spacer

EBI Dbfetch

ID   FP929043; SV 1; linear; genomic DNA; STD; PRO; 3698419 BP.
XX
AC   FP929043;
XX
PR   Project:PRJNA39161;
XX
DT   25-MAR-2010 (Rel. 104, Created)
DT   25-MAR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Eubacterium rectale M104/1 draft genome.
XX
KW   .
XX
OS   Eubacterium rectale M104/1
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Eubacteriaceae;
OC   Eubacterium.
XX
RN   [1]
RG   metaHIT consortium -- http://www.metahit.eu/
RA   Pajon A., Turner K., Parkhill J., Duncan S., Flint H.;
RT   "The genome sequence of Eubacterium rectale M104/1";
RL   Unpublished.
XX
RN   [2]
RA   Pajon A.;
RT   ;
RL   Submitted (23-MAR-2010) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
XX
DR   MD5; 81bfd5249f9a59d16308e3a23b4b7fdd.
DR   EnsemblGenomes-Gn; ERE_R_37120.
DR   EnsemblGenomes-Gn; ERE_R_37130.
DR   EnsemblGenomes-Gn; ERE_T_36600.
DR   EnsemblGenomes-Gn; ERE_T_36610.
DR   EnsemblGenomes-Gn; ERE_T_36620.
DR   EnsemblGenomes-Gn; ERE_T_36630.
DR   EnsemblGenomes-Gn; ERE_T_36640.
DR   EnsemblGenomes-Gn; ERE_T_36650.
DR   EnsemblGenomes-Gn; ERE_T_36660.
DR   EnsemblGenomes-Gn; ERE_T_36670.
DR   EnsemblGenomes-Gn; ERE_T_36680.
DR   EnsemblGenomes-Gn; ERE_T_36690.
DR   EnsemblGenomes-Gn; ERE_T_36700.
DR   EnsemblGenomes-Gn; ERE_T_36710.
DR   EnsemblGenomes-Gn; ERE_T_36720.
DR   EnsemblGenomes-Gn; ERE_T_36730.
DR   EnsemblGenomes-Gn; ERE_T_36740.
DR   EnsemblGenomes-Gn; ERE_T_36750.
DR   EnsemblGenomes-Gn; ERE_T_36760.
DR   EnsemblGenomes-Gn; ERE_T_36770.
DR   EnsemblGenomes-Gn; ERE_T_36780.
DR   EnsemblGenomes-Gn; ERE_T_36790.
DR   EnsemblGenomes-Gn; ERE_T_36800.
DR   EnsemblGenomes-Gn; ERE_T_36810.
DR   EnsemblGenomes-Gn; ERE_T_36820.
DR   EnsemblGenomes-Gn; ERE_T_36830.
DR   EnsemblGenomes-Gn; ERE_T_36840.
DR   EnsemblGenomes-Gn; ERE_T_36850.
DR   EnsemblGenomes-Gn; ERE_T_36860.
DR   EnsemblGenomes-Gn; ERE_T_36870.
DR   EnsemblGenomes-Gn; ERE_T_36880.
DR   EnsemblGenomes-Gn; ERE_T_36890.
DR   EnsemblGenomes-Gn; ERE_T_36900.
DR   EnsemblGenomes-Gn; ERE_T_36910.
DR   EnsemblGenomes-Gn; ERE_T_36920.
DR   EnsemblGenomes-Gn; ERE_T_36930.
DR   EnsemblGenomes-Gn; ERE_T_36940.
DR   EnsemblGenomes-Gn; ERE_T_36950.
DR   EnsemblGenomes-Gn; ERE_T_36960.
DR   EnsemblGenomes-Gn; ERE_T_36970.
DR   EnsemblGenomes-Gn; ERE_T_36980.
DR   EnsemblGenomes-Gn; ERE_T_36990.
DR   EnsemblGenomes-Gn; ERE_T_37000.
DR   EnsemblGenomes-Gn; ERE_T_37010.
DR   EnsemblGenomes-Gn; ERE_T_37020.
DR   EnsemblGenomes-Gn; ERE_T_37030.
DR   EnsemblGenomes-Gn; ERE_T_37040.
DR   EnsemblGenomes-Gn; ERE_T_37050.
DR   EnsemblGenomes-Gn; ERE_T_37060.
DR   EnsemblGenomes-Gn; ERE_T_37070.
DR   EnsemblGenomes-Gn; ERE_T_37080.
DR   EnsemblGenomes-Gn; ERE_T_37090.
DR   EnsemblGenomes-Gn; ERE_T_37100.
DR   EnsemblGenomes-Gn; ERE_T_37110.
DR   EnsemblGenomes-Tr; ERE_R_37120.
DR   EnsemblGenomes-Tr; ERE_R_37130.
DR   EnsemblGenomes-Tr; ERE_T_36600.
DR   EnsemblGenomes-Tr; ERE_T_36610.
DR   EnsemblGenomes-Tr; ERE_T_36620.
DR   EnsemblGenomes-Tr; ERE_T_36630.
DR   EnsemblGenomes-Tr; ERE_T_36640.
DR   EnsemblGenomes-Tr; ERE_T_36650.
DR   EnsemblGenomes-Tr; ERE_T_36660.
DR   EnsemblGenomes-Tr; ERE_T_36670.
DR   EnsemblGenomes-Tr; ERE_T_36680.
DR   EnsemblGenomes-Tr; ERE_T_36690.
DR   EnsemblGenomes-Tr; ERE_T_36700.
DR   EnsemblGenomes-Tr; ERE_T_36710.
DR   EnsemblGenomes-Tr; ERE_T_36720.
DR   EnsemblGenomes-Tr; ERE_T_36730.
DR   EnsemblGenomes-Tr; ERE_T_36740.
DR   EnsemblGenomes-Tr; ERE_T_36750.
DR   EnsemblGenomes-Tr; ERE_T_36760.
DR   EnsemblGenomes-Tr; ERE_T_36770.
DR   EnsemblGenomes-Tr; ERE_T_36780.
DR   EnsemblGenomes-Tr; ERE_T_36790.
DR   EnsemblGenomes-Tr; ERE_T_36800.
DR   EnsemblGenomes-Tr; ERE_T_36810.
DR   EnsemblGenomes-Tr; ERE_T_36820.
DR   EnsemblGenomes-Tr; ERE_T_36830.
DR   EnsemblGenomes-Tr; ERE_T_36840.
DR   EnsemblGenomes-Tr; ERE_T_36850.
DR   EnsemblGenomes-Tr; ERE_T_36860.
DR   EnsemblGenomes-Tr; ERE_T_36870.
DR   EnsemblGenomes-Tr; ERE_T_36880.
DR   EnsemblGenomes-Tr; ERE_T_36890.
DR   EnsemblGenomes-Tr; ERE_T_36900.
DR   EnsemblGenomes-Tr; ERE_T_36910.
DR   EnsemblGenomes-Tr; ERE_T_36920.
DR   EnsemblGenomes-Tr; ERE_T_36930.
DR   EnsemblGenomes-Tr; ERE_T_36940.
DR   EnsemblGenomes-Tr; ERE_T_36950.
DR   EnsemblGenomes-Tr; ERE_T_36960.
DR   EnsemblGenomes-Tr; ERE_T_36970.
DR   EnsemblGenomes-Tr; ERE_T_36980.
DR   EnsemblGenomes-Tr; ERE_T_36990.
DR   EnsemblGenomes-Tr; ERE_T_37000.
DR   EnsemblGenomes-Tr; ERE_T_37010.
DR   EnsemblGenomes-Tr; ERE_T_37020.
DR   EnsemblGenomes-Tr; ERE_T_37030.
DR   EnsemblGenomes-Tr; ERE_T_37040.
DR   EnsemblGenomes-Tr; ERE_T_37050.
DR   EnsemblGenomes-Tr; ERE_T_37060.
DR   EnsemblGenomes-Tr; ERE_T_37070.
DR   EnsemblGenomes-Tr; ERE_T_37080.
DR   EnsemblGenomes-Tr; ERE_T_37090.
DR   EnsemblGenomes-Tr; ERE_T_37100.
DR   EnsemblGenomes-Tr; ERE_T_37110.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01699; Clostridiales-1.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02033; HEARO.
DR   SILVA-LSU; FP929043.
DR   SILVA-SSU; FP929043.
XX
CC   This is a reference genome for the metaHIT project
CC   DNA source: Rowett Institute of Nutrition and Health, University of
CC   Aberdeen -- http://www.rowett.ac.uk/divisions/ghp/
CC   Sequencing technology: 454
CC   Genome coverage: 21x
CC   Annotation was added using ab initio prediction IMG/ER --
CC   http://img.jgi.doe.gov/submit (Markowitz, Szeto et al. 2007).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3698419
FT                   /organism="Eubacterium rectale M104/1"
FT                   /strain="M104/1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:657317"
FT   CDS             complement(71..1711)
FT                   /transl_table=11
FT                   /locus_tag="ERE_00100"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92169"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMG5"
FT                   /protein_id="CBK92169.1"
FT                   /translation="MAIKYTEEQLNTVDKSIIIQMFLNQQEELSKAVNQIEQLTKEVQS
FT                   GNDKLQRMMEQIILSNNARFGRSSEKMDNTDQISFMEVDGNIIFFNESEAVCDLSAEEP
FT                   EDLEPKPRGKKKVGKKEADMSGLPVNRVNHYMTEEELIAEFGENGWKQLPDAISKRYKF
FT                   IPAKVIVTEHHVGVYASKKDNRIVKADYPKALLKGSPVSASIAAAIMNGKYVNAFPLYR
FT                   LEKEFERYGLAITRQNMANWMIRLGETYISVMYDYLHKLIYDYHVIQADETPVLVNKDG
FT                   RAAGSKSYMWVYRSGYMNPEQQIILYDYQLTRNASHPREFLKDFSGICVTDGYQVYHTL
FT                   EKEKENLTIAGCWVHMRRRFEQALQVIPKGSQKGTVSYIAMKQIQAIYREEGKLKDLTS
FT                   NERLEQRQAIIKPLVDALFMYLKQNQANVSGSCKLQDAFKYALNQEKYLKVFLTDGDVP
FT                   IDNNASERAIRGFCVGKKNWQMIDTINGAKTSAMIYSIAETAKANNLKPYDYFEYLLEE
FT                   IPKHMEDTDRSFLEDLLPWSENLPAHIRK"
FT   CDS             complement(1985..2347)
FT                   /transl_table=11
FT                   /locus_tag="ERE_00110"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92170"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMG6"
FT                   /protein_id="CBK92170.1"
FT                   /translation="MLNNATGFKKIYIACGQTDLRRGIEGLANIIRFQFQLDPYDKDTL
FT                   FLFCGKKNTRIKGLLWEGDGFLLLYKRLDVGAFSWPRNTAEALEITSEQYKLLMEGFSI
FT                   VAKRPITELTNPPRAI"
FT   CDS             complement(2340..2723)
FT                   /transl_table=11
FT                   /locus_tag="ERE_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92171"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMG7"
FT                   /protein_id="CBK92171.1"
FT                   /translation="MGKSTSVKREIRFQQWIQQVKEYNERPDGMSMSAWCKTRGIAQST
FT                   FATRLQKVQDRCLESCQISAESSELSVSSEPAMPAFVELPVTKYSCEDKPAAVISCPNF
FT                   KIEISESVSEAFLLKLIGVMKHA"
FT   CDS             2883..3173
FT                   /transl_table=11
FT                   /locus_tag="ERE_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92172"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMG8"
FT                   /protein_id="CBK92172.1"
FT                   /translation="MMIGGLNSLIHFADQQYFSSMTDTYTDYILDFLASQGVDTSREFV
FT                   INGTHCELVNGKICEVGNDYVVPSAIQQKAVKRYEESMSQLLNSGTWYRWS"
FT   CDS             3256..3543
FT                   /transl_table=11
FT                   /locus_tag="ERE_00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92173"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMG9"
FT                   /protein_id="CBK92173.1"
FT                   /translation="MQSISSYINPNTRALTSNYKNTVIKDKEAYNGAMLQHLLNPVEDL
FT                   AQALKTPIKLAKGASISRQNNSVNIAEGQSIRVNGGHVLTVTAHSKNGWC"
FT   CDS             3530..3670
FT                   /transl_table=11
FT                   /locus_tag="ERE_00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92174"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMH0"
FT                   /protein_id="CBK92174.1"
FT                   /translation="MAGVEENDIDRLLANPPEKIEIEVKYKIAVTVMELRFWLKDCESP
FT                   I"
FT   CDS             3697..4347
FT                   /transl_table=11
FT                   /locus_tag="ERE_00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92175"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMH1"
FT                   /protein_id="CBK92175.1"
FT                   /translation="MKNKSINQVSIINGEDGPTSVFIFGEAQKQSLKIRIRNAIYQSRR
FT                   KRIEKRIAANPHTLAEVVQYAKDHYDLVEINPAATNWIERQKNLKASLIMQHKPELLGQ
FT                   RKDIPKPDFHNEESVKNFLNEMEIRNKLIDQMPDNVIPMDFHLYEIKIGEDLMEIEVDY
FT                   TWNIFGISYSGNKSVIKRFKKIARDLYCYYGVSEEDIKNRTKRYSSLVTELSS"
FT   CDS             5249..5359
FT                   /transl_table=11
FT                   /locus_tag="ERE_00180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92176"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMH2"
FT                   /protein_id="CBK92176.1"
FT                   /translation="MLSHRHIYYDIMWLCEKNFFFELICLYDKQNGGFAR"
FT   CDS             5356..5880
FT                   /transl_table=11
FT                   /locus_tag="ERE_00190"
FT                   /product="NADPH-dependent FMN reductase."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92177"
FT                   /db_xref="GOA:D4JMH3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMH3"
FT                   /protein_id="CBK92177.1"
FT                   /translation="MKVIIINGSARKGNTLTAIEAFVKGASEKNEIEIIEPDKLNIAPC
FT                   KGCGVCQCSKGCVDKDDTNPTIDKIAAADMILFATPVYWWGMSAQLKLIIDKCYCRGLQ
FT                   LKNKKVGTIVVGGSPVDSIQYELIDKQFDCMAKYLSWNLLFQKSYYATAKDELSKNQDA
FT                   MKELEDIGKEL"
FT   gap             6211..6875
FT                   /estimated_length=665
FT   CDS             7142..7519
FT                   /transl_table=11
FT                   /locus_tag="ERE_00210"
FT                   /product="Predicted phosphatase homologous to the
FT                   C-terminal domain of histone macroH2A1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92178"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMH4"
FT                   /protein_id="CBK92178.1"
FT                   /translation="MIELKQYIDNIVLNSNMFFSVAVPIMREINTNIRRLSAHTTIMTY
FT                   EELVNTRQRILGIRSIAFPSISTGAYSFPVVLAAKIAVRTVARFLHENPDSFDLVEWVL
FT                   FDTQTESVYEAEVTLYYNIRI"
FT   CDS             7564..8091
FT                   /transl_table=11
FT                   /locus_tag="ERE_00220"
FT                   /product="Amidases related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92179"
FT                   /db_xref="GOA:D4JMH5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMH5"
FT                   /protein_id="CBK92179.1"
FT                   /translation="MVILVVDAQNGIVDERLYEFRKFVGNIKKLIGAAREQGIEVIYVQ
FT                   HDDGPGTGFSIGDDEFEVYSEFKPMPDEKRFIKSVCSSFKKESGLLEYLTAKEEKDVMI
FT                   CGIMTDFCINATVEAGFEHGLHMIVPAYANSTQDNEYMTREQAYHYYNEFLWPERYADC
FT                   VPMDRALELLKK"
FT   CDS             8259..8324
FT                   /transl_table=11
FT                   /locus_tag="ERE_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92180"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMH6"
FT                   /protein_id="CBK92180.1"
FT                   /translation="MKNDEPEIKPAYKNPLMEHYR"
FT   CDS             8321..8503
FT                   /transl_table=11
FT                   /locus_tag="ERE_00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92181"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMH7"
FT                   /protein_id="CBK92181.1"
FT                   /translation="MKTAIVYASVHHGNTKKIIDEIAKTNDVELIDATQTVEKDLSEGF
FT                   HARDLIRSVRSVRSR"
FT   CDS             8500..8592
FT                   /transl_table=11
FT                   /locus_tag="ERE_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92182"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMH8"
FT                   /protein_id="CBK92182.1"
FT                   /translation="MIGGVSKGHPDEKDIAAAIEFYNGLKLKYD"
FT   CDS             8669..9244
FT                   /transl_table=11
FT                   /locus_tag="ERE_00260"
FT                   /product="Chromate transport protein ChrA"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92183"
FT                   /db_xref="GOA:D4JMH9"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMH9"
FT                   /protein_id="CBK92183.1"
FT                   /translation="MKLICSLFITFLKIGAFTFGGGYAMIALLENEFVEKKKWLEKSEF
FT                   LDMVAVAESTPGPVAVNSATYIGYKIAGFAGATMSTLAVCIPSFFVIYGISLFFDQFLS
FT                   LRWVFCAFRGIQVCVIYLILTAGLKMLKSIDKNTLNLTLLTLVMASMLCCSITAVSFSS
FT                   VFYILICGAVGLVVFFLRKIRKGDGKKS"
FT   CDS             9241..9807
FT                   /transl_table=11
FT                   /locus_tag="ERE_00270"
FT                   /product="Chromate transport protein ChrA"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92184"
FT                   /db_xref="GOA:D4JMI0"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMI0"
FT                   /protein_id="CBK92184.1"
FT                   /translation="MIYLRLFLNFLMIGALSFGGGYGMVSLVRERVLSNGWLTENEFLN
FT                   FIAVSESTPGPLAVNMATFIGSTQGGILGSFVATLGVVLPSFLIILLIASALKNLMKYA
FT                   PVNAFLSGVRPCVVAMILATALSMALSTLFGLTDLQAGFAPDLRSIAVFAMLGATHLIC
FT                   KIIRKTAPSPILMILFSAGLGILFW"
FT   CDS             complement(10068..10502)
FT                   /transl_table=11
FT                   /locus_tag="ERE_00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92185"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMI1"
FT                   /protein_id="CBK92185.1"
FT                   /translation="MEWFNVFGLIFIAVIMIPNVVFAIKCKDGFDNKWNNKYVEVTEQV
FT                   GRLGCFGFMIINIPGTWFGWWSDETFAVYLIVDTILVMLYCAIWIICFKKNSIFRALAL
FT                   SIIPSMLFLFSGIMSRSVLLIIASVLFAPSHIVISYKNVK"
FT   CDS             complement(10528..10845)
FT                   /transl_table=11
FT                   /locus_tag="ERE_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92186"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMI2"
FT                   /protein_id="CBK92186.1"
FT                   /translation="MKIIIIFIDLLMATVLFFVGRFFIKSRNTERSVLFLSGDYTGLNT
FT                   EKICRVTGKRIKTWAMLFCLGGIIDFIKLGAGIIIVSVFFIILLVFHLVDMTINRDKYR
FT                   V"
FT   tRNA            11666..11740
FT                   /locus_tag="ERE_T_36600"
FT   CDS             12220..12471
FT                   /transl_table=11
FT                   /locus_tag="ERE_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92187"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMI3"
FT                   /protein_id="CBK92187.1"
FT                   /translation="MQHGFGESEISWTTTGKANIILDNLIEMGKIKPFTLVMSDGMVQE
FT                   KVGSEERLNYVLLERMLVEEIIPMAEKKYQFGGRKKTL"
FT   CDS             12491..12697
FT                   /transl_table=11
FT                   /locus_tag="ERE_00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92188"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMI4"
FT                   /protein_id="CBK92188.1"
FT                   /translation="MDDPDFNNYFHTFFRCIGDNDCFRSRFLEEDAIIQEKGVHEIRKI
FT                   YPGGHDWNVWRPCFTDFAQMIFR"
FT   CDS             complement(12791..14395)
FT                   /transl_table=11
FT                   /locus_tag="ERE_00320"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /function="two component transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92189"
FT                   /db_xref="GOA:D4JMI5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMI5"
FT                   /protein_id="CBK92189.1"
FT                   /translation="MKNVMIVDDNCLTAEGIEKNIDWSALDATVIAVEYNSLSALDILK
FT                   DTHVDLIISDIEMPDLDGISMSQKALEIQPFIKVILVSAYDKFEYAKRAIRLCVYDYIE
FT                   KPLDYHYLTEKIKNAFTDIDRTQKNTELVKASRPVMTEKFFHDLLHYPGVDPATHLSQY
FT                   LKYLDLRSDYDFFDVLILETEPDPAKSELDFTQYQIQLLNILNLVKEEMEIFDNVFYLK
FT                   EFSGIVCIIGQNSKHPQHFLQVIHQVASTIVESCKNNVLSLNIGIGSLADSIWKLPVSF
FT                   ASASNSLKYLFFFPHKNIFDAREALGKELNLLSFSENTDEELIRLICSKDMTAIEEWIT
FT                   CYFQNLLGQVQDKNLVFIRIYSLLGRILKFLYEMNLDTEDLEREIIQVYTRFDSFRTYE
FT                   QFVKWLTQLCASVCEKMDSSLQNYHNQIYTMALGYIRENFETNTLCLNDIARHANISPA
FT                   YLSSLFKKVSGQSISDTITALRIESACHYLESTSLSLKEISTKCGYTNQYYFSNSFKKK
FT                   LGMSPSAYREARGTQGQ"
FT   CDS             complement(15407..16198)
FT                   /transl_table=11
FT                   /locus_tag="ERE_00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92190"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMI6"
FT                   /protein_id="CBK92190.1"
FT                   /translation="MKHSKKGSRGPRLYFSHFQNRILCAFLLCTLIPIFIIGGISYAVS
FT                   YNIAKDKILNASISADAQLHTQFDNRLQQVENIADTLQYNMYNLMQADAPMDTLAMLSE
FT                   IRSNLSMFKTSFDLAYINIFLPDEHMASSESLYFFPMSKLSDFQIPKEVLENPGTSSVW
FT                   FYQDLLSVPFLVNNSYHITNSVSCCRVLKHPDTDSIKYAYIIYLDASEFSSILQEIFQD
FT                   NQITSYILTDNRKSLPATILLCFLHLLTKKNWISYTTREIL"
FT   gap             16462..17709
FT                   /estimated_length=1248
FT   CDS             17733..18986
FT                   /transl_table=11
FT                   /locus_tag="ERE_00350"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92191"
FT                   /db_xref="GOA:D4JMI7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMI7"
FT                   /protein_id="CBK92191.1"
FT                   /translation="MKKKLVSVLLAGVMTVGMLAGCGSSKGESTEKSKDYDLTLYSVMT
FT                   TDPDFDEWLKNVEDATGLNINVIAAPTDSDTRQQKVTTVLSTGDASIDIIEINDEMSAS
FT                   FKNSGWLEGLNDTVMTEDVRSQFAQGYLKNMITDKDGNIVGVPGYTGYLAFWVNQKIMD
FT                   EVGITEIDTKEDFMKYMKAASGDGRYGYGGSWEKTYAYNEIAQFVNMFGGDYFDWTKAE
FT                   NKEAIQFMKDMVDNNQTPIDQIADKYEQMNPKINDGKYGSFFMWGLGTDYQKAGMLGDD
FT                   KIHMAMVPDFSGKGERAIFTDSWNYVLNSASKHKEAAIKFLKYMTEEGGMEASYKAFER
FT                   YPARADIAEKVVPDTDPAKEMYSRYASECNVNGRPMLPQTMEFITDMGTIFQSCMKDEI
FT                   SVDEFCEKAQGLVEKYSK"
FT   CDS             20026..20880
FT                   /transl_table=11
FT                   /locus_tag="ERE_00370"
FT                   /product="ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92192"
FT                   /db_xref="GOA:D4JMI8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMI8"
FT                   /protein_id="CBK92192.1"
FT                   /translation="MQDTNKYKVYKAITAVGKWLLFAIVSFLILFPVLWIFVSSITPPG
FT                   ELFKMPIDYIPDHPTLESYKFLIENVGLLEKIGNTVLIVGVTIVVSTVICAMAAYGFSR
FT                   FRTKGISIAFAFIIATMLIPEVVTARPLYDFMRAVGLYDTYPGLIILYISAVIPFTVLI
FT                   LKNFASEIPISLEEAATIDGANFVQRLFKVVLPLMKPAIATVCIINFITCLNNFFTPLY
FT                   YSNNIQVLSVAIVQLPLRDNMYGVPWDLVSAMGWIILLPIIIFVAVFEKQIMDGIMAGG
FT                   VKA"
FT   CDS             20989..22101
FT                   /transl_table=11
FT                   /locus_tag="ERE_00380"
FT                   /product="Protein of unknown function (DUF2961)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92193"
FT                   /db_xref="InterPro:IPR021345"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMI9"
FT                   /protein_id="CBK92193.1"
FT                   /translation="MYNEFGGTLSNLALAKHRKSRAINAENPRGEKGKGGMAASDLGPS
FT                   RKGSPCLNDIASGQTVTLAEIEGPGAINHIWITVDAKTTDADCFVLRDLVLRMYWDDED
FT                   EPSVESPLGDFFCCGFGRECNINSMPIAVVPSRGLNCYFQMPFRKKARITLENQHVNSI
FT                   PAFFYQVDYCLYDEGLPEDIAYFHAQWRREKITQLQKDYVILDNVKGKGHYVGTYMALT
FT                   TLERYWWGEGEVKFYIDGDEEYPTICGTGTEDYFGGSWSFAKQVDGKTVEQNYCTPYLG
FT                   YPYYSSHDELIHNFYHNDDVMPMRGFYRWHIQDPICFDEDLKVTIQQIGVGYRGLFERQ
FT                   DDVASVAYWYQAEPHNSFPELPGKEERWPR"
FT   CDS             complement(23536..23754)
FT                   /transl_table=11
FT                   /locus_tag="ERE_00400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92194"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMJ0"
FT                   /protein_id="CBK92194.1"
FT                   /translation="MSDAEVKDLNQISKKDIYHTPSGKYIQFIHDHSEKTFDAWEPLPD
FT                   GSHRLLESQSTTIETFDEFKEKIIGKN"
FT   CDS             complement(23757..23960)
FT                   /transl_table=11
FT                   /locus_tag="ERE_00410"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92195"
FT                   /db_xref="GOA:D4JMJ1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMJ1"
FT                   /protein_id="CBK92195.1"
FT                   /translation="MLALYVVTAQKQLAMDTGYDPRTIRRVELGECCPSAEFMFEMSDY
FT                   FGVPIEEIFALDKSTESVQRGK"
FT   CDS             23959..24993
FT                   /transl_table=11
FT                   /locus_tag="ERE_00420"
FT                   /product="Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92196"
FT                   /db_xref="GOA:D4JMJ2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMJ2"
FT                   /protein_id="CBK92196.1"
FT                   /translation="MGLINNYILPVIGKTDVSSVNNHFVEKFYRTLSNMPAVDGANNKK
FT                   SKGNVSPNTIFEIHKILRSCFRQAVKWGIMEKNPAIDATLPKRNKKKCEIWTAEMLMQA
FT                   IETNSCYIVINKIIERVSVEALDFMDRKDIITIFPTQKRNNTTVVVMKTQKTETSNRKV
FT                   YIPSHVGKCLKELKAEQDHTKEILGNEYKDYNLVLAMTFGMPIGASHVRTKMKQIIKKE
FT                   GLPDVVFHSLRHTSVTYKLKLSGGDIKAVQGDSGHAQADMVTEVYGHILDEDRKKNAQL
FT                   MENAFYNKENLNPDIHGASGIQNNNNNNMISVPEGVDADMLMKVLGNPEMAALLTSLAK
FT                   SMKG"
FT   CDS             25114..26055
FT                   /transl_table=11
FT                   /locus_tag="ERE_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92197"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMJ3"
FT                   /protein_id="CBK92197.1"
FT                   /translation="MGAHICFDRHIHIANKTWSKGVLRHLGYEDIDEQTLNEIVNNKKL
FT                   KWIQISDYLPNEAYRKIDQILSERPDITFRLFHFLNNDEVDISFLMDMPHVKKVQIDCI
FT                   EFKNNPKRINLSVLAELNLKSLHIECFDLRDYEFIQNLSDELEELSIMADTMGPGIKFD
FT                   CTWLLKYKNLQTLWLGKKAKKNIESISQLPKLKSLSLRGIKLTDFSFLYKMNLEKLALL
FT                   WNSNNNLHELAALNNLKEIELWRINKLSDISFIEELTNLEIIKLQDLKHVNCLPDLRKH
FT                   ANLQRLFIIDTGIDIKELPNYLQEKVSNWDDR"
FT   CDS             26199..26636
FT                   /transl_table=11
FT                   /locus_tag="ERE_00440"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92198"
FT                   /db_xref="GOA:D4JMJ4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMJ4"
FT                   /protein_id="CBK92198.1"
FT                   /translation="MEMNGGFLVTKIKQLGDRIFEKILSEKNIDAFNGAQGRILYVLWQ
FT                   EDGISIRSLSTKCGLAITSLTTMLERMENQGLISRVQSKTDKRKTLLFLTEKAHALKGE
