRKDKSELISFMQKVKNKLQEDVLLVDEI
FT                   PGNRPYKEVKLAPMAPDFVKENCVACGKCASECPTGAIDSKTYKCNSEKCISCLRCIKV
FT                   CPINCRFVDNRVLENLRVHLTPLCSERKDNQFYL"
FT   CDS             complement(597102..597248)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05793"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHR4"
FT                   /protein_id="CBL05793.1"
FT                   /translation="MANNNAPISEEIVAAITAAVEMMVGHKVMAVRIKRSDAWVMAGRR
FT                   DAV"
FT   CDS             complement(598849..598983)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05794"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHR5"
FT                   /protein_id="CBL05794.1"
FT                   /translation="MKEKGVRMIDEQPRYGAGNSSIAFVHPKASGILVELAQRLDETK"
FT   CDS             complement(599136..599270)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07450"
FT                   /product="Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05795"
FT                   /db_xref="GOA:D4KHR6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHR6"
FT                   /protein_id="CBL05795.1"
FT                   /translation="MKINRVDHIGIAVPNLQEAKKFYEEVLGIKITKEDEVIEDQKVK"
FT   CDS             complement(599267..600247)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07460"
FT                   /product="LAO/AO transport system ATPase"
FT                   /EC_number="2.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05796"
FT                   /db_xref="GOA:D4KHR7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHR7"
FT                   /protein_id="CBL05796.1"
FT                   /translation="MDIAQELLNGNRLALTRAITAIENETDVAVEIMKKLYPHTGHAFV
FT                   LGITGPPGAGKSTLTDRLARAYRNQGKTVGIIAIDPTSPFTGGAILGDRIRMNSLTLDE
FT                   GVFIRSMGTRGSLGGLSHKTADAIKAMDAFGKDVIIVETVGVGQSEVDIVKAADTTMVV
FT                   MVPGLGDDIQAIKAGILEIGDIFTINKADLDGADKLYTELNMMLDLDGETPDWRPPVKK
FT                   VMASRGEGINELIDTITEHQNYLVESGTLAIRRHKRAKNELLDRLSASIGSYITKHIVE
FT                   TGELDAYVKDIETRQNDPYTVVNTIMDNMLKNNLDIIFISGGFYQ"
FT   CDS             complement(600400..600789)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07470"
FT                   /product="methylmalonyl-CoA mutase C-terminal domain"
FT                   /EC_number="5.4.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05797"
FT                   /db_xref="GOA:D4KHR8"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHR8"
FT                   /protein_id="CBL05797.1"
FT                   /translation="MIRVLVAKPGLDGHDRGAKVVARALRDAGFEVIYTGLRQTPEQIA
FT                   EAALQEDVNVVAMSILSGAHPHLFPKVVKLVREKGMNDVLIIGGGVIPEGDIPALKEAG
FT                   VAEVFTPGTPTTDVIEFIKAHVKEA"
FT   CDS             complement(600818..602470)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07480"
FT                   /product="methylmalonyl-CoA mutase"
FT                   /function="methylmalonyl-CoA mutase"
FT                   /EC_number="5.4.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05798"
FT                   /db_xref="GOA:D4KHR9"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR014348"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHR9"
FT                   /protein_id="CBL05798.1"
FT                   /translation="MSNEKEKIQAGLAEYNASVEKTVARFPERGHLPEQRLYTPLDIEG
FT                   TDYTEEIGFPGMYPYTRGVQPTMYRGRFWTMRMYAGFSTAEESNKRYRYLIESGATGLS
FT                   CAFDLPTQIGYDSTDDISEGEVGKVGVAIDSLADMEILFDQIDLGKVSTSMTINAPASV
FT                   LLAMYIAVAEKQGVPADQLKGTIQNDILKEYAARGTYIFPPRPSMRLITNIFEYCSKYV
FT                   PKWNTISISGYHIREAGSTASQEIAFTIADGIAYVEAAIKAGLDVDAFAGRLSFFWNAH
FT                   NNVLEEVAKFRASRRIWAKVMKERFGAKKAKSMMLRVHTQTAGSMLTAQQPNNNIIRVA
FT                   LQTAAAVMGGTQSLHTNSRDEALALPTEESVMIALRTQQIVAYESGLADVVDPLAGSYY
FT                   VEAMTNRIEKEAWDYIKKIDEIGGAVSAIEKGYIQKEIQDSAYKWQMDVESGARTIVGV
FT                   NKFQIEEKPVEGLLKVDASVGEKQKAKVEAMKAKRDNAAVEAALADLEAACKDENENLM
FT                   PHILAAVKTYATLGEICGVMRKVFGEYEAHVNL"
FT   CDS             complement(602499..603998)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07490"
FT                   /product="succinate CoA transferases"
FT                   /EC_number="3.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05799"
FT                   /db_xref="GOA:D4KHS0"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHS0"
FT                   /protein_id="CBL05799.1"
FT                   /translation="MIDILDRVRNKALHAKIVSAQEAAELIKPGMNVGTSGFTPSGYPK
FT                   AVPLALAERMKEHPFKINLYTGASVGPELDGALCEVNGIDKRMPYQTNKLLRNLINSGE
FT                   ISYSDLHLSESAQLLRYGFYGKLDVAIVEACAITEEGNIIPTTSMGNTASFVQQADMVI
FT                   VEVNTSQPLELEGMHDVYVPLDPPHRLPIPIVKANDRIGTPYIPCTPDKIKCIVPCDIT
FT                   DKTRPFGEISEADHKMSEYIIELLQDEVKKGHMPKNLLPLQSGVGNVANAVISGFVDSD
FT                   LKDLSVYTEVIQDGMFDLIDAGKLNFASGTALSPSPDGLKRFYENIKEYRKHLLLRPQE
FT                   ISNSPEVVRRIGVIAMNTAIECDIYGNINSTHIMGTKMMNGIGGSGDFARNAYLTCFFT
FT                   ASTAKNGLISSIVPMCSHVDHTEHDVDIIVTEQGLADLRGLAPRERAREVINKCAHPDY
FT                   KPMLMDYLERAEAATKHAQTPHIIKEALSWHEKFMETGSMK"
FT   CDS             complement(606194..606808)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07520"
FT                   /product="Folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05800"
FT                   /db_xref="GOA:D4KHS1"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHS1"
FT                   /protein_id="CBL05800.1"
FT                   /translation="MFVNFDGQYQELKFSSELLGVNFNYKLKLLGDHQIENSSLAIMTA
FT                   SILGNNDERITRENIIDGLALAKWPARFEVFNFDGQICIVDGAHNPAGMMILRQNLDKY
FT                   YPNEKRVILLGILKDKDIDTMLIDLLRDDDEIVITTPNSERKASPEYIASKISNHRVET
FT                   FNNMQEALTLARQWAGKDKVLCITGSLYLTGELRNILVNEA"
FT   CDS             complement(606829..607485)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07530"
FT                   /product="Folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05801"
FT                   /db_xref="GOA:D4KHS2"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHS2"
FT                   /protein_id="CBL05801.1"
FT                   /translation="MNYLESLEYLDKLSTFGTKLGLGRIKQLVTYLDNPQTRYKTIHIT
FT                   GTNGKGSTSSMLSSILTTSNIKTGLYISPHLVSYTERIQIDGNPISEEDFADCISAVKT
FT                   FVDKMVEDGEESPTQFEVITAAAFLYFAINKVEYAVIEVGLGGLLDSTNVVKPEVSVIT
FT                   NVAFEHAHLCGGTLEGIAEHKAGIIKDGVPVVTAAKDISLDIINQTAEEKMLIFS"
FT   CDS             complement(607517..610042)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07540"
FT                   /product="valyl-tRNA synthetase"
FT                   /function="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05802"
FT                   /db_xref="GOA:D4KHS3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHS3"
FT                   /protein_id="CBL05802.1"
FT                   /translation="MPPPNVTGQLHMGHAMDNTLQDILIRFRRMQGYNTLWMPGTDHAG
FT                   IATQAKVDAQLREQGVSRYDIGREKFLEHAWAWKEKYGNRIKYQIRTLGSSCDWDRERF
FT                   TMDEGCSHAVREVFVQLYKKGLIYQGKRITNWCPHCNTALSDIEVEHQNEQGHLYHLKY
FT                   QVEGEDRFVEIATTRPETMFGDTGVAVHPDDERYSDLVGKTLILPIVGRRIPLFADSYV
FT                   EPQFGTGAVKVTPAHDPNDFDMGARHNLEQIVVINNDGTMAENTGKYAGLDRYECRKQL
FT                   IEDLKQQGYLISIEEHEHAVGHCSRCSTTVEPLVSKQWFVKMESLAKPAAEAVKSGKIK
FT                   FVPERFSKIYCNWLDNIRDWCISRQLWWGHRIPAWYCDDCGATIVENEDVTVCPHCGSK
FT                   HVHQDEDVLDTWFSSGLWPFETMGWPEQTAELKQFYPTSVLVTGYDIIFFWVARMVMMG
FT                   LEFGKDIPFKHVFIHGLVRDSQGRKMSKSLGNGIDPVEVIEKYGADTLRFMLITGNTPG
FT                   NDMRFYWERVESARNFANKLWNASRFMLMNLEGFDKTFVPEASDYTLADKWILSRYAKT
FT                   AISITENLEKFELGEAGRSLYDFIWNEFCDWYIELSKARLYDKENVRPRKVAQYVLGYV
FT                   LEHTLRLLHPFMPFITEEIWQHIPHEGKSIMVADWPTGEEAKLDDASEVEMTTIMETIK
FT                   AIRNMRAEVNAAPSKKTEVILHLSDESLTDVFAKNSGYLETLASAKNVTILAKDDAKPE
FT                   NAMTAVVNGVEIYLPLAGLIDVEKETARLNKELATLDKEVSRLDKKLSNAGFIAKAPAD
FT                   IVEKEKEKLKGYEEKREAVKQRLAYLATL"
FT   CDS             complement(610042..610170)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05803"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHS4"
FT                   /protein_id="CBL05803.1"
FT                   /translation="MEETNIPKVYDPQSFEKKWYQYWEENKLFHAEVDETKNHLAL"
FT   CDS             complement(610596..610862)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07560"
FT                   /product="Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05804"
FT                   /db_xref="GOA:D4KHS5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHS5"
FT                   /protein_id="CBL05804.1"
FT                   /translation="MEALVTIINKSGVHARPAAMLAQMGRRYTSKITYTAKGITADGKN
FT                   IIPIINLGLSCGTQVLITAEGDDEQEAIKALSELVNNRFGEHQ"
FT   CDS             611008..612342
FT                   /transl_table=11
FT                   /locus_tag="MHY_07570"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05805"
FT                   /db_xref="GOA:D4KHS6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHS6"
FT                   /protein_id="CBL05805.1"
FT                   /translation="MKYDLTTGSVSMTMLKFSLPMILGNLMQQLYNISDTLIVGHFIGT
FT                   DALAAVGASYALIIFLTSVLLGLCMGSGALFSIFYGEKDYFKLKSSIFISFILILILTI
FT                   IINIFIFIYIDEIIYFMQVPSEIFDLTYTYLYIIFIGFSFSFVYNYFTCLLRAIGNSKT
FT                   PLIFLASSALFNIILSIILVVNFQMGVAGSALGTVIAQGFCALGLTIYTIKKCPELIPQ
FT                   KEHCKFDLAMIKDISNSSLLTSTQQSIMNFGILLVQNLVNSFGATVMAAFTVAVKIDSL
FT                   AYMPAQDFGNAFSTFIGQNYGAKKTDRIQQGIKSAIKISFLFCLIISVGVFIFARPLMT
FT                   IFIDSSETEIINIGVDYLRIEGSFYFGIGILFLLYGFYRATNFPSMSVILTIISLGTRV
FT                   GLAYYLASIPSIGVIGIWWSIPIGWALADIFGIVYYKRKIKQLHF"
FT   CDS             complement(612323..612628)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05806"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHS7"
FT                   /protein_id="CBL05806.1"
FT                   /translation="MKITIEDNEQNLWKEENEAPIYFLYEMVQKALEINVVGFLNDWGY
FT                   RRNEKKNLYEIDFYFDTVDKDIAVNLVKHVIEVFSMNAKSKVEEVIELVEVKNGVV"
FT   CDS             complement(612933..613865)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05807"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR026000"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHS8"
FT                   /protein_id="CBL05807.1"
FT                   /translation="MGKKSLLTKEDIDILESWTDGYFYKIFYYLEDFVKKGIEQKLFTL
FT                   KEAKEDLNIALWYAYAGNNIDIYEYYYKVINWMPYSEKNSKGSGAWYYRYSVALTYCSD
FT                   LEKAYSYAQKGVQEEADYPWGWLNLAKLQYHFGEKEKAMVSIEKGLSLVPDDYEFKVLQ
FT                   EEIKANCSLEEMLCHYIKPEDDAFFKNRQMYKQHLKEKMQAVDGVICHEESLQKVKEFL
FT                   KGNRWQENNPYCTCMVKLDDITVKIVFTMNRAMLSKINMDWLIKEYSDIKDNLLTYDKY
FT                   DVEYKLQEIEIDRDYQIKLTYYNKKKNYL"
FT   CDS             complement(613962..614525)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07610"
FT                   /product="Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05808"
FT                   /db_xref="GOA:D4KHS9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHS9"
FT                   /protein_id="CBL05808.1"
FT                   /translation="MKVLLLNGSRREKGCTYTALSEIAQTLEKQGIQAEIIHAVPETEI
FT                   IKSIAEKVKTADGLVVGSPVYWASPSGEIISFMDRLSSLAGKDLLHKPAAAIASARRAG
FT                   TTATLDVLAKYFTYHQMPVVSANYWNVVHGNTPDEVKKDAEGMQIMRVLGNNMAWILKC
FT                   IEAGKNNGVQIPEIEAKIMTNFIR"
FT   tRNA            complement(614699..614783)
FT                   /locus_tag="MHY_T_29730"
FT   CDS             complement(614858..615286)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07620"
FT                   /product="DNA polymerase III, epsilon subunit and related
FT                   3'-5' exonucleases"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05809"
FT                   /db_xref="GOA:D4KHT0"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHT0"
FT                   /protein_id="CBL05809.1"
FT                   /translation="MFFEEGNIKIHGIIPQMVENAPTFADIWNDLRMYLDNRIVIAHNA
FT                   FFDMGVLRSCIWKYNLAKPQFKTACTVQIARKVWPQLPNHKLNTLGEFFQIQFKHHDAL
FT                   DDAKVCAKIPLVAGRTVGVDNMDSLLRKIGLEAKIFKS"
FT   gap             617351..618614
FT                   /estimated_length=1264
FT   CDS             complement(619916..619984)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05810"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHT1"
FT                   /protein_id="CBL05810.1"
FT                   /translation="MTRISVELVPRDIEVLKEEVKQ"
FT   CDS             complement(620284..621048)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07680"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05811"
FT                   /db_xref="GOA:D4KHT2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHT2"
FT                   /protein_id="CBL05811.1"
FT                   /translation="MIELPSIQQLENFIIYSKVKDIATAAREANVTRSAFSFQMKKLEE
FT                   IVGTQLVVHGENTIELTKEGQIFLAKAEKIVSELKQSLSEMKKLAGEEVSLSVGALMSL
FT                   GDVFINQHLIYFKKYNTNIKINVYNLEAKELINQLEADKLDIVSSFSLKDLQDDEYENI
FT                   FFCDEEMVYYAPNIEHLGNIINVEEIAQYPMVQYSPYYLMNSTIKNYFSKLGCHPQVEA
FT                   WFATPYAIMHYCQQNQVGAVLPKRLLNAMGFF"
FT   CDS             complement(621230..622297)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07690"
FT                   /product="Glycerol dehydrogenase and related enzymes"
FT                   /EC_number="1.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05812"
FT                   /db_xref="GOA:D4KHT3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHT3"
FT                   /protein_id="CBL05812.1"
FT                   /translation="MSQQVYLPSYSIGEDVYRRVPQICSNYGKTAIVIGGEISLSKVKD
FT                   KLLTAMKGTDIKLLDFIWYRGNATRESIERLKNMKTVQMADMIFAVGGGKSMDTCKALA
FT                   DMLKKPVFTFPTIASNCAPVTALCILYGKDKVEFYDAQKPAIHCFIDTKIISNAPIKYL
FT                   RAGIGDALSKQYEVCFNTRGRVLNHTNNLGVQIAKDCSERLLKYGVRAVDDAQKNIVSD
FT                   EFIQTVLTIIVNTGLVSVLVNLNYNSSLAHSLYLASVKIPDCKGHMHGEIVSLGVLLLL
FT                   LVDKQLIQAEKVYDFNQKLDLPTSLMNLGIKDVKQIIDLILQDKYLSFAPYNITKEMIK
FT                   EAIDMLEALKHKKTF"
FT   CDS             complement(622376..622936)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07700"
FT                   /product="ParA/MinD ATPase like."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05813"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHT4"
FT                   /protein_id="CBL05813.1"
FT                   /translation="MTPAQTKTGIKIMSTNLILDNETDPVVWRGPIIGGVVKQFWSDVN
FT                   WGEVDYMFVDMPPGTGDVPLTVYQSLPVDGIIVVTTPQELVSMIVEKAVNMAGLLSVPI
FT                   IGIVENMSYFVCPNCNEKHYIFGKSKVEEEANKYGIKHTATLPINPSLAQKCDEGSFET
FT                   FEGDFLNSLGSIFRRKIIHKNRI"
FT   CDS             complement(622954..623100)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07710"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05814"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHT5"
FT                   /protein_id="CBL05814.1"
FT                   /translation="MSGKGGVGKSLVTSMMAVTMQRRGYKTAILDADITGPSIPKVFNL
FT                   KEK"
FT   CDS             complement(623337..623567)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07720"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05815"
FT                   /db_xref="GOA:D4KHT6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHT6"
FT                   /protein_id="CBL05815.1"
FT                   /translation="MVDFSAQYRLIGARIAYFRKLKRYTQEELAFRASISTSYLSRIER
FT                   GIYSKGVPISTLMQISKALDIDIKLLFEEKI"
FT   CDS             complement(623811..624053)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07730"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05816"
FT                   /db_xref="GOA:D4KHT7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHT7"
FT                   /protein_id="CBL05816.1"
FT                   /translation="MYERGNIFVFESEYRQIGAKIMYFRKMKKYTQEELAFRASISASY
FT                   LSRIERGVYKKGLPISTLMKIAKALEVELSAIFEK"
FT   CDS             complement(624224..624364)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05817"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHT8"
FT                   /protein_id="CBL05817.1"
FT                   /translation="MTYYGNNKGKYDEYLYEMQNVNLANLVILHGDGLRVDITNRNIDL
FT                   P"
FT   CDS             complement(624412..624573)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05818"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHT9"
FT                   /protein_id="CBL05818.1"
FT                   /translation="MIATIPFDKELLNPKKYANTDRALYFDMSVEYDNVNSKDKKLDTG
FT                   VVLHIPFL"
FT   CDS             complement(624688..625059)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05819"
FT                   /db_xref="InterPro:IPR006389"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHU0"
FT                   /protein_id="CBL05819.1"
FT                   /translation="MSKFCFKCGTLVNDGEKFCPKCGTNLGVSTSPQIQPNVNKNINSN
FT                   NINNNNSDNNKMKIVIAIAIVVVIVVGSGLGYFLYQKHEKDTQINTNTNTLVETAKATD
FT                   DTYQQQKQDDENLKKLMIY"
FT   CDS             complement(625075..625755)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07770"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05820"
FT                   /db_xref="GOA:D4KHU1"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHU1"
FT                   /protein_id="CBL05820.1"
FT                   /translation="MNICRQCQKQFDDNVLFCPSCGNKLEKQNLQVANNIICQKCGNTL
FT                   TGADKFCPKCGEKTPAFYQTPMVNNMNTNVVNNNQPIQSVNQSYQQNMNTNFNVNNNSA
FT                   DGILNKIKNEYFCFEGRINRKFYITRSLIIAVVVMVLYFIIYAATTDIFGIMSDFGMML
FT                   TLIVQLVGTVAGISLNIRRFHDFNKSGWWILIFMVPFVNLYFSIKLLCIRGDVGTNNYG
FT                   ADPF"
FT   CDS             complement(625792..626193)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05821"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHU2"
FT                   /protein_id="CBL05821.1"
FT                   /translation="MHRLKQRYLMVFIALLTLSSVMFSGCSLLEDKHVTLVKEGTMEIV
FT                   PNVKIGKAFDQFFSDGKWEYFVATDNSKVVEFTGTCRWQDKPAKAKVQFVILNDTRFQL
FT                   WTIEINGDNMRDSDAIAVMKKILTQYHAK"
FT   CDS             complement(626231..626614)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07790"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05822"
FT                   /db_xref="GOA:D4KHU3"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHU3"
FT                   /protein_id="CBL05822.1"
FT                   /translation="MNSDFIQMIKRDYFSYTGRLNRKIYFIRSLVLVVIECILFVLIDE
FT                   LDTRSDDFSLILMLLSFILLCLCIVADFMLDMRRFHDLDKSGYFALLSLIPAITPFLYL
FT                   YLFLMPGTKGANQYGNDPLENTY"
FT   CDS             complement(626783..627961)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05823"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHU4"
FT                   /protein_id="CBL05823.1"
FT                   /translation="MPADNLFCTNCGMKFNQENNYDVNLQNNFNTPVQNTNYQQNANRM
FT                   VNTNMQMRAQNNYPSANNYQQNQMQQHNQMINNQAMNNNQMGMNEFNIGKNYLQMNMPL
FT                   PNYAQAINYLQKAVNMGVKEASIYLMIAHLYQNIDMLKQNSMYIAEHTNGMNYIQPMQN
FT                   ANYGNNFANGLNGNMMANNFNNRANNMPNNQAMANQQMPNNMNNNQNNQESGLKTFGKY
FT                   AAAAAVGAMASSLYHNATEEASSGHQSSSSSTEQPAPTEYIPNEVTQPVQDYIDPMYAN
FT                   PVDNIQAYSEQVVPDMNNVVAPEIMNSNVVDNIQAYDENIIPDNMQNNNEIQSSEEMLQ
FT                   ENPVDSIQAYDETNTQDDTSNSEDTSADYEEEEYTEEDSFGNFDDEDEDSFF"
FT   CDS             complement(628182..628349)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05824"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHU5"
FT                   /protein_id="CBL05824.1"
FT                   /translation="MFFYELMKSTDFIIKDNPFLQEDVEGVLIKYYLPELKEALKAKTN
FT                   EIMTFLKEYN"
FT   CDS             complement(629560..629721)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05825"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHU6"
FT                   /protein_id="CBL05825.1"
FT                   /translation="MSDFVKQFINDKYKQIDIWKESDKSKIVLAYDESDRQVYVIKYLK
FT                   IKMFLIRN"
FT   CDS             complement(629807..629950)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05826"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHU7"
FT                   /protein_id="CBL05826.1"
FT                   /translation="MSGISTLFKVISYLAKNKTARDMVIKTAKNPTARNIVIKTAKHMM
FT                   KK"
FT   gap             630473..631493
FT                   /estimated_length=1021
FT   CDS             complement(631612..631878)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05827"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHU8"
FT                   /protein_id="CBL05827.1"
FT                   /translation="MFNCEQCGACCRNVGKTELGKQLALPNGICKYLNQKTNLCTIYKD
FT                   RPIFCNIDEYYKKYLYKTMSLDMFYKLNKQQCKQIQYLSTINK"
FT   CDS             complement(632062..632409)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05828"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHU9"
FT                   /protein_id="CBL05828.1"
FT                   /translation="MENNKFVDIKEELNKFVDIIIDNAENTLKSIMQNLKEKAYEPKTL
FT                   EEFANLYIEPTDKILVNELKNTELEYIGGDFKLYYIDESYFGIVISWYFKNEQQKFSEK
FT                   NMNINIIINVI"
FT   CDS             complement(632428..632808)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05829"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHV0"
FT                   /protein_id="CBL05829.1"
FT                   /translation="MIPLIIAGIVGAGIGAVVALNWDEIKSWLLNVICKVKELWQKYKP
FT                   YAKKVASIVAEKYIKNGHPMVRIMYRLFFQDENTHKWNELQDLPTREIEADELPLFLQA
FT                   KLKRAEQVDITNEMQQELKLTI"
FT   CDS             complement(632828..633016)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05830"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHV1"
FT                   /protein_id="CBL05830.1"
FT                   /translation="MIPLLVAVGVAGLVGVTTKVLSNDKEKTIKKCRVRLIRKDELPTF
FT                   LQEKLESAEQNNYKNNK"
FT   CDS             complement(633879..633995)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05831"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHV2"
FT                   /protein_id="CBL05831.1"
FT                   /translation="MPIGREITNDDYSNDKIIKNNKNNEDLKIDNKKINNQK"
FT   CDS             complement(634019..634168)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07930"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05832"
FT                   /db_xref="GOA:D4KHV3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHV3"
FT                   /protein_id="CBL05832.1"
FT                   /translation="MELAQETNISLSYMAKIESGLVTGCVSLPVLYKISKILDVSLDKL
FT                   VNKN"
FT   CDS             complement(634513..635049)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05833"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHV4"
FT                   /protein_id="CBL05833.1"
FT                   /translation="MKIKEVSILRFFISSIVICLGIIFSNILNVEARIPYTYLNIGGLT
FT                   PDQQIDSCFYVYGRPTANLAVRNCNGFNINEVTYNSELMVYYINGGYNENGRIRAIICN
FT                   EDNITTNLGIRVGMNKNDVLYAYGDPDRNYRETQGSTWCYLADSEDHPNMPLYFFFDNR
FT                   EVIKTIVVGDIGYYY"
FT   CDS             complement(635074..635874)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07950"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05834"
FT                   /db_xref="GOA:D4KHV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHV5"
FT                   /protein_id="CBL05834.1"
FT                   /translation="MQNLENKDEVKVHKLTINGGKNKFGEAENIQVEIFAGQVISIVGP
FT                   TGSGKSRLLADIECLAQEDTPTKRQILIDDEILDDEARFNLEGKLVAQLSQNMNFIMDI
FT                   TVEDFLTMHAKVRLGKEIENEKAIIAKCFSMANELAGEKFTLDTKVTQLSGGQSRALMI
FT                   ADVACISSSPIVLIDEIENAGIDRQKAIKCLAKSEKIVIMSTHDPLLALNADKRIVIKN
FT                   GGISKIIETTAKEKACIEKIRQLDETLLNIRSRLRLGDLIENIN"
FT   CDS             complement(636939..637310)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07980"
FT                   /product="L-aspartate 1-decarboxylase"
FT                   /function="L-aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05835"
FT                   /db_xref="GOA:D4KHV6"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHV6"
FT                   /protein_id="CBL05835.1"
FT                   /translation="MFHGKIHRATVTQANLEYMGSITIDEELLELAGILPGERVQVVNN