FT                   YDSVSDEMGSIYYKGFSEEEITRFEECLDRIRKNLEEWQKS"
FT   CDS             26633..27013
FT                   /transl_table=11
FT                   /locus_tag="ERE_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92199"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMJ5"
FT                   /protein_id="CBK92199.1"
FT                   /translation="MSICIKDQIQNMNIVIGCTVGCAYCYARNNVKRWHMIDDFAAPEF
FT                   FPGKLKMMEKKRPQNFLLTGMSDLSGWKPEWAWSLTDQAHKLGIPVFMKEDLVPIIGDE
FT                   NMIQEMPEEFNKVLEVQKSWKK"
FT   CDS             27001..27909
FT                   /transl_table=11
FT                   /locus_tag="ERE_00460"
FT                   /product="DNA repair photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92200"
FT                   /db_xref="GOA:D4JMJ6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMJ6"
FT                   /protein_id="CBK92200.1"
FT                   /translation="MEEVMNGILIREVETKNIMTKSSLPVGGYSVNPYVGCTHACKYCY
FT                   ASFMKRFTGHKEEWGTFLDVKHWPEIKNPKKYAGQRVVIGSVTDGYNPQEEQFGNTRKL
FT                   LEQLIGSDADILICTKSDLVVRDIDLLKKLGRVTVSWSINTLDENFKNDMDSASSIEHR
FT                   IAAMKQVYEAGIRTVCFVSPVFPGITDFEAIFERVKNQCDLFWLENLNLRGGFKKTIMD
FT                   YIAGKYPDLVPLYDEIYNKHNRSYFEALEVKAEKMAKKYDCAFVDNEMPYGRVPQGHPV
FT                   IVDYFYHEEIRGTENTGKRNR"
FT   CDS             28192..28269
FT                   /transl_table=11
FT                   /locus_tag="ERE_00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92201"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMJ7"
FT                   /protein_id="CBK92201.1"
FT                   /translation="MNIGNSLLYKEDFAWMKKQTLLRLN"
FT   CDS             28392..29738
FT                   /transl_table=11
FT                   /locus_tag="ERE_00480"
FT                   /product="Citrate synthase"
FT                   /EC_number="2.3.3.5"
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92202"
FT                   /db_xref="GOA:D4JMJ8"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016141"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMJ8"
FT                   /protein_id="CBK92202.1"
FT                   /translation="MSNLENYMKQQAIFCEQNDSISKNLYSEYSVKRGLRDEKGQGVLT
FT                   GLTNISDIKAFEYHDGVKSPCDGELSYRGYNIKDLVTGSKGKRFVFEEGAYLLLFGELP
FT                   TDTQLMEFQGRLSDCMELPTNFTRDVIMKAPTSDIMGSMTRSILTLGSYDKEKESLEIP
FT                   NVLRQSMQLIAVFPMLAVYAYHAYCHYEKNESMYIHRPEKDLSIAENFLRLLRPDTKFT
FT                   ELEARVLDIALLLHMEHGGGNNSTFTTRVVTSSGSDTYSVISAAMSSLKGKKHGGANLM
FT                   VMNMMDDIKSHVKDYEDEEEIASYLSKILKKEAFDQKGLIYGMGHAVYSISDPRERVFK
FT                   GFVEQLARDKGREKDMTLYNNIEKIAPKLIAKQRQIFKGVSPNIDFYSGFVYDMLNIPR
FT                   ELYTPLFAIARIAGWSAHRLEELITTDKIIRPAYKSLVSKKEYIEREER"
FT   CDS             29740..30165
FT                   /transl_table=11
FT                   /locus_tag="ERE_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92203"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMJ9"
FT                   /protein_id="CBK92203.1"
FT                   /translation="MGAGTSAEEFFLKSINVESIFEFVERTDYLFLYSIKECVEKSDCH
FT                   EGVYLSEVAEYMKLSIPETSKMVKSLENKGYIIWKLDEKKERTYLVLTNKAIELSNCQK
FT                   EKMIEAYEKIISNIQEDDLAVTRCTLRKIRQLMEEIK"
FT   CDS             30341..31774
FT                   /transl_table=11
FT                   /locus_tag="ERE_00500"
FT                   /product="Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin
FT                   synthases and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92204"
FT                   /db_xref="GOA:D4JMK0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMK0"
FT                   /protein_id="CBK92204.1"
FT                   /translation="MKKHKICKILLVILAIFLCVAFYELLGICVAYKKQPEVSNTTKKE
FT                   TKNGSWNECSENTERAVIIEKNPEALLQRVRLIKNAKKEIILSTFAFQSDESGKLILGA
FT                   LHDAADRGVHIRLLVDGMESWIDMEGNPYFYGLSSHENVEIKLYNKANPLKPWKMMGRM
FT                   HDKYLIADGKTYILGGRNTYNYFLGDFPGHKNYDRDVLVVCNEPEKENSVNQLLDYFET
FT                   IWDHEDSGYFHNNKKLANRKSVKNAVLELQNGYQKYFEENKERICDTDYTDETFETEKI
FT                   ALVSNPIHTGSKEPVVWYQLGELMKNAKNRVKIHTPYIICNDMMYNTWEEIAENVSDFS
FT                   IMTNSVANNGNPFGAADYAKNRNRILSTGINIWEYEGGYSYHGKSILIDDDLSVIGSFN
FT                   MDMRSAYLDTELMLVIRSKDINKQLEESMVEYERVSRQVLEDGTYRDPYHVEPIELTKK
FT                   RQRKIFLVQHLLGWARYLF"
FT   CDS             32463..33506
FT                   /transl_table=11
FT                   /locus_tag="ERE_00520"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92205"
FT                   /db_xref="GOA:D4JMK1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMK1"
FT                   /protein_id="CBK92205.1"
FT                   /translation="MEQKKEKGLRIRSCLTGAIWLALVFSTVISALLFAILNHFFNLPG
FT                   SIPVLGWLLIFNTLIAGLITSFINAKLLEPITRLSKAMKEVSRGDFEQHLETNSRIAEV
FT                   GESYQSFNVMTKELRATEVLQMDFVSNVSHEFKTPINAIEGYTMLLQGEELSPDQEEYV
FT                   EKILFNTQRLSGLVGNILLLSKLENQNIPMKKTEFRLDEQIRQAFLSLETKWTEKEIGF
FT                   QVEMEEVKYTGNEGLFMHIWINLLDNAIKFSPSKGTITMFLKQEQDSVKFILEDEGPGI
FT                   EDDVKSRIFDKFYQVDGSHKAEGNGLGLALVKRIVDSAGGTIKAENREYGGCRFVVELP
FT                   IQKDEAI"
FT   CDS             33538..34602
FT                   /transl_table=11
FT                   /locus_tag="ERE_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92206"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMK2"
FT                   /protein_id="CBK92206.1"
FT                   /translation="MTFYQELQLNQAGSKNLLKKSETRKEKLYHMWVYLVKIAVTMAFC
FT                   FLFVTIFSILFGNENSIVGVVVLLCLMVFRNADLGIHTGQSTILLALFFVIMTVCPHLA
FT                   NQFSPVLGMLLNIAALAVLILFGCHNPFMFNQSTLVLGYLLLYGYDVTGKSYQMRLVGM
FT                   ALGAALTCFVFYRNHKNRTYKRNLKDLIQEFDITSSRTKWQICQILCVPIVLCIAELCN
FT                   MPRAMWAGIAAMSAILPFMEDMHYRVRKRIVGNIAGVICFTVLYFLLPSSIYAYIGILG
FT                   GIGVGFSAQYGWQAVFNTFGALAIAAETYGLQGAVSLRVIQNVFGVVFALVFCVIFYWF
FT                   MSKKKESDVTVHAE"
FT   CDS             34592..35164
FT                   /transl_table=11
FT                   /locus_tag="ERE_00540"
FT                   /product="Phosphatidylglycerophosphate synthase"
FT                   /EC_number="2.7.8.5"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92207"
FT                   /db_xref="GOA:D4JMK3"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMK3"
FT                   /protein_id="CBK92207.1"
FT                   /translation="MQSEVNQEENLNRIITVPNLLSFFRLCLIPVIIWSYCVKKNPLLA
FT                   GEILLLSGLTDLADGYIARRFHRISNLGKILDPVADKLTQAAMLICLFTRFQHMLLLIV
FT                   IMAGKELYMVVSGCLVIRKTGKVHGADWHGKIVTFLLYGTAAVHIIWFQITPMVSDLLI
FT                   GLCAIMMVISVALYIIQNTRTLKGETV"
FT   CDS             35529..35753
FT                   /transl_table=11
FT                   /locus_tag="ERE_00550"
FT                   /product="Penicillin V acylase and related amidases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92208"
FT                   /db_xref="GOA:D4JMK4"
FT                   /db_xref="InterPro:IPR003199"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMK4"
FT                   /protein_id="CBK92208.1"
FT                   /translation="MCTAATYKTKDFYMGRTLDYEFSYGEQITITPRNYEFDFRFAGKI
FT                   KSHYALIGMAFVAGGYPLLSKGEVRWQNK"
FT   CDS             35804..37618
FT                   /transl_table=11
FT                   /locus_tag="ERE_00560"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92209"
FT                   /db_xref="GOA:D4JMK5"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMK5"
FT                   /protein_id="CBK92209.1"
FT                   /translation="MKEVKTPKKPLAYYYGIVLIVLIVFNLVVTPILMKHQVKETDYGT
FT                   FMSMIEKKNIGEVEVKDNQIIFTDKDQKNIYKTGLMNDPNLTDRLYECGAVFAKDIDKQ
FT                   MSPIISFLLTGILPLILFIALGNYMAKKLMEHAGGKNSMAFGMGKSNAKIYVQSSEGIR
FT                   FSDVAGEDEAKENLSEIVDYLHNPKKYTDVGASMPKGVLLVGPPGTGKTMLAKAVAGES
FT                   NVPFFSMSGSEFVEMFVGMGASKVRDLFRQAKEKAPCIVFIDEIDAIGKKRDGQMGGND
FT                   EREQTLNQLLTEMDGFEGNNGVIILAATNRPESLDPALTRPGRFDRRVPVELPDLAGRE
FT                   AILKVHAKKIKASDDVDLHTIARMASGASGAELANIINEAALRAVRSGRTVVNESDLEE
FT                   SIEVVIAGYQKKNAVLSDQEKKVVAYHEIGHALVAALQSHSAPVQKITIIPRTSGALGY
FT                   TMQVEQGDKYLMTKKELENKIATFTGGRAAEEIVFGEITTGASNDIEQATKIARAMITR
FT                   YGMTDEFDMVAMENVTNQYLGGDTSLSCSADTQKEIDEKVVQLVKAEHEKARKILAENR
FT                   EKLDELAMYLYEKETITGDEFMDILDRK"
FT   CDS             complement(38066..39298)
FT                   /transl_table=11
FT                   /locus_tag="ERE_00570"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92210"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMK6"
FT                   /protein_id="CBK92210.1"
FT                   /translation="MKKIQFLKVGDYMKTITRTKYLDRIIELNGTPDIKIITGIRRSGK
FT                   SKLMQAYIQYLKSNFENINIIFIDFMDLAYEEIMEYHALHAYVEEHYQEGKTNYLFVDE
FT                   VQMCPNFELAINSLYSKGIYDIYVTGSNAFLLSADLATLFTGRYIEIHVFPFSFQEYCQ
FT                   YYDDVSDKDKLFDDYTIKGGLAGSYAYRTEKDRTNYIKEVYETIVTRDLVQKYALPDTL
FT                   VLQRLSEFLMDNISNLTSPNKVSQLLTANETPTNHVTVGKYIKYLCNAFVFYDIKRYDI
FT                   RGKKYLESSEKFYLCDSGIRYAILGSRNMDYGRVYENIVCIELLRRGYDVYVGKLYQKE
FT                   IDFVAQRGSEKFYIQVSDNISGQETFERECSPLLQIRDAYPKMIIARTKHPQYSYEGIE
FT                   IHDIADWLLQE"
FT   CDS             39354..39548
FT                   /transl_table=11
FT                   /locus_tag="ERE_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92211"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMK7"
FT                   /protein_id="CBK92211.1"
FT                   /translation="MSLSKTQIFLFFESGNYVKECLYLIDTHLVGELFFRFHNMILPSA
FT                   QMKKYGGRDSFRIAKTEAF"
FT   CDS             39713..40645
FT                   /transl_table=11
FT                   /locus_tag="ERE_00590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92212"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMK8"
FT                   /protein_id="CBK92212.1"
FT                   /translation="MLTSVFGISIKYEAWNHQDSLPVYIAGSYDFHTAYIGNRRCIMLA
FT                   PTEELATLPALKKQIVKIQQIDNVPVVFELTTVSNYRRKSLIENNIPFITDKQVFLPFI
FT                   GTMLSDEKEPQKLTGKFVYSTQQLFLFYLYSKKKRLYTSEAGKVLPFTAMTLTRAVKQL
FT                   ETTDLFLVAKDGVNKFIESKYKRDELFEKAKVYLTTPVRKTGYIDKTQVTENMVFAGET
FT                   ALSEKTMLNPSRVVTYAISEKDYDKALLTDELIDPDKQVRLELWAYNPKQFSEDNSADD
FT                   ISLVLSFTDTNDERIEEAVDELQERRLHE"
FT   CDS             40645..41271
FT                   /transl_table=11
FT                   /locus_tag="ERE_00600"
FT                   /product="Domain of unknown function (DUF1814)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92213"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMK9"
FT                   /protein_id="CBK92213.1"
FT                   /translation="MVSGFTKFKERFQGFENQYVIIGGTACDLIMENEELPFRATKDVD
FT                   IVLIVESITAEFGRQFWEYVKEAGYEHLNKSTGNAQFYRFTSPKSKEYPYMIEIFSRNP
FT                   DFIILEDDAVLTPLPIDDEISSLSAILLNEAYYELLKTGQMMIDGIPVLSPTCLIPFKA
FT                   KAWLDLKERKLNGEQVDSKNIKKHKNDVFRLAQLITANTRQYFYR"
FT   CDS             complement(41233..41667)
FT                   /transl_table=11
FT                   /locus_tag="ERE_00610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JML0"
FT                   /protein_id="CBK92214.1"
FT                   /translation="MDNSMEIQDIRTRLEQFQANKDPRLKNTMSVPEMRRLLGLKKTES
FT                   YWLVHRNFFETKIIDGKMRVDIESFEKWYANQVKHKKVNGEEPGAELMKTSYSFKDAAN
FT                   LLGINSSNLYEIWRDENLETITVDFVKRLPIEVLPCIGCD"
FT   CDS             complement(41731..41910)
FT                   /transl_table=11
FT                   /locus_tag="ERE_00620"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92215"
FT                   /db_xref="GOA:D4JML1"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JML1"
FT                   /protein_id="CBK92215.1"
FT                   /translation="MEEKRCYTVKELQEILGISRPTVYELLKRNEFRWIQVGTKYRISK
FT                   KSFDEWLDKMMENP"
FT   CDS             complement(41910..42461)
FT                   /transl_table=11
FT                   /locus_tag="ERE_00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92216"
FT                   /db_xref="UniProtKB/TrEMBL:D4JML2"
FT                   /protein_id="CBK92216.1"
FT                   /translation="MIKIYVDASSAKRVDIIIKHYTDFMGIVDGYTEGLRYMIECEKES
FT                   NSHQEMGDLGIRVQTGGTTSDPTAKKAIRNVMTLEALINCDFSGDVMEGVNRAEEFIRD
FT                   AYLLRDMRKDYDLFNRQLSILGTEKETFEKYLRREKSLDDIADEHGITYESAQQKIHKI
FT                   RTRVKKQVVGFMDGKMGGIA"
FT   CDS             42525..42692
FT                   /transl_table=11
FT                   /locus_tag="ERE_00640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92217"
FT                   /db_xref="UniProtKB/TrEMBL:D4JML3"
FT                   /protein_id="CBK92217.1"
FT                   /translation="MAIEKYVAWKTRALFWRNGRAFKEPKANVQEPEGIENIEPSIKKV
FT                   IDQMIGNFNK"
FT   gap             42695..43670
FT                   /estimated_length=976
FT   CDS             44784..44882
FT                   /transl_table=11
FT                   /locus_tag="ERE_00660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92218"
FT                   /db_xref="UniProtKB/TrEMBL:D4JML4"
FT                   /protein_id="CBK92218.1"
FT                   /translation="MGKQKQIGGTTFLEKVLYGLGDVGVNLIWILP"
FT   CDS             45463..47907
FT                   /transl_table=11
FT                   /locus_tag="ERE_00680"
FT                   /product="Beta-galactosidase/beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92219"
FT                   /db_xref="GOA:D4JML5"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013812"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4JML5"
FT                   /protein_id="CBK92219.1"
FT                   /translation="MIKYDFNREWTYYKEGSDSKKKVNLPHDAMIYERRNRENPSGGAC
FT                   AYFDGGKYIYEKQFHMEEEWRDKVLILECEGVYHNATVILNGNKIGKRAYGYSNFYTEL
FT                   TPYLKADNMLEIIADNEKTPNSRWYSGSGIYRGVNLYVSEKNYIKPNGVKIDTLTESKI
FT                   SVKTDFVGMGNINVKIYDKDSLVAEGKGQDVEIVIPNVKLWDEDAPYLYRCCVELTNDG
FT                   IVNDSQETKFGIRTIKWSGKGLFINGKNTLIRGTCIHHDNGVIGACNFRDAEYRRVRIL
FT                   KEAGFNAIRSSHNPISKEMLEACDEIGMYVMDELYDYWLIHKNPYDHADNDFLNDWKKD
FT                   CEAMIDKDYNHPSVLMYSIGNEISELGTEKGQSLCKEMAEYVKAKDSKRAVTCGINLLL
FT                   ATMAAKGSGIYGEKKDGKENKNGSMSMDSMPTSTFYNILMNKMGGIIDKMAAKPSADKV
FT                   CDILAPLLDISGYNYATSRYDKEQKQNSDRCIVGSETLPKTLYDNWQYVKKNDNLIGDF
FT                   MWTGWDYIGETGIGTIRYMSKQTRKNAIPGLPILAGCGVIDICGNMRPEVGWNKLIWGL
FT                   QDTPVLAVEPMKYTNCKRAASMWRNTDAVASWSWDGCEGNKSDVIVYTTAEYAELFCNG
FT                   RKVGRSKVNKMKATFKRVTYEPGELIAKCYDRQGREIGTAKLISATGKSNLKLTAEKNT
FT                   LNSNGQDLCYVQVDLVGDNGITKVNSDQVLTVEVKGAGVLQGFGSATPCTNHNYYNGKF
FT                   ETFYGKAIAVIRAGYEPGEIELVVRGEGLEEKQVKINVNNWGRFFCHEECPIGSVGGMV
FT                   LL"
FT   gap             48043..48609
FT                   /estimated_length=567
FT   CDS             49441..50079
FT                   /transl_table=11
FT                   /locus_tag="ERE_00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92220"
FT                   /db_xref="InterPro:IPR025359"
FT                   /db_xref="UniProtKB/TrEMBL:D4JML6"
FT                   /protein_id="CBK92220.1"
FT                   /translation="MEELQIAKLPSNFKVYEIDDYHAINCDKEAKNFLDIINEAKKEND
FT                   VQRYIKSNQKWFIPLSILKAYDFGHHFSCVVPEFQLGSQYRLDYLLVGKNSLGYQFVFV
FT                   EFEDVNVDFRIKTANAETEKVRKGLNQIRDWKRWIDQNRAYFFASEGIKEFANNVPSWG
FT                   FRYCLVVSRRDRMDEISNQLRGEMQSETRVTIMTYDRLVEYVERLHNGI"
FT   CDS             50106..50972
FT                   /transl_table=11
FT                   /locus_tag="ERE_00710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92221"
FT                   /db_xref="UniProtKB/TrEMBL:D4JML7"
FT                   /protein_id="CBK92221.1"
FT                   /translation="MSRYLYDITNPNVAYNWLYEALKMKQGDLIDAYCLECHKDVNAFY
FT                   EKYRIVMDSIDIEKLEIAAFHVTTCVDDCNEIKLYGLHNLQWVLENDTQLRRFLKQNYI
FT                   SFDIDNKCVYVGENVYDIDYDKYKDLDVLSRRKNQLHKIGHKLYFDYQVNAFFFCRDIY
FT                   QYSTIHEAPEFLFTLSSLNEETTGIDTKWKEICKPYVVKYKGTISDYAYFSFYGNKTEF
FT                   EEDRSNNWIKLRRWLISYAIDCAFGDLHSDVYAYMNPETVIAPENIIEYMPAEKWRKDV
FT                   LKYFGKE"
FT   CDS             50944..51810
FT                   /transl_table=11
FT                   /locus_tag="ERE_00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92222"
FT                   /db_xref="UniProtKB/TrEMBL:D4JML8"
FT                   /protein_id="CBK92222.1"
FT                   /translation="MFLNTLGKNEMYHSVAEIMGTDIEHIKEYVKENADDIVGCGYNEY
FT                   CIENMSLIKLIEKCGTHPQVIDRLIVHHITPRECEETIWDEGLLTLSHALTKKTALSDY
FT                   LKELGFEFVFDGKQIFIYRHGNKVDTAGNHGMTNINMRLGGAGTLNDYNVNGYLFVDAF
FT                   EIETVKGWLGSPEFLKSLSIFYNDYNIADGYADNCSNYYVSFEVPLNKIDIEWFDASID
FT                   EERKTDILLKYTINALAYSEMRIRPFLPMYNPIIFLKRDYDVSKECIRKIWRFKREGSK
FT                   LVPTDES"
FT   CDS             52367..52744
FT                   /transl_table=11
FT                   /locus_tag="ERE_00730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92223"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="UniProtKB/TrEMBL:D4JML9"
FT                   /protein_id="CBK92223.1"
FT                   /translation="MGVWIFMLIMDLLLPFTMIGFGRYFMKKVPKEINSVFGYRTSMSM
FT                   KNKDTWEFAHKYCGKVWYVCGMVMLPITVMFMLLVIGKNEDCVGSIGEIICGVQLIPLI
FT                   GSILPTEIALKKNFDKNGTRR"
FT   CDS             53279..53407
FT                   /transl_table=11
FT                   /locus_tag="ERE_00740"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92224"
FT                   /db_xref="GOA:D4JMM0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMM0"
FT                   /protein_id="CBK92224.1"
FT                   /translation="MNQSVTGKFIALKRKQKNLTQEQLAEKLGVSNKTISKWETGV"
FT   CDS             53697..53876
FT                   /transl_table=11
FT                   /locus_tag="ERE_00750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92225"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMM1"
FT                   /protein_id="CBK92225.1"
FT                   /translation="MGKVLIWFVIIISTVVLYCLMKVKAESDELYEELMRKHFYGRSDD
FT                   IPASDKTEHLKGCG"
FT   gap             54763..55418
FT                   /estimated_length=656
FT   CDS             55711..56706
FT                   /transl_table=11
FT                   /locus_tag="ERE_00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92226"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMM2"
FT                   /protein_id="CBK92226.1"
FT                   /translation="MMNYEIFKEVVKEKFMDYMPEKFKGMELVVEPVEKVNVTLDGIIL
FT                   REEGRNISPTIYINDMYKKYQDCGDLEETLMAACDFMERAYEQAPVVDVDSIMRDANEK
FT                   IVFQLINTEQNKTFLEQVPHREFQDLSIVYKVIISADKDAVQSSKITNEFAKRLGMSEE
FT                   QLFKCAAENTRRLFPPVVRSMNDIMKEMFARDGMPQEIAEMMIAEIPPEQTMWVISNEN
FT                   GINGAASMLYENELHELAESLESDLYILPSSVHEVIAVSSDMGSPEMLAQMVVEVNMQE
FT                   VSLDERLSNQVYHYDKDLRKLTLATDTPNKRLDGIVAEPPLVYDAKEKSR"
FT   CDS             56716..56832
FT                   /transl_table=11
FT                   /locus_tag="ERE_00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92227"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMM3"
FT                   /protein_id="CBK92227.1"
FT                   /translation="MEQELTMEELIALINSQKGDFVIRVEFGEEAVSDAKEE"
FT   CDS             56816..57355
FT                   /transl_table=11
FT                   /locus_tag="ERE_00800"
FT                   /product="DNA repair proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92228"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMM4"
FT                   /protein_id="CBK92228.1"
FT                   /translation="MPKKNDFKLDVVSVRLVKDAPIYSEHTFNNPADIAAVMGDCMCQF
FT                   DREVVCVVNLRSDLKPINVHFASVGSLNEAMAHPRELFKSSILSNAASMMLIHCHPSGN
FT                   VFPSKADTMMTDRMNKLCELMGIPLIDHIIVGGDNREFFSFREKGMIDNPKITLSTDYR
FT                   TLDIKSPLVAEQGKAR"
FT   CDS             57360..58337
FT                   /transl_table=11
FT                   /locus_tag="ERE_00810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92229"
FT                   /db_xref="InterPro:IPR025054"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMM5"
FT                   /protein_id="CBK92229.1"
FT                   /translation="MDGRFTDEELAIAKSVDLCAVAESLGYTVKRIGKYHTLKEMDSIR
FT                   IYNRSHWYRWSRQFDKGNNGGSQIDFLRVFCGMSVKEAVFWLLDFAGYRRIEKPVKQSL
FT                   VHQVSQKQAEERKPFVLPEPAGDNSYLISYLNQERGISRVVIDLFLKDGLIYESRHYHN
FT                   VVFKGNDKNGVTRFASMRGVFDKQGKPFKCDVTGNDKNYGFNVVNVNSTELVVFEAAID
FT                   LMSYVDIFADYESNKLALGMLADAPLETFLREHPQITSIRFCLDGDEPGRKAAAELMRK
FT                   YYELGYEVEDCPPPAGYKDYNEWLVAAKLNLNRMNKRADEPVRA"
FT   CDS             58334..58543
FT                   /transl_table=11
FT                   /locus_tag="ERE_00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92230"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMM6"
FT                   /protein_id="CBK92230.1"
FT                   /translation="MRNRILMCGGRKRPQNSKVGAESAPKMSKWGQKVPPQFGHDKIRT
FT                   EVKIKVGAESAPKITKWGQKAPPK"
FT   CDS             58731..59252
FT                   /transl_table=11
FT                   /locus_tag="ERE_00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92231"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMM7"
FT                   /protein_id="CBK92231.1"
FT                   /translation="MDKELTIIAEPEELIAWADTFDILLNPSIEDAAILLNYMEGHDYA
FT                   IGIDSDGKMYRQDVAEENGEIEPYPIDDVIDIVCEWNYELILDAEAHRSDPKDFNDYNE
FT                   YQSRYESLKADEKRLDRLFDKTSYGKELIEVATELADRVIAQLGNKELEKAAVTVAEGV
FT                   REYSTGKRGR"
FT   CDS             59257..59589
FT                   /transl_table=11
FT                   /locus_tag="ERE_00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92232"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMM8"
FT                   /protein_id="CBK92232.1"
FT                   /translation="MADKVHCIRKTLRLMPQEAKVLSDKAKANGMNEAEYIRLLISQKP
FT                   NDYPEVRKLLKELINEVNRIGININQIVFNSNAQLYSKKDKEQLVAYMKKLNQSVSEAV
FT                   VKIGNQ"
FT   CDS             61048..62232
FT                   /transl_table=11
FT                   /locus_tag="ERE_00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92233"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMM9"
FT                   /protein_id="CBK92233.1"
FT                   /translation="MEEKREPLSEMAIERKIQILRNKHMDSEVIALVKSDYEYGLTDDE
FT                   IGLYLNKSYDIEQMKVLSKCLHKGVSEELLTLLKDSRMAAPKMQTALDYYEKGVPIDAI
FT                   REVVQKDDTAVNMRRMFDVVLDKLNKAKEQVPQDLEYVKSLVAQMDEVVEKINHQNERY
FT                   DALNKKLSEIETSKDDEEVRERLVKENQDKDALINSQQNELNKASSTIARLRDDIEKKD
FT                   KEIKRMGDRIESLEDKIISVATENKKEAESKAEPQESQSVPQAEKKMVDTVAVPQNMQA
FT                   VANGIPVYYQIPVVDGTGNVVQRLPIERSVRKSSNSGVASLFARLSFKKKSRADIVKLV
FT                   ASGDLVPAQLVQIKSAIEKGLTESQLVELINNNISAEKMKEIIEIAVLENSMAD"
FT   CDS             62242..62646
FT                   /transl_table=11
FT                   /locus_tag="ERE_00870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92234"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMN0"
FT                   /protein_id="CBK92234.1"
FT                   /translation="MNLAVVNEAVTEMNGVEHQFTEEEKNFVVQFAFRSGSKEDTISLI
FT                   EALAHSADKAESDEIMVTYRSKYDMKPAWVEQVENLLVALEMYRIEEEKAINHLADILT
FT                   AYGIDVSAEEIRTTETETLKTTVREKVEVR"
FT   CDS             62646..63764
FT                   /transl_table=11
FT                   /locus_tag="ERE_00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92235"
FT                   /db_xref="InterPro:IPR024234"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMN1"
FT                   /protein_id="CBK92235.1"
FT                   /translation="MAEEIQEAVQIIRVAYDGIEIAMKVGSGGIAAMQKAIDFLKGMLD
FT                   YEKSLGKTSMRKLILKGGDLQVLQFNTEDMKKVEKMAKKYGILYSVLPDCNRKDGLSEV
FT                   IFHTEAVPRVNMMIQKLKFGKIATFDDYLKNGDEKSLGKLMDFLKKQQGNEKSHTIEGD
FT                   RVNTAIDGLIEKVGMFAMEKKAISVDQVKENFSINGEQAESVIKQLETIGVLGKKNEDG
FT                   THTVMMDKDAFINRVRGYQDLAERMRAVAASKNANLSDVTISKKLIIEENDHAVKTRVP
FT                   GTWGEEARYVWLRKENIMEIHGGKTMLTFLDSTKDYKLYDEQNRVVTTQKGTELYTHYD
FT                   KVELSVRERYEKVQKQQKKTTQKKTVTTKKAR"
FT   CDS             63771..65963
FT                   /transl_table=11
FT                   /locus_tag="ERE_00890"
FT                   /product="Type IV secretory pathway, VirD4 components"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92236"
FT                   /db_xref="GOA:D4JMN2"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMN2"
FT                   /protein_id="CBK92236.1"
FT                   /translation="MQTTKKKPSLIFILVGAVLAGYLGYLINGAWTEGIAFNEFMDRFN
FT                   EVCAVPFANYYNSNTVKAVAIALGIYAMAIVMYYTSQRNYMPGKEFGTARFENPKQVNK
FT                   ILADKDENFNRILSQNVKMSLDFRRLKLNGNILICGGSGAGKTFYEVKPNLMQMPHNCS
FT                   FICTDPKGEILRSCGQMLKNNGYNLKVINLLEMDKSDCYNPFSYIREETDVVKLITNLI
FT                   SNTTPKGATPSDPFWEKAEGLFLQAIFYYVWLEVQPAKRNFETVLKLLGEAEVTEQGKA
FT                   SKLDVRMKFLEESSPLGANHPAVKQYNKCMRGAGDTVRSIIISANSRLAFLENKQVLRL
FT                   LSKDELNLSDIGIGVNGDGETKTALFCVIPDSDKSYNFIIGLLYTQIFQELYYQADFNC
FT                   GGRLPIHVTFMLDEFANVALPDDYCSLLSTMRSREISSIIIIQNFAQLKALFKDTWETI
FT                   PGNCDTFIYLGGNEQSTHKYVSELLGKGTIDKKSSGETKGRQGSSSRNYDVLGRELFTP
FT                   DEVRKLDNKKCIIFIRGFDPIMDNKFIPFNHPMFNQTADGKGEPYVHQIRGADNLIGPP
FT                   FEILSGKAVKYYEKLKDKGENVYIDSLTYEQFMMLGDAELSRRFSMQDEAEQKAKIDRE
FT                   QANELEYVDESQKSDAAESANASNGSAGGKPVRNPEREKPKWEDTITNRMLHWSYTPEQ
FT                   KEELRKALAVGVPKATILTYFYPDVTVEKMSSYRKK"
FT   CDS             66033..66812
FT                   /transl_table=11
FT                   /locus_tag="ERE_00900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92237"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMN3"
FT                   /protein_id="CBK92237.1"
FT                   /translation="MDVGNATIIAAAIAAAVSLGSSVFAWCAANKSNKAAAQSNEVTNR
FT                   TNREIAVFEQDEENKRNESQIDANIVWSARVEWIQNVRRATADLLTAINNYIYSDENDV
FT                   DLVKMNLMSVREKSNLLILYFGPDKVENDKVDLLNKGDNISKNQHIVKLIEDIYIGCCS
FT                   YFINIKTMKTCNDLDSLCKSCRKSGSEYENCNIYNEHYSNQQQENECSSFINGNLAKCQ
FT                   CVAEQNNKLFSDVDMLTNAMRIYLKIEWNRTKERKDN"
FT   CDS             67010..67387
FT                   /transl_table=11
FT                   /locus_tag="ERE_00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92238"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMN4"
FT                   /protein_id="CBK92238.1"
FT                   /translation="MRKEQIITTNNKQMEEKGMKNRFIHFKKRFVPALSGALMGVMLMS
FT                   TTCFAAGTGTSAVTQPLENLKTLIIAVIGAVGVIILAKNVMEFAQAYQQQDSSTMNSAL
FT                   KGIVAGVMMAGISTVLTFLGF"
FT   CDS             67442..68284
FT                   /transl_table=11
FT                   /locus_tag="ERE_00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92239"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMN5"
FT                   /protein_id="CBK92239.1"
FT                   /translation="MDIFKLGDKILALLEAVFGFWNNQISLVFAMLGQSPVSFKGGGPW
FT                   AVIEGIEPVFVAVGSSLVVLFFVIGFCSESIDVKDEMRFESILRMLIRLGLAEWFVANN
FT                   VTIMKAFFTSIGNLVGLISAGTTTQLAIDRTQADIIKGLGFGESLVMLILTALLAIIII
FT                   ICGFFIIYTVYFRFLKILIIVPLGAIACSTMAGNRMVSHTMATYCKYFLSCVFEAVTMA
FT                   LAIVVCNAFINAGLPAFTGSYADWAQTLICLCEMTFTIAMTVGSVKGAQTLTSKAFGL"
FT   CDS             68297..68707
FT                   /transl_table=11
FT                   /locus_tag="ERE_00930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92240"
FT                   /db_xref="InterPro:IPR025462"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMN6"
FT                   /protein_id="CBK92240.1"
FT                   /translation="MDNEKKQVTYNSSITGETQVTFDIQQYMNNRAMFIGLMCNEDGYE
FT                   EPFGDVTVNLSVAAPNYCGYLNVNDMPDIEKFITDNDLGEFTGFTQRSGFCEYPLYLFN
FT                   VDKLRELCPDGMDKYEANIGMTRKPETKDLSR"
FT   CDS             68720..69232
FT                   /transl_table=11
FT                   /locus_tag="ERE_00940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92241"
FT                   /db_xref="InterPro:IPR024414"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMN7"
FT                   /protein_id="CBK92241.1"
FT                   /translation="MVIEVNKDIDRYQESVAMGLTARQLIFSIASVVVGGGIVLLLYKY
FT                   IGLTGSAYVAIPCVAPIALGGFYSFNGMNFYEYMGKKLHFMFGNRALTYVSTEGEPAIK
FT                   QLEAEQNEQVKKKGRKAEPETVTADSAVKKQEEFEAMKKKTRNMLLGLVAVIVAAAAGI
FT                   AAYKAMH"
FT   CDS             69386..71803
FT                   /transl_table=11
FT                   /locus_tag="ERE_00960"
FT                   /product="Domain of unknown function DUF87."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92242"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMN8"
FT                   /protein_id="CBK92242.1"
FT                   /translation="MNASIHDKKESEVRDMGLFTDGFKLLKKASEPLYKTPKSIQETIE
FT                   IMAVAENGIFEVSKNKYSKCYRFQDINYTTATEDEQIGIFERYCKFLNSLDCNYKITIN
FT                   NKNKNMDDLRDKVLIAEKNDGFNNYRRIYNDIIEEKIIEGRQGIEQERYLTITIERKNF
FT                   EEAKAQFATLEATIHKAFIELGADIVPLNGNERLKVLYDYYHLGDEGSFDFDIKKAKKV
FT                   GPDFRNDLCNGMVKYFPDHFEDESKFCKALFIKKYPSSLSDRFINEITSLPVHSITSID
FT                   VVPVPKDLTTKVLQKKYLGIESDIIKQQRVRNKNNDFSTEISYAKRTEKKEIEEIMDDV
FT                   RENDQCLFFVGVTIILMAESKKELESVCETVETIGKRNSCTIDTHYLKQREALNTALPI
FT                   GVRQVETMRTLLTQSLAVLMPFNVQELNDSTGNYYGINQISKNVNIGNRKKLINGNGFV
FT                   FGVPGSGKSFFCKMEMGSVFLSGDDEIIVIDPMNEYFDIAETYGGTVVNMSTYTDNYVN
FT                   PLEMDVWSLDPNDSKGMVREKGEFMLGLCEQCIGDSLNSRQKSIIDRCVRKLYIDIARS
FT                   KEKYIPVMSDFYDILMAQPEDEAKDIALSLELFVNGSLNIFNHQTNVDVDNRFTVYGIR
FT                   DLGTELSPITMLVMMESIQNRIVENGKRGKATWLYIDEFHVLLNSEYSAKYLQQLWKKV
FT                   RKQGGLCTGITQNVVDLLQNYTATTMLANSEFVALLKQANTDSSKMAEVIGVSEAQLRF
FT                   VTNTASGMGLIKCGSVVIPFDNQISKDTDLYKLYNTNIHEIIEMKKHANEKC"
FT   CDS             72056..72625
FT                   /transl_table=11
FT                   /locus_tag="ERE_00970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92243"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMN9"
FT                   /protein_id="CBK92243.1"
FT                   /translation="MRNVLDCINAFIPLLSTEYELVLGRKGVSVTLRISFDKKDCFHLM
FT                   GLQYLVDRPELSRDRGRVFDEIADGTITIEKIESSDFYNKIEQRVHFLPLLEQMIDSND
FT                   TVFKYNKKANMYSMIEADYLMENNVESRNLFLFLSNDEGDNYFCRSFFPEEKMDYSKNQ
FT                   ASWTLLYKKKIDLSTRIETVLYNRIK"
FT   CDS             72746..74683
FT                   /transl_table=11
FT                   /locus_tag="ERE_00980"
FT                   /product="Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92244"
FT                   /db_xref="GOA:D4JMP0"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMP0"
FT                   /protein_id="CBK92244.1"
FT                   /translation="MVIHTKEKAKIHAHEPKGAKIKGSNIYTVERGPKVHDAKANEMDK
FT                   KASAKLMLQKSAGGKRTYRKSTIHQSEAKDKGLSRFKRNIRESGTSIKTKNTNLHIAGR
FT                   TGVLAAGAVTEQVEGGYEVSQAAYLAYEASQPVTGTASKGAALFRKKAAAEAKKRIKKV
FT                   EAGKKLAKKTAKKAVKDTAKTVAKETAKETAKTTAKVATKTATKAAATAAGTAVAPGVG
FT                   TAIGMAAGYAAGVSIEVKDEKMTNRSRKIKFFLDKMKAQENQTDSVAKLVKDLIVRKAI
FT                   TWVKAAAPIIGLVLLLLVLVVAMIAVPVIAVIAILYNSPFALFLPPLESGDTVQTVTSA
FT                   YVQEFNRDVNTKVNEHTGYDLGELVYVDYEGMEENPSNYYDIMAVYMVKHGIGDTATVM
FT                   NDISKGWLQAVVNDMCSYTTSTGTKDVEETDADGNVTTVTKSVLYVNVTLKSYRDMISV
FT                   YGFNSDQVEMLEQIMSPEFMGQLGYAGSGSGGGGGSPGVSSMTEDEINAILSGITDSRQ
FT                   KTVCSYALHRVGFPYSQDLRDSGNYYDCSSLAYYSWKDAGVDISYGGATTAAAEAQGLD
FT                   EAGKTVSFDELQPGDLIFYSFTSNGRYKNISHVAVYVGNGKVVEALNESLGVVYRDVAS
FT                   TGKIVVIGRP"
FT   CDS             74734..75630
FT                   /transl_table=11
FT                   /locus_tag="ERE_00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_00990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92245"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMP1"
FT                   /protein_id="CBK92245.1"
FT                   /translation="MDLKDMILVTENDRGTETNMLMTLDDYKSFIAVDDMSELADNLLQ
FT                   LGRTLGEAENFAEYYRAANVTLSARFCLDDIQLGHFLQGFYNDSKEFRFDKEASSSECV
FT                   AKLKEIGMTDKGWVDDFNLHYEMENRSFERGQTFHNFNDHDYMVLEALSPRNLVVMDMK
FT                   SGSLTIALGATEYKRYPKDEKPTKDNTTIGVSWEHGIYLGSTLSTTNFKAYKREYGTPE
FT                   KIEDIYDYRAKLKQKFYFYQDMSKDDDVPKKLQNDFLHQMYEDFGTIEEDCFYDRLEDG
FT                   KYDEGFKERQVKEEKSR"
FT   CDS             75658..75876
FT                   /transl_table=11
FT                   /locus_tag="ERE_01000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92246"
FT                   /db_xref="InterPro:IPR025575"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMP2"
FT                   /protein_id="CBK92246.1"
FT                   /translation="MEQEFDVEIKEVLSRVQKVKAESLDDAINKAMDMYYAEQIVLGAE
FT                   DMKGVDFAPISESQLPSSLKENGGRAR"
FT   CDS             75873..76241
FT                   /transl_table=11
FT                   /locus_tag="ERE_01010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92247"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMP3"
FT                   /protein_id="CBK92247.1"
FT                   /translation="MTSDSTTVIKNMEFLVKELHKEWDRSGASKASVIISIEEVDGIND
FT                   KLKEIIYQTQKSVDEDELTFKQSMAKSKECYVLLRVVRKIAKKKDKCEKQAIDNEFAIE
FT                   LDKDELKLFKGLFAEMFK"
FT   CDS             76256..83908
FT                   /transl_table=11
FT                   /locus_tag="ERE_01020"
FT                   /product="DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92248"
FT                   /db_xref="GOA:D4JMP4"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMP4"
FT                   /protein_id="CBK92248.1"
FT                   /translation="MGVDMKVKAIYDSEIGNITRSEKNWKDVLKVAGQLYRYEFDNIVM
FT                   VTAQRPPEKSTLMADYDTWKKVGRYVKRGAKGCAIFPSRALNPRMRYIFDISDTGGKNV
FT                   KLTWDLEGENLKDYVDFLVSEGQIEQYDNSDRESLKNILKQFTGTDVWLIIKEEFGDRM
FT                   TELMQLSGSVIKEESKKRNGLQQEMDMEQLVYASVMYAVGTRCGFDLSVQEQDFSQIVN
FT                   IKDEEIIYRLGSIVCDVSCSVLREFSRNLKAIESERRIGYVRRNDLQGSGRTALSADRD
FT                   AGRDGGSHEAGQIRKDGDELSQRERAGKIQDADEIREDVREDVSGRGGSESAVRPVRDA
FT                   VSGEAQATGSVIDNGDVEDKRAGEDAGRGSGTESDSDAIPLESDDTELNRELDEINSLG
FT                   VSKEAEYTQASFFFDQNGQASIGTIHTEDENNNQFMRQFEQDRKAALAGKYNYLNPKKS
FT                   ATVPGEYIKQVLMGGTGFIGGKGRVCKIFETEIDAGTRAKRIKAEYGQGGAGWPVDGLG
FT                   LHGYDTFHGNGLRFQWRDEDGEVEGYVSWKDIEKELGVLILTGEYQPETPRIDELAMDG
FT                   LREDDEVIDAEYREVEPEEAESEIDDYAIPDEPESYASNRDYVSAKGMTPQEAADEDRM
FT                   VTQAEYGAEIEAETSEKDPSELKYITPIDYAKRIAELDEDLRDAAEILVTDCSCYTPFR
FT                   AFLMDVVQSDFAFMPNKLDLIRDIALGTDNAERKAYSNNKYGLVEYSIRSGYVKISYKN
FT                   RNGVRKEGALDWRELYEILSYMVKQPFYCGEDQKKYYQETKQKADRDKMNPVYKRFFDI
FT                   EDSVKANRLETRERAIANGWETKIDENGHVVSDDAVSVSVDDIQADTESQETVDFTPKQ
FT                   EPVQQVESLENEKNVAGQTKHNFHYNLWEMEKGGAKTRYQWNMDAIRTLKQIESENRLA
FT                   TPEEQKTLSKFVGWGGLSQAFDENNAGWSKEYAELKDLLSDEEYSAARATVNNAFYTSP
FT                   EIAMCINSALVQFGFRGGNVLEPSMGIGNFFGSMPAPMQRSKLYGVEIDSISGRIAKQL
FT                   YQNANISITGFENTTYPDNFFDVVVGNVPFGDYKVFDPKYNKYNFRIHDYFLAKALDQV
FT                   RPGGMVAVITTKGTLDKANPTIRKYLAERAELVGAVRLPNTAFKDNAGTEVTADILFLQ
FT                   KRERKIDIEPDWVHLGVTENGIAVNSYFAEHPEMMLGSMEYDTRIYGQDSRYTVCVNND
FT                   ENFNMYETLNKAIGNIKAQMTDFERVADEAEQTEEVIPADPDVRNYTYTFFEGKLYYRE
FT                   NSEMVKKEVSQTAEERIRSLDEIRQITRELIDIQMDGCSEEELSDKQRLLNVKYDAFVK
FT                   QYGAITSKANRIAFRDDSDYPLLCSLEEVNEDGEVKKADMFYKQTIKAKTVIDRVETAV
FT                   EALNVSVNEFGYVNLAYMLSIYEPDITNAKEELAEKSGQTVDEITLSDDALAEIRRAVL
FT                   VEELDGLVFLNPDRYNENNPDIGWETADEYLSGNVRDKLRVAKAMAADTDNPQAERFAG
FT                   NVAALEKVQPEWIEASDIDVKIGTTWIESLDYEQFIYELLNTPRRARAVRSQFYNTGIQ
FT                   VHLNKMSMEWFIENKSMDKHSVAATKTYGTSRMDAYSIFEDTLNLKTVTVRDRIDDGDG
FT                   KYHYEVNKNETMLAREKQNMIKEKFKEWLFAEPERRQKYVEYYNETFNNIRLREYDGSH
FT                   LQFPGMNPAIELKPHQKNAVARILLGGNTLLAHCVGAGKSFEMMAACMEQKRLGLANKT
FT                   IMVVPKPLIGQTASEFLRLYPSANILVATERDFEKSRRKQFVSRIATGDYDCIIMSHSQ
FT                   FEKIPISAERKERMLNEQIDEISYAIDEMKERNGERWTVKQMESQKKKLEEQLKSLSDE
FT                   SRKDDLITFEELGVDSIMVDEAHNFKNLAIFSKMNNVSGISSSGAKKSTDMQLKCQYLS
FT                   EINDGRGIVFATGTPISNTMCEMYVMQLYLQKAALEEMGIYHFDSWAANFGEVTTALEL
FT                   TVEGSGFRFKSRFNKFTNLPELMNIFREVADVQTADMLDLDVPALRGGKPIIVESEPDW
FT                   YVKQVMEDFVVRAERIRGGGVDPSVDNFLKITHEARLLGTDARLIDKDAPSNPDGKLNK
FT                   VAENVWKEYEKGNVDGHIGCQLIFSDIGTPGPDKDFTIYDYLKETLIQYGIPAEEIAFI
FT                   HDAKTDAQRDALFKEMRTGKKKVLIGSTDKCGTGVNVQTHLVAMHHVDCPWKPSSIEQR
FT                   EGRGIRQGNENEEVAIYRYVTKGTFDAYNWSLIENKQRFISQVMTSKAVSRSCEDIDEA
FT                   TLSYAEIKAVATGNPLIREKMEIDNDVQRLKLLKASYDNQRYGLQDNFMIKYPKLIKTA
FT                   TEKLANVREDVKARDKELIDNPEFAITIGKATYTERVDGGTMMLEAISKCKTGETTAIG
FT                   KFHGFELLVEKNFLGINYMVLRGKTEYKAELSTSPVGSMVKLENLFNGLHENIDFLEKK
FT                   IEQYQNDLEASKAEYDKPFAYSKELEEKLARQCELNAQLDLENAKAVDADLSGPEEERE
FT                   ADDRMESAAIVAEDKGAYQADREGRTR"
FT   CDS             83922..84539
FT                   /transl_table=11
FT                   /locus_tag="ERE_01030"
FT                   /product="LPXTG-site transpeptidase (sortase) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92249"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMP5"
FT                   /protein_id="CBK92249.1"
FT                   /translation="MSIRKVVAGLLIAAGIAIMAVPFFWRTTGEKQTEQLISEFEQTLE
FT                   DDYDEETDVEEEQTSISEEDEAILKEGGVIGIIEIPGLNIRYPVMEGTASKVLNAGIGH
FT                   IEETAGIGESGNCVLCGHNGSRYGTFFTPLSQISIGDEIMITDKNGLKHIYEVTETEIV
FT                   NPYDNSIKTQGDEKELTLFTCSQKGTMRFVVRCIYKEAVMDE"
FT   CDS             84532..84930
FT                   /transl_table=11
FT                   /locus_tag="ERE_01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92250"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMP6"
FT                   /protein_id="CBK92250.1"
FT                   /translation="MNKRYRLGEIEEAVSEMEELIDIEDDIAEIDDDFQIVVSGWSVYV
FT                   ESLNLTLRQGIACVWDAEEGLFMPDFDVTIVYEGNIETQEWLYYEQDGMVVTLGNWLNG
FT                   RLSCEQIEQLWCELIIPEKNKEQKESEE"
FT   CDS             84934..85623
FT                   /transl_table=11
FT                   /locus_tag="ERE_01050"
FT                   /product="Uncharacterized protein, involved in the
FT                   regulation of septum location"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92251"
FT                   /db_xref="GOA:D4JMP7"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMP7"
FT                   /protein_id="CBK92251.1"
FT                   /translation="MKYSIKVNEVRAKEGSNIKGFATVVFGDSFKITNIAILENKDKGE
FT                   FFVSMPRYRSNERDESNGVIYKDVCNPITAEFREELYTNILDAYARIKEPEKEETQKQD
FT                   RTQEMPEFSVTVTPYEREGSNIKGLARIYFENSFIVNNINIVQGKEKIFVSMPSYKTKQ
FT                   VDEQGKPIYQDVCYPVTKDFREKLYNEIISEYEKAKDKSNEKARESAEKHHGNPDKDKD
FT                   KEATPFR"
FT   CDS             85684..86604
FT                   /transl_table=11
FT                   /locus_tag="ERE_01060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92252"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMP8"
FT                   /protein_id="CBK92252.1"
FT                   /translation="MDMEAGKTLTNEEVIRELLELLKKNAMKEQANDVFEICSYVDGLE
FT                   KKIDSMTEELTNMQNQIKEMQEDTLVNNAKKALSEAQERLNVRCEQIKSQVLEVKAQVK
FT                   STAKSIVDEAKAKGRAALYRVSEFLEIKKRLLDIRENVRGAIKTTDKDIAKTALLAKGF
FT                   REAGQTAANAFRTFADKSEVDYSQKEQKHPITKAVLAPMKAVRKLFVLMELHLDASIDK
FT                   LDNLAMNVQLDKEKHMENAKAQEQTEPEMAEAERVEAEIVYAPMVAEPQEYQYNADAFE
FT                   ARKTSEGKQEKAGKALPKVSEDKVR"
FT   CDS             86721..87800
FT                   /transl_table=11
FT                   /locus_tag="ERE_01070"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92253"
FT                   /db_xref="GOA:D4JMP9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMP9"
FT                   /protein_id="CBK92253.1"
FT                   /translation="MSRKKQVNQKITALYCRISLEDGGDNESMSISNQKLMLRDFAEKN
FT                   GMFQYEYYVDDGYTGRNFNRPSFQRMIADIEAGKIGCVITKDLSRLGRNYIEAGSYIEI
FT                   FFPKHNVRYIAITDGVDSLTRQEMDITPFKNILNDMYSRDISKKVLAGRMTRSRQGKFC
FT                   GGQPPLGLMRDPEDKGHLILDPETAPVIRKIYDMALDGWGCMRIAKQLMDDKVPITRVK
FT                   SNTECDVNYYSWGSARISHILRNPFYKGAHLVCRTHQKGIRSNTYDIIPREDWEIIEDC
FT                   HEAIISPEEWEQVREIIDRRPTIMKGNSCPFYNLFHGIIYCATCGKSMQVRYEKVGRTG
FT                   KNRFTGEIREPIDKAYYIC"
FT   CDS             complement(88568..89755)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01090"
FT                   /product="Major Facilitator Superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92254"
FT                   /db_xref="GOA:D4JMQ0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMQ0"
FT                   /protein_id="CBK92254.1"
FT                   /translation="MKDKSLTRVSVFLTSQIISLFGSAIVSYSIVWYITLKTSSTMALA
FT                   ISIVCTYMPQIVISMFSGTWGDKFNKKNLIIIGDTITGISTLILAILFINGFDSLYLLY
FT                   GACALRSVGSGIQTPLEHAFLPLICPEEKLTKINGIYATASSAINILSPAMAGVLLNVM
FT                   DFGHTLFIDCITALLAIIVLLKLKYKNTISSNKDTSTLSDFLEGVKYFKQHIFLGRLIL
FT                   FYLLFYFFMSAPAFLTPVLVNLKFSSSVNALAINEFVWSLGTMLGGILICSFKEFNKLK
FT                   FMAISALLFGGFICLLGASNIFSIYILFMLCSGISLPLFNTSNTVLIQENVKKEMLGRV
FT                   FANLNILSTISTTIGITVFGIIGNTISVDILLILVGAFIAILSIWIWKIYRENKV"
FT   CDS             complement(89777..90679)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01100"
FT                   /product="Domain of unknown function (DUF1848)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92255"
FT                   /db_xref="InterPro:IPR014998"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMQ1"
FT                   /protein_id="CBK92255.1"
FT                   /translation="MILSVSRRTDIPGCYPEWFMNRLRDKYVMTRNPMNFHQVSQINLS
FT                   PDFIECIVFWTKNAVPFMDYLEELNRMGYMYMFQYTITPYDNTLEKNISDKSDIIKNVL
FT                   ELSEKIEKKRIVWRYDPILLNDTYTVNRHIELFEEMCSLLYTAVNHVVISFIDLYQKNR
FT                   GYRLYELSTDEITHLAQAFGEIGAKYKLPIKTCCENYDLTKFGITKGACIDSVLLEEIC
FT                   NRPLLLKKATGQRKNCLCAESVDIGAYHTCLNGCIYCYATDYKRLKTKQKCYDKNSQIL
FT                   CDKLDFGKDIIKVRKMKKL"
FT   CDS             complement(90691..91209)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92256"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMQ2"
FT                   /protein_id="CBK92256.1"
FT                   /translation="MKIMIAGAWDETNENLLSSAFQIAKVAAEKKHIIITGGGTGIPNS
FT                   ATHGALAVNGISIAYSNEGHCEGGHEPATFRVATEMGWDGRSVLAVKSSDLLIVIGGCN
FT                   GTLNEITLAYLNNIPIWVLEDSSEMICRLKNFLYEGKYIDKRKNVEIEFFNSAQSMIEK
FT                   LNSKNILQN"
FT   CDS             complement(91206..91526)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01120"
FT                   /product="MazG nucleotide pyrophosphohydrolase domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92257"
FT                   /db_xref="GOA:D4JMQ3"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMQ3"
FT                   /protein_id="CBK92257.1"
FT                   /translation="MEQLLEKVRLLHIQNDFKNNGGEDKYFRMALLMEELGEICDALTK
FT                   QKPNFKEEHADLLILLLGNCVAYDIDIIKLTSEKLDRLLKMKARTDGNGHSRLITELEE
FT                   KE"
FT   CDS             complement(91529..92182)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01130"
FT                   /product="Methyltransferase domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92258"
FT                   /db_xref="GOA:D4JMQ4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMQ4"
FT                   /protein_id="CBK92258.1"
FT                   /translation="MNYYKEVKSAFDDWATTYESDVVPKLDLRGYSYNELAKTILSYYD
FT                   KSMDKKSILELGVGTGVLGERVKSLVPSTEIDGLDISSEMLKRSKEKAVYNHLYLGSAD
FT                   EHLYTEQYAFVYSAFMFHSVKGQDILLSKIAECLVNGGMFILVDLIPNMKILANNADFN
FT                   AHSIKYEHGAPAMYKTCAEMVDLIESSPFELVELKKLGISKDYNHYLFALRKGK"
FT   CDS             complement(92214..92987)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01140"
FT                   /product="Methyltransferase domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92259"
FT                   /db_xref="GOA:D4JMQ5"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMQ5"
FT                   /protein_id="CBK92259.1"
FT                   /translation="MFDSSDVQSVFSGNIAEEWEKKSRYINSLNGNDNMMIPTIKKYIT
FT                   STSKILEVGCGTGKLLSQIDALTFGIELTGVEMSSDMLQQIDTLRFKNPVRLINDSVEN
FT                   FIDDNKYDIIVMKQVLHHIVSREQVLKKLAGYLNPNGVIIIMTPNDGYQKSILPFNPIT
FT                   DLLGRIDDSMIYEYIKDLPLQVVEIQHVNSLATFNSLYEYFMFLYAIGSLQKIFNYKGE
FT                   YEYALKLITVFKNLFSKEETLSVDFNYSYITLKKK"
FT   gap             94111..95572
FT                   /estimated_length=1462
FT   CDS             95854..97263
FT                   /transl_table=11
FT                   /locus_tag="ERE_01150"
FT                   /product="Arylsulfatase regulator (Fe-S oxidoreductase)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92260"
FT                   /db_xref="GOA:D4JMQ6"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR024001"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMQ6"
FT                   /protein_id="CBK92260.1"
FT                   /translation="MPVFHTFTAGGKRYMFDANTNVIINLKEDLYFELEKYMQSGYKEF
FT                   TPAIEKLRDRGYLKDRADFEMVHPMDSTLEYSLERCIGTIALQVTQGCNLRCKYCAYSG
FT                   SYDNRVHSSKRMSKEIAFKAIDFLFDHSIDRDRVSLGFYGGEPLLELDLIKECVKYAKK
FT                   KSIGKELMFNITSNTTLITDEVLKFLYDNEFSLTVSLDGDRQAHDKNRVFAANGAGTFS
FT                   VVMQILEKIQTQYPDYMERVHINAVIDPTTDFDCTSNFFSDYKTVKDFYIQANLISEYY
FT                   RKDEVATDEEYREKFSYEIFKMYLQKLGRLENGSVSKLVSHGFHSLKEIHDKTKMPSSL
FT                   TIKRDHHSGPCVPGIQRLFVDVEGNLYPCERVSEASKAVRMGHIDTGFDIDKARALLNI
FT                   GKLTEKECKQCWAFRFCSACAVQADNLEELSAEKKLQNCALIRGHIDNMMRDYCVMRDL
FT                   GCNFDKEKLFV"
FT   CDS             97277..98383
FT                   /transl_table=11
FT                   /locus_tag="ERE_01160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92261"