FT                   NNGARLETYTIAGKRGSGVICLNGAAARKAQVGDTVIIIAYAMMTKEEAQNLVPDVVMV
FT                   DEHNRPVRVRGTELEGEIG"
FT   CDS             complement(637325..638179)
FT                   /transl_table=11
FT                   /locus_tag="MHY_07990"
FT                   /product="pantothenate synthetase"
FT                   /function="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_07990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05836"
FT                   /db_xref="GOA:D4KHV7"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHV7"
FT                   /protein_id="CBL05836.1"
FT                   /translation="MILCQDVAKLRELVANFKKENKSIGLVPTMGALHEGHASLINASA
FT                   KENDITIVSVFVNPTQFGPNEDYEAYPRTLENDCIVAQNAGADVVFAPKNKDLYPNEDM
FT                   TWVEVTGDITKVLCGRTRPIHFRGVTTVVSKLFNLSRADRAYFGLKDAQQTEVLRRMVD
FT                   DLFFNVELRIMPIVREADGLAKSSRNTYLSLEERKSALILSKSLKLAKEAFTNGQRDVE
FT                   AILNLVKDTIQFEKTSQIDYVEMYKLPGLKPVGNKIEGRVLLALAVKFGTTRLIDNVIL
FT                   EDK"
FT   tRNA            complement(638618..638693)
FT                   /locus_tag="MHY_T_29720"
FT   CDS             638847..639728
FT                   /transl_table=11
FT                   /locus_tag="MHY_08000"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05837"
FT                   /db_xref="GOA:D4KHV8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHV8"
FT                   /protein_id="CBL05837.1"
FT                   /translation="MELNQLEYFVALAHIKNFTKAAKSLNVSQPALSRSISRLEKDLNI
FT                   PLFIRDSRKVNLTQYGQTFLTYAERILQELETARQDITNMAEPDSGVVNLSFMHSLGVY
FT                   LVPELLKEFRKIYPKIQFRLIQNHSFLLSKQLFKGESDLCLCSSPINSEGIAWVPLLTE
FT                   ELFIIVPSTHPLAHRSSINITEVASEPFITLKPMYGLRTKTEHIFEVASIRPKIRFEGD
FT                   EIVTVASLVAANLGVSLVPKIPGMEHLDIKFISVDNPKCTRDIGLAWYANKPLSLAAHR
FT                   FQNFIIDKFNHE"
FT   CDS             640039..640491
FT                   /transl_table=11
FT                   /locus_tag="MHY_08020"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05838"
FT                   /db_xref="GOA:D4KHV9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHV9"
FT                   /protein_id="CBL05838.1"
FT                   /translation="MVDYKHRIYLEYIQESNSIYPIDGVLDLLYQLHSEGIPVALASSA
FT                   DRKVINAVLTKFGLMDCFEYILSGAELPASKPNPAIYQLTAKALGFAPADCVVIEDATA
FT                   GIMAAKDAGAYCIAYDNPNSGPQDLSRADKIVSSLSDIVVSDILQN"
FT   CDS             640510..640791
FT                   /transl_table=11
FT                   /locus_tag="MHY_08030"
FT                   /product="Uncharacterized oxidoreductases, Fe-dependent
FT                   alcohol dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05839"
FT                   /db_xref="GOA:D4KHW0"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHW0"
FT                   /protein_id="CBL05839.1"
FT                   /translation="MEKFKFYCPTEIIFGKDSELSTASLIKKYNGHNVLIVYGGGSVKR
FT                   SGLLDKICQQLSNDNLSYMTLGGVQPNPVVRFVNDAVKKHIKLILILS"
FT   CDS             641712..642602
FT                   /transl_table=11
FT                   /locus_tag="MHY_08050"
FT                   /product="Uncharacterized Fe-S protein PflX, homolog of
FT                   pyruvate formate lyase activating proteins"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05840"
FT                   /db_xref="GOA:D4KHW1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHW1"
FT                   /protein_id="CBL05840.1"
FT                   /translation="MDMQNCTLCPRLCHVDRTKNYGVCLASDKVEIALVSLHQWEEPCL
FT                   SGTNGAGTVFFSHCNMRCIFCQNHEISTEGKGFPVTIERLAQIFLEQQARNAHCLELVT
FT                   PTHYVLQIIEALKLAKKQGLSIPVVYNTSGYERVEVLEMLKDYIDVFLPDFKYYSPDTA
FT                   KEFSHAPDYPQVVKEAIDKMFELVGKPQFKNNIMQKGVIIRHLILPWYYKESMEIVKYI
FT                   WEKYHDDVYLSLMNQYTPMYKALTHPKLKRKLTTFEYDKVVDYALDLGFKNCYIQQGKT
FT                   ATTKFVPHFDGTNVY"
FT   CDS             642628..643107
FT                   /transl_table=11
FT                   /locus_tag="MHY_08060"
FT                   /product="Predicted flavin-nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05841"
FT                   /db_xref="GOA:D4KHW2"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHW2"
FT                   /protein_id="CBL05841.1"
FT                   /translation="MRRFKQALPSSENIAILKQKTHGILALCDEKSFPYTVPLNYVYLN
FT                   DKIYFHCANVGRKLDIVRQNNKASFCVINQDTVIPEKFTTAYSSVIVFGTIKEITAEND
FT                   KQIILEEFIRKFSADYFIEGLEEIKTYIKRTCILELSIEEITGKEGLELQKLRHK"
FT   CDS             complement(643187..643498)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08070"
FT                   /product="Thioredoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05842"
FT                   /db_xref="GOA:D4KHW3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHW3"
FT                   /protein_id="CBL05842.1"
FT                   /translation="MLVHADANAFNKLLENKGTFVVDFFATWCGPCKMLGAVLEKVAPE
FT                   YDFDILKIDIDENVKLAEEYEVMVVPTLLFVKDGEIIHRESGFFSKDKFKSLIDAYLK"
FT   CDS             643953..645554
FT                   /transl_table=11
FT                   /locus_tag="MHY_08080"
FT                   /product="Sugar (pentulose and hexulose) kinases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05843"
FT                   /db_xref="GOA:D4KHW4"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHW4"
FT                   /protein_id="CBL05843.1"
FT                   /translation="MQTNEMIKSNIEQGLTTLGIEFGSTRIKAVLINTDHEPIAVGAYD
FT                   WENSLIDGIWTYSEEEIWAGLQGCYKNLVEEVKAKYGVSITKLAGLGFSAMMHGYLAFD
FT                   EKDTLLVPFRTWRNNITGQASHELIKLFKYNVPQRFSIAHLYQAILNNEEHVDKIKFFT
FT                   TLAGFVHWKLSGEKVLGIGDASGMFPIDINIKDYNEKMLADFDAHIADKNYPWSIREIL
FT                   PKVLVAGENAGYLTAEGAKLLDPTGTLQAGTPMCPPEGDAGTGMVATNTVTKRTGNVSA
FT                   GTSVFAMIVLERDLSKVYEELDMVTTPAGDLVAMAHSNNCTTDLNSWISLFHECLTSFG
FT                   VKVDANELFSTLYNKALEGDADCGGLLAYCYHSGEHITGFTEGRPLFVRKSDSKFNLAN
FT                   FIRVHLSTALGAMKTGLDILTKEENVTIEQILGHGGLFKTKGVGQTIMANAIGAPVTVM
FT                   ETAGEGGAWGIALLADYMNNKENLSLDEYLSTKVFKNSVAETIAPTKEGIEGFETFMTR
FT                   YRNGLAIEQSAIDNLK"
FT   gap             645561..646379
FT                   /estimated_length=819
FT   CDS             complement(646469..648289)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08090"
FT                   /product="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05844"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHW5"
FT                   /protein_id="CBL05844.1"
FT                   /translation="MPNNEDPFPVDLKIEELEVHKPDIKIYQLTVPNECREVAKAVLKV
FT                   SDTAEKRIVKLENMMATLYRYLFRIGSRMSINCVYYGGQNPSFEKYRSIRCLVDNRTGE
FT                   GQEIQLDQCLTCTRFEPIYGQVYECMNDLGANVASILDDNQMAYSNMDKYVEQNRVEQY
FT                   HDENEKASIDLATVQLKSDTSYNDREFKQHWGNGIAMDWKLVPKEQQKPHINWRQSIND
FT                   DGSNLKRLASFPMNEQNAGSNLVTAGKTMENLFIKNKQAMDSNSNSEIQSWINTGKQQG
FT                   ENVSDTLINKIKGGWATEIRSAINGQQGLDSLAIACCAFIENKEPSSIISKLVDIKGVT
FT                   GVDNPALNIAAYASGINAIMGDESSDIPRIDKVTKPNSSDNGVTTETYHLNWENRDTWY
FT                   WTEFAEPLSINAKANGATSSNVMPFFPQVCYLYCALLPLCKTSEYDGDWAAFPFDDNQI
FT                   QNNNIYFTSKYGPRNGRIHYGIDLQAPHGTEIHAIADGTVIDPSGWGAEDCNAVIIDHG
FT                   NGITSKYLHCSSHAVSVGTSVTKGTVIAYVGSWGNGHDGAYDADHLHLEIGTNGLNSSN
FT                   QNPIDYYPLLADCQPERGSHYYDLANHTMY"
FT   CDS             complement(648486..648668)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05845"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHW6"
FT                   /protein_id="CBL05845.1"
FT                   /translation="MAQSNATQEDLEATKKEHPDWIVGGQIYSDPEEREAARQALAKLQ
FT                   AEEETRTRAIRKRRS"
FT   gap             649710..650218
FT                   /estimated_length=509
FT   gap             650946..652114
FT                   /estimated_length=1169
FT   CDS             652830..653483
FT                   /transl_table=11
FT                   /locus_tag="MHY_08150"
FT                   /product="Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05846"
FT                   /db_xref="GOA:D4KHW7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHW7"
FT                   /protein_id="CBL05846.1"
FT                   /translation="MIMNLAPYGVFALLVPVVAANGPKVLLPLLSVIVTVYIGCIIHAL
FT                   VVYSSIVSTLGKMSPLKFFKGMTETMLLGFTTCSSAAALPVNMKNCTENLGANKSIASF
FT                   VLPLGATINMDGTAIYQGVCAIFIANVYGIDLTAGQMLMIVLTGTLASVGTAGVPGAGV
FT                   IMLALVLQTVGLPMEGLALVAGIDRVLDMIRTCLNITGDAAVTIAVSQTERSNN"
FT   CDS             complement(653548..654135)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05847"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHW8"
FT                   /protein_id="CBL05847.1"
FT                   /translation="MEKAKTLLEIARIISGNDDDVLAEIEESIDNIEAYAQEHLEEFEE
FT                   RNISIKYDSVEDLQWLVTVNILVRNNYVMQIQEDCSITDFGWSLKSLRTFKEYNLALDS
FT                   KFEEEDYEIDKYDYNEDDEYDYYNEEMDFIDDENIINWCKYLDSKWFDEDICIGMIDLS
FT                   PDIFTLFLASEENLEDLEDLADSLGKVISTVY"
FT   CDS             654963..655118
FT                   /transl_table=11
FT                   /locus_tag="MHY_08180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05848"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHW9"
FT                   /protein_id="CBL05848.1"
FT                   /translation="MKKIGQGKIGLDAIIKIINHPQLKHLPFILETPNDHDGYAQEIAL
FT                   LRANFN"
FT   CDS             complement(655228..655677)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08190"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05849"
FT                   /db_xref="GOA:D4KHX0"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHX0"
FT                   /protein_id="CBL05849.1"
FT                   /translation="MERSLAHTRWMCKYHIVFIPKYRRKIIYNKLRRDIVQIIKDLCKW
FT                   KGIEIIEGKAMPDHIHILVKIPPKMSISNFMGYLKGKSVMMIFARHGNLKYKFGNNNFW
FT                   STGYYVSTVGLNEATIAKYIRKQDTYDKMMDKISTKELNDPFRDC"
FT   CDS             complement(655818..656621)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08200"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.1.35"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05850"
FT                   /db_xref="GOA:D4KHX1"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHX1"
FT                   /protein_id="CBL05850.1"
FT                   /translation="MALENYKALTIAGSDTSGGAGMEADLKTFEEMGVYGMVALTVIVA
FT                   QNPKDWAHDIFPIDLPTIERQIATVGEGIGINAMKTGMLGSAALVELVAKSIDKYNFKN
FT                   VVIDPVMVCKGIDAIMVPEAAEAIKSLLVKKADVITPNTVESAYLAGMEKVETVEDIKE
FT                   ACVKINKLGAKNVIIKSGSRVDGDYMVDVLFDGKEFTIQKKSKMKNIYNSGAGCTFSAA
FT                   ITAGLAKGLDIHQAFENAQNFIDKAVVNSFKLNEFTGALAHWQTR"
FT   CDS             complement(656731..657561)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08210"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05851"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHX2"
FT                   /protein_id="CBL05851.1"
FT                   /translation="MDVIALVGPSGTGKSHRALMVARQNKADAIIDDGILIKDNKIIAG
FT                   HSAKREASKIMAIRRAVFVVPGHAEEVRTAIEKEQPNRILILGTSENMVHRIDKALNLP
FT                   PISKIINIADIATKAEMAKAQFYRNREGKHIIPVPTIELKPHFSGYLIDPIQSFFKKSS
FT                   TKRRRLGEKSIVRPIFSYYGRLIIDDAAILSIIKHIAKDKDFDFKASHIHVDHVWEKGE
FT                   DKGIKVSFEVVLNYGSHIPTMIQGIQKKIKEVVEYMTGMFVHDVDIVVKGLKFK"
FT   CDS             complement(657825..658073)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08220"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05852"
FT                   /db_xref="InterPro:IPR007347"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHX3"
FT                   /protein_id="CBL05852.1"
FT                   /translation="MEVLRVSTKSNPNSVAGVLREKGTAELQAVGAGALNQAVKAVAIA
FT                   RGFVAPSGIDLVCVPAFADIEIDGEERTAIKLIIESR"
FT   CDS             complement(659376..659504)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05853"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHX4"
FT                   /protein_id="CBL05853.1"
FT                   /translation="MQITKTKDEKKPNMDCVNLLTSVLIYYPEISKISIEPDEKYI"
FT   CDS             complement(659660..660997)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08260"
FT                   /product="metal dependent phosphohydrolase"
FT                   /function="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05854"
FT                   /db_xref="GOA:D4KHX5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHX5"
FT                   /protein_id="CBL05854.1"
FT                   /translation="MRQELDRDTKDRRNELSRQERRLVQKEENLDRKIDSLEKKEEVLN
FT                   RKEAEIDKSQAKIEALHAKQLEELERISGLTTEDARSMLLADAEIEIKHDKAVMIKEYE
FT                   QQAKEEAEKRARNIISLAIQRCAADHVAETTVSVVALPNDEMKGRIIGREGRNIRALET
FT                   MTGIDLIIDDTPEAVILSGFDPVRREIARIALEKLITDGRIHPARIEEMVEKARKEVDQ
FT                   RIKEAGEQACFETGVHGLHPEIVKLLGRLKYRTSYGQNVLNHSVEVSHLAGVMAAELGV
FT                   DVNLAKRGGLLHDIGKAIDHEVEGPHVTIGADLAKKYRESADVVNAIAAHHGDEEAKTV
FT                   EAVLVAAADAVSAARPGARRESLESYLKRLKRLEEIAESFEGVDRSFAIQAGREIRIMV
FT                   KPEKMDDISTVALAHDITKKIEAELEYPGQIKVTVIRETRVVDYAK"
FT   CDS             complement(661437..661877)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05855"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHX6"
FT                   /protein_id="CBL05855.1"
FT                   /translation="MNLKAEKFKAYIAENNITNFKVEESINNNEEENARVTFHTYVKVF
FT                   GQKLPAVIVMDESIYVILRVQVIPDIEYMKNKDEFIRCVNEMNINYKAVKYYLGADNAL
FT                   YLDMYIPNKNDDLDGELVMDLLNAITVHLEKEYPNWMKLLWN"
FT   CDS             662077..662583
FT                   /transl_table=11
FT                   /locus_tag="MHY_08290"
FT                   /product="Guanosine polyphosphate
FT                   pyrophosphohydrolases/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05856"
FT                   /db_xref="GOA:D4KHX7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHX7"
FT                   /protein_id="CBL05856.1"
FT                   /translation="MKTDNMDITIDDIINTVKSYNPQANFDLITKAYNLAYEAHADQKR
FT                   ISGEMYITHPLHVAMILTDLHIDDVTIAAALLHDVVEDTIYTIEQMKELFGEEVAMLID
FT                   GVTKLSKMKYKSKEDQQLETYRKMFLAMAKDIRVIMIKLADRLHNMRTLKYMREENKNA
FT                   LLKKR"
FT   CDS             664326..664952
FT                   /transl_table=11
FT                   /locus_tag="MHY_08320"
FT                   /product="Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05857"
FT                   /db_xref="GOA:D4KHX8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHX8"
FT                   /protein_id="CBL05857.1"
FT                   /translation="MKIKALVVGPIMENCYILYDEQTLEGIIVDPGDEATSILNVVDNL
FT                   KLHIKYIVNTHGHADHIGANKELGLALKAKLAIHADDACMLTDPHLNLSENGYMGRPII
FT                   SQPADIILHEGDIISFGNCNLKVIHTPGHTPGGICLVGEGVVMSGDSLFAGSIGRTDFP
FT                   TGSMTDLISNLKAKILTLDENLTVFPGHGGATTIAYEKQINPYLG"
FT   CDS             664959..665324
FT                   /transl_table=11
FT                   /locus_tag="MHY_08330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05858"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHX9"
FT                   /protein_id="CBL05858.1"
FT                   /translation="MINDFSPEILDLNTIDEARQAMQDIHCTDAGIKIMQDKALFKVIK
FT                   LYDVNSKAANILKQTFLSKGGEVAISRHCADLSKETSDVIIMATIYQYKRAIPVLKMQP
FT                   WKLKQIAEILTTMIKEV"
FT   CDS             665327..665791
FT                   /transl_table=11
FT                   /locus_tag="MHY_08340"
FT                   /product="O-6-methylguanine DNA methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05859"
FT                   /db_xref="GOA:D4KHY0"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHY0"
FT                   /protein_id="CBL05859.1"
FT                   /translation="MFYFCKYQFENISLYLVATETHLINIQFTQPQKALLQTTELLSMA
FT                   TIQLDEYFQGKRTTFSLPFKLTGTPFQLAVWKELQNIPYGQTTSYKEIAQKINKPKAYR
FT                   AVGMANNKNPLPIIIPCHRVIGSNGKLIGYAGGLKLKNYLLELEKSHTNF"
FT   CDS             665824..666480
FT                   /transl_table=11
FT                   /locus_tag="MHY_08350"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 1 with third motif having Dx(3-4)D or Dx(3-4)E"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05860"
FT                   /db_xref="GOA:D4KHY1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHY1"
FT                   /protein_id="CBL05860.1"
FT                   /translation="MNYKGVIFDLDGTLVNSLTDLANSVNIVLTEYNLPTHDIESYKYR
FT                   VGNGIKKLMERSLPQDKQYLLDEALAKFKQVYAKHNLDHTAPYEDILTLLKKLQQQNIK
FT                   LGICTNKHDEAAKNIVKLLFGEGIFSEIIGDKAGLKRKPDPGKVLMIAQNWQLKPQEIA
FT                   YLGDSDVDMQTAKNADMLAVGVLWGFRPADELKQNGADILIAKPLDLLTQVSFAK"
FT   CDS             666511..666696
FT                   /transl_table=11
FT                   /locus_tag="MHY_08360"
FT                   /product="SAM-dependent methyltransferases related to tRNA
FT                   (uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05861"
FT                   /db_xref="GOA:D4KHY2"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHY2"
FT                   /protein_id="CBL05861.1"
FT                   /translation="MKSKIPVQLGQKYEIKITGMGQSGEGVGRFENFTVFIPYALPGET
FT                   VEAKITLVKKIMLQAK"
FT   CDS             666831..667952
FT                   /transl_table=11
FT                   /locus_tag="MHY_08370"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /function="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05862"
FT                   /db_xref="GOA:D4KHY3"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHY3"
FT                   /protein_id="CBL05862.1"
FT                   /translation="MEHIAIKKDIIIHPTMPSVHEWHYRNKMQFPIGRSKKEGIIVGCY
FT                   AHSSHNIINTENCHIQKHTNNVIANAVREMATKFKLSVYDEKTHYGLLRHVVGRTNRDE
FT                   TECMVVLVTAQPKIPRVREIVNFLRSKIPNLTSVVQNINTGRNNIIMGKECKILWGASH
FT                   ITDRLGSLKFKISALSFFQVNTEQAEKLYECALKYANLTGKETVIDGYCGTGTISLFLA
FT                   QKAKKVYGMEIVPEAIRDAIANARDNNIRNAEFLTGDAAKLMPQLYRKGLRPDVIVTDP
FT                   PRAGCAPEVLKTFAAMRPKRIVYVSCNPASLARDIGILDELGYKATEIQPVDMFPQTGH
FT                   VESVCLLVKNNHLSVRFSFNQKKNEPKRKAPQY"
FT   CDS             668176..668949
FT                   /transl_table=11
FT                   /locus_tag="MHY_08380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05863"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHY4"
FT                   /protein_id="CBL05863.1"
FT                   /translation="MSISRRNFFKLAGITTALLAIGGIGFINQPKIGRSPKDDELTKIL
FT                   KSPHYVNGEFQNLEPTSVLVNKDNYYNGIKEILFPTKGVTIPKENIPTQKTDLKALNPK
FT                   ENLLVWFGHSSFYLQIDGIKILVDPVFSDYASPLFFINKAFAGTNIYTANDIPDIDVLI
FT                   ISHDHWDHLDYATIMSLKHKIKHIVCPLGVSSHFYHWEFNPDIIHDEDWYNEIKLSDNL
FT                   KIHILPSRHFSGRFLDNNKTLWASFAIITPTKKFL"
FT   CDS             complement(669373..669693)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08400"
FT                   /product="ACT domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05864"
FT                   /db_xref="GOA:D4KHY5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHY5"
FT                   /protein_id="CBL05864.1"
FT                   /translation="MPVVSNMGAVVGVITETDIFKTFVDVMGLADGKTRITLEVTDKIG
FT                   VVKDIAEIFGQAGVSIDSLITCKKEDNKYEIVIRGDITNIDDIKAKLEAKGYKVIHTVK
FT                   IG"
FT   CDS             complement(669752..670015)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08410"
FT                   /product="CBS domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05865"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHY6"
FT                   /protein_id="CBL05865.1"
FT                   /translation="MFVINRMTKNPMTVTADTKVDEVAHLMKKHNFRRLPVVDDGKLVG
FT                   FLSDSDLMRVAPSSATTLSRYEINSLLAKICVRDIMKKMLFL"
FT   CDS             complement(670112..670816)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08420"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05866"
FT                   /db_xref="GOA:D4KHY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHY7"
FT                   /protein_id="CBL05866.1"
FT                   /translation="MLKINDMNVYYGAIHALKGISLEINEGEIVTLIGANGAGKSTTLR
FT                   TISGLLKPKTGTIEFEGKNIAGMPAQNIVKAGISQVPEGRRVFAEMTVMENLELGAFIR
FT                   KDKAGIAKDLKMVFERFPRLEERVNQQAGTLSGGEQQMLAMGRALMSRPRLLLLDEPSM
FT                   GLAPLLIREIFSIIQDINKAGTTVLLVEQNANMALSIANRAYVLETGRITLSGDAKELA
FT                   ASEEVRKAYLGG"
FT   CDS             complement(670822..671586)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08430"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05867"
FT                   /db_xref="GOA:D4KHY8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHY8"
FT                   /protein_id="CBL05867.1"
FT                   /translation="MELLKTDGVSKVFGGLKAVSNFDIEINEGELIGLIGPNGAGKTTA
FT                   FNLLTGVYQPTTGTIDFAGKSLVGLKPYQITSRGIARTFQNIRLFSELTVLDNVKIAYD
FT                   SHAKYSLVESVFRLGRYFKEEDEITKKSLELLKIFKLEDKAYEVAKNLPYGAQRRLEIA
FT                   RALATKPKLLLLDEPAAGMNPQETQELMEMIRWIRKEFGLSILLIEHDMSLVMGICERI
FT                   YVLEYGCIIASGTPEEIQKNPEVIKAYLGGEV"
FT   CDS             complement(671589..672458)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08440"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter membrane
FT                   protein 2, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05868"
FT                   /db_xref="GOA:D4KHY9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHY9"
FT                   /protein_id="CBL05868.1"
FT                   /translation="MAERIIGSFWELNIFLVCVNIIMAASLNLINGYTGQFSLGHAGFM
FT                   AVGAYVGVILTVNFHSPFIVALLIGGFAAGILGFLIGLPTLRLKGDYLAIATLGLGEII
FT                   RIVIMNIEYVGGAAGFKGIPHNTTFPWVFFIMLFTLFFIKNFVNSKYGRSCIAVRENEI
FT                   AAEAMGVNTTKYKVMAFTIGAIFAGIGGGLFAHCFYIINPSSFTFMASFNFLIMVVLGG
FT                   LGSITGSIAGAFVVTFVSAALASWPEFRMIAYALVLILLMFYRPQGLFGYTEITSLKIF
FT                   QRFKGGRG"
FT   CDS             complement(672542..672760)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08450"
FT                   /product="Branched-chain amino acid ABC-type transport
FT                   system, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05869"
FT                   /db_xref="GOA:D4KHZ0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHZ0"
FT                   /protein_id="CBL05869.1"
FT                   /translation="MPGLKAFVAAVLGGIGSIPGAMTGGIVLGVIEALVSGFISSTFRD
FT                   AAAFAILILVLLFKPSGIFGKNTNEKV"
FT   CDS             complement(672747..673430)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08460"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter membrane
FT                   protein 1, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05870"
FT                   /db_xref="GOA:D4KHZ1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHZ1"
FT                   /protein_id="CBL05870.1"
FT                   /translation="MDFFEQLIQQLINGISLGSIYALIALGYTMVYGIIKLINFAHGDI
FT                   YMVGAYVGFYAVTMTKMSIIPALIISMVVTGLLGILVEKIAYKPLRKAPRISLLITAIG
FT                   VSFFLEYTSMYFVSPTPRTFPNVIDSLSLNIGSFVINGQQLLIFIITVILMVLLTYIVQ
FT                   KTKMGKAMRAVSFDTETAQIMGINADRVISFTFGIGSALAAAGGVLVGVYYNSIDPLMG
FT                   DYARA"
FT   CDS             complement(673866..674675)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08480"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05871"
FT                   /db_xref="GOA:D4KHZ2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHZ2"
FT                   /protein_id="CBL05871.1"
FT                   /translation="MNFSKKRLRIAGLLLGMTMFGSIFAGCGGEEAANSDEIKIGANFE
FT                   MTGNVANYGTTTLEGLKLAIKEANDAGGINGKKITLVEADNKSDPAEAANAATKLISDD
FT                   KVVAIVGPATSGAVQAESQVATENKVPIIAPDATSPDITVENGQVKPFVFHGCFIDPLQ
FT                   SNTMAAFAANELKAKTAVIYLDSSTDYSKSLAEVFKNKFEALGGKVVMEEVFVAKDQDF
FT                   KATLTNIKTANADIIYIPAYYEEVGKIVKQARELGITQPIFRYRWLG"
FT   CDS             complement(676700..677341)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05872"
FT                   /db_xref="GOA:D4KHZ3"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHZ3"
FT                   /protein_id="CBL05872.1"
FT                   /translation="MIFLENKYQVLQDAYQLLIIEGSECNADIPDYTLEHMQELMHFSI
FT                   NHWLNIINSKKYKTVLFFKNHGPLSGGTMRHPHMQIVGIKNLEFKNMCDKRQFEGIKIA
FT                   EKNNVVMNLSTKPRVGFTEVNVIMKGLNDIDILAEFVQIGVDYIMNHFSVNCSSYNLFF
FT                   YLIEGNIHVKIMPRFATSPLFIGYNIELVPNNLQEIAKHIKQLYFDKKND"
FT   CDS             complement(677338..677511)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05873"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHZ4"
FT                   /protein_id="CBL05873.1"
FT                   /translation="MSFSKIKRERKIFMEYNYLGFDINIGKSKPENIVHREVACPFCDV
FT                   KSLKNIIEIKMI"
FT   CDS             679340..680224
FT                   /transl_table=11
FT                   /locus_tag="MHY_08530"
FT                   /product="conserved protein of unknown function
FT                   cotranscribed with Bmr (bmrU)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05874"
FT                   /db_xref="GOA:D4KHZ5"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHZ5"
FT                   /protein_id="CBL05874.1"
FT                   /translation="MKKFLLAYNPVSGDAMFKKKLDDIINQFQSRDCIIMPYRTKKESF
FT                   DPFFANCIRNVNADGIIAAGGDGTLHKIINMTLKENLDVPVGIIPSGTSNDFASHLGID
FT                   AKFDEYINSIITGKTQYVDVGSIGDEYFINVISAGMMTGVAHEVDTRLKNTFGKLAYYF
FT                   RGLGELPRFRGLDFTIEADGEIIKEKIFFVLVVNSPVVASFKNISMDAKINDGKLDMIL
FT                   LKQCNIPELMKIVADTVAGKTSFDNKNIIYKQASYFKFSCPDRVESDLDGELGPVLPLE
FT                   VRTISNKLKMFVL"
FT   CDS             complement(680601..681218)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08550"
FT                   /product="EamA-like transporter family."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05875"
FT                   /db_xref="GOA:D4KHZ6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHZ6"
FT                   /protein_id="CBL05875.1"
FT                   /translation="MGSLIKLGKKYFFEFSILSIILIWSSNNAVMKIGIEEIGPFIYNA
FT                   LRLTIAALLCWLWLYKTHTYRKMPWRDLKYLILLALGGFCLTQVCLTFGLSKTTAGNAS
FT                   LASAIMPLAVALLNKLFKQNPLSKNVILGLIISFVGMMAIIFSSNKEISFANHHLIGTL
FT                   VVVLGQFSNAYYTIYAKDLLNKYSPCQIVSFLMSISAIVFFY"
FT   CDS             complement(681326..681457)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05876"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHZ7"
FT                   /protein_id="CBL05876.1"
FT                   /translation="MKLKKTFTKELDREKIKYIKNKIVDKKILRKGESIKFNKIKFL"
FT   CDS             complement(683679..684623)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08590"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05877"
FT                   /db_xref="GOA:D4KHZ8"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHZ8"
FT                   /protein_id="CBL05877.1"
FT                   /translation="MGFGIYIHIPFCKQKCFYCDFASTAKKVDETLYEQYINALCQEIT
FT                   MYQALFPDIYIDTIYFGGGTPSILPPDLIIRALNAVKANFTLNSDIEITLEANPGTVDE
FT                   QKLQYLYQNGINRLSFGVQAVQDDLLQKIGRIHTIKEAEMAIEMAQKIGFKNISMDLMY
FT                   GLPGQTLEMLKEAVSWAVNKNMQHISIYGLQIEENTVFGRLYDQGKLILPSEDESEMMY
FT                   DYLTEQLPKYNYNRYEISNFAKIGYESRHNLAYWQDKFYLGLGAGAHGYYNQKRVQNPF
FT                   DIDEYIKKCNQKILPFINEEIVDEKAHIEEFCF"
FT   CDS             complement(684623..684688)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08600"
FT                   /product="Membrane GTPase LepA"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05878"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="UniProtKB/TrEMBL:D4KHZ9"
FT                   /protein_id="CBL05878.1"
FT                   /translation="MKAVGSVEVPQEAFMAILKID"
FT   CDS             complement(686603..687763)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08620"
FT                   /product="branched-chain amino acid uptake carrier"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05879"
FT                   /db_xref="GOA:D4KI00"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI00"
FT                   /protein_id="CBL05879.1"
FT                   /translation="MQVKISDVVVTGFALFAMFFGAGNVIFPPYLGMTSGTEWLTGFLC
FT                   FIFIDVFLSCIGIFTIVYGGGGIKALESVVGKIPGMILNIAAVLCTGVLIAPPRTAATT
FT                   FEMSIAPFTDKISLFVFSIIFFGIVFAFTIRPTRFVDIIGKFLTPILIICTFILIIAGI
FT                   LSPIGEIAAPVSQTVAEDGIIAGYQTMDILVVSGFGLVMLNTLRLKGYVERKSQIKAII
FT                   GVCIVAGILLSLIYGGLAYLGATSSVVLGNNNLNQAQLIVAITNHLMGHTGMVILGIIV
FT                   GFACLTTAVGLIGSTACFFEDFTNKKIKYPVWVVINTLTSISLCNLGLTTIINVAVPIL
FT                   TTICPPFMITVLLLLFRNQIKNTLVYKGIALVAFLYGLISTIQSYM"
FT   CDS             complement(687963..688433)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08630"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /function="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05880"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI01"
FT                   /protein_id="CBL05880.1"
FT                   /translation="MKVSTKGRYALRTMIDLTVNNTGNPIPLKDIATRQNISLKYMEQI
FT                   ISLLIKAKLVKSVRGNNGGYLLAKSSMQYTAGDILRAAEGDMAPIACIEKDHCNCNRAD
FT                   YCSVLPFWLGLNKVINGYLDSVTLSELARQAKENNAMITCQQNEKQNKKDKK"
FT   CDS             688959..691352
FT                   /transl_table=11
FT                   /locus_tag="MHY_08640"
FT                   /product="leucyl-tRNA synthetase"
FT                   /function="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05881"
FT                   /db_xref="GOA:D4KI02"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI02"
FT                   /protein_id="CBL05881.1"
FT                   /translation="MDPNKPKYYVLEMFPYPSGNLHMGHVRNYSIGDVIARYKTMNGFN
FT                   VLHPMGFDAFGMPAENAAIKHGVSPSDWTEDNMANMTRQQKEMGLSYDWDRKVATCHED
FT                   YYKWTQWLFELFYKKGLAYKKKASANWCETCHTVLANEQVIDGKCWRCDDTVVKKDLEQ
FT                   WFLKITDYADVLLKDLDKLEGWPNRVKIMQDNWIGRSEGAEFSFDVPDYNEKISVYTTR
FT                   PDTVFGVSYVVLAAEHPLVKKFIKGKENEQEILKFIEEVHNMNEIERTSSESEKKGMFT
FT                   GVYAINPFNGEKVPVWVTNYVLFEYGTGAVMGVPTHDERDFMFAKKYNLPMKIVIQNKE
FT                   HNLTLETMENAYVEDGELVESGQFTGMNNRKAITAMIDWLEENNLGKRRVNYRLRDWLI
FT                   SRQRYWGAPIPIIYCPHCGEVLVPEEQLPVKLPKDVKFETGATSPLAQAEDFVNCTCPK
FT                   CGAPAKRETDTMDTFICSSWYYMRYADPHNDKAPFSKDAINYWLPVDQYIGGIEHAILH
FT                   LLYSRFFTKVLKDAGLVEFDEPFTNLLTQGMVIKDGSKMSKSKGNVVSPEEIIKKYGAD
FT                   TARLFILFAAPPERDLEWSDQGVEGAWRFIQRVWRIILSYADKVKENPTFDVKALTKEE
FT                   KELFRILNVTIEKVTEDIGTRSTFNTAISSIMELVNAFYVFKDGNLNAGLAREVVINLI
FT                   KLLAPFAPHVTEELWQQIGQTGSVHHTTWPTFDPKATIADEVEVVVQVNGKLRSKIMVS
FT                   SSATREAQQEIALADEKIKGLIEGKTIVKVISVPKKLVNIVVKG"
FT   CDS             complement(691412..691909)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08650"
FT                   /product="Peptidase propeptide and YPEB domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05882"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI03"
FT                   /protein_id="CBL05882.1"
FT                   /translation="MDNRTEQQIEQHDVKVEKSGIISKEQAEIIVLENADMEAKDISGL
FT                   KTKIENYYGKDIYDIEFYADNKEYNYNVDMYGGEILAMDYEIDKKYYAKLSGKPIDEAG
FT                   AIELVKAQIPNCTTGDINLKLEHDDDYLQYEGRAQVNGVLYEFTIDKNTGTFVEWKWKN
FT                   HK"
FT   CDS             complement(692726..694720)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08670"
FT                   /product="ferrous iron transporter FeoB"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05883"
FT                   /db_xref="GOA:D4KI04"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011619"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI04"
FT                   /protein_id="CBL05883.1"
FT                   /translation="MSKDVHVAFIGNPNCGKTTLFNAYTGAHLKVANWPGVTVEKKEGV
FT                   MQFHNENYKLVDLPGIYSLTSYTMEEQVSRQYILDDEVDIVVDVADASSLERNLYLALQ
FT                   LIELGKPMVLALNMMDIVEERGMDIDFHRLPEMLGIPVVPVSARKKRGLEILMHAVAHH
FT                   QGEKIKDKIEHHHGEEILNRKHRHNHHKDCVVVYSDEIEDKIDIIEEALVEKYGQLPNL
FT                   RWHAIKELVQDKEIIEKYPLDLPDVLDRSYEKDIIKQKYDFIEEIIQEVLVNKDKEARS
FT                   TDRIDAVLTDNVWGIPIFLAIMAFIFFLTFTIGDIFKNYLVEGIDIVSNDLMAILNSID
FT                   VSPIISSLLIDGAIAGIGGILAFLPNIFILFLALAVLEDSGYMSRVAYVMDSVMGKIGL
FT                   SGRAFIPLLLGFGCSVPAIMASRALEDPKDRLRTILVTPFMSCSARLPIYILFSGMFFP
FT                   EYAMFVAFSMYVIGIVMAIIIAKIFYKVSDKSDKKVLLIELPEYKSPNIMSIFLYAWEK
FT                   VKSYLAKAGTTIFVASIVIWFILNFNFSGMVDIGDSFGAQIGRLIAPILVPAGLGLWQI
FT                   AVALISGIAAKEVVVASLSVLYGILNINSAEGMNTLVGQLAQVGFHELNAYVLMVFCLL
FT                   YTPCIASIVTIKKKLILQNGLVLQYFSNY"
FT   CDS             complement(695063..695248)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05884"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI05"
FT                   /protein_id="CBL05884.1"
FT                   /translation="MAPDRNNPPKFCPECGNRLNGANQSEYQQYNQYTNEQDAEYTESK
FT                   SGKIIDITPPKDKDKF"
FT   CDS             complement(695191..695799)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05885"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI06"
FT                   /protein_id="CBL05885.1"
FT                   /translation="MNFKKILAIVMVGVFAFSGIGMAKAKSGGGGFKAPASTTKSVTPS
FT                   TKSTTTTTPKTDAPKTNATEAPKSNATTNNASTNTANKTNTTTNTANNQQSGSRWGSAL
FT                   RNIGLFAGGMFLGSMLSNMFGLGGFMGDILGLIANVVLIGIVVMIIMAIYRKLFGKKMK
FT                   LMLMLAVDMMKIISVALIVDGWHQIEIILQNSALNVETV"
FT   CDS             complement(695936..696187)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08710"
FT                   /product="pro-sigmaK processing inhibitor BofA"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05886"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI07"
FT                   /protein_id="CBL05886.1"
FT                   /translation="MVESTLVIAFFVGLLILCVFTKIFSMPLKILWNCIYNSIIGAIVL
FT                   YIINFLGFVYIPINFITALIAGIFGVPGVLVLAIYSML"
FT   CDS             complement(696216..696812)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08720"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05887"
FT                   /db_xref="GOA:D4KI08"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI08"
FT                   /protein_id="CBL05887.1"
FT                   /translation="MRYIEPMAKLIEHFRTLPGIGSKTAVRLAYHILDMEPAQAKALAQ
FT                   AIIEAKEKIGFCSCCFNLSDTDPCAICTSSNRDHSIICVVEHPKDVVAMERMRDYKGVY
FT                   HVLHGALSPIEGVGPEDIHIKELLNRLYDDKVKEVIMATNPNIEGEATAMYIAKLLKPL
FT                   GIKVTRIAHGLPVGGDLEYADEVTLAKAIENRREM"
FT   CDS             complement(696812..697066)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08730"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05888"
FT                   /db_xref="GOA:D4KI09"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI09"
FT                   /protein_id="CBL05888.1"
FT                   /translation="MQDELKKKTVEVSVGGGVVKVVMNGEKQMQSLVIDKAAVDPEDVE
FT                   MLQDLILSAVNQAMVKVDEMMASEMSKLTSGLNLPAGLF"
FT   CDS             complement(697206..698000)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05889"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI10"
FT                   /protein_id="CBL05889.1"
FT                   /translation="MMNNIPAVNNKGASEAKIMALEQTVSRLDRIVKALSSQLANMQEQ
FT                   YKSTSMTNTPMMNTFVEPRQNTVKRASKIVKNEPVHTNIMPMENADATAIWQNVLAGLN
FT                   ARRKKVVVACVNRALPYRIADNQFFIHFDSPFLQARTEKDDYRLLIEEVLENVTGHNLR
FT                   LVCTCGDLKITQMPQVNTTLNNNVDKIQEIKAPKVTIPMIEDEDVLPQGDYQADIPMPT
FT                   DEDYVDIAPTDVDYDNMTPEGKHTLQTAIEIFGGKIIPEDNK"
FT   CDS             complement(698116..699120)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08750"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05890"
FT                   /db_xref="GOA:D4KI11"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI11"
FT                   /protein_id="CBL05890.1"
FT                   /translation="MAYMALYRKWRPQDFSDLIGQEHISETLSNAISTGKVAHAYLFSG
FT                   PRGTGKTSTAKILAKALNCEHGPTPTPCNQCVCCQKINDGSFMDVFEIDAASNRGIDEI
FT                   RDLRETVKFAPVDGKYKVYIIDEVHMLTTEAFNALLKTLEEPPSHVVFILATTEVHKVP
FT                   ITIQSRCQRYDFKRITKDDILKRLVMITDEMGLNADKDALSIIAIQADGGMRDALSLLD
FT                   QCLAFTKDELTVTQVRKVLGLVGHDWVWQITDALAKKDSQTILTILDEVIAQGKEIKQL
FT                   LNELVLHFRSIMLYKASNKLLNLNMYFEDEEVLSRQAKEFTHDQIMQIIQKNT"
FT   misc_RNA        complement(699177..699279)
FT                   /locus_tag="MHY_29820"
FT                   /product="Bacterial signal recognition particle RNA"
FT   gap             699417..699761
FT                   /estimated_length=345
FT   CDS             complement(700030..701004)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08760"
FT                   /product="porphobilinogen synthase"
FT                   /function="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05891"
FT                   /db_xref="GOA:D4KI12"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI12"
FT                   /protein_id="CBL05891.1"
FT                   /translation="MKLNTLRPRRLRLNSAVRDMVRENSLSVKDLIYPIFVVAGENVKE
FT                   EIPSMPDVYHLSVDNAVKVAKEVYELGIPAIEVFGLPEYKDEIGSSAWDLNSPVQRAMR
FT                   AIKEAVPNLVIVGDVCLCQYTTHGHCGQLCGHEVDNDATLKLLAKVAVSQAQSGADIIA
FT                   PSDMMDGRIAVIREALDETGFKNVSIMSYAVKYASGYYGPFRDAADSAPQFGDRRAYQM
FT                   DPANSREAMKEVELDMEEGADFIMVKPALCYLDIVRQVRDKIDRPIAVYNVSGEYSMVK
FT                   AAAQNGWIDEKRIVMETLLSMKRAGADIIITYHAIDVAKWLKG"
FT   CDS             complement(701011..701433)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08770"
FT                   /product="Uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05892"
FT                   /db_xref="GOA:D4KI13"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI13"
FT                   /protein_id="CBL05892.1"
FT                   /translation="MFMAEGILNVLKDDIKEGTKVLIPRAQKAREALPIGLRQLGAVVD
FT                   VAETYTTKMADTNKEEIKALLKEHKVDMVTFTSSSTVENLLKLIDEDKSLLDNVAKASI
FT                   GPITANTCKKHGLIVDVEADVYTIDGLVAKIKNFGW"
FT   CDS             complement(701846..702520)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08790"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05893"
FT                   /db_xref="GOA:D4KI14"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI14"
FT                   /protein_id="CBL05893.1"
FT                   /translation="MNGMVYLVGAGPGDYRLITLKGKECLEKADVVICDYLADKRLMAF
FT                   AKDDIEYIYVGKKAGNHAMRQEDISQLIADKAKEGKCVVRLKGGDPFVFGRGGEEAEVL
FT                   KKNNVAFEIVPGISSAIAAPAYAGIPVTNRKVAVSFAVITGHEDPTKGKSDINWEKLAT
FT                   AVDTLVFLMGVGNLPHITSQLIKYGRSADTPAALVRWGTKAEQEVLVTTVGNAVEDVKN
FT                   II"
FT   CDS             complement(703511..704788)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08810"
FT                   /product="glutamyl-tRNA reductase"
FT                   /function="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05894"
FT                   /db_xref="GOA:D4KI15"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI15"
FT                   /protein_id="CBL05894.1"
FT                   /translation="MQLVVLGLNHKTVSVEVRERFAISVDNINKGLRHLDNYNGISEVV
FT                   ILSTCNRTEIYAVVDDANENMQDVKEFFFTLAGSDDAKDEYFYYHVDKDCIRHLFAVAS
FT                   SLDSLIIGEGQILSQVKKAYSMAREAQATSTILNTLFHRAITTGKRVRTETRIAYNAVS
FT                   VSYAAVQLALKIFGSLEHSNTLIYGAGQMAELTARNLMGKGAKKIYVANRHFDKAQELA
FT                   SQFGGEAVGFRDALRKANDVDIVVTSTGAPHYVVKPWETQLFMSKRKGRPLVIIDIAVP
FT                   RDVDPDVAEIKGVELYNIDDLEAVVEDNIKEREYEAYQAQKIIDEEVNSILERFQYLSC
FT                   QPVMARLSTKAERIRRREVKRAMTKLGDLTESQVREIEHMSHMIVRKLLREPMIKLNSF
FT                   AGTQQEDYYVNAVTKLFKIDVLKERE"
FT   CDS             705717..706091
FT                   /transl_table=11
FT                   /locus_tag="MHY_08840"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05895"
FT                   /db_xref="GOA:D4KI16"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI16"
FT                   /protein_id="CBL05895.1"
FT                   /translation="MKTIALIAHDQKKEEMLEFVGNHLDVLKQFHLVATRTTGTLINEK
FT                   YNLNVETMMSGPLGGDQQIGAMVATEKVDYVIFMRDPLNAQPHEPDINALLRICDVHNI
FT                   PLATNRRSGHILIKYAGEKL"
FT   gap             706121..707279
FT                   /estimated_length=1159
FT   CDS             complement(707304..708008)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08850"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05896"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI17"
FT                   /protein_id="CBL05896.1"
FT                   /translation="MRKFSLVGLVMALCILFSCSLVQAQDLRTISVDGSSTIKVAPDKA
FT                   TISISIENTAKDAKLASAQNAQIMQNIQSAILGLAITKDKMQTTNYNLYPVYNTKDNSR
FT                   EIIGYSVSNEITVTIDNIDMVGTVIDTAINAGASNVNSIEFGLKDSQVYKDKVLQQAIA
FT                   DAKRKAQVVANSLGKSIVNVVSVNTGSTYIEAKNFNNAMYMRAADATGATSPIQSGDIS
FT                   VRANVSVVFEMN"
FT   CDS             complement(709271..709747)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08890"
FT                   /product="Phosphoglycerol transferase and related proteins,
FT                   alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05897"
FT                   /db_xref="GOA:D4KI18"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI18"
FT                   /protein_id="CBL05897.1"
FT                   /translation="MASDFINKVKAKYPDSLFIFVGDHADRYNIDKVPTMYERYSVPLI
FT                   ITGKGIQKDLLPEDMAGSQIDIMPTVIDLIAPEGFTYYSVGKSLSENKLGQSYAFWITA
FT                   DAIGNTDDLVEKPQYFNREVLPDRTVLENYINGVRAISWWLGKYGTIIDEALLQ"
FT   CDS             complement(709783..711129)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08900"
FT                   /product="Phosphoglycerol transferase and related proteins,
FT                   alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05898"
FT                   /db_xref="GOA:D4KI19"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI19"
FT                   /protein_id="CBL05898.1"
FT                   /translation="MHEYIAVDSDFSLIFTAIYSGAKLSLQTAGVLTLCMLISLVAEGF
FT                   SKRLRWFRQVCSFCVLFITTLLFIARFPFYQQFHSGFNQMIFTAMHEDVYALFISLIEE
FT                   FHLPLKLCIVVLLVCVLNYIFNKFIDKKWGFFKWSKLKSKYRLIILLIGVYLLATLSLY
FT                   GGGWSWKSGVNWENAGITNDTFLNESILDDYQSIYRAYANQMRMEACNGLSFSAQNVRD
FT                   LAKSLTNKDGGNDLSIYLAKEATGAKIEKPKHIFVIVSESYANWPLLDKYSNLHIADNM
FT                   KKIIAEDDTIYTSHMLPSGSSTVGALMTMVTGMANSNLYLTTMPEALANPYITATAPQM
FT                   KNLGYETSFWYAGPATWENIQEFTLAQGFDNFYSRGNIDPNATGSVWGADDEYLYDAIF
FT                   KQIDDNKMTFSVILNTSNHSPFNIDLEKVGFDASKVVEGLPDKEKIIKN"
FT   CDS             complement(711444..712019)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08910"
FT                   /product="Protein of unknown function (DUF3221)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05899"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR021598"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI20"
FT                   /protein_id="CBL05899.1"
FT                   /translation="MEVEFTMKKIRVLLMMVLCLAFASTAAFASSAVDQVRSLHGHIIE
FT                   ISGNMVTIEGENPQDVVAVHLNWDTEIVNGRNGNDVDFNRLEVGDELTAYYSASATRSL
FT                   PPQSRAYALVMGNGEHDAIYMQVAEVNKVKNGVEVLNSNEDTLVTIPTKVEDDANELRA
FT                   GDRILVWYDFVAMSMPGKATATKAEILD"
FT   CDS             complement(712218..712550)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08920"
FT                   /product="Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05900"
FT                   /db_xref="GOA:D4KI21"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI21"
FT                   /protein_id="CBL05900.1"
FT                   /translation="MNLEVIHHVAIIVSDYAKSRHFYVDLLGFEVIREHHREDRNDYKL
FT                   DLKLGSCELEIFGKADAPKRVNNPEACGLRHLAFKVECIEKTVAELEKLGIECEPIRWD
FT                   DFTQKK"
FT   CDS             complement(712562..713164)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08930"
FT                   /product="Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05901"
FT                   /db_xref="GOA:D4KI22"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI22"
FT                   /protein_id="CBL05901.1"
FT                   /translation="MVVLMSLSSWDQVGLQGSPFVQIFSNIGIPAAANILNFVVLVAAL
FT                   SAYNGILYGTSRMLYGLAKEGNAPKIFASLSRTGIPMVGILVSAVIGIILVIMTYYFPK
FT                   ELFMYLLSIVVAGLIISWFIITITHMKFRLKFTRENRLDELKFKSLFYPYTNYFCILFL
FT                   IAVVVIMTQIPDMLISIIVLPIWVIFIYMTYLFKKKD"
FT   CDS             complement(713206..713862)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08940"
FT                   /product="Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05902"
FT                   /db_xref="GOA:D4KI23"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI23"
FT                   /protein_id="CBL05902.1"
FT                   /translation="MQMIALGASVGTGLFYGSAPTIKLVGPGIILSYLLAGIFIFFVMR
FT                   MLGEMSVREPVSGSFSYFADKYWHRFAGYLAGWNYWFLYMIAGMAELSATATYVNFWLP
FT                   DFPQWLTILICILLIITVNLINVSFYGESEYWASFIKITAICCMIVLGLYLIFTTMGPF
FT                   PQNFSNLWVNGGFFPNGAWGFAASLAVVMFSFGGVDLIGITAGEAENPEKLYQKL"
FT   CDS             complement(714101..715450)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08960"
FT                   /product="Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05903"
FT                   /db_xref="GOA:D4KI24"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI24"
FT                   /protein_id="CBL05903.1"
FT                   /translation="MSDENNKMKRGLKNRHMQMIALGTSIGTGLFYGSAPTIKLVGPGI
FT                   ILSYTLAGVFIFCIMRMVGEMSVREPVSGSFVYFANKYLGPFAGYLAGWNYWFLYLLVC
FT                   FAELSAIAIYVNYWLPDVPHWITVLVCIVVVTTVNLINVKTFGEAEFWASFIKILAICC
FT                   MIVFGFYLIFTTMGPFPDNFSNLWNNGGFFPNGAWGFAQSLAVVMFSFGGVELIGIAAG
FT                   EAENPEKTLPRAINEVLLRILIFYIGTMVVLMTLAPWDEVGLNASPFVQIFSNIGIPAA
FT                   ANILNFVVIVAALSVYNSSLYSTSRILHNLAQNGNAPKMFASLSRRGIPMVGILVSTAI
FT                   SLLLVILTYILPEKVFMYLLSTVVAALVITWATIAITHMKFRMKFIQENRLDELHFKAF
FT                   LFPYINYFCFIFLAAIVVIMFFMEDMRISLGALVVWVAFIYITYKLRAKV"
FT   CDS             complement(715834..716658)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08980"
FT                   /product="Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05904"
FT                   /db_xref="GOA:D4KI25"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI25"
FT                   /protein_id="CBL05904.1"
FT                   /translation="MSAKVFLGFGIGIILGLIFQKDILWLQPIGDLFLKLIKMIVVPVV
FT                   FLSIISGISSIGDIGKLKRIGTKVVGFYIVTTVLSAIIGLIVAHIMKPGADFAVSQIVD
FT                   TGEVIKPAEPMTVSQTILSMVPDNPITALATGNLMQIIVFGVFIGIAITILGDRVKNVK
FT                   KVIDEANIIMFKITDMVMQVTPFGVTALVACSVGEYGLSIFNILGKFILTHYIGAFSVV
FT                   LFMYVFIIKYIAKISLKDFFTKITEVWLVAFSTTSSSGTLPVSLHVTEENLK"
FT   CDS             complement(716924..717400)
FT                   /transl_table=11
FT                   /locus_tag="MHY_08990"
FT                   /product="Cytosine/adenosine deaminases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_08990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05905"
FT                   /db_xref="GOA:D4KI26"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI26"
FT                   /protein_id="CBL05905.1"
FT                   /translation="MDHLFYLRKAIEVSKKSREHGNTPFGAILVDGEGNILLEQENIEI
FT                   TESNCSGHAETSLMIKASKKYSKDFLWNCTLYSTAEPCAMCAGAIYWGNVGKVVYGISE
FT                   KRLLELTGDDEQNPTFDLPCREVFARGQKDIKVEGPFPEVENEVVEVHKDYWNK"
FT   CDS             complement(717427..718173)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09000"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05906"
FT                   /db_xref="GOA:D4KI27"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI27"
FT                   /protein_id="CBL05906.1"
FT                   /translation="MKFCKVKEQALSQLTKQSILQYIQSMDLSISNKLPREELLAQELG
FT                   VSRITVRSALNELASEGIIFRKQGKGTFVNQQALGMNVVFNPIGDLRDVIANSGYEVKT
FT                   EVLSTNRRLATDDEAKKLQLDNNEEVFIVERMFYANEMPAIYCVDRIPVKIVKENFLQN
FT                   CLDVSIYKYFSKFLKRTIIWDKVELSTITNQELSSLTDYFKCEQITSFLNCDIINFDNN
FT                   DEPVFYANEYVDTKFIHYQLIRQKKY"
FT   CDS             complement(718267..719493)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09010"
FT                   /product="uracil-xanthine permease/xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05907"