FT                   /db_xref="InterPro:IPR023823"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMQ7"
FT                   /protein_id="CBK92261.1"
FT                   /translation="MKRKAIIFPYNAECASLVRNRELLLNHEIVACVSPIGYGLQGKDA
FT                   AYAYGGENTGIVISDKKISEINFDDLLVCESSSDFDTFIMPQVKLAAECGKNVIFLYNI
FT                   SQQQKKEAEETCKKKNVKCVVLTNRRMDTDKLFEHEIIPLSVPVVFVASVIENTNKFDV
FT                   QLGLRKFLQEEGYKVSQIGTKEYCELFGFHAIPEFMYANQLSEADKIVWFNRICKSIEL
FT                   QEKPDIFIIGVPGATMVFNETITNNFGITAFEIANAVRPDTAIMCVPYEGYDSGFLKMI
FT                   QTSSKYKLDMQVDCFNMANKHFDVARSKEEKKLSFITTGADLVDKRIEDLKRDTEIPIY
FT                   NSLNVTSALEMYSYIVNKLSESDFGTVS"
FT   CDS             98797..100233
FT                   /transl_table=11
FT                   /locus_tag="ERE_01180"
FT                   /product="Subtilase family."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92262"
FT                   /db_xref="GOA:D4JMQ8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMQ8"
FT                   /protein_id="CBK92262.1"
FT                   /translation="MSLEIQIAVIDSGLNEKLLDRKKIRNRFEVDENNDFIEERSMSKA
FT                   SDFLHGTICAIIIEKYCPDAVFNSIRILNQNGTGGVEKLEPALEWCCKNNIKIVNLSLG
FT                   TTHFKEKDILKKLINRYTYKGLVFVAAISNIGYFTFPASFTNVIGVANVESPLSYSKDY
FT                   IHLGIDTVTISEHIIMLENKEHKTSPSNSYAAPYICALIANKLSNDKTLDIVKLKRYAK
FT                   EQSHIEMTVDSYEPDWIYRAYISGRGTMSRAEYYFETVTGVYDEIQGKIDTVIAYSMAE
FT                   LENLDIRNKNLIYLGHEDIHNIDVQGFIWSKETRQRQIKHNHYQGNGLEVPVVILAVED
FT                   VIDKFYILTELKRAFANGGYNAYTIGMEPECVLYALEYMPEPVSDIDAWKNFIESQTFY
FT                   KQSDLVIWCIPVEEQDKYLKVYPDCDVQISLCNEGDINIVRFSFEGEKIEKKISGLIDR
FT                   KDVEKIYHIIEAKLTEEEDG"
FT   CDS             100226..101932
FT                   /transl_table=11
FT                   /locus_tag="ERE_01190"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92263"
FT                   /db_xref="GOA:D4JMQ9"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMQ9"
FT                   /protein_id="CBK92263.1"
FT                   /translation="MDNKEAVKRLLLLLGRYKKTIVVIVGCLLVSTGLNLCVPLISRRI
FT                   MDDGFIGGNKKLLIELVLVSMVIYTINSLIDIVKEKKRVDISAKIQYFLSEQSFSHLMK
FT                   LRVNYFNNTNYAETLNNINTDINQMTSIADSSVFFVITQAFSMTGGIIGLFIIDFRMTV
FT                   LVLLFIPIKCVVMKYFAKKQKQIMDEFIKRNQEYAKWFGDTVGGVREVKLFNILDKKHE
FT                   EFVLNQNNIIEKQKQMNMLGQWNTIIDSIMVQFLSTLLYILGANLVFDMKLSVGSVFAF
FT                   ITYSAYVTGPISAILNIGYLLSGIIPSTKRYYAFMELEEETDNGKKTDLCPNDLRLQKV
FT                   SFVYERDKCILKNIDILFAKSSKTAIIGRNGSGKTTIINLLTRMYEPTSGEILLGAENI
FT                   SELPLPEYRNMVSVVSQQIYLFNDTIRNNICLDKQIDDTVIEAACKDSGLEDFIKEVSL
FT                   DHVVGQNGAMLSGGQKQKIALARALVHDKPIIIFDEATSNTDAYSEQQINGLLDTRLKD
FT                   KTVIVITHKKEVLSKVDQIVVLKEGVVADLGRYDDLVGKSDELNVMLEKAE"
FT   CDS             102334..102708
FT                   /transl_table=11
FT                   /locus_tag="ERE_01200"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92264"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMR0"
FT                   /protein_id="CBK92264.1"
FT                   /translation="MYRDTIFQYVKKQYGTIPEYLWNDLPDSAILRNDNGKWYAVFMNL
FT                   EGFKIGLDTKDRVDIMVVKCKPDMISVMTHMKGFLPGYHMDKSNWITILLDGTVQEAKI
FT                   LDFLDMSYDLTDGRIEESIE"
FT   CDS             103833..104540
FT                   /transl_table=11
FT                   /locus_tag="ERE_01220"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92265"
FT                   /db_xref="GOA:D4JMR1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMR1"
FT                   /protein_id="CBK92265.1"
FT                   /translation="MLNIAVCDDSRTDVEMLESAFDKLAQYQFSYEVYFTAKELLKHVI
FT                   DDGEMYHLYIFDIEMPEMNGLQLAKEIRKIDAKALFVFLTGYTQYVMDVFEVITFDYIS
FT                   KPITVEKLESVLLKAMQYLHMIKRDFVFQFRKNQFRISCDDIVYFEKKGRQAVIHTISE
FT                   NFKANMTTEEIWKQLDDKVFAHIHVSYIINLGHIRAIEGDEVVMDNEERLLIARSHKQN
FT                   LKEKHMEFVRRMV"
FT   CDS             104543..105829
FT                   /transl_table=11
FT                   /locus_tag="ERE_01230"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92266"
FT                   /db_xref="GOA:D4JMR2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMR2"
FT                   /protein_id="CBK92266.1"
FT                   /translation="MEYVIRFAISLFDLAVFMYYFHSNKKMKPVSKVWIWAGFTIAAVI
FT                   WTFVSSIKNPYLNLATLLIVLILLSFYYESGMWTRIINIVTFMGIGMLFEPVALLLLHA
FT                   MNFHVGESYKYYFVMVICSFVRGNVMYILSKLISKKGMQIADFPREILGVLVMVFTFTV
FT                   LNCCFVILLSLEAGSEKSLLMCASIVISIVLTDYFMLYMMERFNYLVQKQYEDAMYREE
FT                   MHYKDIYYEEAEKQNKEVQKLKHDMKHKLHELYHLVENSDGQELSEKIGAMCMEFEQID
FT                   EKQYSDNPIVDSVLRIKFGRAKARGIKVETSIRIPKQMQLDHGDIGVLYGNLVDNAVEA
FT                   CSKVPEGQRFVKIENKYQSGILLLIITNSKTGKKNKSLKTTKKDNIRHGHGVQSVRKVV
FT                   EKYNGTVSFTDKGDIFEVSAMLYGIEVKE"
FT   CDS             105933..106097
FT                   /transl_table=11
FT                   /locus_tag="ERE_01240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92267"
FT                   /db_xref="InterPro:IPR009229"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMR3"
FT                   /protein_id="CBK92267.1"
FT                   /translation="MSKLRRLMNRLSHGALSSVAALALTVTATNMNRCCWFIFGQDKLP
FT                   DNAKKLRKF"
FT   CDS             106112..106696
FT                   /transl_table=11
FT                   /locus_tag="ERE_01250"
FT                   /product="Accessory gene regulator B."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92268"
FT                   /db_xref="GOA:D4JMR4"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMR4"
FT                   /protein_id="CBK92268.1"
FT                   /translation="MIAKFAKKINEILIQKGIVQKEDAELYQYGIENGIVVAGNLLASG
FT                   IFGIVTGRPGLVLVFLLFYASLRSYSGGSHCKSRIGCFLISMAILFIPVYTYEPVMKNV
FT                   PNAVILLIGVLAVVIIIVLAPVESINKPLDEEERRYYARVTHCITALQVCVLIILFCLD
FT                   LQDYFYAGYVSIVLVAVFMVMGKIAVKRYVQ"
FT   gap             107064..107669
FT                   /estimated_length=606
FT   CDS             108095..109387
FT                   /transl_table=11
FT                   /locus_tag="ERE_01270"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92269"
FT                   /db_xref="GOA:D4JMR5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMR5"
FT                   /protein_id="CBK92269.1"
FT                   /translation="MNTILLVLCNALSCFIISTILFQFMNGKYKKSSRNRYVYIVIETT
FT                   TVIFTFCINMLNHSILNLVVWGVLTGIIAYVLYYEDIDKPLRRIIECEALVFCMSVCES
FT                   LGVILLQCILQAADIKNVNETMLYCLEVTFSKVILIFLYYTFINRFVKKSDVPYSNTRY
FT                   IMYGIILLYSLINMSVIVENFKNGEENYLCAVNMGCIVLADLYLLYFVKMADEKNYYEK
FT                   QLIALEQQAKVQYEYYLTQTKKYDQTIQILHDVNKHIKAIEGLYGAEQEKTAGEYATKI
FT                   RELLKPLIPVQYTENPILNILLTDKESVMREKGISVTIKIDNVNLNFIEPIDITTIFGN
FT                   LLDNAIEATEKLKGEKYICIKIGSYHKMIVVSIENNCNEVKWKNGFPVSNKGKNGGIGL
FT                   LNVQSSIKKYDGDLTLKNDGNKFAAELFLNS"
FT   CDS             109692..110162
FT                   /transl_table=11
FT                   /locus_tag="ERE_01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92270"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMR6"
FT                   /protein_id="CBK92270.1"
FT                   /translation="MKKIFKIISLVMMMVMCFSVTAFAAETDETSNLKVSFTDEGMINT
FT                   VDEDVTPGISVRAPAPAVSSVKVVAAQIKSDGYVYVTVQVAGYGKNIYATYDGSQCYVS
FT                   STTSVGKPIVTGYLYEVKCAKAVVGSHNFTFRITSVNSPWNTMSTSSIITVK"
FT   CDS             110282..110866
FT                   /transl_table=11
FT                   /locus_tag="ERE_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92271"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMR7"
FT                   /protein_id="CBK92271.1"
FT                   /translation="MSIAGINGYNYSNYYTGTKRNTAKANGMNSGLLSNVSSTSSNITL
FT                   HMSGTEDSGNALTAVGFPDGSSASVYKSDAYDSANPEYRVRYWDKEGNYTDTNVQINDV
FT                   DPRNASYLEMLAYTTYSDVEGFTKNAFGDFMNAAGGVNGNITYDSDSINEKKDYMSMIK
FT                   EFMQLQYDSNNLSGYLSYKELYDYINDRTER"
FT   CDS             110876..111463
FT                   /transl_table=11
FT                   /locus_tag="ERE_01300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92272"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMR8"
FT                   /protein_id="CBK92272.1"
FT                   /translation="MEISNNYSTAKVWNTSNKNVSKSSKKNKWKLTDSLKEKIVDLAKK
FT                   DAQDNVYMGNAFMNLRKTEVSKVAPNRAALIGKFSQSMNSGNMSAVKEVEEADKKWLCM
FT                   LFGIPYEAKYQGTGTGSAIHVYNEEGEEVLTYTGGVGWQEKETKAESQVHSALKMTYYE
FT                   AFSEARKALNSEEKTGSVGENIILQDNFDMKA"
FT   CDS             111508..112014
FT                   /transl_table=11
FT                   /locus_tag="ERE_01310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92273"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMR9"
FT                   /protein_id="CBK92273.1"
FT                   /translation="MFNLSKKKINKIMAFAIAFTMLFASQVTAFAATTSSKTVTSSKAM
FT                   SVALLPGVTGNSNTITFNFNSLPDKAIVKEVEIDCSNASVIGGKGAILAKSLTITSPSG
FT                   ETHTVSWGKGNVTTTNLFIAEKAAGTWSVYMTGTNIASPNLGSAFIGGTKYSSVKMKVS
FT                   YILED"
FT   CDS             112422..113480
FT                   /transl_table=11
FT                   /locus_tag="ERE_01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92274"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMS0"
FT                   /protein_id="CBK92274.1"
FT                   /translation="MFKKMPVCRLMISCPSDVKTEIEIINRVVDNINDSIGFSMNIFVK
FT                   TLYWSKNVMPEAGEYPQSIINKQILDKSDAIIAIFGNRIGSPTQHYESGTIEEIELMIQ
FT                   KGKQVFVYFSDKPVRKSEIDMEAETKIQAFKEKYKDRGIYVVYASDEEFNDYVSMHLTR
FT                   YLTTELANEVNRVNEHTRFDDSISQRKEVDLIYDYTKFYDIKQVSSYTDSNIMKIRTHK
FT                   DSFEMDIDIINVNKIENKEFAMALFEYAPCDNWSAFFEAGYFFEFDAASSGDIRAFQLE
FT                   IKDDIRNKVIDRTLQVSCEEEHFRIWIPSTTRDSTAWKKISQVCFVVFFNSTYIDGEKG
FT                   LLTIRNLKMVPR"
FT   CDS             113856..114251
FT                   /transl_table=11
FT                   /locus_tag="ERE_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92275"
FT                   /db_xref="GOA:D4JMS1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMS1"
FT                   /protein_id="CBK92275.1"
FT                   /translation="MGLSPYSLEQRFEFIKDCYKSGLSIPAWCHDNNIAPGTFYGWIKQ
FT                   VTSHGYEIPDSLNYHPAVKRQEVVKLPVIDDRCADSYMNDFPSFNDTYADKPLVLSAHI
FT                   GGITLDIPQDIDQDFLTKIFKSFKECL"
FT   CDS             114248..114592
FT                   /transl_table=11
FT                   /locus_tag="ERE_01340"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92276"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMS2"
FT                   /protein_id="CBK92276.1"
FT                   /translation="MIGDISGATSIYIITGKTDMRKSINGLCAIVYDMMGQEINRNSIY
FT                   LFCGTRCDRIKILLKEPDGITLLYKRLDVKGRYRWPRNSSEVKPITWRQFDWLMSGLDI
FT                   EQPKAIGNVK"
FT   CDS             114695..116320
FT                   /transl_table=11
FT                   /locus_tag="ERE_01350"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92277"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMS3"
FT                   /protein_id="CBK92277.1"
FT                   /translation="MSESAKDIQLLELKDTIAQLNNLIKNQSEIMAGLQKTIDNLRLEL
FT                   SNKQSELDYCKAKLFGASSEKSKTPFPGQLNLFGDMEDDRTPELIEAEDIEVTAHKRTR
FT                   KKKATYDELFGSLPVRQVKLDNLKPEELICPNCGDKMAAIGTEVVRTEVIFHPATLERV
FT                   EYIATTYECPSCKLTENPYFIKDNDAKPLVPHSYVSASLATHVMYSKFINAMPYHRQEK
FT                   DFFTQYGIKISRGTMAHWTIFCAKNYFAPMLDYFHRCLSKRKYLCADETPIQVLKEKDR
FT                   RPQTKSYIWLFRSGDDGMAPIIIYKYHPTRNGDAAADFFKNNPDGSYIMADGYAGYNKL
FT                   KDFNRCCCYAHIRRYFIEAIPKGHEKDFTNPAVQGMLYCNKLFEYERSYREKGLSYKQI
FT                   YNRRQRDQKPVVEAFLSWINNAPTTKGTRFDRAITYAKNQSSYMMTYLEDSHCSISNNM
FT                   SENSIRPVTVGRKNWLFCDTTDGADASMMVFSLLETARANGINPYKYLEFLLESRPNEK
FT                   MTDEQLDSLSPWNENVKQICQNNS"
FT   CDS             116709..117986
FT                   /transl_table=11
FT                   /locus_tag="ERE_01360"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92278"
FT                   /db_xref="GOA:D4JMS4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMS4"
FT                   /protein_id="CBK92278.1"
FT                   /translation="MNYKQNEKINQVKESTLVVGIDIGSTTQYARAFDWRGIELGKVFP
FT                   FSNSREGFESFKAWMQHLQDKYKKLDAIVGIEPTGHYWFDLGAYLEDEGILLVMVNPYA
FT                   VKQTKELDDNSQSKNDRKDPKVIAKLVTEGRYSAPYTPDGVYADLRIMVANRKRLIREM
FT                   TQIKNRFARWFAIYFPEYTDVFGDYEAQSSMLLLKKVCTPEAIVELGAEKINQIWRDAK
FT                   LRAVGMKRATTLCETAKRSIGLKKGSSAARYEMKLLLEDYEYKKAQLDAVMEEIEKLCR
FT                   KIPESEQMLAIKGIGVITVAGFLAEVGDVRRFESPRQIQKLAGLSLRENSSGKHKGQTT
FT                   ISKRGRSKLRAVLFNAAIPLIAKNPEFKSLHEYYTTRANNPLKKKQSVIAISCKLIRVF
FT                   YAILANGVTYDAQKMLSDIHRQPQAA"
FT   CDS             118127..118195
FT                   /transl_table=11
FT                   /locus_tag="ERE_01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92279"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMS5"
FT                   /protein_id="CBK92279.1"
FT                   /translation="MDKQNEGIKDPEVKEILYDMGG"
FT   CDS             118404..118550
FT                   /transl_table=11
FT                   /locus_tag="ERE_01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92280"
FT                   /db_xref="InterPro:IPR009229"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMS6"
FT                   /protein_id="CBK92280.1"
FT                   /translation="MKKLNDVALKLLAKAAYANAEKEANSACLFIGYQPKMPQKVKELK
FT                   ERK"
FT   CDS             118560..119138
FT                   /transl_table=11
FT                   /locus_tag="ERE_01390"
FT                   /product="Membrane protein putatively involved in
FT                   post-translational modification of the autoinducing
FT                   quorum-sensing peptide"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92281"
FT                   /db_xref="GOA:D4JMS7"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMS7"
FT                   /protein_id="CBK92281.1"
FT                   /translation="MDKLLKNVLSCMRTKGLLDENEEDVYRFGLECLLLEVVHYLSYIV
FT                   IGFAMRMIMPMIVTAMVLIPLRRKSGGFHARTRSGCYLFSCSIVVAVCLLDKIIFPLWL
FT                   CTITTFGANAIIFAFAPIENENRTLDQEEQKKFRKQALIILVLADMAIIISHKIHIEVC
FT                   QWLLNGMIVAALLNLCGKIQTKCKLEKIW"
FT   CDS             119279..119398
FT                   /transl_table=11
FT                   /locus_tag="ERE_01400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92282"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMS8"
FT                   /protein_id="CBK92282.1"
FT                   /translation="MLETDRVYISYMAIAVILCAALLCIAKIFKQEVRENEAG"
FT   CDS             119385..119525
FT                   /transl_table=11
FT                   /locus_tag="ERE_01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92283"
FT                   /db_xref="InterPro:IPR009229"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMS9"
FT                   /protein_id="CBK92283.1"
FT                   /translation="MKQVNKKVLKVVERVMRKEAVYGIDGFPPACLGIWHQPKRPNIKK
FT                   R"
FT   CDS             119589..121034
FT                   /transl_table=11
FT                   /locus_tag="ERE_01420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92284"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMT0"
FT                   /protein_id="CBK92284.1"
FT                   /translation="MKNKFITTVVATALALTMTFSLANGMDVKAAEITEDSLVAAEDTN
FT                   VGNESVDIQQQEPVEISELETTENNDLSKSSESITVDESIAEDILATQADTAVVVGTVS
FT                   DYLTAKGDAKLYNINLPAGVYLQAQLTTPANADLDYDLYLLDAEGNILTGSDYYTYING
FT                   TAGTLPEALGYITSGDTATYYLYVLASEGGSVSESFTLDYSVSTACDSYEIDESVRQAL
FT                   AFTYGAGGAYIESRNLSSPIDNDWYVITVPSSRIYDKLKISATTASTNTCSVEVYQNVA
FT                   SEGYQMKRVGSGNTISVSSGKYYIRVSNAKTMENFDDLDIQNYKLSITPILKATGIVIT
FT                   DLKGSEGLNKVVNYPGYGAHFRTQGSGTLTVYGVLTATDSSTGVTYAVGGEQINGLYYS
FT                   PAWEANNTSANAIRRGTGTTDSSGKFEIDISLPPGIGVYSYYGSTSTHYFDICGVSVSP
FT                   SDDSSISASETIFHLAYTMYHPF"
FT   CDS             121123..122055
FT                   /transl_table=11
FT                   /locus_tag="ERE_01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92285"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMT1"
FT                   /protein_id="CBK92285.1"
FT                   /translation="MKIATQHYQDSVITPYGNNHWNGKEKIDISKEKDDAVILEISAKG
FT                   KRAIQLKEKNEFEQNIVQVDKSADDLPAYSGMYDVDKTISSSLENCSKEEQGFVYDIIR
FT                   ENFLIGNGSSVSEEERQANISLGMKKAEYAANNFISEDKKSSFLDAMESIAKLASAGKM
FT                   NADGNMDYGVKKGNYLGHGSNLVYTTDGLDMMRSMDSGAYDEYQRISRESSNSDRQLNT
FT                   LKYLTNWYSNAVTKNPHMVEKYEAKSDEYIEKNVKNQKVDSIFSDLKTESKSAFIESLK
FT                   AFQAQNPNFLSNIVNKELSRKYWAYGIIA"
FT   CDS             122039..122272
FT                   /transl_table=11
FT                   /locus_tag="ERE_01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92286"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMT2"
FT                   /protein_id="CBK92286.1"
FT                   /translation="MVLSPKGEDKYEMKYVPEDFDRYDQGFFGRAKPEYIIVKGECLEK
FT                   LKQQGYEMDCWQKGIPLAINNKHPDSIKLKGF"
FT   gap             122596..123934
FT                   /estimated_length=1339
FT   CDS             124059..124481
FT                   /transl_table=11
FT                   /locus_tag="ERE_01460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92287"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMT3"
FT                   /protein_id="CBK92287.1"
FT                   /translation="MERAIIYYAKTGLEATDHFVPKLLEKYCQDNGYEIVAMLSEPAST
FT                   EGVSFPMKYAIIGLNMEEDVNTIITLSKDMIGATDENVIDTLGKLSEYDIYVEDINGEL
FT                   EECYEMMYKEPVQESDIRGLVLDTVSKFYHNIRNGR"
FT   CDS             124490..124876
FT                   /transl_table=11
FT                   /locus_tag="ERE_01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92288"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMT4"
FT                   /protein_id="CBK92288.1"
FT                   /translation="MQDSREKKRCLIFARNNANDTADRIEAYAKKSGMEVVETIFNTDK
FT                   KAVERLRYYIERDAIICVLVRDVVDISMELNEIKAVMTLAAEHGISINAESRGYEPALI
FT                   SLFARHGRALTGVSPEHAQVVGNV"
FT   CDS             125166..125309
FT                   /transl_table=11
FT                   /locus_tag="ERE_01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92289"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMT5"
FT                   /protein_id="CBK92289.1"
FT                   /translation="MGMERRGEQSISLSMSRIAEMTTSAVTNRVKGGQIKRDGKERTHG
FT                   HK"
FT   CDS             125296..126579
FT                   /transl_table=11
FT                   /locus_tag="ERE_01490"
FT                   /product="Retron-type reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92290"
FT                   /db_xref="GOA:D4JMT6"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMT6"
FT                   /protein_id="CBK92290.1"
FT                   /translation="MDTSNLMEQILSSDNLNRAYLQVVRNKGAEGVDGMKYTELKEHLA
FT                   KNGETIKGQLRTRKYKPQPARRVEIPKPDGGVRNLGVPTVTDRFIQQAIAQVLTPIYEE
FT                   QFHDHSYGFRPNRCAQQAILTALNIMNDGNDWIVDIDLEKFFDTVNHDKLMTLIGRTIK
FT                   DGDVISIVRKYLVSGIMIDDEYEDSIVGTPQGGNLSPLLANIMLNELDKEMEKRGLNFV
FT                   RYADDCIIMVGSEMSANRVMRNISRFIEEKLGLKVNMTKSKVDRPSGLKYLGFGFYFDP
FT                   RAHQFKAKPHAKSVAKFKKRMKELTCRSWGVSNSYKVEKLNQLIRGWINYFKIGSMKTL
FT                   CKELDSRIRYRLRMCIWKQWKTPQNQEKNLVKLGIDRNTARRVAYTGKRIAYVCNKGAV
FT                   NVAISNKRLASFGLISMLDYYIEKCVTC"
FT   CDS             126819..127205
FT                   /transl_table=11
FT                   /locus_tag="ERE_01510"
FT                   /product="Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92291"
FT                   /db_xref="GOA:D4JMT7"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMT7"
FT                   /protein_id="CBK92291.1"
FT                   /translation="MKLNRGDIVIANLESVSKGSIQKYTRPYIIISNNKANQYSPVVTA
FT                   VAMSTKTWKKKYLPTHCPIPAAKVKVTDTDFEVFDSMALCEQIVSIDVNVQIERVVASI
FT                   SDTELLDKITECVKIQIGAYEKYN"
FT   CDS             127289..127537
FT                   /transl_table=11
FT                   /locus_tag="ERE_01520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92292"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMT8"
FT                   /protein_id="CBK92292.1"
FT                   /translation="MTAEEYRALLDTDFSDVKINEMPDMASYHADLNDTIEKRQQKFIR
FT                   KVGNPYMMRVGKMKVKVSFANNGVSIEEAFKNMLLTV"
FT   CDS             127677..129368
FT                   /transl_table=11
FT                   /locus_tag="ERE_01530"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92293"
FT                   /db_xref="GOA:D4JMT9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMT9"
FT                   /protein_id="CBK92293.1"
FT                   /translation="MSKQISKIYHAAIYVRLSKEDGDVSTSAKAESNSISNQKDFIRNF
FT                   LADKKDIRIVKEYVDDGYSGSNFDRPSFQTMMEDIKRGVIDCVVVKDLSRFGREYIDSG
FT                   RYIERLFPALGVRFIAINDNYDSVTGKSQGDEIIIPFKNLINDAYCRDISIKIRSHLDV
FT                   KRKNGEYIGAFVPYGYEKSDDDKHKLVIDIYAAGIVKEIFRLKLHGMSQDAIATQLNNE
FT                   GVLAPMEYKQSTGSGYQTGFLQNEKSVWSSVTVRRILENEIYIGNLVQGKRTTPNHKVK
FT                   QEVVKPESDWIRIEKNHEPIISDRDFEIVQRLLGMDTRISPDSDMVYNLSGIAVCADCG
FT                   SPMTRKITTAGDKKYAYYICSNHKLTKQCSQHSISVSLLEDTVLEMLKLHIKNVMNLEE
FT                   ILDYIGTIPFQQLDVKSLEARKQKKLEEVEKCKRLKTSLYEDMKDGILTKEEYLELHEA
FT                   YLKKAKEGEEIIRQIERDIALILEEKDDKHLWMNYFTEYKDIKELTRDVVVKLICEVRV
FT                   SENKEVEIVFDFDDCYKQLLESVEKLGYQVDKEPGGQLNISRREAV"
FT   CDS             129370..131052
FT                   /transl_table=11
FT                   /locus_tag="ERE_01540"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92294"
FT                   /db_xref="GOA:D4JMU0"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMU0"
FT                   /protein_id="CBK92294.1"
FT                   /translation="MARKSRKNMMLQENTALPDKEKKVLFKAGLYARLSHEKEENIERG
FT                   TIETQMELMKNYVKDHEDIVIEEEYYDASFTGTNFERPDFKRMLEDAKTGRINCIIVKD
FT                   LSRLGRNYVEMGNYIERVFPFLNVRFIAVTDDFDSFRPGTDLMMPLKNIVNEFYAKDIS
FT                   KKVSTAHRRKWTTDEYMCGFAPYGYLKSKTEKNRIVVDEATAGNVRLIYKLFLDGKGYT
FT                   PIAKYLNEQGIMSPLMYLKSLGYQQNVKTNGVWTKTTVKSILTNQAYIGSAVHGKVVIE
FT                   KYNNIPLHATDPSEWVIVENTHEPLVDKETFEKAQERVKEISDAYFAKEFTKHPPNEKN
FT                   LLKGKIVCGDCGKGMRLSPRTTKSYVYFCGTFSDGINPACSRHKINQEDVNNAVFAQIS
FT                   NHMRCCIDALRVIRELNARSSGLKKYDVYEKAITRQRRELEKVNRKFSELYGDYSEHLI
FT                   NESEYLTLKQQYLLKSEALKKEIDNLLISQNLYSKNYKIDADWENLINKYLKCRKLNKE
FT                   LADAFVDKVQVFEGGRISVNLVYDDCLEELLQVKNKREGDLNE"
FT   CDS             131045..132595
FT                   /transl_table=11
FT                   /locus_tag="ERE_01550"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92295"
FT                   /db_xref="GOA:D4JMU1"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMU1"