FT                   /db_xref="GOA:D4KI28"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI28"
FT                   /protein_id="CBL05907.1"
FT                   /translation="MYSAAVIVPIILANALQLSNLDLAFLISADLFTCGIATFLQSFGI
FT                   GRFIGIKLPVVLGCAVITLGPMISIGKTGGMTVLYGAILLSSVLVFACSFFINKIIKFF
FT                   PPIVIGSLVTIIGFSLVPLALQDMAGGIGSENFGDPINYLVAIFVLIIILLINRFCKGF
FT                   AKSIAILVGLILGTIFASFFGMVDLSHLNDADWFKLIHPLHFGVPEFTFNSVVVMSIFL
FT                   VISVAESVGIFYMIADICEVKITPKDIANGIRAEGCAQFLGGLFNSFPYVTFSENAGLM
FT                   TVTGVRNRFVLVAAAIILVILGLVPKFAMLTTLIPHPVLGGAMICLFGTIGANGIKILS
FT                   SVDFKKNENIIIVACSIGIGLGTTVTPGLFNEMPEILKMLLENGIFTGTVTAIILNTLF
FT                   NYSEIFKTK"
FT   CDS             complement(719705..720007)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05908"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI29"
FT                   /protein_id="CBL05908.1"
FT                   /translation="MHLNKICPVCHQSFEARRKDQVYCTYYCRKKHHKETYYSKNRIVE
FT                   DFNDEDTHVILRQFRCKKCHELVTVVNKHDRRTIFCSPRCEKLYWKHPKKIINKN"
FT   CDS             complement(720008..720502)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05909"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI30"
FT                   /protein_id="CBL05909.1"
FT                   /translation="MDIIKDNIGIIGVFFVVIIGVGIFFLSKPAKPVEAQSNKMIGETN
FT                   IGTVYIDTDTIETVKKDGHFYLIVSAEEHYKESDFLTELRKGEDLKDTISSLTLYMFTN
FT                   DGRYYCMPQRYLIDSQGKVCGDLGSSMQLQMIDDEIIFKIYTNALKTLEDKNRFRKMME
FT                   K"
FT   CDS             complement(720517..720939)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05910"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI31"
FT                   /protein_id="CBL05910.1"
FT                   /translation="MKKVIFIVTLIMMMAFSGLCFAADGNDLNKEQKVAETFMEVFTKD
FT                   QIPAYDVVSKDFSDTLKTNVNEKAYKDLSKQIKEQYGNVKEVKFYNFQRFDQGDRVTYV
FT                   AAFDKEQAVAIMLAFDKDKKLTDYVFTPLQVEEASK"
FT   CDS             complement(725774..726142)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05911"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI32"
FT                   /protein_id="CBL05911.1"
FT                   /translation="MASNKKAQILAAVMCASSIFGSYTMVSAESSISGNNSSVVAGNGT
FT                   ITATAENGSNQTSKITLNGNSLSIDLAKNNNVYDGTFSLNSKYLNVNKYNGTVTVKGTT
FT                   YTSDLANNGLTIKIVVLH"
FT   CDS             complement(727233..727655)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05912"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI33"
FT                   /protein_id="CBL05912.1"
FT                   /translation="MMVIALCIFALTANSFSMAEASALYTPASYWNNDTNYPLAFSQNG
FT                   VNRYVDLSSAKIIEQEEKVEENTKTAVFSYDVVMVDGDKTTKFTYKTMIRFINDEMYVA
FT                   SARGNGDGWFQLSSRSFDQPQYNATLILADYFGINK"
FT   tRNA            complement(727813..727902)
FT                   /locus_tag="MHY_T_29710"
FT   tRNA            complement(727950..728025)
FT                   /locus_tag="MHY_T_29700"
FT   tRNA            complement(728033..728109)
FT                   /locus_tag="MHY_T_29690"
FT   CDS             complement(728119..728364)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09100"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05913"
FT                   /db_xref="GOA:D4KI34"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI34"
FT                   /protein_id="CBL05913.1"
FT                   /translation="MRKFKLKTGYSIHQYILNKRLIVAKEKIKSGIALTQICFDCGFKD
FT                   YSTFSRTFKQIFKQTPREFKKALNEKTDIYEPLGSL"
FT   CDS             complement(728379..728657)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05914"
FT                   /db_xref="GOA:D4KI35"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI35"
FT                   /protein_id="CBL05914.1"
FT                   /translation="MNLDNINENDILKQIQILENSFNDKGFAHELYSNLKFLEFMILIN
FT                   RAIINDNKNLTIHHKVSYDKTINSVIDYINEHLFTELNIDYLANHFL"
FT   CDS             complement(728717..729019)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09120"
FT                   /product="Cupin domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05915"
FT                   /db_xref="GOA:D4KI36"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI36"
FT                   /protein_id="CBL05915.1"
FT                   /translation="MKRGIAMEYQKKGYLTSYFKLFHLKDVQKIEIKAHYHEFDKIILF
FT                   LSGKVKYNIEGQTYQLFPYDIVFVPHNCIHYPTISDITTYERIVLYIDPNYLKIK"
FT   CDS             729221..729484
FT                   /transl_table=11
FT                   /locus_tag="MHY_09130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05916"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI37"
FT                   /protein_id="CBL05916.1"
FT                   /translation="MSLVMKKYRYNHKDYLVYERNLLAREFDANEWQTICNNDLGVGAD
FT                   FIIEIVNTQIFAYDMYGQKIDLNQDLQLVIDYHEGILKIIIF"
FT   CDS             729700..730080
FT                   /transl_table=11
FT                   /locus_tag="MHY_09140"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05917"
FT                   /db_xref="GOA:D4KI38"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI38"
FT                   /protein_id="CBL05917.1"
FT                   /translation="MKNASLEERFLSTKGRINRKIFILYAVCFILFCLFLIIPTFLVII
FT                   STTDGTVVDISISIVSTLIELALLPSLFLGIKRLHDLDKSAVWIILCVIPLINMLFLAY
FT                   LCLIKGTDGDNKYGKDPLSLDL"
FT   CDS             730091..730357
FT                   /transl_table=11
FT                   /locus_tag="MHY_09150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05918"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI39"
FT                   /protein_id="CBL05918.1"
FT                   /translation="MNLEEKYFSTEGRLNRKPFIHYIIFLIVISLAFIGIITLLGLASA
FT                   LSIAILGENVNDLNVLSQIEVIPILLILVASLILIILFLPLNF"
FT   CDS             complement(730510..730635)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05919"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI40"
FT                   /protein_id="CBL05919.1"
FT                   /translation="MQTQTNFIYFFRVESLLYSIFLNKKFLLMIKAVMYLNITAF"
FT   CDS             complement(730635..731411)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09170"
FT                   /product="Uncharacterized paraquat-inducible protein B"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05920"
FT                   /db_xref="InterPro:IPR024906"
FT                   /db_xref="InterPro:IPR024910"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI41"
FT                   /protein_id="CBL05920.1"
FT                   /translation="MVVYSLAAPRRTTADGTMYSSVLKTVDKPFTAKTLNLKTNELTEA
FT                   TLPPATPEEVEATIKVMGGEDWADWMHALKAADVLTENACTVAYSYIGSKITYPIYYEG
FT                   TIGAAKQHLYKTAETLRQEGFNAIISVNKALVTQSSSAIPIVPLYVAVMYRVMKDKNVH
FT                   EGTIEQMYRLWHEYLSQPQPKVDDEHRIRIDDLEMRDDVQNTIFEYWDKVTTENLTQYA
FT                   DVDGYWNDFYNLFGFGFDNVDYDADVNPEVNLDLVE"
FT   CDS             complement(731477..731803)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09180"
FT                   /product="Uncharacterized paraquat-inducible protein B"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05921"
FT                   /db_xref="GOA:D4KI42"
FT                   /db_xref="InterPro:IPR010758"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI42"
FT                   /protein_id="CBL05921.1"
FT                   /translation="MIIKPRVKDFICLTSHPEGCKENVRRQIEYVKSQPKVELGKRVLV
FT                   LGASTGYGLASRICATYASGASTIGVIFDKSAHGKRTATAGWYNTAAFEEFAKMMAIML
FT                   NNKW"
FT   CDS             complement(732093..732695)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09190"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05922"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI43"
FT                   /protein_id="CBL05922.1"
FT                   /translation="MAATLLQIKSKILLPDTKVEEVNEDDTDEVDPRKELVERLLEYRR
FT                   YKEVSSILGEMADEAGKRFFREASNLPTKHLPPKGLDVKLLWQAFQNVLESQIENEPLV
FT                   ANVAREKYTIEDKIISLLALLKQHGGNICFNIVFQYSEHKISKSELITTFLAMLELVKI
FT                   KRITVYQTSIFSPIYLKINDEVESSDNDIIVDNTENN"
FT   CDS             complement(732893..733519)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09200"
FT                   /product="Zn-dependent proteases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05923"
FT                   /db_xref="GOA:D4KI44"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI44"
FT                   /protein_id="CBL05923.1"
FT                   /translation="MFGFGPDMIYAIPGLLIALTVHEYAHAKVADNLGDFTPRMNGRLT
FT                   LNPVAHIDPIGLIMLFFAQIGWAKPVPINLNNFDDWRKGEMQVSLAGPLANLITAFVAS
FT                   IFFALCFKYSFAPHWLIMVLQLIIIYNVNFAIFNLVPIPPLDGSKILSSLLPGRLAYKY
FT                   QSSVINRYSFFILIALVFTGILGFIIHPISNFIISILNLIISIII"
FT   CDS             complement(734005..734106)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05924"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI45"
FT                   /protein_id="CBL05924.1"
FT                   /translation="MYEDLIEEKVSSEDIFDGVLLHVKRDYVKITKW"
FT   CDS             734973..735743
FT                   /transl_table=11
FT                   /locus_tag="MHY_09240"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05925"
FT                   /db_xref="GOA:D4KI46"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI46"
FT                   /protein_id="CBL05925.1"
FT                   /translation="MGLNDPFLVQYGNWLLGVAQGDMGISYSAKKPVIDKLMEGFAGTV
FT                   LLALTTIILIIIISIPLGIFSATHRNRIPDFLVRIFSFIGVSMPSFWVGLILLYIFGLK
FT                   LGLFPIATASVTPSGLVLPALTLAIYQSAKYTRQVRTVILDELHQDYVIGARARGLSEK
FT                   AILWKHILPNAILPLITLLGMSIGWLLGGVAVIETVFAWPGMGRMAVYAITMRDYPLIE
FT                   GFVLWISIVYTVINFLVDLSYTYLDPRLKKGDSR"
FT   CDS             736416..736556
FT                   /transl_table=11
FT                   /locus_tag="MHY_09260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05926"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI47"
FT                   /protein_id="CBL05926.1"
FT                   /translation="MLNEGRQYIQTAPWLMIYPGLAIFIVVAIFNLWGDSLRDILDPRQ
FT                   D"
FT   CDS             736603..738171
FT                   /transl_table=11
FT                   /locus_tag="MHY_09270"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05927"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI48"
FT                   /protein_id="CBL05927.1"
FT                   /translation="MKKLWKAISLSLCGILTAGIIAGCGSENTVDKTTLKFGVTNFADT
FT                   LEPTQNYFGWVVMRYAIGECLAKFDEKMNVQPWLAESWSISDDHLTWTFKIRDNVKFSN
FT                   GNLVTAEAVKKSIERAFTKNTRAKTFFEYTEMKADGQNLIITTSKPQPNMPGFLADPLF
FT                   IIVDVSAEEQGRDFAKEGPICTGPYKVESFVKEKAVMVRNEYYWDGEVPFERVEIPSID
FT                   DPNTRAMALQSGEVNFAVNIAAGDIDLFRNNDKFYIDEISSLRTVLARINQKGILGDPK
FT                   VRAALISACDRENYNKILLKDTFITGKAPIPPSMDYGFDELTDPNAYNPERAKQLLAEA
FT                   GWNDSNGDGILDKDGKDLSLDFVVYNSRAELPLYAEAVQADAKKVGININIKSVDYNLI
FT                   DKMGIDGDYDLLISNITTANTGDPEIYLSWYWKTNVNGDNPQNGSGYSNREYDEILNQL
FT                   SVEFDKEKRRQLIIEAQQILLDDGAALFLGYPQTNIISTKGLDGVVMYPSDYYWLTNKI
FT                   KPAKA"
FT   CDS             738185..738271
FT                   /transl_table=11
FT                   /locus_tag="MHY_09280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05928"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI49"
FT                   /protein_id="CBL05928.1"
FT                   /translation="MLLDVSNLTIQYSKNIEATVKDINFSFG"
FT   CDS             739138..739599
FT                   /transl_table=11
FT                   /locus_tag="MHY_09300"
FT                   /product="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05929"
FT                   /db_xref="GOA:D4KI50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI50"
FT                   /protein_id="CBL05929.1"
FT                   /translation="MNMHVPTSGEVIFQDQDITKLTGEKRRQNCRHIQMVFQDPTAAFN
FT                   PKMKIGDIICEPLLNFNLIKKSQMKEKAQELLRLVELPDDFVYKYPNNMSGGQRQRVAI
FT                   ARALALEPEIIVCDEATSALDVSVQAKIIELLVKLQREKISPIFLFVMI"
FT   CDS             739635..739829
FT                   /transl_table=11
FT                   /locus_tag="MHY_09310"
FT                   /product="ABC-type oligopeptide transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05930"
FT                   /db_xref="GOA:D4KI51"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI51"
FT                   /protein_id="CBL05930.1"
FT                   /translation="MYLGNIVEKIDGDKLIEAKHPYTKALLKAVFSLDNEQNKNIETLS
FT                   GDIPSPLDLPKRLSISKSL"
FT   CDS             740029..741147
FT                   /transl_table=11
FT                   /locus_tag="MHY_09320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05931"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI52"
FT                   /protein_id="CBL05931.1"
FT                   /translation="MRKKLLTKLLMATILSTTISTGVAFAETHTEDIDKTNNKIVEEQQ
FT                   KSIINKEKQDILTIKGLSRYDIRHDNRPGKKGETRKSLWRTRLEPTINIDNGWKIKNRI
FT                   DYEQNYKAKGDDKSHFYNRMLYLQGPAFGGTISLGKVDYADFANMDIAYGMIFDDYIKG
FT                   IKYAYTDKDTKNIYTAMIGNFDSPYNDNVNGKMHYNGKQAYPENDAMHYVGLQAEMPIS
FT                   NKLMTGLAYHNIRSGELEDTQQILEVAGEYKLDNNFKLGGVYALSNLDANKYDLGNSAQ
FT                   EQAYIFQLNYKGAKRTIPNTYGLWVAYKNIGELATFLPTYTNSFTGEQGYELGARYIFA
FT                   KNLMGEVSYFNGNDIENDKTKTRWFGRLEYRF"
FT   CDS             741222..742481
FT                   /transl_table=11
FT                   /locus_tag="MHY_09330"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05932"
FT                   /db_xref="GOA:D4KI53"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI53"
FT                   /protein_id="CBL05932.1"
FT                   /translation="MLSTATQPLLGAVNTAVMGHMSEAFYIAAVSLGVILFNNIYWLFG
FT                   FLRVSTTSFSAQALGSESAKDKFLALARPLLIAIVISLIFLIIYPWIFKYYVLLMKPES
FT                   QVVELMKNYCDIIIWGAPFVLINYVTLGWLMGQMIIRYTMFMQISMNVLNIILSIVFVF
FT                   IMDMNIQGVAYASLIAQIYGCIVGFIAIYKRGNLIICSEYIQSLKTLQPFLAMMKVNVD
FT                   LMFRIVCLLTINNLFAIAGASMGTVTLASNAIILEIIFIVVYFIDGMANGVSVFSGKAK
FT                   GYKDINLLNSVLKISLRCLAVFIIFISVIMYITKSYFINMMTDLAIVANYANDYSIYLI
FT                   LHPICACVGLLLYGMYTGIGNTASIRNMMFVAVIFFYICQKILMSYLGNDGIWLTYNLT
FT                   YLLESIILILYLPSLKKYFN"
FT   CDS             complement(742536..743327)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09340"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05933"
FT                   /db_xref="GOA:D4KI54"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI54"
FT                   /protein_id="CBL05933.1"
FT                   /translation="MMIKAIFFDIDGTLVSFKTHKIPESTIQALHTLKAKGIKLFIATG
FT                   RPPYDLKFLIDEFGDLFTGYITFNGQYCYDSTGKILHEEYLNREDLIQFTNYIKDKDIA
FT                   CGFMEIDYFYFNLYNDRLAKLKETLGDTAPDRAFDDVSRVSNHKTYQLNIFLNEDEEQE
FT                   VLPYLPNCKAVRWCPYFTDIIPKDGGKGTGIKKVLAYYGIDINEAMAFGDGGNDVEMLE
FT                   AVKYGIAMGNANDNLKQIADFITLDVDNDGIAYALKQYNVL"
FT   CDS             743458..743628
FT                   /transl_table=11
FT                   /locus_tag="MHY_09350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05934"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI55"
FT                   /protein_id="CBL05934.1"
FT                   /translation="MIFMNATLKNITAMLIFGSIGLFVRNIELASSQIALVRGFVGAFI
FT                   LFIAMVFLHKK"
FT   CDS             744867..745505
FT                   /transl_table=11
FT                   /locus_tag="MHY_09380"
FT                   /product="thiamine biosynthesis protein ThiF, family 2"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05935"
FT                   /db_xref="GOA:D4KI56"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR012729"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI56"
FT                   /protein_id="CBL05935.1"
FT                   /translation="MADILAKELIYQTLNDRHGIVNQEKLNNAKVAIAGLGGLGSNIAV
FT                   ALARIGVGHLHLIDFDKVDISNLNRQHYFISHLNKYKTQALAEQLQMINPYLNIVTDCI
FT                   KVTEDNIFSLFKDEDIICEAFDVPENKAMLVNKVLELFPEKYIISGSGMAGFGHSNEIH
FT                   TRKVMGKFYICGDEKTALSNENSLMAPRVAICAGHQANLITQLILENNL"
FT   CDS             745521..746279
FT                   /transl_table=11
FT                   /locus_tag="MHY_09390"
FT                   /product="thiazole-phosphate synthase"
FT                   /function="thiazole-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05936"
FT                   /db_xref="GOA:D4KI57"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI57"
FT                   /protein_id="CBL05936.1"
FT                   /translation="MWQLGKHQFNSRFILGSGKYSLELIQAAINEAKAEIVTLALRRVN
FT                   NGGMANILDYIPKDIALLPNTSGARNADEAIRIARLSKELCGSDLVKIEIMRDSKYLLP
FT                   DNYETIKATEVLAKEGFTVMPYMYPDLNVARDLVNAGASCVMPLGAPIGSNKGLCTKEF
FT                   IQILIDEIDLPIIVDAGIGRPSQACEAMEMGATAIMANTAIATAGDVVRMAKAFNYAIE
FT                   AGRLAYEAKLGRIKAQGASASSPLTGFLQD"
FT   CDS             746398..747534
FT                   /transl_table=11
FT                   /locus_tag="MHY_09400"
FT                   /product="tyrosine lyase ThiH"
FT                   /function="tyrosine lyase ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05937"
FT                   /db_xref="GOA:D4KI58"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI58"
FT                   /protein_id="CBL05937.1"
FT                   /translation="MAYLPDMEVIPSDILDKVIADMDSYDYDKYTAQDVQTALSHDHIT
FT                   PEDFRALLSPAALPFLEQIAQKAQKTTKRFFGNSIYMFTPIYIANYCENYCIYCGFNCH
FT                   NKIKRAKLNYDEIDKEMQEIAKSGLQEILILTGESRKQSSIEYIGEACKIAKKYFRVIG
FT                   LEIYPLNTDEYAYLQKCGADYVTVFQETYNSDKYETLHLAGHKRIFPYRFYAQERAIRG
FT                   GMRGVGFAALLGLDDFRKDALATGMHAYYLQQKYPHAEIAFSCPRLRPIINNDKINPKD
FT                   VHEAQLLQVICAYRLFMPSASITISTRECARVRDNLVNIATTKISAGVSTAIGEHSQES
FT                   EDKGDAQFEIADTRSVDEVYHDLIHNGLQPVMADYLYV"
FT   CDS             747614..747871
FT                   /transl_table=11
FT                   /locus_tag="MHY_09410"
FT                   /product="prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05938"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI59"
FT                   /protein_id="CBL05938.1"
FT                   /translation="MLAVNYSTIRNKLKNYCDEATDNNQTIIVTRKAEKNVVILSLEKY
FT                   NRLMKIVQNAEYLSMLDRGIKQLEAGKGQKHDLIEADIDE"
FT   CDS             747864..748124
FT                   /transl_table=11
FT                   /locus_tag="MHY_09420"
FT                   /product="toxin-antitoxin system, toxin component, Txe/YoeB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05939"
FT                   /db_xref="GOA:D4KI60"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI60"
FT                   /protein_id="CBL05939.1"
FT                   /translation="MNKLWSDRAWDDYLYWQFQDKKILKKINELVKDIERNGLSEGIGK
FT                   PEPLKYKNVWSRRIDKENRLVYNIVDGELWIIACRGHYISL"
FT   CDS             complement(748194..748340)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05940"
FT                   /db_xref="GOA:D4KI61"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI61"
FT                   /protein_id="CBL05940.1"
FT                   /translation="MMDGVKNAIFITTSTYNENALETARALNKNGFNINLWTTKDLLAF
FT                   INK"
FT   CDS             complement(748782..749318)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05941"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI62"
FT                   /protein_id="CBL05941.1"
FT                   /translation="MPESKKLLNKEIDAEFDERIKKDLNNISANPIFNPDVVVPLFKIG
FT                   LIYTQRGINNFADFSEQMIGKGGERIKPWIKPTWNMIASYQGNDLDEKILTASFRYVGY
FT                   KWEYEGKSLNEIKNDLEELIGKEQAKQYIKYIEIAYNGVQTYFAQKEEEINQYDNLKLI
FT                   KYWKNICKENKQLLS"
FT   CDS             complement(749624..749827)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05942"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI63"
FT                   /protein_id="CBL05942.1"
FT                   /translation="MEFIIGYIVVSIFAFIVGILLGQDIERGKYLEKIQAMKALVKRND
FT                   KILEAKEVDKQKRNIKFIRIYR"
FT   CDS             complement(750736..750972)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09480"
FT                   /product="Protein of unknown function (DUF1653)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05943"
FT                   /db_xref="InterPro:IPR023387"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI64"
FT                   /protein_id="CBL05943.1"
FT                   /translation="MRALPKSGEIWVHFKGEDKKYLIITVATHTETHKQFVVYKALYGD
FT                   FKDYIRPLDMFMSEVDRQKYPDVSQKYRFEKLI"
FT   CDS             complement(751003..751623)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09490"
FT                   /product="N-acetylmuramoyl-L-alanine amidase."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05944"
FT                   /db_xref="GOA:D4KI65"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI65"
FT                   /protein_id="CBL05944.1"
FT                   /translation="MNRRDFIIKGLKLGGALLAGANISTFLNSIANINNNVAKAADYTL
FT                   YASDLPIVENYFNFTSLSTRPRTSQIIVHHSAIGGNDDITAADIHRIHLQNGWSGIGYH
FT                   MFIRKSGLIETGRPLEDIGAHTYQHNNSSIGICLSGNFNDEMPTDMQIASASKLIGLLC
FT                   QMYSLSPNENTVFGHRDFNATACPGENLYADLYHLRHMASNFI"
FT   CDS             751938..753944
FT                   /transl_table=11
FT                   /locus_tag="MHY_09500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05945"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI66"
FT                   /protein_id="CBL05945.1"
FT                   /translation="MAHRKTKQHTVNVVKAQFCAPENISYLDLFEGFNELYTINIATNI
FT                   DFLANLLELFTKVEIIFGNLALVPSTLENIFAMQRNTLQELYKTEHYTNFKEKYTQGNL
FT                   NIYLADAPLYPEKLFCLKNTQTGATRVILGSNNLDQLPANSDRNQALVYFDDENAFNYY
FT                   MNIYNDFKQNNSEIVNENAWEITYEDTQMLENLPILHKAKQDSEHIYPAVSKTTIVKTA
FT                   EYLSDIERLAKDFVDIPKAERKGQAKITNDKIDTIKRKTLENIQVRRAKFEKFMPQLVI
FT                   EPERNRAFYNEREFNFRPYRGDVKRDAETYLQYMEGFNTAVPAKNIEPLKFEYFKLMSW
FT                   CFLSPFLARVRTTIREATVTDEVFTYPIVALLCGQSNAGKTIYASLLMKMMTDSALYKA
FT                   FGQNNFTKTRIDSLLCDIKGLPILIDDITQTQFTNNSGNIIKQEERIIRETKPENLNYY
FT                   SAILLTANKDLNSLKNELTKRMVVFHVNASWNNEFTRQQKSPCSELIQKMRNNFYSAYL
FT                   AKIIPHINLYLSQINDLGSSSIDLYNISSEVIISIFKECGLDIPSYMRPLTMKDYFDSR
FT                   AVNEIMIKFFQRQYRLNRDFFEVNKKNNQLIFEDKSLSSVGKMTPMRIAESLPPELEAD
FT                   VVGDKVIMRLDSATKFFSTEFKEQGLLNKLFGR"
FT   CDS             755662..755928
FT                   /transl_table=11
FT                   /locus_tag="MHY_09520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05946"
FT                   /db_xref="InterPro:IPR023811"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI67"
FT                   /protein_id="CBL05946.1"
FT                   /translation="MAKRPKIKITLVDRKGPCGCHRGHKIGDSFDFDTQRGELCPMAMH
FT                   VAFPYIDILRYGGSIPNQSEGTAVFCCPDVDTINVFRIEKEDI"
FT   gap             756448..756825
FT                   /estimated_length=378
FT   CDS             complement(758095..758589)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05947"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI68"
FT                   /protein_id="CBL05947.1"
FT                   /translation="MATKNIIEADAVNYYIYAMVLFIACRWLCTYLMKYFVPAKMMAIF
FT                   ALGGILCCLGTIYLPTSVSVYCLIAISGCMSLMFPTIYGIALRGLGAEVKFGAAGLIMA
FT                   ILGGAIITPIMGWLVDSSALSFMVSGFSASEAAIRTAFYLPVVCFAVVLGYSLAFRKTN
FT                   D"
FT   CDS             complement(758687..759439)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09550"
FT                   /product="Major Facilitator Superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05948"
FT                   /db_xref="GOA:D4KI69"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI69"
FT                   /protein_id="CBL05948.1"
FT                   /translation="MENNANTLSEKNVANNSSSIPVVPAQYRIYFFLLVSCFALWGLLN
FT                   NMTDNLVPSFAKIFMIKAVDSSLVQVAFYGAYAVLAMPAAFIIKKYSYRVGVLVGLGFY
FT                   MIGAFGYIPAAILQSYNLFLVSIFILAGGLSVLETTCNPFVLSLGAQETSVRRLNFAQA
FT                   FNPVGSMAGLFLAKYIILANLNPADLDDRLAMSPAELSAIRDTELFWVCVPYVGLILIA
FT                   FIIWVIFFRSKLNDKDGRVAMTVPQAFW"