FT                   /protein_id="CBK92295.1"
FT                   /translation="MSKITAMYIRLSMEDEDVSLNRKEESNSISSQRELLKAYIENHSE
FT                   LKDTKVQEYCDDGFTGTKFERPGYMKLMEDIRAEKISCIVVKDLSRLGRDYIEVGSLLE
FT                   QILPLYQVRVIAVNDNYDSNNYDGSTGGMNVAFKNLIYMLYSRDLSNKICSAKHTRILN
FT                   GENISGQLRYGYVKDPSDKHKIIVDPEAAEVVKLIFELTAQGKRKTEVANYLNAQGIDT
FT                   PSAYKKRKGSRNVFHAVEVKSLWSTSSIRDILNDEVYLGKLIWNKTKKRIGSNNTSSYV
FT                   PKDEWMVIENCHEPIITQELFDMAHANSKKCVRLKRGKRNYNPFYYCGVCGRALVPSKR
FT                   VKGDILLCYSSRIEENSPCKNNRVEVAKVEDAIMKIVNMYATAYLDEKGIKKAGKSKEV
FT                   SPEEKIATLEKKVKSLSSKKMMLYSDYKDDKLTREEYVKRSKAMVEQIDELHQEIEQLK
FT                   TEIPPEDNSSSKFETQLESIINMESFDREKIQKVIKKVIINGEDNIEIVWNTDDPFFK"
FT   CDS             132768..133103
FT                   /transl_table=11
FT                   /locus_tag="ERE_01560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92296"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMU2"
FT                   /protein_id="CBK92296.1"
FT                   /translation="MPDYSIVKSLCEELEVTVAELLDGEKAEDKSVRIYDDEQMLDLLR
FT                   RTQELEKQKVMLTGLILIVMGIAFQALSYTLGGSDFKDFLSGLLLGLSIAEMLVGVYVV
FT                   GKSLTGR"
FT   CDS             133394..133630
FT                   /transl_table=11
FT                   /locus_tag="ERE_01570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92297"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMU3"
FT                   /protein_id="CBK92297.1"
FT                   /translation="MRTIYAEYNINHDSIDVYTSAGYMLRIDCWKAEKNLKTTYGSECA
FT                   LTSLAVDEPLEYARLYLEGNLQMWVDAEDSLEL"
FT   CDS             complement(133782..133958)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92298"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMU4"
FT                   /protein_id="CBK92298.1"
FT                   /translation="MLKKCSIVLADEPTGSLDKKNSEIVMNILHELSEQGKTVIVVTHS
FT                   EEIVAQEKHVLYL"
FT   CDS             complement(134074..134391)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01590"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92299"
FT                   /db_xref="GOA:D4JMU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMU5"
FT                   /protein_id="CBK92299.1"
FT                   /translation="MITIENLCKAYNDKILFKNFHLEIPDSRFLVISGESGCGKSTLLN
FT                   MIGGIETPDKGSIIVNGFDVAKKGKKQKYFKEVVGFLFQNFALLENKTVKENLEIIKKI
FT                   R"
FT   CDS             complement(134388..136328)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01600"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92300"
FT                   /db_xref="InterPro:IPR006541"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMU6"
FT                   /protein_id="CBK92300.1"
FT                   /translation="MKAIKNLCLFCFLIFGILMQSEIFQDQLWNFSTAYFTSSRYEVAS
FT                   EDMSQFLKDVSETATENDVHIFSQYNEINNKYLSTLHIYGDDKVIRQTLKNTANIEESE
FT                   YTALVSGITKVKFHNLSELQSTSVGYENFISYIGNEDNIISAYQKLSEKYSLTYPEYWN
FT                   STEKDMIFIIWGMIIALMIVLNVIEVVRRKKEVVVRVSLGESAGFIAFKAALFDVTFDI
FT                   ALFIVAKILLSNYISGAYENRLVTILYSIGIILSTIPYCSFCFFDIRKAFANATHKRGV
FT                   DFLIYSLKFIAGVAAVFTITTNISSIHNNLFTNEHLLEEYYDANYFTVKTTDFNAEKEE
FT                   AFWNKLYKNEYNTLKPVICLNILNDKNDVIYVNNHAKDMLQGFTKQINAVENESSDLII
FT                   FIPKNRYFAKNKQLAYDSLSHVLNHDNLQQLNIQYIEYSETEYFSYLDTSRINGIEKSK
FT                   NPIIIYQANKDLAVNGGYLESYKAGAVLFQCDEKQLRNISKKYEDMLGNYQLVITNVHE
FT                   QYLYNHTFLIKLVGFLSSLCTIVLLLNIMIIVTVSRLEFRENAMKISLMKIFGYSLFER
FT                   HKTLLKMIVVENFVILVGMLIYSLLSVQTEVGISILVSSFMALIEFTIIFFNITIVEKT
FT                   NIPKSLKGGCL"
FT   CDS             complement(136329..136778)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92301"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMU7"
FT                   /protein_id="CBK92301.1"
FT                   /translation="MKKKIKYIGIVLVILFCCYNLFWYFGSYKPYNEFQKDFPEIEESG
FT                   VKIYTDKDGFQYSVSVPDYLLWNGNLAIAESDVRYALIIWIKPFHQGISQGVLFNDYKD
FT                   LNTQIMLSSSKKAEDQEDQWIVDENSTILTTIFEKANKVWNLGLK"
FT   CDS             complement(136846..137190)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92302"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMU8"
FT                   /protein_id="CBK92302.1"
FT                   /translation="MRAKKVIVGVAISAMLISSSIPVMAFSVTNGNKTFDKKWELSTTS
FT                   DDGKGVLTYGYNTLAINEDYAHAYHSTKDHYAYVKNGNGSFSGSNVGKGNWSKIEVAHK
FT                   GNSITYGNSY"
FT   CDS             complement(137927..139648)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01640"
FT                   /product="plasmid mobilization system relaxase"
FT                   /function="plasmid mobilization system relaxase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92303"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMU9"
FT                   /protein_id="CBK92303.1"
FT                   /translation="MAIFHYTVKIVGRSKGKSVISASAYLNGDVMKNEETGRISYYTSK
FT                   KEVVYTRLMMCENAPPEWQIVPEENIKRFQKSVRYKRSEDKEAALEKFKITFQKQRLWN
FT                   EVLKIEKNADAQLGRSFEFALPKEWNRQEQIQYTTDYIQKTFVDRGMCADWSIHDKGDG
FT                   NPHVHLLLTMRPFNPDHSWGKKEVKDWDFLRDKNGNIVIDESHPNWWQDKKNPDRHGIR
FT                   IPVLDENGIQKMGARNRLQWKRVLTDANGWNNPKNCELWRSEWAKVCNEHLPLHNQVDH
FT                   RSYEKQGKLQIPTIHEGADARKIEQKFLAGQEIKGSWKVAENQIIKQQNTLLQKILDTF
FT                   GKVSGALSLWKERLNDIRRKPGNYTLNGIHDWANRRTADLNGRNDSGNAEPGHPTLSYA
FT                   GTESEIAKIKQRVIRAAQHFAKYRGTAFQDGRTENEDRTFGKRKSAMAEIGTETEQRKQ
FT                   FITETEHRIAELEQQIEKGRDIDERIQRIKERRTVGRTSPLDRGDTRRTGTERPAYRGT
FT                   KDAAQRISDLEREIKQREQSREYSSIKERLEASRQSIAEREREAAKRKRHDRGMSR"
FT   CDS             complement(139605..139976)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92304"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMV0"
FT                   /protein_id="CBK92304.1"
FT                   /translation="MAEGMSFSFPSLLFHEGRTYGQPEVVPISLPQVATGLRSRLPGSF
FT                   RRRGFQPDLLMPQEALFAREAHSMQAAMRRALLRRGRSGNAAFPKTESNVAGNLCRMCR
FT                   KEESRHGDFSLHSQNSRTK"
FT   CDS             complement(139976..140290)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01660"
FT                   /product="relaxasome subunit MobC"
FT                   /function="relaxasome subunit MobC"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92305"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMV1"
FT                   /protein_id="CBK92305.1"
FT                   /translation="MAKSTKSYEARMLEMEKKEQESLEKAKRYAAQKKELLKRKKAEES
FT                   KKRTHRLCQIGGAVESVLGAPIEEEDIPKLIGFLKRQEANGKFFSKAMQKEVNTDMEEV
FT                   "
FT   CDS             complement(140431..140661)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01670"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92306"
FT                   /db_xref="GOA:D4JMV2"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMV2"
FT                   /protein_id="CBK92306.1"
FT                   /translation="MTQRKIALSIEEAADYTGIGRNTLRQLVEWKKLPVLKVGRKVLIK
FT                   TDILEMFMEANEGRDLRDRGNVKAVTRTAAN"
FT   CDS             140833..141462
FT                   /transl_table=11
FT                   /locus_tag="ERE_01680"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92307"
FT                   /db_xref="GOA:D4JMV3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMV3"
FT                   /protein_id="CBK92307.1"
FT                   /translation="MKDKELRKLIGSRVKQRRLELNLTQPYVAEKMGVTASTILRYENG
FT                   SIDNTKKMVLEGLSEALHVSVEWLKGETDEYETDITDKRELQIRDAMGDILEQLPLALT
FT                   KEEDAFSKDLLLLMLKQYGLFLDSFQFACKNFKGNAGQTDIAKTIGFESNDEYNEIMFL
FT                   REITHTINAFNEMADVVRLYSKKPKTAEQRLANLLSEVLYEDSESV"
FT   CDS             141549..142844
FT                   /transl_table=11
FT                   /locus_tag="ERE_01690"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92308"
FT                   /db_xref="GOA:D4JMV4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMV4"
FT                   /protein_id="CBK92308.1"
FT                   /translation="MAKGSVRKKGKKWYYRFYVEDASGNLVQKECVGTESKSETEKLLR
FT                   QAMDDYEKKKFVAKAENLTVGQLLDVWAEEELKTGTLSNGTVENYLGTIRNIKKHPLAE
FT                   RKLKNVTSEHLQSFFDLLSFGGVHPDGKERKGYSKDYIHSFSAVMQQSFRFAVFPKQYI
FT                   TFNPMQYIKLRYQTDEVDLFSDEDMDGNVQPISREDYERLLAYLQKKNPAAILPIQIAY
FT                   YAGLRIGEACGLAWQDVNLEEQCLTIRRSIRYDGSKRKYIIGPTKRKKVRVVDFGDTLV
FT                   EIFRNARKEQLKNRMQYGELYHTNYYKEVKEKNRVYYEYYCLDRTEEVPTDYKEISFVC
FT                   LRPDGCLELPTTLGTVCRKVAKTLEGFEGFHFHQLRHTYTSNLLANGAAPKDVQELLGH
FT                   SDVSTTMNVYAHSTRDAKRKSVRLLDKVVGND"
FT   CDS             143106..143630
FT                   /transl_table=11
FT                   /locus_tag="ERE_01700"
FT                   /product="NADPH-dependent FMN reductase."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92309"
FT                   /db_xref="GOA:D4JMV5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMV5"
FT                   /protein_id="CBK92309.1"
FT                   /translation="MKIVIINGSARKGNTLTAINAFIKGASEKNEIEIIEPDKLNIAPC
FT                   KGCGVCQCSKGCVDKDDTNPTIDKIAAADMILFATPVYWWGMSAQLKLIIDKCYCRGLQ
FT                   LKNKKVGTIVVGGSPVDSIQYELIDKQFDCMAKYLSWDMLFKKSYYATARDELEKNKDS
FT                   MNELEGIGKNL"
FT   CDS             145228..145746
FT                   /transl_table=11
FT                   /locus_tag="ERE_01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92310"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMV6"
FT                   /protein_id="CBK92310.1"
FT                   /translation="MILKVENIVYNELLIRGYNVDVGIVEMYAKNDEGKTTRKQFEVDF
FT                   VVNQGSQRYYIQVAYDMTSEEKQKQEFNSFRNIPDSFKKIVVMVLYSKKVYELSKESEN
FT                   DELDGSLSYLNAKEKEFLAFLLKKRLYEFTPIEVSKMRGVTNKTIINRCAKTNDKELFF
FT                   LFHNSIIMV"
FT   tRNA            145791..145862
FT                   /locus_tag="ERE_T_36610"
FT   tRNA            145881..145951
FT                   /locus_tag="ERE_T_36620"
FT   CDS             145960..146046
FT                   /transl_table=11
FT                   /locus_tag="ERE_01730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92311"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMV7"
FT                   /protein_id="CBK92311.1"
FT                   /translation="MTTSVYDVVFLLYTKSNIKLIIRIILLF"
FT   CDS             complement(146094..147086)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01740"
FT                   /product="Predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92312"
FT                   /db_xref="GOA:D4JMV8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMV8"
FT                   /protein_id="CBK92312.1"
FT                   /translation="MKQLNWATLGCGVIANELAHALSKEGRTLYSVANRTHEKAVAFAQ
FT                   KYGISKVYDNIDDVFYDPDVDIIYISTPHNTHINYLRKALSNGKHVLCEKSITLNIAEL
FT                   DEAVSLAKENNVILAEAMTIYHMPVYKKLNEIIASGQLGRLNLIQVNFGSYKDYNMTNR
FT                   FFSRKLAGGALLDIGVYSLSLIRWFFKETPTQVSSQVKYAPTGVDEQAGILLMNDAVEM
FT                   ATVTLSLHSKQPKRATLSFDKAYVEIFEYPRGMQATITYTEDGHKEVIDAGDTSDALYY
FT                   EVRDMEKAVSSASSDEIETLMHCQYTYDVMKIMSDIRAEWGMKYPEEEK"
FT   CDS             147659..148402
FT                   /transl_table=11
FT                   /locus_tag="ERE_01750"
FT                   /product="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92313"
FT                   /db_xref="GOA:D4JMV9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMV9"
FT                   /protein_id="CBK92313.1"
FT                   /translation="MLAEDRCKKILDILDSMGSVTVQQLMDELDTSESTIRRDLVAMDK
FT                   KGYLTKVHGGAIANNTNIHTQDEKVINRLKQNRSEKEQIARYAASLIVDNDFVYIDAGT
FT                   TTAVMIDYITAKNVVFVTNSLTNAKRISDRGYTVYILGGEFKSTTEAIVGDEAVVTLDK
FT                   YNFTKGFWGTNGITVKNGFTTPEIKEAMVKKKSMENSKEKYILADDSKFSQVSSIKFAD
FT                   FEDAVIVTNALSNDNYKKYKNIKEV"
FT   CDS             148404..149321
FT                   /transl_table=11
FT                   /locus_tag="ERE_01760"
FT                   /product="fructose-1-phosphate kinase"
FT                   /function="fructose-1-phosphate kinase"
FT                   /EC_number="2.7.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92314"
FT                   /db_xref="GOA:D4JMW0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMW0"
FT                   /protein_id="CBK92314.1"
FT                   /translation="MIYTVTFNPSLDYIVDVTDFKTGVVNRTTGEKIFAGGKGINVSMV
FT                   LKNLGMSNTSLGFTAGFTGNEIKRLLAKKGVDTDFIEVEDGISRINVKLRSNEESEING
FT                   QGPVITEDNIKKLYEKLDCLKESDVLVLAGSIPDVMPSSMYMDIMKHLEGRGINIVVDA
FT                   TRNLLTNVLAYKPFLIKPNNHELGEIFGVEVTDKDDVIKYAKKLQEQGARNVLVSMAGD
FT                   GAVLVTEDGQEFKAQAPKGKLKNSVGAGDSMVAGFVYGYLKSNDYKQAFIYGVCTGSAS
FT                   AFSEELATKPEVEALIDKWDSASN"
FT   CDS             149383..151311
FT                   /transl_table=11
FT                   /locus_tag="ERE_01770"
FT                   /product="PTS system D-fructose-specific IIA component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)/PTS system
FT                   D-fructose-specific IIB component (F1P-forming), Frc family
FT                   (TC 4.A.2.1.4)/PTS system D-fructose-specific IIC component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)"
FT                   /function="PTS system D-fructose-specific IIA component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)"
FT                   /function="PTS system D-fructose-specific IIB component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)"
FT                   /function="PTS system D-fructose-specific IIC component
FT                   (F1P-forming), Frc family (TC 4.A.2.1.4)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92315"
FT                   /db_xref="GOA:D4JMW1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMW1"
FT                   /protein_id="CBK92315.1"
FT                   /translation="MTIRDLLAAESINLNGTPAGKTEALNQCIDLMAKSGKIADVEKYR
FT                   KGVFAREEEGTTGIGMGIAIPHCKSDAVTKAGLAAMVVKDGVDFESLDGTPAKIIFLIA
FT                   APNTEDNVHLQVLSKLSVMLMDEQFTNSLINAGSVDEFLNIIDSAEKAKDEKEAAKEAK
FT                   AKEPVEVKKDDVFIVAVTACPTGIAHTYMAAEAIEKKAKELGYQVKVETRGSGGAKNVL
FT                   TDDEIAKAAGVIVACDTNVPTDRFDGKKVIECQVSDGINKAEELIKRIASGDAPVFKAS
FT                   GKKEASHSSVGGKESVGHQIYKHLMNGVSHMLPFVVGGGILIAIAFLIDGFSVDLNSLP
FT                   ADQRANFGTITQAAAMFKGIGGTAFGFMLPILAGFIAMSIADRPGLAVGFVGGSIAANG
FT                   TSGFLGALVAGFVAGYIVLLLKKIFSKLPESLDGMKPVLLYPLLGIFLVGVIMQFVVEP
FT                   PIGALNTAINNGLNGLNGASAVVLGVLLGGMMSVDMGGPVNKAAYVFGTASIAAGNYNI
FT                   MAAVMIGGMVPPIAIALATIFFKNKFTAEERKAGPTNFIMGLSFITEGAIPFAASDPLH
FT                   VLPACVVGSAVAGGLSMAFGCTLMAPHGGIFVVPTIGNPLMYLVALVIGSFIACGLLGL
FT                   LKKKVSE"
FT   CDS             151549..153309
FT                   /transl_table=11
FT                   /locus_tag="ERE_01780"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92316"
FT                   /db_xref="GOA:D4JMW2"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMW2"
FT                   /protein_id="CBK92316.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVLENNQPVVITNSEGQRTTPSVVAFTKN
FT                   GERLVGEAAKRQAAVNVDRTFFSIKRQMGSDFRAKVDGKLYSAPEISSMILRKLKKDAE
FT                   DYIGEAVTDAVITVPAYFSDAQRQATKDAGRIAGLNVLRIINEPTSAALAYGLDHGQQQ
FT                   KILVYDLGGGTFDVSVIEIGDNLIEVLATAGDNHLGGDDFDERITNYLVTEFYRQQNVD
FT                   LRKDNTAMQRVREEAEKAKKVLSSSSSTTINLPFITTVKGQPVHMEMNLTRAEFNEITK
FT                   DLVERTAIPVNQALSDAGICAAELGMVLLVGGSTRVPAVVEEVRRITGKEPSHNLNPDE
FT                   CVALGAAVQGGKLGGAIVAGSSAAEIILMDVTPLSLGIETVGGVSTKIIDRNTTIPTRY
FT                   SQIFTTAGSFQTSVDIKVLQGERQFARDNKLIGNFRLKGIKPAPAGVPQIEVTFDIDAN
FT                   GIVQVSAKDLGTGKHQEITITASSNLSDSEIEQAIREAQEYEATDGQRKAYIDARSEAD
FT                   TLVRQVENVMADKEKRKAMDSAQKKSVKSSLSYVKKLISRTKPGNVSEEQAAEIKHAAD
FT                   ELRNAAAGLI"
FT   CDS             153441..154313
FT                   /transl_table=11
FT                   /locus_tag="ERE_01790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92317"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMW3"
FT                   /protein_id="CBK92317.1"
FT                   /translation="MNANDKTEKVLREIHIMLSKAEPYKPEPSRVIINKQQMIDLLAEL
FT                   NKCIYAIQDEYELTEQSRNHAEREFRKKGDQIVWDASRKAEDVYAASVIYTDEALSRVR
FT                   DIINDTNESLEKLCKNMKDKIAEQEKIVKTNQYELKGQLQDLSDTEKYLKIIDDRNKEI
FT                   ERQKNAGKPVEERTIDNEEKSIYANRQTEIKVNMDYIRKLGLAEGEDLGDGVVGEVKLA
FT                   DDTPDAGLNHSNDKDEAKAAGSKSSVDEDYKAISRKAGNPPVINTKEGKELTDGIHRMW
FT                   QSITGNKGK"
FT   CDS             154491..155183
FT                   /transl_table=11
FT                   /locus_tag="ERE_01800"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92318"
FT                   /db_xref="GOA:D4JMW4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMW4"
FT                   /protein_id="CBK92318.1"
FT                   /translation="MTILVCDDDKEIVEAIEIYLMQEGYDVEKAYDGIQAVEIMKNKKI
FT                   DLMIIDVMMPKLDGIRATLQIRKESRVPIIILSAKTEDADKILGLNVGADDYVTKPFNP
FT                   LELVARVKSQLRRYTTLSSNDAAGDKVYEAGGLLVNDDLKKVTVDGEEVKLTPIEYNIL
FT                   LLLLKNKGKVYSINEIYESIWNEEAIGADNTVAVHIRHIREKIEINPKEPRYLKVVWGV
FT                   GYKIEDNK"
FT   CDS             155180..156553
FT                   /transl_table=11
FT                   /locus_tag="ERE_01810"
FT                   /product="His Kinase A (phosphoacceptor) domain./Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92319"
FT                   /db_xref="GOA:D4JMW5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMW5"
FT                   /protein_id="CBK92319.1"
FT                   /translation="MKQYTIGKKAAVIVLHQLCMILMVTGVFATGYAFRHDAHGNIDIY
FT                   TLISLAGLVGSFVSLAYMANVAGRKSEDDYTIYYLPIDKVYSDVMLVIFTLLMVFMGKV
FT                   ISGVKNQHFDYASLIMTAGTFTFLFDLAFIILYQSIVRKIKGNILYTHSLMYKGYELLK
FT                   RVIEKKDIHTQKTKEIMRIQEALEAISEGALDTTLNVNEFHGQQKKVAEAVNHIRQGLM
FT                   SSVNESLKNEKLKADLITNVSHDIKTPLTSIVNYVDLLKRENLENENAKYYIHVLEEKS
FT                   QRLKQLTEDLVETSKITSGNVKLNMQKLDLVELLYQTGGEFNERFESRNLTIVTKIPSE
FT                   QIFIYADGRQLYRSIENLYTNAAKYALENTRVYVELEKADKKAVFTIKNVSKNELDIVS
FT                   NGNVDLTERFVRGERSRTTEGSGLGLSIAKNLTHLMGGKFEIKVDGDLFIATITYNII"
FT   CDS             158900..160213
FT                   /transl_table=11
FT                   /locus_tag="ERE_01830"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92320"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMW6"
FT                   /protein_id="CBK92320.1"
FT                   /translation="MEETGKAGKKSNIEINADKGAKQNSHPGREEWPHLIRIGVMVFVT
FT                   FAVSILFFFALYRFEGFAGIWSKLLAAAMPIIMGLVLAYLMNPVMLWLERCFKKLLSKK
FT                   MKSESKLRKVSRALAITGSVIILVAIISLLIAAIVPSVIASISGLMKTLPNDVAAFINM
FT                   IKNGNFGDSKIAELASTGLQNATDYIEDYATEKLIPEAQKYVAQITTGVISVVRGLFNF
FT                   IIGIIVMVYVMSIQETLAGQSKKIIYAVCKPKTGNIIIETIRKTNEIFGGFISGKIIDS
FT                   LIIGVIAYFGCLILRIPSSVLVAVIIGVTNVIPVFGPFIGAIPSLLIVVIQSPWHALYL
FT                   LIFIVVLQQVDGNIIGPKILGSSTGLSTFWVMFAILIGGGMFGFLGMLLGVPTFAVIYY
FT                   IVKRVVNYALRKKKLPEDTRDYTKTTGVDTKNNKLKYE"
FT   CDS             162866..164824
FT                   /transl_table=11
FT                   /locus_tag="ERE_01850"
FT                   /product="alpha-1,4-glucan:alpha-1,4-glucan
FT                   6-glycosyltransferase"
FT                   /EC_number="2.4.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92321"
FT                   /db_xref="GOA:D4JMW7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMW7"
FT                   /protein_id="CBK92321.1"
FT                   /translation="MCNFTAMDCYLFGQATHYDIYKKMGAHLAERKGKKGVCFDVWAPH
FT                   AREVYVFGEFNDWNETSHEMKRVEPETMGVYELFVPGAQKGQMYKFIIVTEQGDKLYKA
FT                   DPYANYAELRPGTASIITDIEHFTWTDKEWMDKRAAKSDADVYSSPMAIYECHPGSWMR
FT                   HPGRDDEGFYTYRELAKSLISYVKTMGYTHIELMGISEYPFDGSWGYQVTGYYAPTSRY
FT                   GEPEDFAYFVDQCHKNNIGVILDWVPAHFPKDAHGLANFDGTATYEYADPRKGEHPDWG
FT                   TKIFDYGKNEVKNFLIGSALMWIENYHVDGLRVDAVASMLYLDYGKNDGQWVPNKFGGN
FT                   KNLEAVEFFKHINTLILGRNHGTVMIAEESTAWPKVTGKVEEDGLNFSYKWNMGWMHDF
FT                   LDYMKLDPYFRKNNHNKMTFAMSYNESEKYILVLSHDEVVHLKCSMLNKMPGLEGDKFK
FT                   NLMAGYAFMMGHCGKKLLFMGQEFAQKQEWSEERELDWYLLENPEHKKIQNWVKELLHL
FT                   YRRNRCLYELDSSWEGFEWINANDADRSIFSFIRKSKDGKNNMLFVINFTPVERPDYRV
FT                   GVPKRKTYQLVLDSEDPKFTGKTVQEPVKKAAKGRGKAAKQSYKKLDYKAVKSECDGRP
FT                   FSFAYPLAPYGVAVFKY"
FT   CDS             164893..168174
FT                   /transl_table=11
FT                   /locus_tag="ERE_01860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92322"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMW8"
FT                   /protein_id="CBK92322.1"
FT                   /translation="MSIYNKKITIQNHPLTYEKKISINKGCRDGIYAGHGAGNMQIENL
FT                   INKSTDTKNTDTKTINDMTAGMRVSDYIKTDSSDNMSKKAAVVGSSNSVDMSDTIYARP
FT                   QAKNEAGNNNGTDMAENLLNDMNQTSENRRNDMIVTASTTTSDDYKAAKDDGYDVIVTE
FT                   TDKIKAVLAKAGVDISIYGDDLSMEQLTDITGSQTEAAMLVNQMKAYDIPATDDNIKAG
FT                   TDAIDRAKSLTNISNETKAYLVRNNMNPTVSNVYKATYSSSQVQDYRQKTKMTEISDEL
FT                   FEELKPQLKQILEEAHIDSSDENLNQCRWLIDEDIAVTPDNVLLANQVDCINAAEENVS
FT                   SDFYARAVTEALAMGKKATEATMSQDGLTFDMAKKACDVLGEATADDIVTLESDNIPVT
FT                   IENLSKLIAARGKDSAASQASANKAADNSITDSREARLVTAQRKLEEARLSMTAEANLS
FT                   LIKKGVSIDTEPIERVVELLKQQENKYYGALFGESSVEASDDRVRMYNNVCDIFNQMKQ
FT                   QPAYVLTLESADDTVYELYTAGKAMKQSLEAAASGYETLMTSPRADMGDSMSKAFQNVD
FT                   DILKELQIDTSESNRRAVRILAYNSTDITEDNIKQIKSVDEQVQRAFSDMTPAVTIEMI
FT                   KRGISPLDMSMSDISDTARRIKSENPDERDEKFSEFLWKLEKKNEISEEERDSYIGIYR
FT                   LISQVEQSDGAVIGSLVNQGADITMKNLLTAVRVRGKSAMDYKVDDTFAGVDSVSRGIK
FT                   IDSQIESAYHTNCLRDVLDTLSPEKMEFVQYDSWLDMTPEQLRQAVYEANEDNALSEQY
FT                   ATEQLRQFNQAVSVPENVYAFLEKYDVKTTAVNLMAASRLMKNPSEAVRNLWERGDSAT
FT                   ARALLDETLRRFSESVKNPKELAQAQETLADTAEHVMDSMIIEDRHTGSIDLRQMKLLC
FT                   SQLRIASNMSRQENYIVPIETADGVTGMKLRIVRGEDKKGLVDIFLEDKKCGRVAAYFE
FT                   AKENSVSAMIVTDDEQTKKLFEDNITMFEAGISDGEQRVRIDVALEHDISAKESKMSDM
FT                   KSNTESDNETKKQLDGGESVQTTRLYHIAEQFIVNVQRVIAQDSL"
FT   CDS             complement(168131..168853)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01870"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92323"
FT                   /db_xref="GOA:D4JMW9"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMW9"
FT                   /protein_id="CBK92323.1"
FT                   /translation="MKKYMYIIKKNKYCLILALFILSFYLGRGVCALAKNTGKNTNSTV
FT                   IVIDPGHGGSDPGKISTSGVMEKDVNLSIAMALKQLFENRGFTVVMTRTTDCDLAPDNS
FT                   KHPKTDDLTKRTALMSKSNVAVSISIHQNSFEDSSSSGPQVFYYEASDAGKELASSVLG
FT                   ALNTSLCVAKPRSIKPNKEYFILKKSTSPTVIVECGFLSNPAETLLLTDKNYQDDLAHA
FT                   IYIGVTDYLAQSPSGHLQ"
FT   CDS             complement(169005..170738)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01880"
FT                   /product="Predicted glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92324"
FT                   /db_xref="GOA:D4JMX0"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMX0"
FT                   /protein_id="CBK92324.1"
FT                   /translation="MKKKLLPALIVTGLIILVVIIMGITALINKYTPTKKTEDLKEYFN
FT                   ISSDDEAALIVDNELSDYKAKIIDKKIYVDYKFVHDSLNSRFYWDANENVLLYTTASDI
FT                   ISAAADSNSYSVTKQTNDFGYPIVKATSDSALIALDYVKQYSNITFKSYDDPERIVITS
FT                   KWDEIDSATVSKSTQVRVKGGIKSPILKEVKKDDKITILDSGDKWDKVATEDGVIGYIK
FT                   RKALSESKKTKLTNPDYEEETFTHIKKDKDICLAWNQVTSQSANSKVPQVISSTKGINV
FT                   MSPTWFYLNDNNGNLADIASKDYVSYCHSQGIEVWGLFSNFENTDVDAAYVLTHTSTRT
FT                   TLINQIMSAAFNYELDGVNIDFENITEAAYGDSYIEFIRELAIKCHNNGISLSVDVTVP
FT                   ASFNKFFNRSDMANFADYIVIMGYDEHYKGSDAGSVSSIPWVTEGVESTLKEVPADQII
FT                   LGMPFYTRIWELTPKEDDDAVTDTEDQSKYTVASQVYSMDAAAAQLATNNATAALDEES
FT                   GQNYAEWSVSNKLYKVWLEDSTSLEKRLKLVDDNKLAGAAFWKLGFENSSVWDTVIKYL
FT                   N"
FT   CDS             complement(171317..171787)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92325"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMX1"
FT                   /protein_id="CBK92325.1"
FT                   /translation="MYRTAYVELNGTHEILSLSKTADEKVFTYKNVDFFPHAVMSTLTE
FT                   ILNMRYERVIIDFGILNPNTLKEFMRCDVRIAVCTISKWNRGALNRIIELFNSNKITDS
FT                   ESVKILFNLVEKKKTINHKHFKYPVVDFPYLEDPFLINTSLFGTLDKISERN"
FT   CDS             complement(171868..173232)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01900"
FT                   /product="Protein kinase domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92326"
FT                   /db_xref="GOA:D4JMX2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMX2"
FT                   /protein_id="CBK92326.1"
FT                   /translation="MKNTNHSLFDKYEMIKDLGTGSSGSVTLVRHISMDQERALKKVPK
FT                   ASAFAESALSEARLLKSLEHPSIPRIFDFEEDDAFYYIVEEYIDGETLDSFLLHQQLIS
FT                   PGLFFNICEQLCNVFIYLHTQISTPIIYRDLKPEHIIVCHNKLKLIDFGVSAYVIQDGN
FT                   NFNHYGNIEFSAPECFTEDTITPAADIYSLGQLLQYILTFTPDSFSHKFQHIIQKATTS
FT                   DASLRYVTVAELYQEIQEIQKLTGQPHLIHKIAVLGSHRGCGSTHVAVSLTCELNILGY
FT                   HGIYIDSAKSVLCHGNHDGLQIFKQKNGYYYYKSFQGIPDYSDGIQFNIPKDAIQIYDL
FT                   GTDVCNEKIYDMDLVLYVCNGGFWHLNDIYRNHSILKKMTASLSVICNMCSRQDASAIA
FT                   ALLNCSVYHFPYDSDMFKNSVQKETLIQKLLELKGGASLSDTLKGYLRKSILHHS"
FT   CDS             173407..174147
FT                   /transl_table=11
FT                   /locus_tag="ERE_01910"
FT                   /product="Negative regulator of genetic competence,
FT                   sporulation and motility"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92327"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMX3"
FT                   /protein_id="CBK92327.1"
FT                   /translation="MKIEKVNDNQIRCTLTREDLEDRHIKISELAYGSAKAKSLFKDMV
FT                   EQANYEFGFETNDIPLMVEAIPLPSESIVLIITKVEYPDELDTRFSKFSEADDDFTDLG
FT                   NAGQPPVIKGAADILELFERIKKENEKTADSEQGTDDITEEQAEADVVKLFVFDKFDDV
FT                   RRISHVLDGFYSGRNDLYRDASSNKYYLVAHKSEHTPKEFNKVCNIISEYAYQKNYVPA
FT                   NEAFFKEHGNVIIEEAAIQTLAAL"
FT   CDS             complement(174205..174414)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01920"
FT                   /product="Domain of unknown function (DUF1858)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92328"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR023883"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMX4"
FT                   /protein_id="CBK92328.1"
FT                   /translation="MARVTKDTMIGDLLQIDQNVAPLLLNIGMHCLGCPSSQMETIEEA
FT                   AMVHGLDPDDLVVEINTFIDHDLG"
FT   CDS             174584..176014
FT                   /transl_table=11
FT                   /locus_tag="ERE_01930"
FT                   /product="Flagellin and related hook-associated proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92329"
FT                   /db_xref="GOA:D4JMX5"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMX5"
FT                   /protein_id="CBK92329.1"
FT                   /translation="MKINRNMSAVRANKQLLGTENRLSKSMKRLSSGYKINSAEDNPAG
FT                   MAISNKMKAQIEALDQAKSNSSDAQNVMKIADGALGEVSSMLQRIRELAVQGASDTYSE
FT                   NDKKALQSEIDELTKEVDRISGDTEYNTKSLLDGSSDTRVYVRQKDANGNMTQVNSYIT
FT                   RINFSDNVASDKYELTVNSLATQATGSLASATKPDAEGTISINGVSVAVKADMTQDEYI
FT                   QALQKAATTAGTTMQVNGDSISFLSNEYGSDSTVNISLSSSLKALAGAGYENADDGSGN
FT                   MQLKSNGKDAVVTGGENLSDKTIRADGNRVYVVGNSGFSMDFLLSSDMDMTAGSSNLQI
FT                   DISDIGNMAVQIGANEGQEMKIRIPEVSSQTLYLDTVDVTVKGGADKAMSTLDEAIEYV
FT                   SGVRSRIGAFQNRLESAESSLSETSENMTGAYSNIMDTDMATEMTEYAAQNILDQAGIS
FT                   VLSQANDLPQQVLSLLSR"
FT   CDS             176021..176494
FT                   /transl_table=11
FT                   /locus_tag="ERE_01940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92330"
FT                   /db_xref="GOA:D4JMX6"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMX6"
FT                   /protein_id="CBK92330.1"
FT                   /translation="MKNELKQELTRRLCACNNGGLVLVMYDIYFGFSDDVKNALVSEDR
FT                   EALRKGVSDVQAALDELMGALDFKYPLAGQLYPLYSYCKRLFSTVLYSLDVSVVDEADV
FT                   IMKKLRNSFETAAADDKSAPLMDNAQKVYAGMTYGKGRLTESFINDDNRGFLA"
FT   CDS             complement(176515..176727)
FT                   /transl_table=11
FT                   /locus_tag="ERE_01950"
FT                   /product="Protein of unknown function (DUF2508)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92331"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMX7"
FT                   /protein_id="CBK92331.1"
FT                   /translation="MKLFKETPVNDGYKTLQDDIRKTTDELQIVYTNLENVVEPDLIDY
FT                   YIYQAKAVSMRYKFLLNCAKRLNEV"
FT   CDS             177523..178521
FT                   /transl_table=11
FT                   /locus_tag="ERE_01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92332"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMX8"
FT                   /protein_id="CBK92332.1"
FT                   /translation="MKKIRLGIYIEDSEYGDRLTCYFMNHYKDQLEIHMYTMKEQLEHL
FT                   EGEIDIMLSSELDQWNNKYIPLIQIVEETPIESEEGIYFVEKYQEVNRIVEEILKHVGG
FT                   EVRDLTSEGSLIGQTRLISVYSLADNQYQMPFAMTLSSILSENEKVLLMDFQENSGLSR
FT                   MLEQSVEHNLDELLVMAESGRYSTNRINSCIGRKHKLDYVYPIENTECLCEINTVICNN
FT                   LLQMLGKEMHYDCIVLNMGTRFKGFFDILDRCSDIYLVQKKGGISQWREYEFTEELIER
FT                   GLSNVVERIKLIEPPVITTPVSTCDKLVELWKWNEFGDVIRNMTRGISCAG"
FT   CDS             179816..180559
FT                   /transl_table=11
FT                   /locus_tag="ERE_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_01990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92333"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMX9"
FT                   /protein_id="CBK92333.1"
FT                   /translation="MDYSRYSMSIKDWGIVFIKSMAATVIIAYLFYDSPIVVIAFPAVF
FT                   AYCAKLCRQEGVRRQKEKLNEEFMNVLKVLSSNMLAGYSVENAWQEAEKEMELMYGNDS
FT                   LMLSEIQEMNRQIKMNQTFEAVLSEFAHRSGLEDIVNFSDIFSFAKRSGGRFVDIIEST
FT                   TYRMWTKYDTNRQIEVAVSAKRLEQKTMNYIPIFLLAFLKLSSRDYMSALYGNLIGVIF
FT                   MSTCLLAYAGAIKLAKKFLQVGIGI"
FT   CDS             180556..181344
FT                   /transl_table=11
FT                   /locus_tag="ERE_02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92334"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMY0"
FT                   /protein_id="CBK92334.1"
FT                   /translation="MTGGKRLRIAALFAIVLVFAFIMDMSSNAITDNTLIRNDTGDGDA
FT                   VYDLVLNADGLDEDYSYQLKVREEQPSDKQANELFTQAKKEIDDTFCEENQSVEQVRGH
FT                   VIMKDEYASGAVEAEWTLSDYDVVDIDGDVNQDAFEEADDEQGKLISASVELSCGEHRQ
FT                   LYDFSFVVFPDELDAGERLIKGINRHIDSEMSKTGTKKLTLPDEVDGVKLSWSQEKSNT
FT                   AAKIAMLEVVVIVLLVLEKKEKRRRRRRREIYNCSSNIRR"
FT   CDS             181353..181781
FT                   /transl_table=11
FT                   /locus_tag="ERE_02010"
FT                   /product="Bacterial type II secretion system protein F
FT                   domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92335"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMY1"
FT                   /protein_id="CBK92335.1"
FT                   /translation="MAVLMGSGMTVEQAWNRITARYLDERKNNDKNIMPAYEEMLVTER
FT                   EISDGVTGRKAYAGFAERVKLPCYQKLVRIILQSIHKGSKGVCEMLEKESEDAFDERRL
FT                   LALKLGEEAGTKMLMPMMIMMAIVIAIVIAPAIIDFKI"
FT   CDS             181794..181961
FT                   /transl_table=11
FT                   /locus_tag="ERE_02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92336"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMY2"
FT                   /protein_id="CBK92336.1"
FT                   /translation="MLGFKNFLLDEDGAGVVEMILIIVVLIGLVLIFKKQLTTLVNNIF
FT                   QTISREAGKV"
FT   CDS             183554..184402
FT                   /transl_table=11
FT                   /locus_tag="ERE_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92337"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMY3"
FT                   /protein_id="CBK92337.1"
FT                   /translation="MKVSFVNKVKFHIKKLYRKAKLPGDDSSQKMPSCTCLKASYTLEA
FT                   AVIFPLVAGFFVFILFFFRVVQVESQVKAALYYSSRMSALASSANDSSVVSVATAEVLF
FT                   RSQISDSKHIDTYVSGGRYGVSLLGSSMGGDDVSLKAKYKVKLPVSFFTVDGIWIEDYS
FT                   NSRKWTGKNPGEKTDPYVFYTDYGSVYHLSEQCNYLDLSIKSIKWSQVGASRNKDGRKY
FT                   HACYCAADKKTEGSTVFITDYGMNYHGKLGCSKLKRTVHKVHKSEVDGKNLCSKCKGEG
FT                   T"
FT   CDS             184399..184806
FT                   /transl_table=11
FT                   /locus_tag="ERE_02050"
FT                   /product="Type IV leader peptidase family."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92338"
FT                   /db_xref="GOA:D4JMY4"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMY4"
FT                   /protein_id="CBK92338.1"
FT                   /translation="MIQLIILLGIISIIDFSTKKIPVVVLVVMGMVGIASSFYAKQSII
FT                   SVTVALIPGIVLMAAAFLTGEQIGYGDAAVVTLMGLFVTADIVCSTMVMGLTIAGTISV
FT                   ILIASGRAGRKKQIAFTPFLLLGYGLTEVFM"
FT   CDS             185029..186222
FT                   /transl_table=11
FT                   /locus_tag="ERE_02070"
FT                   /product="FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92339"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMY5"
FT                   /protein_id="CBK92339.1"
FT                   /translation="MNSNEIVYERKMTGSFMKLRCDEVRPLDEKILLKNNIPGFLPMEK
FT                   CYVNNEGQYWYDISGVQSLEMRCQYNDIKLEFLEKLVVSICNKMELLENHLVSTESLVL
FT                   DPQLIHIKGVNQDEEIYFTAYPAQMKTICNTFQHLMEYMLTKLDHSDAEAIHIAYGIYE
FT                   KTINGNYSIADIRNAIIEERQKKVAEKPVEEVVAPISQPQVRVEEPKEQIKPTLYDKLR
FT                   VYLLEQLDIRLPERKKQASVIEKPKKPDTNRKWFKKEKRKENREKVEDTMLIHPSPEAA
FT                   PEPVPRQIHPTVCLSDYREHPQGMLLYEGMENRSNIIIDKDCTRIGQGDEADAVIGKDT
FT                   ISHFHAVINRENQEFYLEDLNSTNGTFVNNEVLAYKQKKQLKSNDIIRFADVKYRFV"
FT   CDS             186938..187927
FT                   /transl_table=11
FT                   /locus_tag="ERE_02090"
FT                   /product="SCP-2 sterol transfer family."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92340"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMY6"
FT                   /protein_id="CBK92340.1"
FT                   /translation="MKINIYYGGRGLLDDPTLYVISKIENVLKELRVKVERYNIYEHKN
FT                   EIATLPQTFRDVDGIILATTVEWLGIGGYMQQFLDACWLYGDKEKISNTYMQPIVMSTT
FT                   YGEREAETTLCNAWEILGGLPCSGLCGYVEDITTFQLNKEYNLIIEKRAENLYRTISQK
FT                   IKSLPTSNQAVKQSVLRTQQLNLTPQESEQLSKYVSDDTYVKQQKEDIEELATMFKDML
FT                   GQQASTDDMPYIKELEAHFIPLREFKACYSFNIEGIKNPLYIKVDEDKLDIHYGEEDIV
FT                   DVYAKFSKSIMESIIDGHMTFQRAFMTGEMTAKGNFKTLRMLDQIFPF"
FT   CDS             187983..188399
FT                   /transl_table=11
FT                   /locus_tag="ERE_02100"
FT                   /product="Diadenosine tetraphosphate (Ap4A) hydrolase and
FT                   other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92341"
FT                   /db_xref="GOA:D4JMY7"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMY7"
FT                   /protein_id="CBK92341.1"
FT                   /translation="MKDDNCIFCKLANGDIPTNSIYEDDDFKVILDASPATKGHALILP
FT                   KQHYANIFEIEDETLAKAAKLAKKIMTHEKDVLGCEGYNLVQNNGEVAGQTVFHFHMHL
FT                   IPRYESDDNKNVIEWNHKEFTDDEMKKICDEMSM"
FT   CDS             complement(188517..189593)
FT                   /transl_table=11
FT                   /locus_tag="ERE_02110"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape
FT                   ptide) pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /function="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentap
FT                   eptide) pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92342"
FT                   /db_xref="GOA:D4JMY8"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMY8"
FT                   /protein_id="CBK92342.1"
FT                   /translation="MKKIVMTGGGTAGHVTPNIALMPALKEAGYDIEYIGSVNGMEKGL
FT                   IEAQKIPYHGISSGKLRRYFDWKNFTDPFRVLKGYGQAVSLMKKLKPDVVFSKGGFVSV
FT                   PVVLAAKHCHVPAIIHESDITPGLANKIAIKGAKKVCCNFPETMKYLPADKAVLTGSPI
FT                   RRELFSGVAENAIKLCNFPDHNKPVILIIGGSLGSKKVNEAVREILPELLKDFYVIHLC
FT                   GKGNLDNKLAGITGYAQFEYANAELTDMFALADMAISRAGANSICELLALHKPNILIPL
FT                   SAAASRGDQVLNAKSFKKQGFSYVIEEEELTKDSLLSAVKEVYGNRDKYKDAMAKSGQM
FT                   DSIATIIDLINSQVKKSS"
FT   CDS             189847..190113
FT                   /transl_table=11
FT                   /locus_tag="ERE_02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92343"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMY9"
FT                   /protein_id="CBK92343.1"
FT                   /translation="MELSMDNMDIVAGGILAIMLALFMLTVIVTLFALSHRIRLLSNEI
FT                   YKIEKQVSDYIDELSRSESDKLEIEHKAHQNGVISSVLQEIFP"
FT   CDS             190233..191456
FT                   /transl_table=11
FT                   /locus_tag="ERE_02130"
FT                   /product="Cell Wall Hydrolase./Bacterial SH3 domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92344"
FT                   /db_xref="GOA:D4JMZ0"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMZ0"
FT                   /protein_id="CBK92344.1"
FT                   /translation="MKLNKKVIDSITVCGLCAMLTVTAVTNSGRSEVKAEDKVLANTGL
FT                   EHTGYNSYAGVAATLFDYEKGLTAENAVTVEKENVEMVAAAQDAQQEVQPQLTQEQQEW
FT                   QTKLMPKVEESLNVRAQADEQSDIVGKLYKGSVADIVENDGTWAHIKSGNVDGYVNVSY
FT                   CVTGTDALSYAYDTCGEIATVNTDGLRVRETADTNSKALEVADQGKTYQVDRAAQAQDG
FT                   WIAVVCDSQTGYIAADYATRSLNTRVGITIEEEQAQIAAQKEAERKAAEEKAAKEAAKA
FT                   AKESKKTETTQGEAVSAGADDLTLLAAIIECEAGGESYECQLAVGAAVINRVKSGSYPN
FT                   SISGVIYQKGQFGPASSGKLARKLSGRISSSCYSAAQEAMSGVDNTGGCTSFNDHGSGI
FT                   SIGNMKFR"
FT   CDS             191692..192681
FT                   /transl_table=11
FT                   /locus_tag="ERE_02140"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92345"
FT                   /db_xref="GOA:D4JMZ1"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMZ1"
FT                   /protein_id="CBK92345.1"
FT                   /translation="MQLKGRNFLKLMDYTPEEITYLIDLSQELKEKKKKGIRHDELTGK
FT                   NIALIFEKTSTRTRCSFEVAAHDLGMHVTYLDPSGSQIGKKESIADTARVLGRMFDGIE
FT                   YRGYGQEIVEELAKYAGVPVWNGLTNEFHPTQMIADMLTIREHLGRLKGVKFVYMGDAR
FT                   YNMGNSLMVTCAKLGMDFVACTNKKYFPNDELVKYCKDVAETTGASITLTEDVAEGTKD
FT                   ADVIYTDVWVSMGEPEEVWAERINDLKPYQVNAKAFENAKDSAIFMHCLPAFHDLKTTI
FT                   GKQVYEKFGLSELEVTDEVFESERSVVFDEAENRMHSIKAIMRATLAD"
FT   CDS             192735..193715
FT                   /transl_table=11
FT                   /locus_tag="ERE_02150"
FT                   /product="birA, biotin-[acetyl-CoA-carboxylase] ligase
FT                   region"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92346"
FT                   /db_xref="GOA:D4JMZ2"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMZ2"
FT                   /protein_id="CBK92346.1"
FT                   /translation="MKEEILRLLRSADGYISGQELCNRFGVSRTAVWKAINQLKEAGYE
FT                   IEAQQNKGYRLMAAPDLMTEAEIKSLMHTDWVAKEVLYFDTIDSTNIKAQELAEKGYPS
FT                   GTLVVADKQESGKGRRGRSWVSPSGTGIFMTLMIKPDINPNNASMLTLVAALAVAKAIT
FT                   SVTGEEALIKWPNDIVVNGKKVCGILTEMNAQFDYINHIVVGIGINVHNESFPEEISQM
FT                   ASSLMIEAGGKRFHRAQIIAETMSYFEQYYDTFLKTQDLSALVREYDELLVNRNKSVRV
FT                   LDPKEPFDGKAMGITPKGELIVDTWESRKLVSSGEVSVRGIYGYV"
FT   CDS             193708..194043
FT                   /transl_table=11
FT                   /locus_tag="ERE_02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92347"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMZ3"
FT                   /protein_id="CBK92347.1"
FT                   /translation="MSKEVVLCVSNAYQKKYYLNENFNGLPQTIRDELKIMCVLYTEDV
FT                   GGILELVFDEDGNLDFRTSCKENDFFYDEIGSVLKIKQYRNERRELLESIETYYRIVFL
FT                   GEGLEEE"
FT   CDS             194047..194829
FT                   /transl_table=11
FT                   /locus_tag="ERE_02170"
FT                   /product="pantothenate kinase"
FT                   /function="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92348"
FT                   /db_xref="GOA:D4JMZ4"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMZ4"
FT                   /protein_id="CBK92348.1"
FT                   /translation="MILALDVGNTNITCGVFDGDRIKASFRITTKMPRTSDEYGMLLST
FT                   LLERNQVGMDDIHDAIICSVVPNIMHSLQNGLIKYFNIRPIIVEAGIKTGIRIATPNPQ
FT                   QIGADRIVDAVAAYELYGGPVLVIDFGTATTYDMVDENGTFMGGITAPGIRISAKALWE
FT                   DAAKLPEIEIKKPDNILGKDTITSMQAGLVYGQIGQTEYIINKVKEETGMYDAKVVVTG
FT                   GLGRIISNETENVDVYDPDLTLKGINLVYRKQNRKGVK"
FT   CDS             194834..195805
FT                   /transl_table=11
FT                   /locus_tag="ERE_02180"
FT                   /product="tRNA-U20-dihydrouridine synthase"
FT                   /function="tRNA-U20-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92349"
FT                   /db_xref="GOA:D4JMZ5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMZ5"
FT                   /protein_id="CBK92349.1"
FT                   /translation="MDIHQIRKLQIGSVTLPNNLILGPMAGVTDLPFRLLCKEQGAGLL
FT                   CMEMVSAKAILYKNKNTESLLSIDEREKPVSLQMFGSDPQIMAQIAKQIEERPFDILDI
FT                   NMGCPVPKIVNNGEGSALMKNPILAGQIIESIVKAIDKPVTVKIRKGFDDEHVNAVELA
FT                   HVAEESGASAVAVHGRTREQYYSGKADWDIIRQVKEAVSIPVIGNGDLLCAEDVIKMQE
FT                   QTGCDGFMIARGAQGNPWIFSQILHYFETGEHQEKPSFEEVRRMILRHARMMIEFKGEY
FT                   TGIHEMRKHTAWYTAGYPHSSRLRAAVNTVESLEQLEELLYK"
FT   CDS             196072..196560
FT                   /transl_table=11
FT                   /locus_tag="ERE_02190"
FT                   /product="transcription elongation factor GreA"
FT                   /function="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92350"
FT                   /db_xref="GOA:D4JMZ6"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMZ6"
FT                   /protein_id="CBK92350.1"
FT                   /translation="MDNKKNILTYAGLKKLEDELEQLKVVKRKEVSQKIKEAREQGDLS
FT                   ENAEYDAAKDEQRDIEARIEEIEKILKNAEVVVEEEVDLDKISIGCKIRILDCEFDEEL
FT                   EYKIVGSTEANSLKGKISNESPVGKALLGKKVGDTVTVETQVGELTYKVLEIQRAEEN"
FT   CDS             196573..198186
FT                   /transl_table=11
FT                   /locus_tag="ERE_02200"
FT                   /product="Lysyl-tRNA synthetase (class II)"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92351"
FT                   /db_xref="GOA:D4JMZ7"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMZ7"
FT                   /protein_id="CBK92351.1"
FT                   /translation="MANQNNNKGGQQQDVNQLLKVRREKLQNLQEAGKDPFQITKYNVT
FT                   HHSSDVKELYNAHEAEILGDRKAPDVEGLDDAAKREVINNDYNERREIMDAKPIEVSIA
FT                   GRMMFKRVMGKASFCNIQDLKGNIQVYVARDNIGEDSYADFKKSDIGDIYGVKGFAFRT
FT                   KTGEISIHAEEITLLSKSLQILPEKFHGLTDTDTRYRQRYVDLIMNQESKEVFIKRSQI
FT                   LKEIRNFLAGRDFMEVETPMLVSNAGGAAARPFETHYNALNEDVKLRISLELYLKRLIV
FT                   GGLERVYEIGRVFRNEGVDTRHNPEFTLMELYQAYTDYEGMMELTESMFRYLAEKVCGS
FT                   TKISYNGVEIDLGKPFARMTMIDAIKKYAGVDFDQVPDDAAAKKLADEHHIEYEERHKK
FT                   GDIVNLFFEEYCEKELIQPTFIMDHPIEISPLTKKKPSDPTKVERFELFCNTWEMCNAY
FT                   SELNDPIDQRERFAAQDANAAAGDDEAEHTDEDFLNALEIGMPPTGGIGYGIDRLVMLL
FT                   TDSQAIRDVLLFPTMKSLDK"
FT   CDS             198426..198647
FT                   /transl_table=11
FT                   /locus_tag="ERE_02210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92352"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMZ8"
FT                   /protein_id="CBK92352.1"
FT                   /translation="MDESKKKDRYEAAKKFVRYSDGAKMYSMGMTKFQEVAKDAKACYK
FT                   IGQLVLVNTEILDKYLETFHITDAEFYK"
FT   CDS             198656..199114
FT                   /transl_table=11
FT                   /locus_tag="ERE_02220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92353"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMZ9"
FT                   /protein_id="CBK92353.1"
FT                   /translation="MVNTLSGSVSAYRKENVKPRFIRIDEVMALLDVTRDEAMDIALAA
FT                   GARYQLAKIILVHKERLMKFMKHFARVPSSNKIVEKKFVRIGEASMTYSIGHHRFIEMA
FT                   RAAGAVYKIGTAKGNTILINLEIFDDYMEQFREPPTEMKHPLPNVKGD"
FT   CDS             199118..199402
FT                   /transl_table=11
FT                   /locus_tag="ERE_02230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92354"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN00"
FT                   /protein_id="CBK92354.1"
FT                   /translation="MSYSYKCYSDTKDFMKKFVNAEEGAIIYGISKSRIIVIAREAGAV
FT                   YKVGNSALINTELFEKYLERFREPARELPKHTWNKLKEMTNTPKTGENS"
FT   CDS             199556..199720
FT                   /transl_table=11
FT                   /locus_tag="ERE_02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92355"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN01"
FT                   /protein_id="CBK92355.1"
FT                   /translation="MYLEDESHSYHISSLMDRKMKGEKLDGNLEKGFGMLRKDNQPQRA
FT                   RSSSLSSKG"
FT   CDS             complement(199717..199881)
FT                   /transl_table=11
FT                   /locus_tag="ERE_02250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92356"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN02"
FT                   /protein_id="CBK92356.1"
FT                   /translation="MAMLNAKHVGTRQSSRLLYRPVYKEVFSPLGVTDEPQNVFHDALL
FT                   NYQKHYLLF"
FT   CDS             199949..200098
FT                   /transl_table=11
FT                   /locus_tag="ERE_02260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92357"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN03"
FT                   /protein_id="CBK92357.1"
FT                   /translation="MMGFSIAFIIIVLIVLYSLARTAGESDRILENIREQSLLGREESS
FT                   GGNS"
FT   gap             201219..202216
FT                   /estimated_length=998
FT   CDS             202228..203070
FT                   /transl_table=11