FT   CDS             complement(759478..759927)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09560"
FT                   /product="Fucose dissimilation pathway protein FucU"
FT                   /EC_number="5.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05949"
FT                   /db_xref="GOA:D4KI70"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI70"
FT                   /protein_id="CBL05949.1"
FT                   /translation="MLKNIPKILSPELLKVLCEMGHSDRIVIADGNFPAESMGKNAIVI
FT                   RCDGHGVPELLDAILKVFPLDIYVDKPVNLMEVMPGDTVETPIWDTYKEIVAKHDERGA
FT                   NAIGNIERFAFYEEAKTAYAIIATSEKALYANIMLQKRCCSRLIM"
FT   CDS             complement(759921..761129)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09570"
FT                   /product="Sugar (pentulose and hexulose) kinases"
FT                   /EC_number="2.7.1.51"
FT                   /EC_number="2.7.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05950"
FT                   /db_xref="GOA:D4KI71"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI71"
FT                   /protein_id="CBL05950.1"
FT                   /translation="MAKLLENPVHYRDARTKGMMEKVFAKLDKDTVYSITGNQFMELNT
FT                   LFQLMALKENQPELLQKAETLLLMPDLLNYFLSNEKCTEYTIASTTQLLDAKNKTWSSE
FT                   IIENLDLPKNIFTKIVQPGTKIGKLSKQISEELGINEIDVIAVAGHDTQSAMVAVPTQE
FT                   DDFIFLSCGTWSLLGTELKTPIINETSASLNITNEGGADNKTSFLKNIIGLWLIQESRR
FT                   QWIREGKEYGFGELEQMASKVGMINSFIDTDNEEFIPAGNIPKRIQEYCKRTGQYVPQN
FT                   EAEIVRCIDQSLAVKYRFALEQIEMATGKKYDILNIIGGGIQSKLLCQLTADVCGRKVV
FT                   AGPVEATVMGNIALQLMALGEIKDIKEARKIIANSENVTVYEPQKDENWDEIYKNVKES
FT                   LLC"
FT   CDS             complement(761095..761397)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05951"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI72"
FT                   /protein_id="CBL05951.1"
FT                   /translation="MKKDVKVLALDFGASSGRAIIGSFDGEKISLKEIHRFTNDPVILL
FT                   DTMYWDVLRLFHDIKIGLIKAKQEGEIKSLGIDTWGVDFGLLNKDGKTFRKSCSL"
FT   CDS             complement(761641..762324)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09590"
FT                   /product="Ribulose-5-phosphate 4-epimerase and related
FT                   epimerases and aldolases"
FT                   /EC_number="4.1.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05952"
FT                   /db_xref="GOA:D4KI73"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI73"
FT                   /protein_id="CBL05952.1"
FT                   /translation="MAYEEIKEQICDICHKMWQLGWVAANDGNITVKLDDGTFLATPTG
FT                   ISKSFITPEKLVRINAEGEILEANEGYRPSSEIKMHLRCYADREDVGAVLHAHPPTATG
FT                   FAVAHVPLDRYDMIETVVALGSIPITPYGTPSTYEVPEAIAPYIQEHDAVLLENHGALT
FT                   VGSNLVEAYYKMETLELFAKINLNAYLLGGPKEISRENIDKLINLRSYYGVKGRHPGYK
FT                   HYKED"
FT   CDS             complement(762364..763851)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09600"
FT                   /product="L-fucose isomerase"
FT                   /function="L-fucose isomerase"
FT                   /EC_number="5.3.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05953"
FT                   /db_xref="GOA:D4KI74"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR005763"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR012888"
FT                   /db_xref="InterPro:IPR012889"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI74"
FT                   /protein_id="CBL05953.1"
FT                   /translation="MDMDPKTIKGVWGFNGTERPGAVYLASVLASHAQKGLPAFGIYGH
FT                   DVQNADATDIPEDVQEKLLRFGRAAVAVATMRGKSYLQIGSITMGIAGSIISPEFFEEY
FT                   LGMRVESVDEVEIIRRMTEGIYDHAEFEKALKWTKENCKQGFDKNPDFCRKTDAEKEEA
FT                   WEFVVKMMCIIKDLYNGNKNLPEGCEEEQLGHNAIAGGFQGQRQWTDFYPNCDFPEAMM
FT                   NSSFDWNGAREPYVLATENDTLNGVGMLFGKLLTNTAQIFADVRTYWSPEAVKQATGYE
FT                   LEGVAKESKGFIHLINSGAACIDACGEAKDENGNGVIKPFWEMTEKDQKACLDATEWCP
FT                   ADNGYFRGGGFSSRFLTNSEMPVTMVRLNLVKGLGPVLQIAEGWTVKLPDEVSDKLWKR
FT                   TDYTWPCTWFAPRLTGEGAFKSAYDVMNNWGANHGAISYGHIGADLITLCSMLRIPVCM
FT                   HNVPEDKIFRPAAWNAFGMDKEGQDYRACKNYGPLYK"
FT   CDS             complement(763899..764156)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09610"
FT                   /product="L-fucose isomerase and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05954"
FT                   /db_xref="GOA:D4KI75"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR012888"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI75"
FT                   /protein_id="CBL05954.1"
FT                   /translation="MATNRLIGDYPVIGIRPTIDGRRGVLKVRESLEEQTMGMAKAAAK
FT                   LFTENLKYSNGEPVKVVIADTTIGRVPEAAACAEKFKKKA"
FT   CDS             764375..765253
FT                   /transl_table=11
FT                   /locus_tag="MHY_09620"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05955"
FT                   /db_xref="GOA:D4KI76"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI76"
FT                   /protein_id="CBL05955.1"
FT                   /translation="MKHDSYNEQRERGNFSFPVEYHYVTNHHPRYNMPYHWHIQYEIIR
FT                   VLEGKIVISIDENEYTASAGDIIFITDGCVHGGKAFLENTIYECMVFDKKLFETNVGDK
FT                   NILQKFFEHHLIINSYFNNEYTDIHRTIWTIFDALKTKSSGYEFIVLGCLFNFFGLVLK
FT                   HNLYTKSFTNFISSNQKNIHKLKKAFHLIETSYSQPLTLEDLANTSGLSPKYFCRFFQS
FT                   MTNKTPIAYLNYYRIECACSKLISDKDQSITDIAYSCGFNDLSYFIKTFRKYKNTTPNK
FT                   YIKSYFELTNK"
FT   CDS             complement(765318..765548)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09630"
FT                   /product="RNA-binding protein Hfq"
FT                   /function="RNA-binding protein Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05956"
FT                   /db_xref="GOA:D4KI77"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI77"
FT                   /protein_id="CBL05956.1"
FT                   /translation="MFFLNQVRKENVGVIIHLTNGFQLRGNVKGFDNFTVILDSAGKQM
FT                   MVYKHAISTISPLQPLKNSFQDNKRTETVSE"
FT   CDS             complement(766403..766624)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09650"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05957"
FT                   /db_xref="GOA:D4KI78"
FT                   /db_xref="InterPro:IPR002627"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI78"
FT                   /protein_id="CBL05957.1"
FT                   /translation="MEKLKLIVILGPTAVGKTNLSIALAQKLSTEIISGDSMLVYKGFD
FT                   IGTAKPTLEEMKGIKHHIIDIFRALGKF"
FT   CDS             complement(766626..767303)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09660"
FT                   /product="Predicted Zn-dependent hydrolases of the
FT                   beta-lactamase fold"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05958"
FT                   /db_xref="GOA:D4KI79"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI79"
FT                   /protein_id="CBL05958.1"
FT                   /translation="MIKFKYYGHACFLLETDNEKLLFDPFLTGNPVASISADEVECDYI
FT                   LLTHAHGDHYGDATQIAQKTGAKVISTPEVLTKLPSDYVNVHGMNLGGSFTFPFGIVTM
FT                   VPALHSAGVEGGIPCGFVIKFNDDTVVYFAGDTALFSDMALIGEKQQIDYAILPIGSNY
FT                   TMDAKDAAKAVQLLNAKHAIPVHYNTWPVIAENPEAFKSYAESISHASVDIVPVGSSLD
FT                   LVK"
FT   CDS             complement(767325..769034)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09670"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05959"
FT                   /db_xref="GOA:D4KI80"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI80"
FT                   /protein_id="CBL05959.1"
FT                   /translation="MLKTLSIWNFALIEHVQIDFDKGLNILTGETGAGKSILLGALGMV
FT                   IGRRTNIDAIRSGCEFMRVEAVFTLDNNLVKDFLTKYNILVEDDDLIITRQININGKNS
FT                   VQINNCHTTMAILRQLGELLVDIHGQHANQALLKPIKQLSLIDMYDGDAIQKQKEVYLE
FT                   KYYQWLQIKQKLADSKINTQEMAQRLDMLKWQINEIENAKLTLDEDEKLESEIKVLANA
FT                   EKISLLTQDAYKLLYEGENGKFAILSSLSQVRKDLENLAQYDENMAKVHQILDEAYFQI
FT                   QDSADEIRNYGESIDYNPQKLDMMQSRLNDIDKLKRKYGNTIEEILNYLAKAKEELTYI
FT                   ENYDDNLAKLEQELSLLAKDVSQEALILHELRQKSAKALEMAIMKELASLSMADAKLVI
FT                   NLTLNDDDFTENGADDVEILFSANLGEDLKSLAKIVSGGELSRIALALKTITAKKDDID
FT                   LMVFDEVDTGVGGKTAQMMAEKIARIALYRQVICITHLPQIAAMADAHFYISKETKNNK
FT                   TFTTIDEINYDAKLAEIARMSSGIDLTQASLENAEEMLTNARKRKELLHFDE"
FT   CDS             complement(769049..769501)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09680"
FT                   /product="transcriptional regulator, ArgR family"
FT                   /function="transcriptional regulator, ArgR family"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05960"
FT                   /db_xref="GOA:D4KI81"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI81"
FT                   /protein_id="CBL05960.1"
FT                   /translation="MKATRHARIKEIIEHSVIETQEELANALREQHIVVTQATVSRDIK
FT                   ELMLIKVPTGDGRYRYAYPTDKELMYSKNRLLNLFRDSVVGLNFSENIIVVKTLPGAAN
FT                   AVASTLDYAKWPEIIGTVAGDDNIFIVVKPISAVEDIMKRLQDMLN"
FT   CDS             complement(769498..770088)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09690"
FT                   /product="Predicted S-adenosylmethionine-dependent
FT                   methyltransferase involved in cell envelope biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05961"
FT                   /db_xref="GOA:D4KI82"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI82"
FT                   /protein_id="CBL05961.1"
FT                   /translation="MQKLSNSIQLAHCLLKNRLNEAKIIVDATAGNGNDTLFLAQNTLN
FT                   NAQIYAFDIQKEAIENTKALLIKNKDNINLPLENISFIHDSHEHIDNYIQTKIDIAIFN
FT                   LGYLPGGDHKFTTKDDTTLKAIDKILNNLNINGYVAIVMYPGHEEGLKEYQSIKLFVKD
FT                   LPKKSFTVGWYKMINHNFNAPALCWIEKVGEYA"
FT   CDS             complement(770133..770987)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09700"
FT                   /product="Predicted sugar kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05962"
FT                   /db_xref="GOA:D4KI83"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI83"
FT                   /protein_id="CBL05962.1"
FT                   /translation="MRIAIYPNVTKSGAGEILERVIKFANQYNIELLLPPKEGKFFYHE
FT                   ELINQNIEKEYIDMAISIGGDGTLLGLCRRLAKNGIPVCGINIGHLGFLADIEPGEIEA
FT                   KLTKIINRQYKIEERLMLSAYIKRQGKINYIGSAVNDVVVSKCGVSRMLHFGVAINDYM
FT                   VTNYKADGLIISTPTGSTAYSLSAGGPIVNPKVKGIILTPICPHSCFIRPMVIDESEKV
FT                   ALNIINIISMTKRSVNLTLDGQEGVDIEPDDEIIIEKANFPAQIVRFEDKNFYQTFMNK
FT                   LCL"
FT   CDS             complement(771181..771786)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09720"
FT                   /product="hemolysin TlyA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05963"
FT                   /db_xref="GOA:D4KI84"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI84"
FT                   /protein_id="CBL05963.1"
FT                   /translation="MLTEQNLVSSRERAKTTIMAGLVLVNGQKIDKPGTMVKEDAVIRV
FT                   LGDSIGYVSRGGLKLAKAIKEFKLDLTDLVVADIGASTGGFTDCSLQNRAKKVFAIDVG
FT                   YGQLAWSLRTDERVVNMERTNIRYVTPEDIGEPINFASIDVAFISLDKVLPVAKTLLSD
FT                   DGKIVALIKPQFEAGKDKVGKKGVVREASVHEEVIKKS"
FT   CDS             complement(771829..772644)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09730"
FT                   /product="Deoxyxylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05964"
FT                   /db_xref="GOA:D4KI85"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI85"
FT                   /protein_id="CBL05964.1"
FT                   /translation="MFTLRDFFDVGIAEEHAVTFAGGQACIGKRPFVALYSTFAQRAYD
FT                   QVIHDICLQKLPVVFCLDRAGLVGEDGPTHHGVFDIAYMRQIPNMVVMAPKDENELRQM
FT                   VFSAVEYNCPCSIRYPRGNACGVPIEEDVEILPLGKGEILQDKENATVAIIAVGSMVKE
FT                   AMVASEKLSLENINCSVINARFIKPLDEELILNIAKKVKYVVTIEEGILAGGFGSAILE
FT                   LLNQNKIYKPIIRMGIPDEFIEQGTRNELLKECKLTSEDIIQTIKDFEE"
FT   CDS             complement(772619..773707)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09740"
FT                   /product="Deoxyxylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05965"
FT                   /db_xref="GOA:D4KI86"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI86"
FT                   /protein_id="CBL05965.1"
FT                   /translation="MNILEQIHSPAELKYLSETQLEIVATQIRELIIKTVAQNGGHLAP
FT                   CLGTVELTLALHKVFSCPRDKFVWDVGHQAYAHKILTGRLEKFSTLRQKDGITGFPNRF
FT                   ESEYDAFGVGHASTSISAALGMAVARDLDNEDYNVIAIIGDGALTGGEAFEGLNNAGMS
FT                   KRKLIVILNDNEMSISQNVGALSEYLSLIRIDEKYKRAKKDIQRILGNIPKIGGSVLKT
FT                   ANYVKDGVKNAIVPGGIFEALGFNYIGALNGHSLTDLINVFEKVKANIDGPVLIHVQTK
FT                   KGHGYLPAENNPSKFHGIGKFDVLTGLPIASNSIVPTYTAVFSRALIDLAAKNKNITAI
FT                   TAAMPSGTGLQKFADVYPKRFF"
FT   CDS             complement(773729..774607)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09750"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /function="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05966"
FT                   /db_xref="GOA:D4KI87"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI87"
FT                   /protein_id="CBL05966.1"
FT                   /translation="MMKSYMQRKMDLINQQLNEIYTENMALNKDLAKAMNYSLMAGGKR
FT                   LRPILIMAAADALGVDGEKFLRLSTSIEFIHTYSLIHDDLPAMDNDDYRRGKLTNHKVF
FT                   GEALAILAGDALLTMAFEIIATDKNVDAETKIKIITEMSKAAGAEGMVGGQVIDMQSEN
FT                   KKIDIQTLKQMHAAKTGALFCAAIRSGAILAGADEKQLANLTEYARQFGLAFQITDDIL
FT                   DVVGDEKTIGKPVGSDEKNHKSTYVTLGSLGSAKALAQEAVDKAKASLVDFGENAEFLR
FT                   ALVDYLITRNK"
FT   CDS             complement(774608..774847)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09760"
FT                   /product="Exonuclease VII small subunit."
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05967"
FT                   /db_xref="GOA:D4KI88"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI88"
FT                   /protein_id="CBL05967.1"
FT                   /translation="MARKKLTFENAMETLEEIVNQLEAGDIPLNELIDKYNEGMKLSAF
FT                   CLDELNRAKDAIYAEVDVKDNKIIEKKLDIEGDY"
FT   CDS             complement(774858..776060)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09770"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05968"
FT                   /db_xref="GOA:D4KI89"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI89"
FT                   /protein_id="CBL05968.1"
FT                   /translation="MAEKIYTVSQLNKYLRQQFDDDIILQNIMLKGEISNFKVHSSGHC
FT                   YFTLKDNLASIKCVAFRFNAMKFRFAPQNGMKVIASGYISIYEKDGLYQLYVQSLAPEG
FT                   IGELALAFEQLKNKLNDEGLFDSKYKKQLPFYPKRIGVVTSRTGAVIKDICHVAKRRNP
FT                   LVKILLYSVLVQGENASKEIVQGIEFFNKKCPVDVIIIGRGGGSLEDLWAFNEENVIRA
FT                   IFASKIPIISAVGHETDYTLSDLTSDVRAATPSQAAELAVVEKEALVNYIESLKRDCRY
FT                   KAYNLFSIKENKFNLLWKHSIFSDKERLLQSRQQELDFLNERLNKVVTDKYVNKFHQME
FT                   VIAEKLKVLNPLNVLQRGFSIVKQDDKYIKNIKDIDMNKSLNIELSDGTVETKIVQIKE
FT                   K"
FT   CDS             complement(776118..776513)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09780"
FT                   /product="transcription antitermination factor NusB"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05969"
FT                   /db_xref="GOA:D4KI90"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI90"
FT                   /protein_id="CBL05969.1"
FT                   /translation="MSRRQAREIALQSLFQLDFNECEVDSAIENVLSHKKLHEADCDFV
FT                   RILVSGTRENLESIDKMIAEKSKDWKIERMSGIDRNIVRLAIFEMKFSSDKLVPNIAIN
FT                   EAVELAKKFGTDDSARFVNGILGSMIK"
FT   CDS             complement(776532..776783)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09790"
FT                   /product="Small integral membrane protein (DUF2273)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05970"
FT                   /db_xref="InterPro:IPR018730"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI91"
FT                   /protein_id="CBL05970.1"
FT                   /translation="MKEYILNFIKYQLHEHCGRTIGVILGFIISLAILIFGLFTTLFVI
FT                   ICMGIGLYVGNLIDKDDEFSDNILYKIQKILPPYSRRW"
FT   CDS             complement(777400..777492)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05971"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI92"
FT                   /protein_id="CBL05971.1"
FT                   /translation="MTGLSTVEVNVHVQGVGFPEDVQTEEVRVR"
FT   CDS             complement(777605..777679)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05972"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI93"
FT                   /protein_id="CBL05972.1"
FT                   /translation="MSGGIAGGIAEILGRKNFSKGVKS"
FT   CDS             complement(778001..778558)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09830"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /function="translation elongation factor P (EF-P)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05973"
FT                   /db_xref="GOA:D4KI94"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI94"
FT                   /protein_id="CBL05973.1"
FT                   /translation="MISSSDFRTGLTLEIDNGVWQIVDFQHVKPGKGAAFVRTKIKNVQ
FT                   TGAVVERTFNPNEKLPAAHVETRAMQYLYEADGMYTFMDNETYDQIELTKDQLGSALNF
FT                   LKENMDISLQSFKGNIIGITLPNSVNLEVVECEPSVKGDTATGATKMAKVETGYEVRVP
FT                   LFVNEGDVLRIDTRTGNYIERA"
FT   CDS             complement(778633..778767)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09840"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05974"
FT                   /db_xref="GOA:D4KI95"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI95"
FT                   /protein_id="CBL05974.1"
FT                   /translation="MIVTNEPGIYVPDFGGVRIEDTVLVTANGCQALTQSDKRLVEIM"
FT   CDS             complement(778865..779572)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09850"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05975"
FT                   /db_xref="GOA:D4KI96"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI96"
FT                   /protein_id="CBL05975.1"
FT                   /translation="MIVFLITDSRYTKQASEQTSFTIIEQKTGLLSKTVELIKKLNINS
FT                   LAFEGNALIFNQYNYLAKNLVDIEVDFSTSLDLTELRIIKDENEIELIKKAINISDEAY
FT                   SHILKFVKAGMSEQEIATELEYFMRKLGSERPAFTTIVASGVRGALPHGVATDKLINNG
FT                   EFVTIDFGAVYKGYHSDITRTFCVGKASDRQKEIYDIVLQAQLLGLKEIAPNKSGREVD
FT                   FPVREYIKKCRLW"
FT   CDS             complement(779550..779714)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09860"
FT                   /product="Creatinase/Prolidase N-terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05976"
FT                   /db_xref="GOA:D4KI97"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI97"
FT                   /protein_id="CBL05976.1"
FT                   /translation="MYQNNRIEKLRKVLQANYCDAMLISKEENLHYFSGFTGDDTFLII
FT                   TLNDCFFDY"
FT   CDS             complement(779718..780167)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09870"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /function="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05977"
FT                   /db_xref="GOA:D4KI98"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI98"
FT                   /protein_id="CBL05977.1"
FT                   /translation="MKINKVLVIHGPNLNLLGTREPEIYGSMTMQDINEDLAKQAKKHN
FT                   IEIDFFQSNHEGAIIDTLHNARGQYGYIILNAGAFTHYSIAIRDALAAIDIPVIEVHLS
FT                   NIHKREDFRHHSVIAPVVEGQICGFGLESYKSALFIAISRLQKED"
FT   gap             780357..781436
FT                   /estimated_length=1080
FT   CDS             complement(781572..781850)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09880"
FT                   /product="Acylphosphatases"
FT                   /EC_number="3.6.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05978"
FT                   /db_xref="GOA:D4KI99"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="UniProtKB/TrEMBL:D4KI99"
FT                   /protein_id="CBL05978.1"
FT                   /translation="MEQIKRYKAVITGNVQGVGLRVFVVDNASKLGITGWVRNMADGTV
FT                   EMEAQGNPDKLDQLFATIKKGNFIIKVDNIDCTEIDCVEETSFIIKY"
FT   CDS             782160..782552
FT                   /transl_table=11
FT                   /locus_tag="MHY_09890"
FT                   /product="3-carboxy-cis,cis-muconate lactonizing enzyme."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIA0"
FT                   /protein_id="CBL05979.1"
FT                   /translation="MLTGYIGTYNTASTKGIYQFSYEENSGKISDIQSFLSIDDAKCVD
FT                   RYENILIITTSKNNKSGIALVDITTKTILDEILLENSSPCFVKHHDDFIYTANYHDGVV
FT                   MVYQIVNNKLKLIKQISIQTKLVAIK"
FT   CDS             783161..783382
FT                   /transl_table=11
FT                   /locus_tag="MHY_09910"
FT                   /product="Glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05980"
FT                   /db_xref="GOA:D4KIA1"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIA1"
FT                   /protein_id="CBL05980.1"
FT                   /translation="MSLNKAFTIFGGTGDLTFRKLMPAQYNMTAANAEEAQSRIIIIGR
FT                   RDYTTEQYCELVRDWVKNSLVYHMKKNF"
FT   CDS             783414..783524
FT                   /transl_table=11
FT                   /locus_tag="MHY_09920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05981"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIA2"
FT                   /protein_id="CBL05981.1"
FT                   /translation="MDISDLNEYARLSEYYTAENIDDHVFYLAVAPKFSA"
FT   CDS             783689..784549
FT                   /transl_table=11
FT                   /locus_tag="MHY_09930"
FT                   /product="Glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05982"
FT                   /db_xref="GOA:D4KIA3"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIA3"
FT                   /protein_id="CBL05982.1"
FT                   /translation="MVRNIQTIRFTNPIFANLWNSQYIESVQISAFEDLGIGTRGGYYD
FT                   TSGALKDMVQNHLFQILSIVAMEWPEQFSTTAMHDAQLRVLRALRPVEDVRDSLVLGQY
FT                   KGYRQEKSVPTDSTTETYAALRLFIDNERWWNTPFYIRTGKKLRCREMQIAIVFRQTFI
FT                   SAPRNILIIKIQPNEGVHLQFNVKTPGDTDEITQAKMDFSQSSSISNRINTPEAYERLI
FT                   TACIKGERSWFSQWDQIETSWDFVEHLKDLYRWDKLPVFTYEQGSDGPAEADNLLKRFG
FT                   DEWVF"
FT   CDS             complement(784617..785906)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09940"
FT                   /product="4-aminobutyrate aminotransferase and related
FT                   aminotransferases"
FT                   /EC_number="2.6.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05983"
FT                   /db_xref="GOA:D4KIA4"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIA4"
FT                   /protein_id="CBL05983.1"
FT                   /translation="MSQYLGPEKCLEKKKKYIMPCLGHFFANPPQFVKGEMQYLYDHEG
FT                   KKYLDCFAGVSVINCGHCNPEITQKVAKQVQTLQHVCNIYLTEDIYNLAEKLAQVTPGR
FT                   LQKSFFCSTGTEANEGALLLANIYNGKSELLALRNGLHGRTKLTMNLTGIGMWRTDPNP
FT                   VGGIHFAPNPYCYRCPMGKKFPECDYACANAVEDIISYATSGNVSAMICETIQGNAGIV
FT                   VPPKGYFKRLKEILEKHNILLIIDEVQTGFARTGKMFAIENYDVEPDIMTMAKALGNGA
FT                   PISCFISRSEIADKYTRPGASTLGGNPVSSTAGIAVLDYIEEHNLVEKARVRGKQLKDG
FT                   LIALQEKYPFIGDVRGLGLMVGAELINPDKSPAPDKLEFVVETMKDRGFLIGKNGIARN
FT                   VLAFQPPLVISEENINDLLNNLDDVMSHVK"
FT   CDS             complement(786050..786652)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09950"
FT                   /product="Collagenase and related proteases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05984"
FT                   /db_xref="GOA:D4KIA5"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIA5"
FT                   /protein_id="CBL05984.1"
FT                   /translation="MVGNLGAATIVRELTDLPIYADHSFNVFNHVATEFLQENGIVNAT
FT                   ASYELPYAQVKTLVESSKLPMTITVHGNVEAMISDTNIPALNLKYDPLTNPEFNDKHFA
FT                   LLDTVGGKHSMRVDQFGRIHILFTNDLCLLPYIDKLMGADTLRIEAQDYTPEVTGMLTK
FT                   IYRDAIDNGKNNDMIEKIKEVSPRPVGIGVYRHKKSY"
FT   CDS             complement(787565..787972)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09970"
FT                   /product="Collagenase and related proteases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05985"