FT                   /locus_tag="ERE_02280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92358"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN04"
FT                   /protein_id="CBK92358.1"
FT                   /translation="MARNTKPIPLAEKGWVITMKRISIILLSAVLVFSMAACNGGKEKA
FT                   DNQTEKQTESVKPTEEVAMATEAVTEVTTEAGSEETDKDIAEVKDSEEKTDKEDKRSAD
FT                   NETASKQEEKPKQNDEPEQKAPVNDNEEAGGNQSNAGNGCQTTDSPKDNVSNPQPASVA
FT                   YSPQNVVSLATAKCQAGGMITTQQNLQNHLNDGSITQEEYNEYYPYDGMEGSYYSVFVE
FT                   TDLNKASTIDGQRLSSEDAIAEYIASMLLLETDPVFYISYDGVYTTGGTDYYEFRCHR"
FT   CDS             203162..205591
FT                   /transl_table=11
FT                   /locus_tag="ERE_02290"
FT                   /product="Cna protein B-type domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92359"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR008970"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN05"
FT                   /protein_id="CBK92359.1"
FT                   /translation="MKQKLKRFMAGFMAMLTLVGTLFTNGTTAFAASPQANIAFWNASV
FT                   KNSGEVSELKPGFNHGKILYSILDGNSAYCMNFGLRADGGQLMNSYDDASTSMSAQQRK
FT                   LLSYCLYYGFNSTQKVAPSNSQCDEYIATQAMVWVIVADIFGTGSGDSAARKLCNTAPS
FT                   PASSYSYYEKLRDNINSSYSATLPSFASRRTSEAPTYELKWNESNQRFETTLSDSNGVL
FT                   SDFDFSVSGYSVNKNGNSITISSTSVNTTATTGTFTSNAGKVETTSSCVFWLTGKSGYQ
FT                   EFISERPTADPIKAYIKVKTENIGYGELTKTDESSGVKLSGAVYGIYSDSGCTNRVQTM
FT                   TTDGNGYAKSAALVAGTYYVKEITAPKGYVLSGKVHTLTVKAGQTTGISATDKEQLGAI
FT                   TIYKEGEVLSSWNGSNFTYEKKKLPGATFKVTAGADIYKADGTKVYSAGDVVAESLTTG
FT                   TDGQVVLSDLHLGTYVVTEIKSIDGYTINTTPQTVAVEYKDQTVTVQYESATVENTRQK
FT                   ADVSVVKKDSDTENPLDGGKYTLYAGNDIKSYAGQVIVTKGTALETVTTGEDGKASYSV
FT                   DLPISNGYYIQETQAPYAYIRNQSDVYSFNFNVLPETQAKTSFSHTFVNDRTTAKIHIY
FT                   KVDKESGKAAAQGDASLEGAVYGLYVRNDIVHPDGATGVVFKAGDLVATLTTDKNGEAE
FT                   VNNLYLGNYYVKEITPSEGYLLDEEEHDVVCDYEGDLVAEVSRSTTSAEQVIKQPFQLI
FT                   KVSDNGDDTEAGLLAGAEFTAYLKSSLQTFIDCTTPIFTRRLQNRRKKKQCCSDNR"
FT   CDS             205773..205880
FT                   /transl_table=11
FT                   /locus_tag="ERE_02300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92360"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN06"
FT                   /protein_id="CBK92360.1"
FT                   /translation="MHIVHFDENMLIGDAADLDAFMEMYGVEAISKEYL"
FT   CDS             205927..206451
FT                   /transl_table=11
FT                   /locus_tag="ERE_02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92361"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN07"
FT                   /protein_id="CBK92361.1"
FT                   /translation="MKKRFLKIVIGIVLVCILFVGFLYANNNIGMTSTNLETDIRSSQK
FT                   IKDDWTLDGSVSNTMAAYISYSQDMSDHTFSVYVNRPGLSFGYFFRGGGTLSGIQRGIV
FT                   EFTVEGYNERAFISMNQQQVQQLEIDDGNTIQVVDIDRNKPFAIVLPINAGNITFYDVN
FT                   RNTVEYWNNPL"
FT   CDS             206975..207262
FT                   /transl_table=11
FT                   /locus_tag="ERE_02330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92362"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN08"
FT                   /protein_id="CBK92362.1"
FT                   /translation="MELHLDASIDKLDNLAMNVQLDKEKHMENEKKQEQTEPERAEAER
FT                   VEAEVVYSPMVAEPQEYQYNADAFEARGVDEVKQEAAHKEVSKVREDKAR"
FT   CDS             207499..207669
FT                   /transl_table=11
FT                   /locus_tag="ERE_02340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92363"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN09"
FT                   /protein_id="CBK92363.1"
FT                   /translation="MKKRCRDYVGVACVNGRCPAAIREKYEEECIPVVIRCHNCFFYRG
FT                   CEDCALADTDW"
FT   gap             208831..209166
FT                   /estimated_length=336
FT   CDS             209596..209910
FT                   /transl_table=11
FT                   /locus_tag="ERE_02380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92364"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN10"
FT                   /protein_id="CBK92364.1"
FT                   /translation="MKKIFHLIAVTISLVLLVGCISNNLGDEKSMNLKIDGIEQITVST
FT                   QTTGQKQDVIIEKEKFEDLISKLNSYSLKEITDEKDKGWQYLIKIEKKGGRNYSNIFYG
FT                   "
FT   CDS             209903..209986
FT                   /transl_table=11
FT                   /locus_tag="ERE_02390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92365"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN11"
FT                   /protein_id="CBK92365.1"
FT                   /translation="MDNKVKVNDIVYEVRDYNIDDFSYLFE"
FT   CDS             210260..210343
FT                   /transl_table=11
FT                   /locus_tag="ERE_02400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92366"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN12"
FT                   /protein_id="CBK92366.1"
FT                   /translation="MEKYSACEVDIEDGYLLILKEKELHAE"
FT   CDS             210333..210971
FT                   /transl_table=11
FT                   /locus_tag="ERE_02410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92367"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN13"
FT                   /protein_id="CBK92367.1"
FT                   /translation="MLNNIYEFQKIHLHTQRIMYFLPLVFIYFFLLPNHYQLLVNADES
FT                   ILIKIFDSAQEFLILIEIWFQYLGFRWILSPELKEISYCNMRIKKNMWFSSNTILSVVL
FT                   FLPYAIILALISEKYFFNVPVIFFQCVLAGIMTFFLMHLLKSALGGMTVMIGYYFLCVN
FT                   HALPQKFSIIVLGILPENYRINWYITQIIFIVFFLIGVFLMEKNKYVQS"
FT   CDS             211168..211818
FT                   /transl_table=11
FT                   /locus_tag="ERE_02420"
FT                   /product="Uncharacterized distant relative of cell
FT                   wall-associated hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92368"
FT                   /db_xref="GOA:D4JN14"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN14"
FT                   /protein_id="CBK92368.1"
FT                   /translation="MKRITNKICAVLLSGIFMVMTGVNVNAAEQEYPPAEAVFPEEKVL
FT                   QIENQIKNTPIYNDKDAEGNFSLKNTRATGTYPTRYGVILVTADKYKGLIPTGHAGIIW
FT                   TSSTIVESLSNGVTTGPNDWNTSKTSCYGISVKGTTVDEDNEASNWCYRQLGKPYNYNY
FT                   FNVSTRKKFYCSQLVWAAFKDNYGIDLDTSDFGDAVHPMELVNSSKTYTIYKK"
FT   gap             211907..213134
FT                   /estimated_length=1228
FT   CDS             complement(213545..213811)
FT                   /transl_table=11
FT                   /locus_tag="ERE_02440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92369"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN15"
FT                   /protein_id="CBK92369.1"
FT                   /translation="MDNNKIQKIFHYIIVLLLVILWFIMMFFPEHIDTMNFKIFFSISL
FT                   ACSIIYSLCREKYFPIQTDSKTEKFVFTFLIILLFFRFLFLKN"
FT   CDS             complement(213825..214445)
FT                   /transl_table=11
FT                   /locus_tag="ERE_02450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92370"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN16"
FT                   /protein_id="CBK92370.1"
FT                   /translation="MKKISKLISLILCLSLLCPTVAYAAETKQTTDSPNMKDILIDSTD
FT                   DHFIVVSIPESEAESYQKRLESDPEFRENEIQQALGGTSADSRALPPGHIEYQSYMYKR
FT                   DIKAAVDAASGSGTFDKWLTGLGWTVTAASIAKLIKLSKRDNIFMLSADILRTLAQWAQ
FT                   QEREAWWKEAYKDIINGTISAVRYTIVQNTTEYPKIWRVFERI"
FT   gap             215011..215853
FT                   /estimated_length=843
FT   CDS             216530..217777
FT                   /transl_table=11
FT                   /locus_tag="ERE_02470"
FT                   /product="Nucleotidyltransferase/DNA polymerase involved in
FT                   DNA repair"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92371"
FT                   /db_xref="GOA:D4JN17"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN17"
FT                   /protein_id="CBK92371.1"
FT                   /translation="MGDRVILHSDINCCYASIEHLHHPELAGKPLAVGGDPEARHGIVL
FT                   TADYIAKKYGVKTGMALWQAKEVCPDITFVSPRMDLYLRFSRMAHEIYAEYTDRQEPYG
FT                   IDECWLDVTGSSSLKGDGLLIAQEISRRMKSELGITVSVGVSFNKIFAKLGSDYKKPDA
FT                   ITTMYKSEFKQKAWSLPVADLLYVGKSTNRKLALFGIKTIGDLARTDEEVINSHLGKMG
FT                   SILWSFANGYDDSPVKLENTHAPIKSVGNSTTTPKDLVCDEDVKIVLYILAESVAARLR
FT                   ENGFRCRVVEISVRDNELFSFTRQKKIDHATNITGEIAAYAYQIFKENYSWSKPIRSVG
FT                   VRGADLVTDNYWEQIDLFSSVEKREKQMKMDSAVDEIRRRFGFYSIQRGLMYRDRILSA
FT                   VNAKEEHTVHPHGYFG"
FT   CDS             217793..218035
FT                   /transl_table=11
FT                   /locus_tag="ERE_02480"
FT                   /product="SOS-response transcriptional repressors
FT                   (RecA-mediated autopeptidases)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92372"
FT                   /db_xref="GOA:D4JN18"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN18"
FT                   /protein_id="CBK92372.1"
FT                   /translation="MSEAARIDLVDRAPLTEKQQNVYESIMQYQRVNGYAPTIREICRM
FT                   VGVASTSSVYAHLKILEEKGYIARKMDASRAIAIL"
FT   gap             218335..220022
FT                   /estimated_length=1688
FT   CDS             220531..220878
FT                   /transl_table=11
FT                   /locus_tag="ERE_02510"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92373"
FT                   /db_xref="GOA:D4JN19"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN19"
FT                   /protein_id="CBK92373.1"
FT                   /translation="MSSKAQTREKDYERGLRIADRRKVMGLSQDELAHRVGIGRQALSA
FT                   IENGGDFKTQTLDNLAIVLGVSVDFIMYGKNEENSELLSEAMDVLSDMDELQVRQCLAM
FT                   IKAMKSVSVEK"
FT   CDS             221029..221436
FT                   /transl_table=11
FT                   /locus_tag="ERE_02520"
FT                   /product="Resolvase, N terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92374"
FT                   /db_xref="GOA:D4JN20"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN20"
FT                   /protein_id="CBK92374.1"
FT                   /translation="MDKRDFSVVGNEGTDNQEIAKGIAFVKSRRAELNVVQMVENMRDQ
FT                   AMPNGVIINDAYCDRSMTRDYDREALNAFFATLKEEDFEVVVVRSLNEITDDIYDLEEF
FT                   VKTITDMGIWLYSLEVGPVPIIISHAEDFGC"
FT   CDS             221430..221651
FT                   /transl_table=11
FT                   /locus_tag="ERE_02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92375"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN21"
FT                   /protein_id="CBK92375.1"
FT                   /translation="MLTESFGRARTENHSGRDKQVPAVKDCRFTQTAFGTVVHDSSGKW
FT                   LGQYETEDAAVEMIREMAQDDGGYSDEI"
FT   CDS             221641..221970
FT                   /transl_table=11
FT                   /locus_tag="ERE_02540"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92376"
FT                   /db_xref="GOA:D4JN22"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN22"
FT                   /protein_id="CBK92376.1"
FT                   /translation="MKYDGYQVGIVIKSLRIQRNLTKEALAAELGISVSTIKKYENGER
FT                   ALSITNLFKIIDYFKVDANTILNVAEGKKENSIDSRLELMDYSRKAYFQKIFNEMLDNA
FT                   EMLVS"
FT   CDS             221982..222350
FT                   /transl_table=11
FT                   /locus_tag="ERE_02550"
FT                   /product="Resolvase, N terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92377"
FT                   /db_xref="GOA:D4JN23"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN23"
FT                   /protein_id="CBK92377.1"
FT                   /translation="MRRKKKTIECIEYLSVSAPLDKVDRLEDKQSKYIHEYVKNKEYMI
FT                   VGTERRHGFSQNDVDRQWHQIVDKIRKKQVDGVIVANMSVITDNLIDAFIKVAQVQAAG
FT                   GIIVTVDDGRLAMQLRGF"
FT   CDS             222354..222785
FT                   /transl_table=11
FT                   /locus_tag="ERE_02560"
FT                   /product="PemK-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92378"
FT                   /db_xref="GOA:D4JN24"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN24"
FT                   /protein_id="CBK92378.1"
FT                   /translation="MNKNKKRYDKYKKFDVVYADFGRNPHGVQGGIRPGIVVSCDASNH
FT                   GGAPQISVVPLSSKLKDNPVHVIVEPSEIRGHALSNRSDFMPEDIQTLNKGCVRFKSGY
FT                   IPGESEIREAMDRAMIMQLNLLPVARKMVLEELEMKQNG"
FT   CDS             222778..222990
FT                   /transl_table=11
FT                   /locus_tag="ERE_02570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92379"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN25"
FT                   /protein_id="CBK92379.1"
FT                   /translation="MDNRTKKTNNKRFVRYPEGAEMYSMSLSKFQQLAKDAKACYKMNR
FT                   LVLVNLDILDEYLETFHIEDEEFYK"
FT   CDS             223251..223385
FT                   /transl_table=11
FT                   /locus_tag="ERE_02590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92380"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN26"
FT                   /protein_id="CBK92380.1"
FT                   /translation="MQALFFLRKEKRWLVEKMVKEEYYEKESIIVKLMAGIHIFILIH"
FT   CDS             223460..224521
FT                   /transl_table=11
FT                   /locus_tag="ERE_02600"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92381"
FT                   /db_xref="GOA:D4JN27"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN27"
FT                   /protein_id="CBK92381.1"
FT                   /translation="MDGLNVYVAGSADVNFLFDRYISTKTELRSTTKANYLYTWDHFIR
FT                   DTFGKKKIKDVKYSDVLFFYTDLITNKGLQVNTLESINTVLRPTFELAVRDDIIRRNPV
FT                   DGAYAEVKKRNGGARKSRRALTVEQQREFIDYVAKNPFFFHWYPFFVFLLGTGCRIGEA
FT                   IGIRWDDVDMKKRTININHSLTYYTRYDNSFKCEFRVSEPKTEAGIRTIPMMGPVYEVL
FT                   KSEYQRQQEEGFCVAEVDGMTNFIFTNRFGNPHNPQAVNRAIKRIVDTHNAEEEVEAKK
FT                   KKREPIMLPRFSCHIFRHTFASRFCENETNVKVIQEVMGHADVSTTMNIYAEANPEVTR
FT                   EALEKLAKNMDVF"
FT   CDS             224727..225197
FT                   /transl_table=11
FT                   /locus_tag="ERE_02610"
FT                   /product="EMAP domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92382"
FT                   /db_xref="GOA:D4JN28"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN28"
FT                   /protein_id="CBK92382.1"
FT                   /translation="MKSLDGVNKKNDVNNTASEAPEKNVKTESEKIDFSKVKVEPLFEE
FT                   FVDFDTFSKSDFRAVKVKECVAVPKSKKLLQFTLDDGTGTDRTILSGIHSFYEPEELVG
FT                   KTLIAITNLPPRAMMGIDSCGMLLSAIHEEEGEEKLHLLMVDDHIPAGAKLY"
FT   CDS             225461..226345
FT                   /transl_table=11
FT                   /locus_tag="ERE_02620"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92383"
FT                   /db_xref="GOA:D4JN29"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN29"
FT                   /protein_id="CBK92383.1"
FT                   /translation="MLLNEIINEVGMTKRAVKYYEEKGLLSVDKDNNGYRNYTAQDVET
FT                   LKKISVYRKLGISIKDIQSLLETGDKSILLRIYQEKVQEKVLKDSELEALKQFIDDGDA
FT                   DKANEALDYQTVENAIESLLPGKEWGDYFKSHFKPFLNVRLKTLEQKQALQNILEYCDE
FT                   TTLKVPFIMGIGAKIIGGIAQETRTADEMIAYYRDMSESEYERLKEKVWKGAKMKNGIM
FT                   KYHPAFIAQRKMQKELQNKGYNDIFIPNLMVLSPTYAEYKKALDNLNDRMCRELGLYYD
FT                   SNYNLVIKKDNSK"
FT   CDS             226579..226713
FT                   /transl_table=11
FT                   /locus_tag="ERE_02630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92384"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN30"
FT                   /protein_id="CBK92384.1"
FT                   /translation="MTPAELAKKDEFYSIYWSEYNLVKESGSPELYDKIHNRNNYADI"
FT   CDS             226768..227514
FT                   /transl_table=11
FT                   /locus_tag="ERE_02640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92385"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN31"
FT                   /protein_id="CBK92385.1"
FT                   /translation="MSMNVSTTTAAYANYQNNYKTGTANKKKETAQTTENTKLKENTTE
FT                   SIAEKNLSKAAQKMLENLRGSRNDMDFMVADFENGDNAKDILAQSDKEYTVIFSKEEME
FT                   KMASDPKYYAEKMHSIEGVLRMTDEINAQFGFERAFGKTNDNADADTKITKFGISFNSD
FT                   GTTTFFAQLEKSSASQKEYLEKLQEKKAAEKKEAKKKEQSKQTEVRKTTVQANSKEELL
FT                   DKIKNIDWDSIKPEENKIGGRFDFSI"
FT   CDS             228811..229524
FT                   /transl_table=11
FT                   /locus_tag="ERE_02670"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92386"
FT                   /db_xref="GOA:D4JN32"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN32"
FT                   /protein_id="CBK92386.1"
FT                   /translation="MEMMLQTQNLCKYFRKQKAVNNVSLNIEKGQIYGLLGPNGAGKST
FT                   TLKMLTGMMKPTAGKIYFDGKLLDRKDLSKIGALIENPPIYENLSARENLKVRQLLLGT
FT                   DENRIDEVLQIVSLTNTGKKKAGQFSLGMKQRLGIAMALLGEPELLILDEPTNGLDPIG
FT                   IEELRELIRSFPEQGITVILSSHILSEVQLLADKVGIISGGILGYEGALKQGDNLEDLF
FT                   MNVVRKNQKAGEIHG"
FT   CDS             229517..230248
FT                   /transl_table=11
FT                   /locus_tag="ERE_02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92387"
FT                   /db_xref="InterPro:IPR021205"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN33"
FT                   /protein_id="CBK92387.1"
FT                   /translation="MVNIIKAEHQKAKRTMRKKFIWGFPLLTFVMAFIFTLGMTNAYAE
FT                   SVWNWWYTLLLPGMIALFCYLSVAQEKKIKYYHLMTIPTDRRKLLLGKIIYIGYMILFS
FT                   NVIVFAGATLGGFLLTTHVPVKGALIAVLFLTVSELWEIPVALFLSERFGMIVNLFVCL
FT                   FITVSGVVISQTRIWYVLVSAIPMRMMCPLLHVLPNGLAAEAGNPLLDTGVIVPGMCLS
FT                   IIWFVFVTVLFLKWFERREVK"
FT   CDS             230250..230990
FT                   /transl_table=11
FT                   /locus_tag="ERE_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92388"
FT                   /db_xref="InterPro:IPR022294"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN34"
FT                   /protein_id="CBK92388.1"
FT                   /translation="MIGRSLNADLRKMKGTSVILAHLLIPIITSVIFLIYYFFSPWNEN
FT                   MKVIAFYQAIGAGLPVLIGIFTASVMEQEQNAGDFQNLLSLPDKPAAFLSKLLMLLVLC
FT                   LCSILLTAIIFGIGFGRIASSDIEIMKGCIFAALLLWGSSVPLYLWQLILAFQFGKGVS
FT                   IGAGIISGLISALMLTGLGDYVWKYVFVCWTGRVPYTYLQSVLGETSVGEWLSFIPGCL
FT                   IFTGISMVYYFWWVNHWEGNRISE"
FT   CDS             231005..231667
FT                   /transl_table=11
FT                   /locus_tag="ERE_02700"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92389"
FT                   /db_xref="GOA:D4JN35"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN35"
FT                   /protein_id="CBK92389.1"
FT                   /translation="MAKILAVDDEPAILEMIESILNKDGHLVTKVSNPLKINMEELHRY
FT                   DLILLDIMMPGIDGFELCKRIRALVDCPILFLTAKTEENSLVNGLSLGADDYISKPFGV
FT                   MELRARINAHLRREHREHSVRMVLGRVCIQISQKKLLVDDKELPLTKAEYEICEFLAKN
FT                   RGQVFSKEQILEAVFGFDNESNDSTIITHIKNIRAKFADYDYTPIKTVWGIGYKWEE"
FT   CDS             231655..233031
FT                   /transl_table=11
FT                   /locus_tag="ERE_02710"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92390"
FT                   /db_xref="GOA:D4JN36"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008358"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN36"
FT                   /protein_id="CBK92390.1"
FT                   /translation="MGRVKRSNALSRIFMRYVLVMLGSLVGLVIVAYLLLYLLISVGCI
FT                   YPANYAEQKINEAYDTILRADKVTAEMIPALCDYVIFSENGEKIGGDLSEQYEQIAWNV
FT                   AKHGNASGKYFYKVIVRENEYVVLQYRLTPQYHSAFLREHFIGPQNVMIIMSVIGAVAI
FT                   IIIQSIRFGKRIKKQMQPVLDAIGQIKDQNLEYETSCSGIKEFDDCLSAIDDMRDALRE
FT                   SLEKQWKTEQEKKQQMSALAHDIKTPLTIVRGNAELLSETELTTEQKKNITYVLNGTTQ
FT                   IQSYVKQLIDVTKSWNCSDVTYTTVRLEDFFADIKEQALGLVEIYHQKIDWKAEQSDKK
FT                   VTIAYDPMFRAVMNVIQNAVEHTKENGIIYIDAKEQDDRLTFIVEDSGSGFTKEALLHG
FT                   TEQFFMDDTSRNGEAHYGMGLFFAKTVAEKYGGGIKLSNSENTGGARVEIFFLSSQETS
FT                   "
FT   CDS             233676..234389
FT                   /transl_table=11
FT                   /locus_tag="ERE_02730"
FT                   /product="septum site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92391"
FT                   /db_xref="GOA:D4JN37"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN37"
FT                   /protein_id="CBK92391.1"
FT                   /translation="MSQSVTIKSNKYGINLILDADMPFADLIKAVVEKFKASANFFKNA
FT                   KLAISFEGRHLSDEEQQQIIAAIEENTTIEILCIVESGTEQEAIMKEQVEAFNEAVQKQ
FT                   CENVATVSVPEQFYRGTLRSGQVITSESSVTIIGDVNPGAKIIAQGNIVILGALKGNVH
FT                   AGCTGDRSCFVFALDMQPIQIQIGDLIAKSPDEPQPKHRVRRKEKPAQEQAQIAIAKDG
FT                   YIYIEPITKNILNSI"
FT   CDS             234412..235203
FT                   /transl_table=11
FT                   /locus_tag="ERE_02740"
FT                   /product="septum site-determining protein MinD"
FT                   /function="septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92392"
FT                   /db_xref="GOA:D4JN38"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN38"
FT                   /protein_id="CBK92392.1"
FT                   /translation="MSEVIVITSGKGGVGKTTTTANIGTGLAQLNKKVVMIDTDIGLRN
FT                   LDVVMGLENRIVYNLVDVVEGKCRIRQALIKDKKYPDLCLLPSAQTRDKDAVTPEQMVE
FT                   LINELREEFDYILLDCPAGIEQGFKNAVAGADRALVVTTPEVSAIRDADRIVGLLEANE
FT                   MKRIDLIVNRLRVDMVKRGDMMNVDDVTEILAVNLIGAVPDDEQIVISTNRGEPLVGSD
FT                   SLAGKAYMNICRRIMGEEVPFLDLNQKHGVFEKLKDMFKKN"
FT   CDS             235219..235500
FT                   /transl_table=11
FT                   /locus_tag="ERE_02750"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /function="cell division topological specificity factor
FT                   MinE"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92393"
FT                   /db_xref="GOA:D4JN39"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN39"
FT                   /protein_id="CBK92393.1"
FT                   /translation="MGIMDLFKKKSSGNVAKDRLKLVLVSDRANCSSEMMEMMKRDIIE
FT                   VISRYMDIDAEALDVKITETESDSNNGMVPALVANIPIRDMKHRPDPR"
FT   CDS             235800..236372
FT                   /transl_table=11
FT                   /locus_tag="ERE_02760"
FT                   /product="Protein of unknown function (DUF1393)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92394"
FT                   /db_xref="GOA:D4JN40"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN40"
FT                   /protein_id="CBK92394.1"
FT                   /translation="MKKFVTLFTDSARELKSVRTITTMAMLAAVAVILGYFSIEYGQFI
FT                   RIGFSGIPNGIVDYLFGPVAGAVFHGALDIIKYLMKPTGPFCPQLTLVVMLAGVLYGCF
FT                   FYKKKLTIWRVLAAKFVVMLICNVILNTLCLQVLYGQAIMAILPMRALKNLIMWPIDSI
FT                   VFFGIAKALEQIGLFRTFRKPELAKNA"
FT   CDS             236833..238047
FT                   /transl_table=11
FT                   /locus_tag="ERE_02770"
FT                   /product="acetylornithine aminotransferase apoenzyme"
FT                   /function="acetylornithine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.11"
FT                   /EC_number="2.6.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92395"
FT                   /db_xref="GOA:D4JN41"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN41"