FT                   /db_xref="GOA:D4KIA6"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIA6"
FT                   /protein_id="CBL05985.1"
FT                   /translation="MLLNKKSVELLAPAGNWETLVAAIDAGADAIYLGGKHFNMRMLKS
FT                   DANFDNEMLKKAVEYAHAHGVMLYITINNLISDEEIPELEEYLTYLNEIQPDAILIQDL
FT                   AVAQIVKKLGLNITMHASIMMNSHNNAAIKN"
FT   CDS             complement(788060..788254)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05986"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIA7"
FT                   /protein_id="CBL05986.1"
FT                   /translation="MADVGDKIYDLIQNANSLQYEFLDNDSEYDNIARECLIRNLEYII
FT                   QWFHLPINLEEALAEREWD"
FT   CDS             complement(788221..788388)
FT                   /transl_table=11
FT                   /locus_tag="MHY_09990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_09990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05987"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIA8"
FT                   /protein_id="CBL05987.1"
FT                   /translation="MDSFDDQYILLEELYEDSFYPDFLIDKIKYLLEDFINFVEQKPKI
FT                   WQMLVIKFMI"
FT   CDS             788587..789630
FT                   /transl_table=11
FT                   /locus_tag="MHY_10000"
FT                   /product="RecA protein"
FT                   /function="RecA protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05988"
FT                   /db_xref="GOA:D4KIA9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIA9"
FT                   /protein_id="CBL05988.1"
FT                   /translation="MDKMDKVQALESALKQIERDFGKGSIMKLGDVSANMNIEVIHTGC
FT                   LPLDAALGVGGVPRGRIVEIFGPESSGKTTVALHIVAEAQKTGGVAAFIDAEHALDPVY
FT                   AKKLGVDIDNLLISQPDNGEQALEIADALVRSGAIDVVVVDSVAALVPKAEIEGDMGDS
FT                   HVGLQARLMSQAMRKLTGIISKSRTTAIFINQIREKVGVMFGNPETTTGGRALKFYASI
FT                   RLDVRKIDTIKQGNDPVGSRTRIKVVKNKVAPPFKQAEFDIMYGEGISREGSLIDMGTA
FT                   FEILDKSGTWYSYQGTRLGQGKENVKAYLKEHADTALEIENKIREKLFVQEEQTEEKVE
FT                   EPTKNLK"
FT   CDS             789640..790107
FT                   /transl_table=11
FT                   /locus_tag="MHY_10010"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05989"
FT                   /db_xref="GOA:D4KIB0"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIB0"
FT                   /protein_id="CBL05989.1"
FT                   /translation="MKQQNNTKTALIYAVDLLATRPYSTQQLITKLKRKEYAPEEIQEA
FT                   INRLTARHYLDDTDLCQRQYQAYINEKHRSIKAIKYKLMEKGFSQSDIQNAQEETDIDE
FT                   IDYEYTVCLRLLNSRYTPSKADKLKCQGYLYRKGFNYSAIRLAIEDFFYNP"
FT   CDS             complement(792588..793211)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10050"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05990"
FT                   /db_xref="GOA:D4KIB1"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIB1"
FT                   /protein_id="CBL05990.1"
FT                   /translation="MYYKPRVDKDLLRQYHEGIICLSSCIAGEIPQAIIRDNMERAEKL
FT                   VQEYVDIFGKDNFFLEIQNHQIPEEAKANKGLISLAQKYDLKLVATNDIHYIKKEDNDF
FT                   HDVLLCIQTGRTLDDKDRMKFYNDDFYLKSGAEMLALFKDTPEAITNTLEIANRCNVSF
FT                   EFGHLHLPNFPLPEGMTDEQYLHKLCKEKFIIDMLKLQRKYNKG"
FT   CDS             complement(793264..793452)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10060"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05991"
FT                   /db_xref="GOA:D4KIB2"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIB2"
FT                   /protein_id="CBL05991.1"
FT                   /translation="MKSIAITDHGTMYGTIAFYKEALKQGIKPIIGCEVYVAPKSRFDN
FT                   FEVEGTRYYHLILLAEK"
FT   CDS             complement(793430..793591)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05992"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIB3"
FT                   /protein_id="CBL05992.1"
FT                   /translation="MKLEKSDVNTVVENHIDFTHLHVHTEYSLLDGASRVKINYTRKRI
FT                   GHEIYSDY"
FT   CDS             complement(793681..793767)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05993"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIB4"
FT                   /protein_id="CBL05993.1"
FT                   /translation="MLKLSSFLYCYFNEEKEAFIFGIDLFSL"
FT   CDS             complement(793969..794127)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05994"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIB5"
FT                   /protein_id="CBL05994.1"
FT                   /translation="MLHNTCDKIKTKCIEKRCLCNGKLHEKAFLKIYDINKNVNLNNYN
FT                   DDYDKNR"
FT   CDS             794218..795633
FT                   /transl_table=11
FT                   /locus_tag="MHY_10100"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05995"
FT                   /db_xref="GOA:D4KIB6"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIB6"
FT                   /protein_id="CBL05995.1"
FT                   /translation="MELLNSLVGQINDILWSYVLIILLIGAGIIFTIRTKFVQIRFIKE
FT                   MIRLIAGDAGNKMEGQQISSFQAFCVSTASRVGVGNIAGIAIAVVLGGPGAIFWMWIIA
FT                   ILGSATGFVESTLAQIYKVPRTDSNGYLGGPAYYINNALHSPKTAVFFAILISVTYGLI
FT                   FNSVQSNTISLSLQTAFNFDATMIGIVIAIFSGIVVFGGLHRIAKVTEYMVPIMAGIYL
FT                   LIAFAITIYNISELPTVLSVIFKDAWGIESVAGGSFGAAIMTGIKRGLFSNEAGMGSVP
FT                   NAAATAEVSHPVKQGLIQAFGVFVDTLFICTASAFIVLFSSDYQATGLTGIQLIQYDLS
FT                   LYFGDIATTGIAIIVLLFAFTSIVGNYYYGEINIKHLSDNPLYLNIFRILVVIMVFFGS
FT                   VAELSLVWNLADLFMALMAITNIIAILLLGKYAFIALDDYTQQKKQGIKDPVFKASILP
FT                   KQDGIYWWKDDNK"
FT   CDS             795882..796685
FT                   /transl_table=11
FT                   /locus_tag="MHY_10110"
FT                   /product="dihydrodipicolinate synthase"
FT                   /function="dihydrodipicolinate synthase"
FT                   /EC_number="4.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05996"
FT                   /db_xref="GOA:D4KIB7"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIB7"
FT                   /protein_id="CBL05996.1"
FT                   /translation="MEKDVIFKGAGVAIATPFYENGNGINYDELARLIDFNLNNGTDAI
FT                   IIAGTSGESATMTDEEHEEIIKFTVDYVNKRVPVIAGTGSNDTRYAINLSQHADKAGAD
FT                   ALLVVTPYYNKCTQKGLIKHFTSIADNVNVPIILYDVPSRTGVGITPETYAVLAEHPRI
FT                   AAVKEASGNISQVAETMSLCGDKLTFYSGNDDQIVPLLSLGAKGVISVLSNVMPQETHD
FT                   MCQLFFDGKVEEAAKKQIEYFPLIKALFCEVNPIPVKSCTSFNGL"
FT   CDS             796675..796779
FT                   /transl_table=11
FT                   /locus_tag="MHY_10120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05997"
FT                   /db_xref="GOA:D4KIB8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIB8"
FT                   /protein_id="CBL05997.1"
FT                   /translation="MGFDMGPLRMPLCEMEDAHLEQLKTAMRKFNLIK"
FT   CDS             complement(796843..797703)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05998"
FT                   /db_xref="InterPro:IPR025357"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIB9"
FT                   /protein_id="CBL05998.1"
FT                   /translation="MENLVENISKSVAIELLFEEMPTRPTANAIFREARKIFGDINIIN
FT                   RDENDIEFSVDKFVAYNEDNTTSPVVLAMGNITDFDDKVAVSEFERTQIWNVANSEELL
FT                   SKYKYAVKIWDVNAQRQIPKERAIMLVDWLNVALKLYPKCQAIWIKSAGKLQLAQSIKN
FT                   LKETGIVKYLYSMVNIRFFNVPNTNEFIVDSVGLANIGLSDVQFHFKGMNPNKIANLAY
FT                   SLARYILNNDDIMIKDGDTIDGMNDEGKMTPEVQWICRYEDSLIEPLRPVLDIDTGKYA
FT                   AGNRN"
FT   CDS             complement(797804..798148)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10140"
FT                   /product="Protein of unknown function (DUF1292)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL05999"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIC0"
FT                   /protein_id="CBL05999.1"
FT                   /translation="MEELKNNSVVEEDTEGTVVVITDEEGNEYNYVEEMVFDAGSDKYA
FT                   ILVSIDGDEECECHEHDEECGCEEEVDVILAKIVKDENGEVEYIEPTDEEFEIAQQAYE
FT                   ELMDKLEAEE"
FT   CDS             complement(798253..799866)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10150"
FT                   /product="Predicted exonuclease of the beta-lactamase fold
FT                   involved in RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06000"
FT                   /db_xref="GOA:D4KIC1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIC1"
FT                   /protein_id="CBL06000.1"
FT                   /translation="MNLQFLGAAHTVTGSCYLLEANDHKVLIDCGMFQGARNLRDLNYN
FT                   DFRFVPSDIDCVLLTHAHVDHCGLIPKLCKQGFKGDIYATKATCDLVNIMLPDSAHIQE
FT                   SDAQITNRKGQRMGKTPIAPLYTIDDAMASLKQFVPIDYDQEINPVNGIRAIYKDAGHI
FT                   MGSAIIEVYVTENGEETKIVFTGDLGQPDQPIIKDPTHIKEADYLVIESTYGDRKHQIY
FT                   DKETPLAEIINDTMDRGGNLIIPSFAVGRTQTMLYYLFKLWKANRIEDYSVVVDSPLAV
FT                   EATRIFAKNTKYFDDEATEYIRKHGKLPQMPQLRLCESANESKALNTEEGSHIILSASG
FT                   MADAGRVLHHLKHNLWRPESTILFVGYQAEGSLGRKLLEGAKKVKVLGEEISVKARIVN
FT                   MDGFSAHADYSQMEEWLQHLTMYNAKQVFVVHGEATASKAVKEMIEEEFGWNAYIPFYA
FT                   DRAIMTKNTCEIKAANIPQVSVEKDMEDFFVDVDADYRQLRRRIINLVVKNPELMPAAM
FT                   NTIQKGWRYVKRLFKDFGIS"
FT   CDS             complement(800106..802118)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10160"
FT                   /product="Predicted Zn-dependent peptidases,
FT                   insulinase-like"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06001"
FT                   /db_xref="GOA:D4KIC2"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR013578"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIC2"
FT                   /protein_id="CBL06001.1"
FT                   /translation="MLAFTILEHALLKSEAAPLRNALIKAGLGSDVISSFDNGILQPMF
FT                   SIIVNGSEANKVDEFAKVVTDTLNDIVKNGIDDELLQASINSMEFKLREADFGQYPKGL
FT                   IYNINLMNSWLYDGDATMYLHYEEALKTVKQWAKEGKFEALIQEYLLDNTHSHILILEP
FT                   DENVIAKQEKDLADKLAQKKASMSKEDIEKIIADTQKLKERQRSVDKPEDLEKIPLLKI
FT                   EDITKQCDKLIIAEDEIADTKVLRHDIDTNGICYLRMLFDISNIAYEDINYLFLLEEFI
FT                   GRTATKNYTYEALANAVNLHTGGMRFAVATYDKEGDVDSYMPKFVFKAKVLVDKMPELI
FT                   KLLQEIIFNSSFTSKERIKDLAMQCRSDFEMSILRSGHQLVLDELMAYFTPKERYDNFG
FT                   DLKFYAFIKNFLNDFDNEFNKMQTAFAKILPMIFNKANLLTSITVSKNDYEKVISAIKP
FT                   LLEVLPNETYPKQEIPFAVEKKNEGFITSSQVQYVAKGANFIRLGYKYTGAMKVLETIM
FT                   RYEYLWTNIRVLGGAYGAFVKFRRDGNMYFGSYRDPNLVETLNVYDKTAEFLRNFNVSD
FT                   REMTKYIIGTISNIDMPLTPALKGELASSAYIAEMTDEMRQQQRDEILATTQEDIRALA
FT                   DLVDACMKENAICVLGGSNKVNEAKDVFKTVTTIL"
FT   CDS             complement(804133..804546)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10190"
FT                   /product="Phosphoribosylamine-glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06002"
FT                   /db_xref="GOA:D4KIC3"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIC3"
FT                   /protein_id="CBL06002.1"
FT                   /translation="MKQEGYEYKGCLYAGLMITAEGPKVVEFNARFGDPETQVVLPLLE
FT                   SDLAEIMLACANGTLANCDIKWSKKAAVCVVMSAGGYPAKYEKGNEILGLDKAENENVL
FT                   VFHAGTAKKDGKIVTNGGRVLGVVALGDDIKLL"
FT   CDS             complement(805404..805997)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10230"
FT                   /product="AICAR transformylase/IMP cyclohydrolase PurH
FT                   (only IMP cyclohydrolase domain in Aful)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06003"
FT                   /db_xref="GOA:D4KIC4"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIC4"
FT                   /protein_id="CBL06003.1"
FT                   /translation="MPIKRALLSVSDKTGIVEFARKLHEAGVEIISTGGTMKAIDDAGI
FT                   PVTYVSDVTKFPEIMDGRVKTLNPYIHGGILAVRDNQSHVAQMQKFNIQPIDLVVVNLY
FT                   PFRETIEKPNVTLAEAVENIDIGGPAMIRAAAKNFKFVTVVVNPKHYDEVAEMIAKDGC
FT                   TTGKFRMQLAQEAFCHTSHYDDCIQEYLTAQLSK"
FT   CDS             complement(806032..806646)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10240"
FT                   /product="formyltetrahydrofolate-dependent
FT                   phosphoribosylglycinamide formyltransferase"
FT                   /function="formyltetrahydrofolate-dependent
FT                   phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06004"
FT                   /db_xref="GOA:D4KIC5"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIC5"
FT                   /protein_id="CBL06004.1"
FT                   /translation="MNNQIILGVLASGRGSDLQSIIDAIENGQIKTKIGVVLTDKPEAM
FT                   ALERARKAGIPAVCVDRKKCSTKEEFEQKLVEQLKKYNVGLVVLAGFMRILSPYFVNEF
FT                   KNCILNIHPSLLPSFGGAHAHRDVLAYGVKVSGCTVHFVNEGMDSGPIIMQKAVPVLDD
FT                   DTEETLSARVLEQEHIIYPKVIELYLAGKIHVNGRHVTIDD"
FT   CDS             complement(806639..806929)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10250"
FT                   /product="Phosphoribosylaminoimidazole (AIR) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06005"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIC6"
FT                   /protein_id="CBL06005.1"
FT                   /translation="MKIFPAFLPEGTGVEVDASTWEMPAIFKLLQAWGNVDWHEMYRVF
FT                   NMGIGMILLVSEEEAAKIQEDLKAKGEKSYIIGKVVDGNQTVEVKGGVFNE"
FT   CDS             complement(806886..807707)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10260"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /function="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06006"
FT                   /db_xref="GOA:D4KIC7"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIC7"
FT                   /protein_id="CBL06006.1"
FT                   /translation="MTDNKQTNLTYRDSGVDIDAGNYSVKLIKDSVKATYRPEVLGDLG
FT                   GFGGLFALNSGKYKEPVLVSGTDGVGTKLRLAFMLDKHDTIGQDAVAMCVNDILVQGAE
FT                   PLYFLDYLAVGKLDPEKVATVVKGVAGACKESGCALIGGETAEMAGFYADGEYDIAGFA
FT                   VGVVDKANIITGKKIKSGDVLLGIPSSGVHSNGYSLVRKICFDVKGFKGEEKFPELNGK
FT                   TLGEELLTPTRLYPSVCLPLIEKYDIHGMVHVTGGGFYENISRIFTRRYWR"
FT   CDS             complement(807730..808344)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10270"
FT                   /product="Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06007"
FT                   /db_xref="GOA:D4KIC8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIC8"
FT                   /protein_id="CBL06007.1"
FT                   /translation="MMGRMLARESKFKGDIVISVPDSGNTAATGFAYESGIPFCEGLIK
FT                   NRYIGRTFIQPTQKKRDTAVRLKLNAIAEAVRGKSVIMVDDSIVRGTTSGKIVKMLRKA
FT                   GAKEVHMCISSPPIGYPCYYGIDTSVRKELIAATKSVEEIRQFIGADSLHFLSLEGLKA
FT                   SMTTANPEDMCYACFNNAYPIEMSKETVTGADKYVFEQKAK"
FT   CDS             complement(808377..809162)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10280"
FT                   /product="Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06008"
FT                   /db_xref="GOA:D4KIC9"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIC9"
FT                   /protein_id="CBL06008.1"
FT                   /translation="MVDITSNKWKEECGVFGVFSRTEDVSMLTYLGLYALQHRGQESAG
FT                   IAVTDGAWMDVTRDMGLVNEVFRHQLPHMENQYIAIGHVRYSTTGSSLLSNTQPLIANY
FT                   SGGKISLAHNGNLTNAAELRRYLEEQGTIFQTSIDTEVIVNLIARSRKSSIEEKIIESV
FT                   QQVKGAFCLAIMTENKLIAVRDPQGFRPLCIGKTEEGSWIISSESCGLDVVGAEFIRDV
FT                   EPGEMVVMGDDGLKSYKYTTPQKKLHVFSNIYILLVQIV"
FT   CDS             complement(809277..809507)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10290"
FT                   /product="Phosphoribosylaminoimidazolesuccinocarboxamide
FT                   (SAICAR) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06009"
FT                   /db_xref="GOA:D4KID0"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:D4KID0"
FT                   /protein_id="CBL06009.1"
FT                   /translation="MTKYLATKNIDLIDFKLEFGKYHGEILLGDELSPDNCRFWDSQTH
FT                   EKLDKDRFRRDLGNVEDAYKEVLHRLTGETL"
FT   CDS             complement(809512..809655)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06010"
FT                   /db_xref="GOA:D4KID1"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniProtKB/TrEMBL:D4KID1"
FT                   /protein_id="CBL06010.1"
FT                   /translation="MSKPVIEYCYKCDDLGDPMVNRYHITAMGWATDEELDQIEAMSLK
FT                   NQ"
FT   CDS             complement(810076..810132)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06011"
FT                   /db_xref="UniProtKB/TrEMBL:D4KID2"
FT                   /protein_id="CBL06011.1"
FT                   /translation="MVEEVEAKAAKVAQQLQA"
FT   CDS             complement(810125..810289)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10320"
FT                   /product="Phosphoribosylcarboxyaminoimidazole (NCAIR)
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06012"
FT                   /db_xref="GOA:D4KID3"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="UniProtKB/TrEMBL:D4KID3"
FT                   /protein_id="CBL06012.1"
FT                   /translation="MDALLSTVQMPSGIPVATMAINGAKNAAIFAIEIFAISDMILRKQ
FT                   LKEYREKNG"
FT   CDS             811086..812312
FT                   /transl_table=11
FT                   /locus_tag="MHY_10330"
FT                   /product="aspartate kinase"
FT                   /function="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06013"
FT                   /db_xref="GOA:D4KID4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:D4KID4"
FT                   /protein_id="CBL06013.1"
FT                   /translation="MALIVKKFGGSSVGNIDKIKAVAKRILDEKQPDDKIVVVVSAMGD
FT                   TTDDLIQLAKGITKDPYQYTREMDMLLTTGEQVSISLLTMAFKALGQKAISLTGALAGV
FT                   KTNSVHTKGKIKDIQPKRIFEELDKGNIVIVAGFQGCDDLGDPVTLGRGGSDTSAVALA
FT                   GAMKADVCEIYTDVDGVYSADPRIAKGARRMKEITYYEMLEMARLGAGVMQPRSVETGR
FT                   LYNIPIHVRSTFTNKPGTIIREEYTMEEKEFIIRGVAHDTNVAKFAVLGIPNTPGIAHA
FT                   IFSKLAENNVDVDMIVQSIRNMEKNVTDMVFTVTADDLGQAKQIVDKVADELNAVAVLI
FT                   EQDVAKVSIVGAGMLGNPGIAARMFKALSDANINIDVISTSEISISCLIKADKIKEAVN
FT                   AIHDEFFKD"
FT   CDS             812894..813541
FT                   /transl_table=11
FT                   /locus_tag="MHY_10340"
FT                   /product="Threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06014"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:D4KID5"
FT                   /protein_id="CBL06014.1"
FT                   /translation="MLTQQGDNVSVFAVKGNFDDAQSGVKQIFSDSKYNEYLNEKGFKL
FT                   SSANSINWGRLLPQIVYYFSAYADLVNDKKITMGDKVNFTVPTGNFGDILAGFYAKCMG
FT                   LPVNRLICASNSNNVLTDFLKTGTYDRNREFFKTISPSMDILISSNLERLLYHITNDAT
FT                   KVKSYMEKLQSTGCYQVDEATFKAIQETFSAGYLDDSATKNVFMIFINKIIM"
FT   CDS             813613..813846
FT                   /transl_table=11
FT                   /locus_tag="MHY_10350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06015"
FT                   /db_xref="UniProtKB/TrEMBL:D4KID6"
FT                   /protein_id="CBL06015.1"
FT                   /translation="MVVLSTASPYKFSDSVLSALGEDISDKDEFALLDKLSTLNKDKIP
FT                   QGLAQLQSLPILHNNLCAKEDMIKAVNTFLNI"
FT   CDS             814380..814910
FT                   /transl_table=11
FT                   /locus_tag="MHY_10360"
FT                   /product="Phosphate transport regulator (distant homolog of
FT                   PhoU)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06016"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="UniProtKB/TrEMBL:D4KID7"
FT                   /protein_id="CBL06016.1"
FT                   /translation="MSGNNKAEAKLSDIINIEHEADAVNDKIIDKLNKTFITPIDREDI
FT                   YALANGLDDGVDFLQGTLQRAVMYHLVDTSKAAIALSELLVSATDEILKAFSMLHEVTK
FT                   HEHEILECTYKISKLESEGDRIYREEVAYLFEHITDPIELIKWKDILTYMEDTLDHCEK
FT                   LSDLVRGVVMKYA"
FT   CDS             814903..815904
FT                   /transl_table=11
FT                   /locus_tag="MHY_10370"
FT                   /product="Phosphate/sulphate permeases"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06017"
FT                   /db_xref="GOA:D4KID8"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D4KID8"
FT                   /protein_id="CBL06017.1"
FT                   /translation="MHELQFLIIAVIILALVFDFINGFHDTANAIATSVSTRALKPRTA
FT                   IIMAAFLNFFGAMYSTGVAKTIGGDIVKSAEHIDEHIIVAALIGAIVWNLFTWWIAMPS
FT                   SSSHALVGGIIGAVLVSTGAIGLNFWGIGKIVLSLILSPIIAIVVGFIIMNIFYLLFGK
FT                   FRPSSLNNKFKRMQIITAATMAFSHGSNDAQKSMGIITLALLSGGYIDVFEVPYYVKIL
FT                   AATAMACGTAIGGWKIIKTVGGRIFKLQPISGFAADLNSSVIIFSATLLSLPVSTTHVV
FT                   SGSIMGIGSAKRIGAVRWGTAQQMLMAWVLTIPCTAIVGALVYSLMCYVFGL"
FT   CDS             complement(817769..817954)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06018"
FT                   /db_xref="UniProtKB/TrEMBL:D4KID9"
FT                   /protein_id="CBL06018.1"
FT                   /translation="MYVDKSPSDIIEMHNPPTSNWEVVADDLGITQEELDEIHQKMETL
FT                   DLGMIKDPKGPGAMRF"
FT   CDS             complement(818005..818304)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06019"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIE0"
FT                   /protein_id="CBL06019.1"
FT                   /translation="MRINNEMQNISEYFGVDKQTLVMYYNNGWEMPELRRGAFLAYASH
FT                   KSFDDVMNLRENNSWSRVEYLIGLTPNDLKATQDDIISTQIANKLDINKSIVTF"
FT   CDS             complement(818495..819319)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10420"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /function="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06020"
FT                   /db_xref="GOA:D4KIE1"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIE1"
FT                   /protein_id="CBL06020.1"
FT                   /translation="MMKKINKEGIYMFDNLKLGFIGFGNMGQAIATGLINQGAIQSNQI
FT                   FACAKNWDKLCKNTQEKQINPCKSAKEVVDNVDMVIIAVKPYMIEEVITPIKKELQEKI
FT                   VISIAANFPFAKYEQILLPNTHHLSTIPNTPVAIGEGIFICENTHSLSDEELDLFTKLL
FT                   STISIVQFVETKQLSIGGTVAGCGPAFASMFIEALADAGVMHGLARPVAYKLASQMIVG
FT                   TGKLQLATNNHPGAMKDAVCSPSGTTIVGVATLERKGFRSAVIDAIDAIENK"
FT   CDS             complement(819401..819952)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10430"
FT                   /product="Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06021"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIE2"
FT                   /protein_id="CBL06021.1"
FT                   /translation="MGYAIATEAASRGAEVVLVSGITNIKAPENVKLIKVESAREMQKH
FT                   IEEHFADCDITIMSAAVSDYRVKEVASQKIKKSDEVMTIELVKNPDILKGLGEKKSDKQ
FT                   YLVGFAAETQNVEEYAKGKLQRKNLDMIVANDVSQAGAGFNVDTNIAKIITRDGEIKQA
FT                   PLMQKAELAKLILDTIEENK"
FT   CDS             complement(819921..820601)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10440"
FT                   /product="Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06022"
FT                   /db_xref="GOA:D4KIE3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIE3"
FT                   /protein_id="CBL06022.1"
FT                   /translation="MLKGKNILLAVCGGIAVYKVVDVASRLRKLGANVHVVMTKEATNF
FT                   VTPLTFQEISGNPVNVSMWDKVTNWNVEHIALANLADLVLIAPATANIIGKIANGIADD
FT                   MLSTVIMATKAPVFVAPAMNSNMYQNPITQKNINTLREYNYHIIEPASGHLACGVNGIG
FT                   RLPEPITLVETIKDYVEKQNNQSLKGKKVIVSAAGTREPIDPVRYISNRSSGKNGICYC
FT                   YRSC"
FT   CDS             complement(820686..820895)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10450"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /function="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06023"
FT                   /db_xref="GOA:D4KIE4"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIE4"
FT                   /protein_id="CBL06023.1"
FT                   /translation="MDIVHPSMDQLLPKVDSKYTLVVLAAKRARQILAGSPVKSVLQSH
FT                   KDVTNALEEVAEDKITFARVKKSI"
FT   CDS             complement(821148..821543)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10470"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06024"
FT                   /db_xref="GOA:D4KIE5"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIE5"
FT                   /protein_id="CBL06024.1"
FT                   /translation="MKNKGNLIVISGPSGTGKGTVCKELLKAQPEIVFSISATTRKPRP
FT                   GEVNGKDYWFLSKEEFQQMIAENRLLEWAEVYGNYYGTPADKVREVLESGKDVLLEIDT
FT                   QGALNVQKMFLKEGTFIFFITSFSCRT"
FT   CDS             complement(821533..821808)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10480"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06025"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIE6"
FT                   /protein_id="CBL06025.1"
FT                   /translation="MQARLVNIGYGTIIAVDRIIAVVAPESAPIKRIVQEAKELKNLID
FT                   ATYGRRTRSVIIMDNSTVVLSAVQPETITNRVNMDIIKEKGRVNEE"
FT   CDS             complement(822488..822709)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10510"
FT                   /product="Uncharacterized stress-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06026"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIE7"
FT                   /protein_id="CBL06026.1"
FT                   /translation="MTGFGSATFDNGMYKIGVEMKAVNNRYRDISIRMPSGLRALEASI
FT                   VEALNKYALRGKIDIYINFVNNNEENKS"
FT   CDS             823892..824542
FT                   /transl_table=11
FT                   /locus_tag="MHY_10530"
FT                   /product="Predicted RNA-binding protein homologous to
FT                   eukaryotic snRNP"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06027"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIE8"
FT                   /protein_id="CBL06027.1"
FT                   /translation="MSLDGFSLNPLINELNDKLAGGRIDKICQPNKQDIYLYIRQPGQT
FT                   YILYLSINPQNPMANITEFQPDNPPEPPVFCMVLRKQLEGGRIASISQYGLDRMILIDI
FT                   DTLGPKSLIITKTLIAELMGKYSNLILMQDGTIIEAFRRVGENSNRVRTVLPGQNYEVP
FT                   PIQDKINILTTDTNSFIERLKTYQEATLYQAIIASGLGFGPITAKEIIFFSWL"
FT   CDS             824928..825656
FT                   /transl_table=11
FT                   /locus_tag="MHY_10550"
FT                   /product="Predicted RNA-binding protein homologous to
FT                   eukaryotic snRNP"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06028"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIE9"
FT                   /protein_id="CBL06028.1"
FT                   /translation="MTYQYQFKDHQDKEISVANIYDENYAPITIALDTKLTLIQNMQAY
FT                   YKKYDKLKRSTQMLEIQIKRCQKDREYALTIETAIDACTTIADIEDIKAEMIKAGFLPP
FT                   ENKKKASIAPSKPFKFALPNGMFLFVGKNNYQNDKLTFKTAHSDDIWLHTKDIPGSHVI
FT                   IDTKGDEVDEDTLFLAAQIAGYFSKARGSSKIPVDYVECRYLKKPSGAKPGFVIFTNNK
FT                   TLYVTPDEDEIMPIINKDLK"
FT   CDS             complement(825795..827372)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10560"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06029"
FT                   /db_xref="GOA:D4KIF0"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIF0"
FT                   /protein_id="CBL06029.1"
FT                   /translation="MMNNYSSQDFLSVARRITYDATIPELLEEAVRNHEGRLSDKGAIC
FT                   VTTGKHTGRSPKDRFIVDTPDIHDLIHWSNTNQPCSENTFNRLYEKMKDYAKDHQLFVT
FT                   DALVGADPAYKLQIKCINEHAWHHLFLKQLFIRPKTKLTTPAEFTLICMPSVKANPIED
FT                   GTHSETFIIVNFSKKMVLIGGGAYAGEMKKAIFSVMNFILPQRGVLSMHCSANVGKDGN
FT                   SALFFGLSGTGKTTLSADPNRSLIGDDEHGWSEHGIFNVEGGCYAKTIKITPESEPEIY
FT                   NAIQYGTVLENVYINPYTREPDFFDARFTQNTRTAYPIENITNAIVPSMAGHPNAIIFL
FT                   TADAFGVLPPIAKLTKEQAMYHFLSGYTSKVAGTERGITEPQATFSIGFGEPFFPLPPL
FT                   QYARLLGEKINQYNTSVYLVNTGWTGGPYGVGKRMELKYTRAMISAALDGKLDDVTWTK
FT                   HEYFQLNIPDSCPGVPSEVLNPENTWMDKKAYKNQAEKLVRLFAENVKRFAGEMPEEIL
FT                   NAGPRLED"
FT   gap             827522..827820
FT                   /estimated_length=299
FT   CDS             827918..828034
FT                   /transl_table=11
FT                   /locus_tag="MHY_10570"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06030"
FT                   /db_xref="GOA:D4KIF1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIF1"
FT                   /protein_id="CBL06030.1"
FT                   /translation="MELKQLEYFQMTSRLKNITRAAKRLSVSQPNITVAIKN"
FT   CDS             complement(828021..828119)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06031"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIF2"
FT                   /protein_id="CBL06031.1"
FT                   /translation="MRFKNTAPSGVSDNCFWLRSKSCMPSSASNFL"
FT   CDS             828626..828793
FT                   /transl_table=11
FT                   /locus_tag="MHY_10600"
FT                   /product="LysR substrate binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06032"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIF3"
FT                   /protein_id="CBL06032.1"
FT                   /translation="MAFLLDFVVQDTPHIKTLPIEDPIFVDVGLAWKKDRYISKAAQSF
FT                   INFCQDTLNK"
FT   CDS             complement(828925..829668)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10610"
FT                   /product="Uncharacterized protein involved in tellurite
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06033"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIF4"
FT                   /protein_id="CBL06033.1"
FT                   /translation="MMAEYDKLSVQIDKIQGELDKARMSMMKDIVMFDTMYQRNLEYFK
FT                   ELQLYIKAGEEKILELQQHTIPKLRMEAVNSQNQMAVQVVSDFENAVSRFEKKVHDLKL
FT                   SKTIAIQTAPQIRLIQNNDKVLVDKVQSAIYNTIPLWKSQIVIALGLSRQQKVLQMQRE
FT                   VTDTTNELLRRNAEMLKQNTIETARETERGIVDIETVKKVNEDLISTIEETIKIQKDGR
FT                   ERRKLVEAELVQIEDKLKQTLLAHR"
FT   CDS             complement(830089..830223)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06034"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIF5"
FT                   /protein_id="CBL06034.1"
FT                   /translation="MGIFYLLFSWTGIPFIAGFIEGIRYLFMDKDDFYRKFFDNMNRG"
FT   CDS             complement(830557..831039)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10650"
FT                   /product="5-bromo-4-chloroindolyl phosphate hydrolysis
FT                   protein."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06035"
FT                   /db_xref="InterPro:IPR018770"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIF6"
FT                   /protein_id="CBL06035.1"
FT                   /translation="MFLAVITTILAFIGFDMITHFSDIVNLIGAVALGVGVFLTFKPNK
FT                   KKQISLDLDDSENSKLLQENYQKALEDYNYIKGSLKYIRDSELKMHVQDMQKVSLNILQ
FT                   YLQKHPEKITLARRFIDYYQDTVAGLIEKYVEIENTQLNTDSVNDIKERTKILYMD"
FT   CDS             831251..831742
FT                   /transl_table=11
FT                   /locus_tag="MHY_10660"
FT                   /product="HD domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06036"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIF7"
FT                   /protein_id="CBL06036.1"
FT                   /translation="MANINTVLLEMINYYQGDPKRIQHFLKVHNFAKFIAEQENLPSDK
FT                   LYILEIAGLMHDIGIKIAEQKYNSSNGKYQELEGPAPAREILEKLQVDTAVIDRVCFLI
FT                   AHHHTYNNIDDLDYQILIEADFLVNLYEDNCSKQAVENALNRIFKTKTGINLCKTIYGI
FT                   "
FT   CDS             831773..832303
FT                   /transl_table=11
FT                   /locus_tag="MHY_10670"
FT                   /product="Protein of unknown function (DUF619)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06037"
FT                   /db_xref="GOA:D4KIF8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIF8"
FT                   /protein_id="CBL06037.1"
FT                   /translation="MSQNLDIELKPVIPKEYPTFIKNLQEAFSPAIIEKFGTNEYLPSK
FT                   NDILSSLTAKNAEIFHIIYNNQCAGGVVLMIDKNTHYNSLDLFFISPKYHGDGLGLATW
FT                   KTIEKKYPDTITWRTITPYFEQRNIHFYINKCGFHIIEFFNKYHKEKNMPNHINDKPNP
FT                   CIDNYFLFEKKMK"
FT   repeat_region   832505..833130
FT                   /rpt_family="CRISPR"
FT   CDS             complement(833283..834554)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10680"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06038"
FT                   /db_xref="GOA:D4KIF9"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIF9"
FT                   /protein_id="CBL06038.1"
FT                   /translation="MKKFYDVEEKVPLLQGIPLSLQHLFAMFGSTVLVPFLLHVNPATA
FT                   LFMNGIGTILYLIICKGKLPAYLGSSFAFISPVLAVLATSGLSYGDAQGGFIAFGLSFI
FT                   ILSFVVGKLGTAWIDIILPPAAMGAVVAVIGLELAPLALDMSGFISDTMQSQGIPNELA
FT                   MITSVFTLAVAILASVIGRGFLSVIPVLIGVIAGYIMAFCLGIVDWSGVEAASWVQVPT
FT                   FYEPTFNIHAIMIIMPALFVVFAEHIGHVVVTSSIVDRDLIKNPGLNRSLFADGVSNVL
FT                   SGFVGSTPNTTYGENMGVMAITRVYSVWVIGGAAVFAILFSFIGKIAAIIHAIPVPVMG
FT                   GISVLLFGVIACSGIRMLIEKKVDYTSTKNMILTAVTMISGLSGAAVNIGPVQLKGMGL
FT                   AVVCGMILSLSFYVFGKLGIANKE"
FT   CDS             834760..835233
FT                   /transl_table=11
FT                   /locus_tag="MHY_10690"
FT                   /product="Cytosine/adenosine deaminases"
FT                   /EC_number="3.5.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06039"
FT                   /db_xref="GOA:D4KIG0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIG0"
FT                   /protein_id="CBL06039.1"
FT                   /translation="MTKEEFMLIATQEADSNLTTNEGGPFGAVIVKDGKIVGRGHNRVL
FT                   IKHDPTCHAEVEAIRDACQNLGTHDLTGCELYTSCYPCPMCLSATIWANIKKVYYGNTA
FT                   KDADKIGFRDDFIYNYIEGKCQDISVLDLEQFGRDITIKSFDNFAQKTDKTIY"
FT   CDS             complement(835312..836067)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10700"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /function="signal recognition particle-docking protein
FT                   FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06040"
FT                   /db_xref="GOA:D4KIG1"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIG1"
FT                   /protein_id="CBL06040.1"
FT                   /translation="MDDVRAGIKKKQINSPEDLKPFLIKRITEMLNEGSDETNIAKSGP
FT                   TVILVIGVNGVGKTTTIGKLGRYYKEQGKNVMFAAADTFRAAAIDQLEIWGQRVNVPVI
FT                   KHEEGSDPAAVVFDAVKAAIARKVDILIIDTAGRLHNKANLMTELNKIQRVIKREIAEA
FT                   PHETLLVLDATTGQNAISQAELFTKSAPISGLVLTKLDGTAKGGVVIGLKSELSMPVKW
FT                   IGVGEGMDDLRPFVANDFAAALFNQKVEE"
FT   CDS             complement(836257..837462)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10710"
FT                   /product="RecF/RecN/SMC N terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06041"
FT                   /db_xref="GOA:D4KIG2"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIG2"
FT                   /protein_id="CBL06041.1"
FT                   /translation="MEAQVDEKQNLYEDIYNEIEVLKHDLKIRQQKVMQKQISCTEARQ
FT                   EVIRYNDKLNLLTGQAERFKAFLADSDKEMAGLQKVIDDSLAELKQLEESVTNLEKLKT
FT                   DGKEEYDTLYKRQLGMRSELSDMDEERAKIASKVGVIKDKIHKCEVSVAKLETEIKQCL
FT                   QSMQEEYELTPQEALNHRLELDENELKSKLKKLDKELKEIGPVNPNAINEYETLNERYS
FT                   FMSKQIEDLVKAKEDLTKIIEQIDKTMSTQFGLAFDKIKVYFNDIFKRLFGGGNAKLIL
FT                   TNKEDILSSGIEIEVEPPDKKPQSLAVLSGGERTLTVIALLFAFFTYNPAPFSVLDEID
FT                   APLDEANVKRFAKFLKDYAKRTQFILVTHRKGTMESADVMYGVTIEDAGVSKLISVRLE
FT                   DF"
FT   CDS             complement(838177..838344)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06042"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIG3"
FT                   /protein_id="CBL06042.1"
FT                   /translation="MAEEKVKFFQEMQASYEGFGKAVKRVLKADKSWQKWYLWCCSRID
FT                   KGRRSFYYSY"
FT   CDS             complement(838496..839107)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06043"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIG4"
FT                   /protein_id="CBL06043.1"
FT                   /translation="MKNLSAENNKLDLEIKGYEQERASLEATVSVSESEKIAKKSEINK
FT                   LEQKIKLLGENNQKIHEEIERSRNQAILLQERIRQSCQSQQRLEERQNQTKEELKISLA
FT                   DGEELKRKAQIANNTADKLELALQEENSSVQKVENDIKAKEEEIKLKQEQDNEKRKQIE
FT                   EQNKVLLLLKRDMSDIDVNIENQHSAHKNAINEKIEKNNS"
FT   gap             839795..840888
FT                   /estimated_length=1094
FT   CDS             complement(840991..842064)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10760"
FT                   /product="Multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06044"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIG5"
FT                   /protein_id="CBL06044.1"
FT                   /translation="MRKDFFIAEDGRYYYGKRYYKKNKPFIIYSVPIILLIAVVAIFGV
FT                   YKWNQGQGIININDAKLTSSKVMVVAQNDGTLTELLVNDGDKVEAGQVIAKMKVVVTPE
FT                   QIEALQKAYDEAKVNYDNLEQQVKASMVVSQPVVTSSSTGNVAAAQARLDAAAANKQKM
FT                   DKLYSIGAVSATQYAEAQSEYAAAQSALAAASTPQVVEQQASVSSAPSKELSEALATAQ
FT                   IQLNQAKAALDQAQSDDNFADITAPVSGIIYLTDFKQGDELKQGDVFINVGNTKNLWVE
FT                   APLTEEQYAKVHQGQFVHYSVDDMDLTGTVLEVTHQDSEDEENKNLVTAAKISFPDELK
FT                   DKVLPGADVTVQITIDR"
FT   CDS             complement(842351..842893)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10770"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06045"
FT                   /db_xref="GOA:D4KIG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIG6"
FT                   /protein_id="CBL06045.1"
FT                   /translation="MAVLIQENVNDFDFKVKDIVMLGRLPYKKLFDNDTADDFEIVNNA
FT                   LNYVGMQDFAERYFNSLSGGEKQRVMIARILAQQVNFLILDEPTNHLDIKNQFKFFETI
FT                   KSLNYTVFAVLHDLNMATKFCDYVYVLHEGRIYAQGTPQKVFTQNLLKDIFGMEANIHQ
FT                   INEEKIYIEYLNTIKIK"
FT   CDS             complement(843026..843118)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06046"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIG7"
FT                   /protein_id="CBL06046.1"
FT                   /translation="MVLELKDVVIDLDKKQLLIRLILQFPKINL"
FT   CDS             complement(843118..843582)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10790"
FT                   /product="ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06047"
FT                   /db_xref="GOA:D4KIG8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIG8"
FT                   /protein_id="CBL06047.1"
FT                   /translation="MGSVADADWLMVGMVFIAVIIGVFILMLYHRQLNAMLLGEETAHT
FT                   LGVNINKLRWQLVILVALMIGIIVAFCGMIGFVGFVIPHIVRSIFGANHKFVVPISAFI
FT                   GAIFLIYCDILARTIVIPEELPIGIITSILGAPFFIYILERNKYIFGGKK"
FT   CDS             complement(843582..843737)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10800"
FT                   /product="FecCD transport family."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06048"
FT                   /db_xref="GOA:D4KIG9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIG9"
FT                   /protein_id="CBL06048.1"
FT                   /translation="MLILFLLNKQNRDSVRLLLSGCVIAILFSSISSTIMFMAKDKDKI
FT                   SSVVFG"
FT   gap             844049..844790
FT                   /estimated_length=742
FT   CDS             complement(844832..845920)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10820"
FT                   /product="isoaspartyl dipeptidase IadA"
FT                   /EC_number="3.4.19.5"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06049"
FT                   /db_xref="GOA:D4KIH0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010229"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIH0"
FT                   /protein_id="CBL06049.1"
FT                   /translation="MIGEGLSLPAVYDCEVVDCEGNYVVPGFIDSHVHLIGGGGEGGYA
FT                   TRTPEIQLTDITTSGVTTVLGLLGTDGVTRHVASLLAKARGLEDEGITAYIYSGSYEIP
FT                   TPTITGSVRNDIILIDKVIGTGEIAMCDHRSSQSPKEAYQQITAEARVGGMLSGKAGVV
FT                   NMHLGDGEDGLKMLYEITKNGEIPKTQIIPTHVNRNKRLFKEAIEWTKQGGIMDVTSSV
FT                   SPESGSSHSVKSSEAVKQALEAGVNIENITMSSDGNGSMPIFDEAGNNIGVGVASQISI
FT                   LNEFRDMVQKENIAITDAIKIITSNIAKFTKLYPRKGCLANNSDADILVLDKDLQLQHV
FT                   WARGTHMVENGKPIVFGTFEKR"
FT   CDS             complement(845910..846026)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06050"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIH1"
FT                   /protein_id="CBL06050.1"
FT                   /translation="MNTKKTFFTLLKNAHVIAPEDLGVKDILVAGEKNRYDR"
FT   CDS             complement(846042..846530)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10840"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06051"
FT                   /db_xref="GOA:D4KIH2"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIH2"
FT                   /protein_id="CBL06051.1"
FT                   /translation="MSDNKVEVIQKKTILDLFIDGARKGFTIGTTSLLPNVMMAFVIIR
FT                   ILDVTGLLQLIGVVFQPVMGLWGLPGEAATVLITALMSMGGGVGVAMSLYTAGSLDAMQ
FT                   VTVLLPAIYLMGNPVQNVGRCLGIAGVSTKHYPAIILICVINALLSIWAMHFIMLFLQ"
FT   CDS             complement(846545..847042)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10850"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06052"
FT                   /db_xref="GOA:D4KIH3"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIH3"
FT                   /protein_id="CBL06052.1"
FT                   /translation="MVVFGQIPTDKAMSFRGAGGSGAKDGFLFALELIPAVILALGIVN
FT                   VIDGLGGLKAAQKLMNPLLKPLLGVPGVSALANIANMQSTDAAAGMVKELVDEGKLTDK
FT                   ERSVIITYQTSGSAFVTNYFSSGAAAFSILLAPIIVPLLVIFVFKIVGANLMRLYFKFI
FT                   GQ"
FT   CDS             complement(847014..847184)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06053"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIH4"
FT                   /protein_id="CBL06053.1"
FT                   /translation="MDKQKNNDVKISVPWYGYVVFVLAILLFSGIFSSSDGVLRALDFN
FT                   VLNGSFWTDTN"
FT   gap             847849..848124
FT                   /estimated_length=276
FT   CDS             complement(848504..849262)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10890"
FT                   /product="Uncharacterized protein, putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06054"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIH5"
FT                   /protein_id="CBL06054.1"
FT                   /translation="MYLAHLNWQQAKRAFAKDDLVAIIPIGSTEQHGPVGPLGTDFLIP
FT                   DYFAKQIEKRTEVLIVPTVPFGIATHHVEFSGTIDIGFDGLYAVIKGIVDGLSRHGVKK
FT                   FVFLNGHGGNTPALDKVALEANKKGCLCAQIDWWSLAPMLNPVWKGGHGDGQEVSMIMA
FT                   IDEGLINKDDLMETKVNHLSDKLKNIHLNAVDFKGATIKVIRSVDKVVNSGGYGGSDSY
FT                   SANKQWGEDMKVALLDYIVDFVNEFKSVKL"
FT   CDS             complement(849295..850779)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10900"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06055"
FT                   /db_xref="GOA:D4KIH6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIH6"
FT                   /protein_id="CBL06055.1"
FT                   /translation="MTHSLDNNIIPFLAVIITYFGLLTYIGYYATKQTRTLRDYFTMSG
FT                   KAGALLSGLAYFSTQYSMSTFMGVPGTIYKVGYAGMSVSVPGIAFSMVIPALLVGRRLI
FT                   RLGHRYRMLTMADYISDRYESTLMRALLAIIMILFLVPMMGAQTIGAGIIFKTYTGAPE
FT                   WVGIVVMGITVILYCMAGGIRSIMITDVIQGILMVATAVVTFFVSLQLGGGLEVINQHL
FT                   ADTDMSLLSHPGQNNSMPWQNYVSMIIMWSFFTIGQPHLFTKFFTMKNYNVMFKAVLLG
FT                   TLGMWFSATLIEWCGVTGRMSFPNLTGTDTDFIVPLILQAGVHPVISSLMVAGIFSAGM
FT                   STVSGVLITSTSAVTRDLYQKIFNKEATDKDAFIMSRYVTVGLGVLAICIGIYKPSSIF
FT                   QLVLFSFGGLGIWAAPILAGLYWKRATKVGAFASVIVGEIVYILLTTTFTSLTFGFNPL
FT                   IVAWIIAMVVLIVVSLCTKPASAETIRRHFDDLEKC"
FT   CDS             complement(850785..850973)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06056"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIH7"
FT                   /protein_id="CBL06056.1"
FT                   /translation="MYVLIMLPFPWYYATEYIPSFWGTPLFIFGWIFHGLVVIILIFLW
FT                   WQSCKKRPEYKEFGDEE"
FT   CDS             complement(850961..851134)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06057"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIH8"
FT                   /protein_id="CBL06057.1"
FT                   /translation="MIFKCFLVLLCTNVYLAWKLHEYISETLYTDKGGFIMNPFSNSFE
FT                   KKWTFIFYLCMC"
FT   CDS             complement(851124..851246)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06058"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIH9"
FT                   /protein_id="CBL06058.1"
FT                   /translation="MTNFFILYLSPNGNLMVIHNNIPYIIKINGIYQFIKGYDF"
FT   CDS             851230..853200
FT                   /transl_table=11
FT                   /locus_tag="MHY_10940"
FT                   /product="Transcriptional regulator containing PAS,
FT                   AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06059"
FT                   /db_xref="GOA:D4KII0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KII0"
FT                   /protein_id="CBL06059.1"
FT                   /translation="MKKLVIISVGYNTAHTIYEQLCNILYSSVDIKYYYSSSPPPTNLE
FT                   VDLILYSSEYAFERINFRPANVPYIIARRSINYHEISKLFKLPKYSDVLLVNDSKDSAE
FT                   ETILLLQALGIDHINYYPYYPGIDNYPKLKIAITPGETEHVPGFVNHIIDIKTRLVDIT
FT                   SIIEILTHFDILDKFANILSAKYIQDIIKLIKTGNKLLKDSSKMKERFKTVINNVHDGL
FT                   IAINKENKISVFNPIAEKIFAQKATKLIGQDSENFLDDTFFQTVNNPRKEGILKLPSHE
FT                   LLISEIPLYAKNSDNGKLFVLKDVSEIHRLEESVRRRLYQEQNIARYDFSHIVGKSPAL
FT                   QKVLSLAQKMAKSDSTVFIQGESGTGKELLAQSIHNASNRSSGPFVAINFAALSETLLE
FT                   SELFGYVEGSFTGAKKGGSSGLFEAAHKGTLFLDEIGDAPLPFQVKLLRVLQERQIRRV
FT                   GSIKVIPIDVRVIVATNHNLKEHIKAGLMREDLYYRLNVLPIKMPALRERKEDILPLAY
FT                   SFYKKYKPFSLDAKLYFSNIKTCLQNYSWPGNIRELQNVVEYLANICPNEPPQSSDLPE
FT                   DIKSEIFKTPNDIIDLKEEIFAEIKRCNTLRQPVGRRSLAHKFSVSENKIREVLNILHE
FT                   ENRIQIGFGKYSLKSHLKSLL"
FT   CDS             853690..853815
FT                   /transl_table=11
FT                   /locus_tag="MHY_10950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06060"
FT                   /db_xref="UniProtKB/TrEMBL:D4KII1"
FT                   /protein_id="CBL06060.1"
FT                   /translation="MVGIFCPVDIMDENGTVMLPVRNDKHFQEISMGKISLIMIL"
FT   CDS             853812..853964
FT                   /transl_table=11
FT                   /locus_tag="MHY_10960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06061"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="UniProtKB/TrEMBL:D4KII2"
FT                   /protein_id="CBL06061.1"
FT                   /translation="MIVLTHFKGHAMGGYGGSMKNIAIGCADGRIGKSMVHGVSVDNQP
FT                   TDWGQ"
FT   CDS             853983..854306
FT                   /transl_table=11
FT                   /locus_tag="MHY_10970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06062"
FT                   /db_xref="UniProtKB/TrEMBL:D4KII3"
FT                   /protein_id="CBL06062.1"
FT                   /translation="MENMAESAKAVVDYFGKHIVFINVLRRMSVDCDCAGLSAAEPTIP
FT                   DIGILVSTDLLAIDQASIDLVYAQPNNQDLVERIESRHGLHQLTAMRDLKMGNPQYELI
FT                   SIN"
FT   gap             854443..855634
FT                   /estimated_length=1192
FT   CDS             complement(855656..855853)
FT                   /transl_table=11
FT                   /locus_tag="MHY_10980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_10980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06063"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4KII4"
FT                   /protein_id="CBL06063.1"
FT                   /translation="MAVKTLKELNIEDKKRGRYYNYYTGKEWGDPTNYNLVVNVSKFSL
FT                   DEVAEAIIKYIEKVQVNRTK"
FT   CDS             complement(857124..857438)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11010"
FT                   /product="LacY proton/sugar symporter."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06064"
FT                   /db_xref="GOA:D4KII5"
FT                   /db_xref="InterPro:IPR000576"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4KII5"
FT                   /protein_id="CBL06064.1"
FT                   /translation="MVWSKIQLTGMQIGTIYAGNAIFSMVLQPFYGYLSDKIGMKRYLL
FT                   FFIVILVALTGPFFVFVYEPLLKNNFYVGAVIGSFVLSLAYYAGVAVIESFIEKMWSYL
FT                   "
FT   CDS             complement(859274..859642)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06065"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4KII6"
FT                   /protein_id="CBL06065.1"
FT                   /translation="MSAYLHHSAFKDELSRNGIEVINYEMEWNKFDMNYFKRVAVDVFE
FT                   KYPHTDGVYGADMVVCACLGEARKRKLDIPKDIKFIAYDGTFITESSFYNITAIVQPIN
FT                   ILAQKTAQMIVSLIKTKI"
FT   CDS             complement(859579..860196)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11040"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06066"
FT                   /db_xref="GOA:D4KII7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4KII7"
FT                   /protein_id="CBL06066.1"
FT                   /translation="MASIRDVAKLAQVAPSTVSLVLNNKGYVSDASRKKVLDAIKKLNY
FT                   VPNELARNLYRNSTNIIGIIVPDVAHPFFGAFIGALEIALYKYNYKIMVCSTIERENAE
FT                   HEIVDMLRRQMIDGIIMGCHSLEVDLYDNVNKPIVAFDRIINNKIPIIRSDHEKGGRLA
FT                   AQAMLKAGCKYPLQITGIKILQCQHIYIIVHLKMNYLEMELK"
FT   CDS             860402..860683
FT                   /transl_table=11
FT                   /locus_tag="MHY_11050"
FT                   /product="Co-chaperonin GroES (HSP10)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06067"
FT                   /db_xref="GOA:D4KII8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniProtKB/TrEMBL:D4KII8"
FT                   /protein_id="CBL06067.1"
FT                   /translation="MIKPLGDRVVIKVSEGDIKTASGIVLPDTAKEKPQEGTVVAVSEG
FT                   KYVEGKKVALDVKVGDKVIFSKYAGTDVKFDGTDYLIVRDSDILAVVE"
FT   CDS             860741..861844
FT                   /transl_table=11
FT                   /locus_tag="MHY_11060"
FT                   /product="Chaperonin GroEL (HSP60 family)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06068"
FT                   /db_xref="GOA:D4KII9"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D4KII9"
FT                   /protein_id="CBL06068.1"
FT                   /translation="MAKQVLFGEEARQALGRGVDALANAVKVTLGPKGRNVVLDKKFGA
FT                   PTITNDGVTIARDIELEDPFENMGAQLVKEVATKTNDIAGDGTTTATLLAQAMIREGMR
FT                   NVAAGANPMVLKKGIEKAVAALVEEIKAKAQKVEGKEAIAQVASVSSADEETGALIADA
FT                   MEKVGKDGVITVEESKGMQTNLSVVEGMQFDRGYISPYMVTDTDKMEAVMDDPFILITD
FT                   RKISAIADILPILEKVVKQGKELVIIAEDIDGEALATIVVNKLRGTFKALAVKAPGFGD
FT                   RRKAMLEDIAILTGGNVISEELGRKLDSVELEDLGRARQVRASKEETTIVDGFGDKAEI
FT                   AARAEIIKNKSLKLLPISIKKITRTSC"
FT   CDS             861897..862370
FT                   /transl_table=11
FT                   /locus_tag="MHY_11070"
FT                   /product="Chaperonin GroEL (HSP60 family)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06069"
FT                   /db_xref="GOA:D4KIJ0"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIJ0"
FT                   /protein_id="CBL06069.1"
FT                   /translation="MKDKKLRIEDALNATRAAVEEGIVAGGGTTFIDIQPALENIEAEG
FT                   DVKTGVEIVKRAIEEPVRQIANNAGLEGSVVVEHVKSAGVGVGYNALVGEYMDMIAAGI
FT                   VDPAKVTRSALQNAASIAAMVLTTETIVADKPEKADPAAMAGAGMGGGMPGMM"
FT   gap             862446..863220
FT                   /estimated_length=775
FT   CDS             863323..863940
FT                   /transl_table=11
FT                   /locus_tag="MHY_11080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06070"
FT                   /db_xref="InterPro:IPR025570"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIJ1"
FT                   /protein_id="CBL06070.1"
FT                   /translation="MDPDRKQQTNLNDEDDNFIAEYKQEVIHKPWSKTLKLLVAITTLI
FT                   LAAVGTLASFKAASLGNQVVTTQNEAFNHWSNYQAKTIKKTTLETELYTIEIELAKLKD
FT                   TDNALKTELLAKKSIYEQEIAQYKQEEITLTAKAQEAEQRHLLTKEISTNFGNALIFLQ
FT                   IGILLSSLTTLSKIKYYWYIGSISGIIGFSIFITSYYRNLTM"
FT   CDS             865807..866100
FT                   /transl_table=11
FT                   /locus_tag="MHY_11100"
FT                   /product="DNA polymerase III, alpha subunit (gram-positive
FT                   type)"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06071"
FT                   /db_xref="GOA:D4KIJ2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIJ2"
FT                   /protein_id="CBL06071.1"
FT                   /translation="MDILNQNLLKHNLKPVDFSNINFDTLDLVRRFYPNLPNHKLEFLS
FT                   NHFQFETKSNHNSLDDVFATWELLHKLLEDKIIPTAKKRSELINKQKINSFM"
FT   CDS             866796..869018
FT                   /transl_table=11
FT                   /locus_tag="MHY_11120"
FT                   /product="Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /EC_number="1.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06072"
FT                   /db_xref="GOA:D4KIJ3"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIJ3"
FT                   /protein_id="CBL06072.1"
FT                   /translation="MKILIIGGVAAGTKAAAKLKRENRDLDITIIAKDGDISYAGCGLP
FT                   YYIGGFIKDRSSLIVNTPQKYAAMTGVSVLTNVEAITVDNNNHTVIAKNLITNEEASYA
FT                   YDKLIIATGASPITPPIEGIKKQGVFSLRLPNDAVNIRDYVTNNQVKKAVIVGGGFIGL
FT                   EVAENLLAQKVDVTVIDFAPQIMPNVIDPEIASYVQKHLQKHGIRVLTGVAAQEVLGDD
FT                   KVSALKTSAGELSADLVILSVGIRPNTAFLNDTGMEMFKGTILVNEQLQTNLPDIYAIG
FT                   DCAMVSNRMTHSAQWSPMGSSANLESRLLAQILNNTPKNYPGVLGTGIVKLPELNCART
FT                   GLSEKVARDAGYDVETVMAVVDDKAHYYPDASSFITKLIVDKSTHKILGFQALGSGAVD
FT                   KMVDIAVTAISLDATIEQCECMDFCYAPPFSTAIHPFVQTIHIMQNKLSNKLISITPAE
FT                   YLAGKAKDYRVIDAGLAPSIRGAKYVDLAKVNAPIEGIGKDEKLLLVCAKGKRAYFLQN
FT                   RLRHLGYTNTLSLEGGLFFNDVKVKTTSKLTPEEIKAVKALGFLQDKNTEDKFNGRVIT
FT                   RNGKITAQESKVIAEAADKFGSGEITMTSRLTVEIQGVPYDNIEPLREYLMQNAGLETG
FT                   GTGSKVRPVVSCKGTTCQYGLIDTFALSEEIHQRFYKGYRDVKLPHKFKIAVGGCPNNC
FT                   VKPNLNDIGIIGQRVPQIDYAKCHGCKICQPMNRCPMKTLNVVDKK"
FT   gap             869472..869675
FT                   /estimated_length=204
FT   CDS             869701..869913
FT                   /transl_table=11
FT                   /locus_tag="MHY_11140"
FT                   /product="AraC-like ligand binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06073"
FT                   /db_xref="GOA:D4KIJ4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIJ4"
FT                   /protein_id="CBL06073.1"
FT                   /translation="MKEYKETQHSIHYKSLSDLSFYSAGYEKCKPSYSYGPKYRNYQLI
FT                   HFVLSGEGTLHINEQTFNLKQGDAF"
FT   CDS             870021..870533
FT                   /transl_table=11
FT                   /locus_tag="MHY_11150"
FT                   /product="Transcriptional regulator containing an amidase
FT                   domain and an AraC-type DNA-binding HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06074"
FT                   /db_xref="GOA:D4KIJ5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIJ5"
FT                   /protein_id="CBL06074.1"
FT                   /translation="MKKTNDIYIIHNLDITKYKTLIDEIINLQENNVIHYLKANSLLFL
FT                   ILAQLFEDINLSESQMQTKSLANDLKFYFDVNYAEKLILKDIAKKFGIHPNYLTRIFHE
FT                   KFHLSPKQYIMQLKLKKARSLLITTELSISIIASSLGFDDQLAFSRTFKKEFSISPSMY
FT                   RKYYAEK"
FT   CDS             complement(870614..870913)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11160"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06075"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIJ6"
FT                   /protein_id="CBL06075.1"
FT                   /translation="MFKNYIENANFEDTGFSYTLSLIRGKYKMVILYCLMEFNIVRYNE
FT                   LKRYIKTISHKTLAVSLKELEKDGLIIRKEYPQIPPKVEYSLSDRGKIAHGNFR"
FT   CDS             871016..871147
FT                   /transl_table=11
FT                   /locus_tag="MHY_11170"
FT                   /product="Flavodoxin-like fold."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06076"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIJ7"
FT                   /protein_id="CBL06076.1"
FT                   /translation="MHKKICILNGSPRINGNTKELIKYFTKGAETVGHEVTCFDLQK"
FT   CDS             871144..871575
FT                   /transl_table=11
FT                   /locus_tag="MHY_11180"
FT                   /product="NADPH-dependent FMN reductase."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06077"
FT                   /db_xref="GOA:D4KIJ8"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIJ8"
FT                   /protein_id="CBL06077.1"
FT                   /translation="MNIHGCLGCCNGGKNEDAPCIQKDDMSQIYPVYKTADIIVLASPM
FT                   YYWGITGQLKCAFDRLFAIAELNPNYENPQKECILLMASEGNTSDNFAPVKAFYEGLIS
FT                   HLGWKNLGIVYAGGNMNIGDILNKPEQLKQAEDLGKSIQ"
FT   CDS             complement(871742..872122)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11200"
FT                   /product="Domain of unknown function (DUF955)."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06078"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIJ9"
FT                   /protein_id="CBL06078.1"
FT                   /translation="MAFWDAKERNKRKEKINYAKNIKLRVKNLVNKYQTADPFALAKEL
FT                   DVNILYVPLPEKIRGILVRVLRKKTILLNDKLNYEAQKIVICHELGHVRMHWHAGYFFN
FT                   MKEYIILLLVMNVKQMSLLFIC"
FT   CDS             complement(872125..872235)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06079"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIK0"
FT                   /protein_id="CBL06079.1"
FT                   /translation="MGKDKGLEKFLKEAEVLFDGNTYKLNIEEKIRYKKH"
FT   CDS             872410..872757
FT                   /transl_table=11
FT                   /locus_tag="MHY_11220"
FT                   /product="Glycerol dehydrogenase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06080"
FT                   /db_xref="GOA:D4KIK1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIK1"
FT                   /protein_id="CBL06080.1"
FT                   /translation="MNTVFLPSYSVGSDVYNQIPKVCGAYGKTAVVIGGKTAISKAKDA
FT                   LLAGVHNSNIEIIDFIWYGGDSTYANIKKLAQNPQFQKADMVFAVGGGRAIDTCKTLCD
FT                   MENKPVFLSQQ"
FT   CDS             872970..873491
FT                   /transl_table=11
FT                   /locus_tag="MHY_11230"
FT                   /product="Glycerol dehydrogenase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06081"
FT                   /db_xref="GOA:D4KIK2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIK2"
FT                   /protein_id="CBL06081.1"
FT                   /translation="MSHTNALGVQISKNCSDTLLQYGLEALTSAKNHQVSEALEQVVLT
FT                   IIVSTGLVSVLVINDYNSCLAHSIYYGCTMLPQGEKHLHGELVSYGVLVMLLLDKQQTE
FT                   FEKVYAFNRQAKLPTCLKDIEISTKEELDIVLDKVMTTNDIVHVPYKITREMVYDAIMD
FT                   LEIYHQEHLN"
FT   CDS             complement(873541..874044)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11240"
FT                   /product="Organic solvent tolerance protein OstA"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06082"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIK3"
FT                   /protein_id="CBL06082.1"
FT                   /translation="MIKLKLLMKSMFLVCVLMLSMVGVSSASVSVTSDSKYFDISSGCF
FT                   VLEGNVLVKTDTRTIGADKARVNLVTKEVWANGNVYVEEPQEEIKFKGGSVYASDELKT
FT                   AIIKGDAILERPDITIQAEKCSFNWRTKIAEFSGLVEVHQDGKTNVYDVIQYDVINNKI
FT                   IDAK"
FT   CDS             complement(874037..874921)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11250"
FT                   /product="Predicted metal-dependent hydrolase of the
FT                   TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06083"
FT                   /db_xref="GOA:D4KIK4"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIK4"
FT                   /protein_id="CBL06083.1"
FT                   /translation="MMDKIIDCHMHFSAKGIFNKTAENIGLKCTLEEVQNEFKKNNIVL
FT                   GIGMGVDICEENNLSNPQIIYHGKEKFPPFLAQCLGINALAINKENLKDTLDSFKQKLE
FT                   ENSTVGLKIYTGYQPYLATDKKYRDFYKLAQKYDVPVVFHMGDTANSMGKLKYSQPLII
FT                   DEVAVDFPKVKFVIAHCGTPWVADAVEVVAKNKNVYMDLSGLMEGKFKAKKQIKEFKPY
FT                   LNIFRTWFNYLHDYQKLMYGSDWPLVDMKEYIKVIQSIIPKKAYDDVFYHNALKVFDRL
FT                   PKYLKKQEKKIYD"
FT   CDS             complement(875079..876065)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11260"
FT                   /product="Predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06084"
FT                   /db_xref="GOA:D4KIK5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIK5"
FT                   /protein_id="CBL06084.1"
FT                   /translation="MKQMKVGIVGTGLIASLMAKTLNGLNDENIKNYAVASRTLTKAKA
FT                   FADEYKIEKAYGSYMELIQDENIDLIYIAVPHNEHYRIAKLCIENKKNVLCEKPFTVNA
FT                   EETKDLLALAKGNNVLITEAIWTRYMPSRKLINDVIASGIIGQVHSIQANLGYPLKDVK
FT                   RMISPELAGGALLDVGVYTVNFALMVFGNDIKDIFAKAVMSDKGVDLTDSITITWNDGK
FT                   MAVLHASMMTPTDRCGFIYGEKGYICVTNINNPEAIKIYDVEHNLIKEVEIPKQVTGYE
FT                   YEVLACAKAIDKNELECEAMPHKETIFVMEILDKIRNQWNMKYPFEK"
FT   CDS             complement(876080..876295)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06085"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIK6"
FT                   /protein_id="CBL06085.1"
FT                   /translation="MSNLVKKVAKQLGINLTKRKLMQIMPIIGAGIGAAVNASYINDIA
FT                   WTARRSYQLKWLADNEYIDANNLNNI"
FT   CDS             complement(876957..877145)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06086"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIK7"
FT                   /protein_id="CBL06086.1"
FT                   /translation="MILRLIEGSLAPVACLDDDINNCTRADRCPTLILWEKLYDAISEV
FT                   VDNITLADLISWQKNMK"
FT   CDS             complement(877148..877375)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11300"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06087"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIK8"
FT                   /protein_id="CBL06087.1"
FT                   /translation="MKISTKGRYALRLMLDIALNDAKTPVRIKDIAERQQISDKYLEQI
FT                   VSSLNKAGFVKSLRGPQGGYRLTKNQKSIQ"
FT   CDS             complement(877474..877608)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11310"
FT                   /product="Predicted flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06088"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIK9"
FT                   /protein_id="CBL06088.1"
FT                   /translation="MESKLIKDLYCVGEVVDVDAFTGGYNLQAAFSMGFVAGEASSLE"
FT   CDS             complement(877994..878713)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11330"
FT                   /product="Predicted flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06089"
FT                   /db_xref="GOA:D4KIL0"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIL0"
FT                   /protein_id="CBL06089.1"
FT                   /translation="MRKVIVVGGGAAGLMAAVSAAQNGAEVMLLEKNNRLGKKLLITGK
FT                   GRCNVTNTAPLQEFVKNIPGNGRFLYSVFGKFFNWDIRSFFEELDVPLKEERGGRIFPV
FT                   SDKAIDIVNAFEKILHRLAVQIKLNESVKFLKVDNNKVTGVITEEDKLYEADAVILATG
FT                   GSSFPGTGSTGDGYRMAKQIGHTIEDLFPALVPLECEEDWVKDFQGLSLRNVNLKVLVD
FT                   GDVKKKCLVKCYSLILV"
FT   CDS             complement(878724..879245)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11340"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /function="ribosomal large subunit pseudouridine synthase
FT                   B"
FT                   /EC_number="5.4.99.12"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06090"
FT                   /db_xref="GOA:D4KIL1"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIL1"
FT                   /protein_id="CBL06090.1"
FT                   /translation="MLNKPKGYISSVKDEKGRKTVVDILSDVEERIFPIGRLDYNTEGL
FT                   LLLTNDGEFMNKLLHPKYEIGKTYVARIDGIINMEDLDKLANGVKLEDGKTAPADVYLD
FT                   SINKTLKESRVEITIYEGKNRQVRRMFKALGYEVKALKRIAFAGLTLSKLKRGEYRKLT
FT                   ETELLRLRKK"
FT   CDS             complement(879556..880056)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11360"
FT                   /product="Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06091"
FT                   /db_xref="GOA:D4KIL2"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIL2"
FT                   /protein_id="CBL06091.1"
FT                   /translation="MVKKAYNLARKNIEVEMPERDVVIHDIKFQEMTQNGFIFEVVCSK
FT                   GTYIRSLCMDIGKYLGIPTVMSFLIRTHVGAFKLEDAFTTEEIGLLPHMALLSIDFPIK
FT                   HLPKYVISDEEAVMIKQGKQIAVKEDEEVTEKFIRLYKDKEFAGIGRYVFSEHKIAPHK
FT                   VVL"
FT   CDS             complement(880037..880429)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11370"
FT                   /product="Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06092"
FT                   /db_xref="GOA:D4KIL3"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIL3"
FT                   /protein_id="CBL06092.1"
FT                   /translation="MPNGFVNVLKAPGITSHDIVSHLRRVYGLKKVGHAGTLDPAAAGV
FT                   LPVALGKATRMLEYMDDVDKSYKVEVTFGLSTDTGDDTGKIIETMENYTMPTAEKIKEA
FT                   LETFRGEIKQRPPMYSAIRINGEKSV"
FT   CDS             complement(880422..880958)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11380"
FT                   /product="Exopolyphosphatase-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06093"
FT                   /db_xref="GOA:D4KIL4"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIL4"
FT                   /protein_id="CBL06093.1"
FT                   /translation="MNWQFNLEAATCIYTGLCSDTGFFCYSNTTPYTLKAAAELLEIGV
FT                   KPDKISEVFYQRSFSSVKAAGRAIDTIELYHDGKIALMIIDKALKESADNTEGFVNFAR
FT                   NIRGVDVAVMIKYADDEVTRVSMRSKSVNVSEIAQSIGGGGHIRAAGATVYKNLMEAKD
FT                   IVLNAIIKGMNKENA"
FT   CDS             complement(880955..881374)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11390"
FT                   /product="Exopolyphosphatase-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06094"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIL5"
FT                   /protein_id="CBL06094.1"
FT                   /translation="MEVTLKQAGELIEKANKIVLSSHVNPDGDNVGSTLGLYHALKGTN
FT                   KDIKILLDDDLPDNLGMMEGLDLYQKPQDGEIIECDLLVILDVDVDRIGRVKDVVKAPI
FT                   LNLDHHISNTKVSDYCYVDAKAAATAQIVYSLIKK"
FT   CDS             complement(881374..881730)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11400"
FT                   /product="ribosome-binding factor A"
FT                   /function="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06095"
FT                   /db_xref="GOA:D4KIL6"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIL6"
FT                   /protein_id="CBL06095.1"
FT                   /translation="MGSVRIEKVQELIKQEASEIIMRELKDPRIGFVTITEVDVSSDLH
FT                   NAKLYVSILGSDKQIEDTWKGLNSSLGFIRRELAHRIRLKFIPEIKFFMDTSLQYSAHI
FT                   QELLIKVQKDEEQK"
FT   CDS             complement(884055..884369)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11430"
FT                   /product="Ribosomal protein L7Ae/L30e/S12e/Gadd45 family."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06096"
FT                   /db_xref="GOA:D4KIL7"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIL7"
FT                   /protein_id="CBL06096.1"
FT                   /translation="MNNKVKLINIVSIACRAGKVMSGEFVIEKALSSKNNIKLILLAND
FT                   VADATKAKYEKMAKNSKVLVRYTELTKDEMANSIGKTDRAAIAICDEGFKKAILKILDN
FT                   "
FT   CDS             complement(884362..884628)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11440"
FT                   /product="Predicted nucleic-acid-binding protein implicated
FT                   in transcription termination"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06097"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIL8"
FT                   /protein_id="CBL06097.1"
FT                   /translation="MKKLPVRLCVGCQEPHNKREMIRIVKSPEGEFSVDFTSKKSGRGA
FT                   YICKNIECLNTAMKQRRLEKSFKCQIDNSVYEQLKEEFAKLDE"
FT   CDS             complement(884648..884845)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06098"
FT                   /db_xref="GOA:D4KIL9"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIL9"
FT                   /protein_id="CBL06098.1"
FT                   /translation="MSRVIVPDYQLSLAIGKEGQNARLAAKLTGWKIDIKSETQAAEEG
FT                   FDSDDMNMVNVVSEESFSVD"
FT   CDS             complement(885560..885763)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11470"
FT                   /product="NusA N-terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06099"
FT                   /db_xref="GOA:D4KIM0"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIM0"
FT                   /protein_id="CBL06099.1"
FT                   /translation="MATKDKGFLDALKEVGQEKGIAPEVLFEAVEAALVSAYKRNFNTA
FT                   SNVRVYLERATGEFHVYAQKKL"
FT   CDS             complement(885792..885902)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06100"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIM1"
FT                   /protein_id="CBL06100.1"
FT                   /translation="MITGKLTGYTKDIITIDETREIALKDIALVRLHIDF"
FT   CDS             complement(885899..886237)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11490"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06101"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIM2"
FT                   /protein_id="CBL06101.1"
FT                   /translation="MANRVEEAVEKIAEEILANTDYELVDVEYVKERDWFLRVYIDKEG
FT                   GIGLDDCQEVSGLLDEKLEELNIINDRYILEVSSPGLDRALKKEKILNAKWANWWILHY
FT                   IRLLMVKK"
FT   CDS             complement(886669..887013)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11500"
FT                   /product="Predicted RNA-binding protein containing a PIN
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06102"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIM3"
FT                   /protein_id="CBL06102.1"
FT                   /translation="MNRSRTYLTPNRHEKYMVVDGYNIINAWESLKKFINDDLDFAREK
FT                   LIHLLMEYGQYEKYDITIVFDAQYTNAEENVEEKSKHCKVVYTKEKKQLIVILNAVYMK
FT                   LLNIMVEKYM"
FT   CDS             887095..887601
FT                   /transl_table=11
FT                   /locus_tag="MHY_11510"
FT                   /product="peptide deformylase"
FT                   /function="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06103"
FT                   /db_xref="GOA:D4KIM4"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIM4"
FT                   /protein_id="CBL06103.1"
FT                   /translation="MLKFISVNFEFIGGIFVAILDIKKAGDLVLKQQAQPIERIDKTIR
FT                   TLLDDMAETMYKANGVGLAAPQVGQSIQVVVIDVGEGLLELINPTIIRKEGTEIDTEGC
FT                   LSVPEIYGEVERAAKVSVEYLNRRGRRHRITATGLLARCLQHEIDHLHGRLFIDIANNL
FT                   HKAQK"
FT   CDS             887614..887832
FT                   /transl_table=11
FT                   /locus_tag="MHY_11520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06104"
FT                   /db_xref="GOA:D4KIM5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR015518"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIM5"
FT                   /protein_id="CBL06104.1"
FT                   /translation="MPIKNIVFMGTPEFAVPCLDILNQHYNVTAVYTQPDRPKGRGQKL
FT                   AMSPVKEYALKHNLPVYQPEKSKHQNV"
FT   CDS             complement(887882..887992)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06105"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIM6"
FT                   /protein_id="CBL06105.1"
FT                   /translation="MIDQWIGAAPRQRGNNEPCTFTQPSGGISSISLERI"
FT   CDS             888024..888548
FT                   /transl_table=11
FT                   /locus_tag="MHY_11540"
FT                   /product="Methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06106"
FT                   /db_xref="GOA:D4KIM7"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR015518"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIM7"
FT                   /protein_id="CBL06106.1"
FT                   /translation="MYMDVGLDTGDMILKATTEITPDMTTEQLHDKLMVQGADLLLQTV
FT                   QLIEENKTPREKQDDNLSCYAKMLNNDNCRIDWTKSAQDIHNLVRGLNSWPVAYTTLNN
FT                   KKFKIWQTRVTTGTGNPGQIIKLTKQSIIVATGEGAIELLEIQPPNKAKMPASSYINGH
FT                   KQELENNVSFI"
FT   CDS             complement(888744..888923)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06107"
FT                   /db_xref="UniProtKB/TrEMBL:D4KIM8"
FT                   /protein_id="CBL06107.1"
FT                   /translation="MIIGKRKLIKLKIYLSRKEKIFIFAMLKIIFRMNRQQKINKMLTK
FT                   VKAIKAKSKTTRRG"
FT   CDS             complement(889934..890146)
FT                   /transl_table=11
FT                   /locus_tag="MHY_11580"
FT                   /product="Dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:MHY_11580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL06108"
FT                   /db_xref="GOA:D4KIM9"
FT                   /db_xref="InterPro:IPR00