FT                   /protein_id="CBK92395.1"
FT                   /translation="MKLKDTGLTAQDIKDKVKKYMIETYERFDFIAETAEGMYLYDENG
FT                   TPYLDFYAGIAVNNAGSRNPKVVAAVKDQVDDIMHTFNYPYTIPQALLAEKVCKTIGMD
FT                   KIFYQNSGTEANEAMIKMARKYGIEKYGPNRYHIVTAKDGFHGRTFGAMSATGQPGNGC
FT                   QVGFGPMTYGFSYAPYNDLKAFKDACTENTIAIMIEPVQGEGGVHPATPEFMKGLREFC
FT                   DEKGMLLLIDEVQTGWCRTGAVMSYMNYGIKPDIVSMAKGLGGGMPIGAICATEEVSKA
FT                   FSAGSHGTTFGGHPVCCAAALAEVNELLDRDLAGNAKKVGDYFTAKLEKLPHVKEVRHQ
FT                   GLLVGVEFDDTISGVDVKHGCFDRHMLITAIGSHIIRMVPPLIVSEEECDKAFDIIKET
FT                   VESLS"
FT   CDS             238301..238936
FT                   /transl_table=11
FT                   /locus_tag="ERE_02780"
FT                   /product="Cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92396"
FT                   /db_xref="GOA:D4JN42"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN42"
FT                   /protein_id="CBK92396.1"
FT                   /translation="MAHLVITIGCEYGAKGNQIGKKVAKDLGIKFYDRDTVDEIIKEVG
FT                   IPKDIMEKVEEGITIAGKGAEGDVRGSFSKYADLTERAIHVQKTIIRKLSDRESCVIIG
FT                   RSADYILKEHKPILRIFIYSPDEVRIENVMKSHNLSEDDAKLFITEKDKRYHKRHMALT
FT                   GSNRGDRHNRDMLIDSSLLGVDGTAELIESLARKVVENESKTEAGGDK"
FT   CDS             238936..240459
FT                   /transl_table=11
FT                   /locus_tag="ERE_02790"
FT                   /product="Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92397"
FT                   /db_xref="GOA:D4JN43"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN43"
FT                   /protein_id="CBK92397.1"
FT                   /translation="MEQKKSEFNKVLNAWDVLVIAFGAMIGWGWVVSTGGWIEKGGVLG
FT                   AAIGFVIGGIMIFFVGMTYAELTAAMPQCGGEHVFSYKAMGSTGSFICTWMIILGYVSV
FT                   ACFEACAFPTIITYLWPGFLKGYLYTVAGFDIYASWLIVAIVVAFLIMMINIIGAKTAA
FT                   ILQTVLTCIIGGAGILLIIASVINGTVDNLDGQMFAGSSAGLNVKAIIGVAALSPFYFI
FT                   GFDVIPQAAEEINVPAKKIGSILILSVVLAVVFYALVIVAVGLVMGPQAIIDSEQATGL
FT                   VTADAMAAAFNTKIMAKVIIVGGMCGIVTSWNSFMLGGSRAMYSMAESYMIPKFFAKLH
FT                   PKHKTPINALILIGSLTMLAPFAGRKMLVWISDAGNFGCCVAYCMVALSFIILRKKKPD
FT                   MPRPYKVPAYKFFGTMAVIMSGFMVAMYCIPGSGGTLIVQEWGIVLAWCALGVVFFVFC
FT                   KKKYKESFGTLVELISDEDAATLMPEADEVELDKVIDAAIDRVLAKKAS"
FT   CDS             240483..241667
FT                   /transl_table=11
FT                   /locus_tag="ERE_02800"
FT                   /product="Alcohol dehydrogenase, class IV"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92398"
FT                   /db_xref="GOA:D4JN44"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN44"
FT                   /protein_id="CBK92398.1"
FT                   /translation="METFNFSVPQDITVGKGSLSKLPEIAKKLGGKHALIISGPHLEKM
FT                   GLVKKAADYLASVDIKADTFTDIEANPSVTTVEKATAKYLESGADFIVAFGGGSPMDVA
FT                   KAVGVVAKYGGSVTDYEGAHKVPGPIVPLIAIPTTAGTGSEVTAFSVITDHSRNYKLTV
FT                   FSYEILPKYAILDAELITTAPASVAAACGIDAFIHAEEAYVSTAASPFSDALAEKAMAL
FT                   IGKNIRRFVANRNDIEAAEAMMTGSLFAGIAFSFARLGNVHAMSHPVSAFFDVPHGVAN
FT                   AVLLPVIAEYNALADHGKYLTIYNDISPIPAYADEFEPMMLVDAIRELCTDIGIPENLT
FT                   IAINNASKNGTVTKEEIESRIEPMAVDAMKSGNIAVNPRASRQCDIEMLYRRAL"
FT   CDS             241699..242262
FT                   /transl_table=11
FT                   /locus_tag="ERE_02810"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92399"
FT                   /db_xref="GOA:D4JN45"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN45"
FT                   /protein_id="CBK92399.1"
FT                   /translation="MDYLSHNVSENLKRIRQSKGMSLDQVAEQTGVSKSMLAQIEKGTA
FT                   NPSIGVLGKITSGLRIEFQRLIDPPRVDYALISPDDLVPTKELLGQYRVWTCFPYEDSR
FT                   EVEVYRIDVEPGGVYTSGGHGEKTREYLTVTDGVLTVECHDHVQEIHRGQVYKFETDQP
FT                   HLYRNDGDRVASCMCFFLDYTNIR"
FT   CDS             complement(242268..244079)
FT                   /transl_table=11
FT                   /locus_tag="ERE_02820"
FT                   /product="Protein of unknown function (DUF1703)./Predicted
FT                   AAA-ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92400"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN46"
FT                   /protein_id="CBK92400.1"
FT                   /translation="MEYLSCSDASKAMGFSVRRIQQMCKNGELPGAIKEGRKWLIPDET
FT                   IHMNHFAKNKSLPIGVSDFKLATTGYYYVDKTLMIRDFLDKKPMVSLFTRPRRFGKTLN
FT                   MDMLRVFFEKTNEDTSVYFKDKQIWQCGDYYTKHQGQYPVIFLTFKDVKSMTWEETFQK
FT                   IRRLISLEFIRHNELETSSVLTAYEKEQYHLLARDSGDEVDCQMGLQLLSLLLHKHYGR
FT                   ECIIIIDEYDTPIQQGHTCNFYPEIVNFMRNFFSGGLKDNPHLAFGFLTGILRVAKESI
FT                   FSGMNNLKTYSILDDGYSSYFGFTEKEVKDMLRYYGKDDKYNELSEWYDGYRFGNTEIF
FT                   NPWSVINYISDNCFPKAFWQSTGSNEIIGEIIQAATPEITKDLYKLLCGEKIAAYIDTG
FT                   VIYPEVQNNPYSIYSFLLVAGYLKVANIYPQSDGNFMCDVAIPNKEITFVYEKEVLNRT
FT                   NQNSLAISISQAIFSKDTQKLQSLLEDFMVKSISSIDGANEGFYHGMMLGLCAILGNRY
FT                   KIRSNRESGLGRFDIQLMPLAKGMPGFIFEFKHTKDEHTDLSALADSALQQIEAKKYDT
FT                   ELRDNGVNSIISIGIAFRGKSAVVRRG"
FT   CDS             244349..246076
FT                   /transl_table=11
FT                   /locus_tag="ERE_02830"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92401"
FT                   /db_xref="GOA:D4JN47"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN47"
FT                   /protein_id="CBK92401.1"
FT                   /translation="MQTLKKFIKYYKPYKTVFFIDLLCATIISAIDLAFPQLLRTLTKT
FT                   LFAGAPGKIISALIPITIGLLVAYIIQTACRYYVTYAGHMMGARMERDMRKELFDQYEK
FT                   LSFSYYDQNNSGQMMSKLVSDLFDISELAHHGPENLFISLIKIIGSFIFLFMINRMLAV
FT                   PMLILVVLMLVFSYGQNKKMQETFMDNRRKIGDINSSLQDTLAGIRVVQSFANERIEQE
FT                   KFNRSNENFLISKDANYRCMGSFMSGNAFFQGMMYLVTLVFGGFLIAHGRMEASDLAMY
FT                   ALYIGIFISPIQILVELTEMMQKGLSGFRRFLEVVETEPDIVDAADAKPLKNVKGNVCY
FT                   EDVSFHYSDDDTPVLSHVSFEIPAGKSIALVGPSGSGKTTICSLLPRFYDVTEGRVTID
FT                   GNDVRKLTLESLRSQIGLVSQDVYLFGGSIKDNIAYGKPDATMDEIVDAAKKANIHDFI
FT                   MELPDKYDTFVGERGTRLSGGQKQRISIARVFLKNPPVLILDEATSALDNESERFIQKS
FT                   LEELAKDRTTITIAHRLSTIRNADEILVVADCGIAERGTHEELLALDGIYARYYDMSR"
FT   CDS             246145..246618
FT                   /transl_table=11
FT                   /locus_tag="ERE_02840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92402"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN48"
FT                   /protein_id="CBK92402.1"
FT                   /translation="MQAMFIDVDGTLSSPCYKVNGKFQIGMSDVQWADYCSKHGEDTYE
FT                   WCRPVMQVKEYAMKAKEKGTKLYVLTTSGTKIETAAKRRFLDRYYAGMFDDIYAVEHDD
FT                   DKVRFILKKAAELGIEPSDCELVEDTYRILLQTVTEGIKSTHITTILTGGCER"
FT   CDS             246731..247006
FT                   /transl_table=11
FT                   /locus_tag="ERE_02850"
FT                   /product="Anti-sigma-28 factor, FlgM."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92403"
FT                   /db_xref="GOA:D4JN49"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN49"
FT                   /protein_id="CBK92403.1"
FT                   /translation="MRIDAYNQIAQLYGVSRTTKTAKTQSASRMSDQVSISQAGRDYQI
FT                   AKKAVSEASDIREDKVALLKNMVDSGQYEVSGDDFASKLLERYNSL"
FT   CDS             247587..249296
FT                   /transl_table=11
FT                   /locus_tag="ERE_02870"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92404"
FT                   /db_xref="GOA:D4JN50"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN50"
FT                   /protein_id="CBK92404.1"
FT                   /translation="MANGFGSFYVGSSGLKNSQNALNTTANNMANVNTTGYVRQQVRFS
FT                   DKHYITRNNPTAGTNIQQSGLGVSVSDVAHVRDIFLDKSYRQENGRKGFYSTLYSTTSY
FT                   VEDIMQEMNGAEFKESISELWQAFQEYGKDPTNSTKQNLIIQKSELFLTRCNTVYSDLQ
FT                   KYQSNINLQIKDQVDRINEIGDKIYALNLEIQKTESGGVETAMTARDARDSLIDELAGY
FT                   AKIEAEEDSTGYVRIKLEGQQFVQDNKCNHIGLTEEKGTGFYTPYWPHITTQESYMPVF
FT                   SDVALPSALAERVGCTQTTNIATSLNNDIGSLKALLVSRGSEYGTYDFMSEENYSRVED
FT                   NVVMETQAEISYLARNIMMAMNDIFCPNTTYTAADGTTYTVLDTANCSVGADGSLPPHE
FT                   LFAREGYDRYTQMEIDGKQFYVYNDETKANNSSWYKLGNVSVNPKLAAQVTLMPSYKQD
FT                   GSANYGLADQITKAWSAENLYINPKDTSKCNFEGYYDKIISHLGTNGSIYKASSDTMTS
FT                   TAAAIDNQRNQIMGVSSDEELTNMIKYQSAYNASSRFITVISQMTELIVQLI"
FT   CDS             249338..251191
FT                   /transl_table=11
FT                   /locus_tag="ERE_02880"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92405"
FT                   /db_xref="GOA:D4JN51"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN51"
FT                   /protein_id="CBK92405.1"
FT                   /translation="MASTFFGLHIGSSALSSFQVATNTTANNIANVKTTGYTRQEATLQ
FT                   AKDAINVTARYGSVGTGVTVTSIKQQRDLYYDNKYWENNSCYGRYEQKLYYMEQIQNYF
FT                   KDNGSSVKGFSSVFSQMFSDLDTLRSKPSDKTVRNQFISSAQSLCTYFNQMSDNLSKLQ
FT                   DDCNEEIRNNVDKINSISEKISLLNKEINQIETGTGVEAGSLRDERANLIDSLSKIVNV
FT                   SYNETEVQNTNGDNLGGTNFSLYINGEKVVEGKDYRKLICESSKTKNNQTDNDDLYKIY
FT                   WEDTKMEFSATAGTAGGSLKALFEVRDGDNLENFKGKVTKADSYSLTVENISIDNIKSL
FT                   NLPDKDGKITVNNISYSYDSWEAQVDAQGNIKSVTFNLSKDKAIADPEKTVAEGYLLNA
FT                   GSAINARGIPYYMTQLNEFVRNFSEMFNQIESKGQNLNGDTPPTFFEAITNTAKVYDFS
FT                   ESEAYSKLPDGQTATINSSSNTYYRMTAANFSVNKDVMNDVSLFATSTDYVKTDSCDIV
FT                   DELKKLQSEKTVYRGDKAESFLETIISNVSVDTEKAETYNKLYSNLEQTIANQRTSVSG
FT                   VDEDEEALNLVKFQYSYNMASKIISVMNQMLDKLINDTGVA"
FT   CDS             251208..252740
FT                   /transl_table=11
FT                   /locus_tag="ERE_02890"
FT                   /product="Flagellin and related hook-associated proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92406"
FT                   /db_xref="GOA:D4JN52"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN52"
FT                   /protein_id="CBK92406.1"
FT                   /translation="MRITNNMIMGNTKTNINSTKVLVDKYNTQMTTQKKISKASEDPVI
FT                   AIRSLRLSTSLSHLDQYKDNNIPDASSWMDVTQTALSNMKSLLTDIRTQCVNGSTDTLT
FT                   ADVRNTILQQLTALSEQVYTEGNADYAGRTVFTGYRTSSKLTFQKDTKSTYQITQEFSA
FT                   ADLSEKRYYTNGVTVPNSINAATPDCTTDVTEHSFQRIRLGYGNTTDDVKLSIDGKELT
FT                   PGTDYTVYKSVSDFDPSKLSADDTAYIQETGEFVFGKNVAASIKNNEKKLSVTYVKTGF
FT                   DSSDARPEYYYNCKDITNAVTLDAGGNVPHDAAGDIIYSDPSKVVDFKFSSQEIKYTVA
FT                   NSTDITVNTQAKDVMDTGIKRDVDELIDVVQNAVNAHDKVSQIKKMMQQQQYSDKDSQA
FT                   KLKTYLEAAEQEADYADNNLQKTYSQYITRFDDHLNKVNLALTNSGSTKSRLTLIKNRV
FT                   EEQQTTIEELKSTNEDRDISDIIIDFYAMYNAYQSSLTAASKANSQTLLDYL"
FT   CDS             252810..253274
FT                   /transl_table=11
FT                   /locus_tag="ERE_02900"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92407"
FT                   /db_xref="GOA:D4JN53"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN53"
FT                   /protein_id="CBK92407.1"
FT                   /translation="MRAKTRIFGEIDIPQDKIITMEKGMIGFSELKNYTLIYNSEKEND
FT                   KKSIMWLQSMDDGDIAFPVMTPDIIMPDYKPTVNEELLAPLGDLNEENMYVIVTVNVPS
FT                   DITKIACNLKAPIVVNTDSNKAAQLIVEDDYKVHFPIYDIIKGKKERAGE"
FT   CDS             253276..253494
FT                   /transl_table=11
FT                   /locus_tag="ERE_02910"
FT                   /product="carbon storage regulator (csrA)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92408"
FT                   /db_xref="GOA:D4JN54"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN54"
FT                   /protein_id="CBK92408.1"
FT                   /translation="MLALTRKKGESLVINNDIEITILEIRGDQIKLGVSAPKEVPIYRK
FT                   EVYTQIQQENRKSADAQNAQALKELFG"
FT   CDS             complement(254552..254722)
FT                   /transl_table=11
FT                   /locus_tag="ERE_02930"
FT                   /product="4Fe-4S binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92409"
FT                   /db_xref="GOA:D4JN55"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN55"
FT                   /protein_id="CBK92409.1"
FT                   /translation="MAYVISDSCVSCGTCAGECPVGAISAGDSQYVIDADSCLDCGTCA
FT                   GVCPTGAISQG"
FT   CDS             255084..256592
FT                   /transl_table=11
FT                   /locus_tag="ERE_02940"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92410"
FT                   /db_xref="GOA:D4JN56"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN56"
FT                   /protein_id="CBK92410.1"
FT                   /translation="METKIIKIDQDNLDHKLMQEAGDLIAAGELVAFPTETVYGLGGDA
FT                   LDPEASKKIYSAKGRPSDNPLIVHISDFSDLERIAKTVPEDARKLSDAFWPGPLTMIVE
FT                   KGDAVPYATTGGMDTVAVRMPNHPIALDLIRRSGCLIAAPSANTSGRPSPTEAAHVAED
FT                   LSGKIAMIIDGGPVGIGIESTIIDLTEDTPMVLRPGYITPQMLSKVLGKEVIIDPGIIA
FT                   ADDTRKPKAPGMKYKHYAPKADMVIVDGTRKHVIAKINELVASHRDDGKKIAVIATEET
FT                   KQFYDADVVLSMGSRADEDSIAHELYRILRDCDELDVDVIFSESFSTPRIGQAIMNRML
FT                   KAAGHQVIDTHVKYDKIIFVAQTGTCREQMAKGIMNDFVLKVPMEIEARGLVVQFPEPV
FT                   NQKAEAVLISNGISTEGMVSTQLEESDITESTMVFTMESSQRERIIESFADIDPEQVFV
FT                   LSQYVGDELEILDPYGGTLQSYGLCYESLRATLKKLVKRLNANT"
FT   CDS             256640..257269
FT                   /transl_table=11
FT                   /locus_tag="ERE_02950"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /function="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92411"
FT                   /db_xref="GOA:D4JN57"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN57"
FT                   /protein_id="CBK92411.1"
FT                   /translation="MGKVVVMDHPLIQHKIGIMRRTDTGSKDFRTLVSEVAMLECYEAT
FT                   RDLELTDVEIETPICKATVKELKGKKLAVVPILRAGLGMVEGMLELIPAAKVGHIGMYR
FT                   DPETAEPIEYYCKLPADCANREVFVVDPMLATGGSAVAALDMLKKRGVKNIHFMCIIAA
FT                   PEGVKRLTEAHPDVDVYIGALDDHLNEHKYIVPGLGDAGDRIFGTK"
FT   CDS             257375..257860
FT                   /transl_table=11
FT                   /locus_tag="ERE_02960"
FT                   /product="Deoxycytidylate deaminase"
FT                   /EC_number="3.5.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92412"
FT                   /db_xref="GOA:D4JN58"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN58"
FT                   /protein_id="CBK92412.1"
FT                   /translation="MGASEKRKDYISWDEYFMGIAMLSGMRSKDPNTQVGACIVDPEHK
FT                   ILSMGYNGFPLGCSDDEFTWAREGEDNKYFYSTHSELNAILNYRGGSLEGATIYVTLFP
FT                   CNECAKAIIQSGIREVVYDCDKYEGTASVTASKRMLKAAGVTIRRYEHTDREVTLVL"
FT   CDS             258022..258321
FT                   /transl_table=11
FT                   /locus_tag="ERE_02970"
FT                   /product="Putative F0F1-ATPase subunit (ATPase_gene1)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92413"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN59"
FT                   /protein_id="CBK92413.1"
FT                   /translation="MNALIMVFQFGINMIVPIFLCTLAGVWIGKKTGADWVTVPLFFLG
FT                   AFAGANNIYRMVQKFLKPEDDGRAVRQTPGRQSTTETEISDSISRVEKDVKKNK"
FT   CDS             258302..258733
FT                   /transl_table=11
FT                   /locus_tag="ERE_02980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_02980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92414"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN60"
FT                   /protein_id="CBK92414.1"
FT                   /translation="MLKRINDALPGLVFGIVFYGIVVQLIGVWFVTDKISYSIGLWYGI
FT                   AIAVGIAVNIATVIYDATAIYGQKDANRRIVAKSLLRYIVVAVLLFILGLFDFGNLIMA
FT                   FVGMLGLKISAYLQPLFMKVTDRFSGRSDASSAGEMETE"
FT   CDS             259544..259798
FT                   /transl_table=11
FT                   /locus_tag="ERE_03000"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /function="ATP synthase F0 subcomplex C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92415"
FT                   /db_xref="GOA:D4JN61"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN61"
FT                   /protein_id="CBK92415.1"
FT                   /translation="MDINGQDLIRACSAIGAGLAVIAGIGPGVGQGIAAGHGAAAVGRN
FT                   PGARGQIMSTMLLGQAVAETTGLYGLVVALLLLFVHPLG"
FT   CDS             260945..262450
FT                   /transl_table=11
FT                   /locus_tag="ERE_03030"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /function="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92416"
FT                   /db_xref="GOA:D4JN62"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN62"
FT                   /protein_id="CBK92416.1"
FT                   /translation="MNLKPEEISSVIKEQIKRYASQLEVADVGTVIQVADGIARIHGLE
FT                   NAMQGELLEFPGEVYGMVLNLEEDNVGAVLLGQQRNINEGDTVKTTGRVVEVPVGDAML
FT                   GRVVNALGQPIDGKGPIQSDKYRQIERVASGVISRKSVDTPLQTGIKAIDSMVPIGRGQ
FT                   RELIIGDRQTGKTAIAIDTIINQKGQGVKCIYVAIGQKASTVASIVNELEEFGAMSYTT
FT                   VVAATASELAPLQYIAPYSGCAIGEEWMENGQDVLIVYDDLSKHAAAYRTLSLLLKRAP
FT                   GREAYPGDVFYLHSRLLERAARLSDKLGGGSLTALPIIETQAGDVSAYIPTNVISITDG
FT                   QIYLETEMFNAGFRPAINAGLSVSRVGGSAQIKAMKKIAAPIRVELAQYRELAAFSQFG
FT                   SELDASTAEQLAQGARIKEILKQPQYKPMPVEKQVIIIYAATKKYLIDIKIEDILRFEA
FT                   ELFDFIDTRYPEIPEAIREKKVMDDDTEQALIKAIEECKKQFR"
FT   CDS             262484..263344
FT                   /transl_table=11
FT                   /locus_tag="ERE_03040"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /function="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92417"
FT                   /db_xref="GOA:D4JN63"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR023633"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN63"
FT                   /protein_id="CBK92417.1"
FT                   /translation="MASMRDIKRRKSSITSTQQITKAMKLVSTVKLQKARAHAEATDPY
FT                   FNYMYRTVSSMLAKSGSIEHPYLKAGDSPRKAVVVLTSNRGLAGGYNSNIVKLITHGDF
FT                   KKEELDIYAVGAKGEELLTSKGYHIVESASEMMEDPTYEDAAALCKRVLKAFTDGQVGE
FT                   IYLAYTHFKNTVTQEAKLIKLLPVELDESGADEKEDSNILMNFEPNPEEALELIIPKYV
FT                   TSLFYGALVESFASENGARMQAMDSATSNAEDMISDLTLKYNRARQGSITQELTEIIAG
FT                   ANAIE"
FT   CDS             263444..264835
FT                   /transl_table=11
FT                   /locus_tag="ERE_03060"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /function="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92418"
FT                   /db_xref="GOA:D4JN64"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN64"
FT                   /protein_id="CBK92418.1"
FT                   /translation="MADKNVGKIIQVISAVLDIKFSEGNLPEINDAVEVPLKNGGKLVV
FT                   EVAQHLGDDTVRCIAMGPTDGLVRGMDAIATGAPISVPVGENTLGRMFNVLGEPIDEVE
FT                   PPQTEEKWAIHRPAPSFEEQATSQEMLETGIKVVDLLCPYQKGGKIGLFGGAGVGKTVL
FT                   IQELIHNIATQHGGYSVFTGVGERTREGNDLYYEMKESGVIDKTTMVFGQMNEPPGARM
FT                   RVALAGLTMAEYFRDRGGKDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLQTEM
FT                   GALQERITSTKNGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLERSIAELGIYPAV
FT                   DPLASTSRILDPRIVGQEHFEVAHAVQEILQKYKELQDIIAILGMDELSEEDKLVVSRA
FT                   RKVQRFLSQPFFVAGQFTGLEGKYVPIAETIRGFKEILEGKHDDVPESYFLNVGSIDEV
FT                   RAKMQ"
FT   CDS             264850..265257
FT                   /transl_table=11
FT                   /locus_tag="ERE_03070"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /function="ATP synthase F1 subcomplex epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92419"
FT                   /db_xref="GOA:D4JN65"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN65"
FT                   /protein_id="CBK92419.1"
FT                   /translation="MADNIFDIEIITPDRVFYKGETDFLEFNTQNGEIGVYKNHIPLTT
FT                   VLAPGIVTIHNGDEEKIAAIHSGFAEILGDKVTFLAELAEWPDEIDIDRAQAAKERAEQ
FT                   RLSNHTAEIDVKRAEFALRKALIRIDVAHHM"
FT   gap             265581..266774
FT                   /estimated_length=1194
FT   CDS             complement(266955..267785)
FT                   /transl_table=11
FT                   /locus_tag="ERE_03090"
FT                   /product="Transcriptional regulator containing an amidase
FT                   domain and an AraC-type DNA-binding HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92420"
FT                   /db_xref="GOA:D4JN66"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN66"
FT                   /protein_id="CBK92420.1"
FT                   /translation="MSNRKFNLDNEVQPEIHFRLLSISASKFENDWTSFPHSHHFTEIF
FT                   FIKDGTGRMLIENESLPVSSNSLVVIGAQVTHTEFSDPENPLDYYVLGVEGLKLNTDKE
FT                   PEYIHVPASANSPFIRQCFENILREMHNKQDRYAEICQHYLDILILYFCRKDHVSYEVV
FT                   DAQNSSRECHKVKRFIEHNYQSMISLDSLAENCSLSKYYLSHRFAELYGKSPIAYLNEV
FT                   RLASARDLLLTTNHSIEEIAGCIGFSSTSYFSQSFQKNFHESPQQFRKSHRVRT"
FT   CDS             268023..269369
FT                   /transl_table=11
FT                   /locus_tag="ERE_03100"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92421"
FT                   /db_xref="InterPro:IPR022387"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN67"
FT                   /protein_id="CBK92421.1"
FT                   /translation="MKKKILCTMMSMVMVASLFAGCGTDSGKENSASDTSKTKEAGTTI
FT                   SVAAIETAYGSEMWQKVADAFTEETGIKVELTTDKKLEDVIGPSMQGGEYPDVIHLATG
FT                   REAALTEQFIKGHMITDITDVLSMKVPGEDKLVSEKIAGGFTDTSLTNPYGDGKTYLAP
FT                   MFYSPCGLFYNAGLLEEKGWDVPKTWDEMWELGDKAKEEGIYLFTYPTTGYFDAFFYAL
FT                   MYSAGGPEFFDKATNYAEGIWETPEAQTCFDIVAKLAEYTNPVTPAQANDQDFTQNQQL
FT                   VLDNKAIFMPNGTWIVGEMAEAPRADGFKWGMTALPAVKDGGDAYSYTWFEQAWIPSGA
FT                   EHQDAAKLFISYLYSDKACEIFAKAGAIQPVLGIADKLSGDNVMFYSIYDNGAKAAMGN
FT                   FAAFEAIPGVEVRTVFFDPVNSLVSGDMDEQAWIDGIISASDQMRANLK"
FT   CDS             269478..270362
FT                   /transl_table=11
FT                   /locus_tag="ERE_03110"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92422"
FT                   /db_xref="GOA:D4JN68"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN68"
FT                   /protein_id="CBK92422.1"
FT                   /translation="MKKARGRSGFLAVCIAPAVILFFVFMILPTLNVFRMSLFEKGAYS
FT                   PNETFVGLKNFKTLISDTNFIRSMQNMILLIVVVTIVTFAFALVFAGILSREQIRGQNF
FT                   FRIIFYIPNILSVVVIAGIFSAIYKPENGMLNSIIGLFHKMENPILWKGESLVIVSLII
FT                   AMIWQAIGYYMVMYMASMASVPKSLYESAGLDGAGRLVQFFQITIPLIWTNIRTTLTFF
FT                   IISTINMAFLFVKAMTSGGPNGASEVSLSYMYGQKDAGLYGYSMAIGVVIFIFSFALSA
FT                   LVNKVTEREPLEF"
FT   CDS             270374..271264
FT                   /transl_table=11
FT                   /locus_tag="ERE_03120"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92423"
FT                   /db_xref="GOA:D4JN69"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN69"
FT                   /protein_id="CBK92423.1"
FT                   /translation="MREKKNPNSAERLYKFFIYLVLIMLAVSIIIPVAWVFMASIKQNK
FT                   EFYGNPWTLPEGFYFQNFIDAWNTAKMGDYMLNSVLVTALALVILLIVALPAAYCLSRF
FT                   KFKGSKFLNAAFMGGLFINVNYIVVPIFLMLRDGDNWLKSVIGKSFLLNNLVILAIVYA
FT                   ATALPFTIYLLSGYFSTLAHDYEEAAYIDGAGYSTTMWKIIFPMAKPSIITIILFNFLS
FT                   FWNEYIISMTLMSSAKGPKTLPVGLLNLMQAQQSAAQYGIMYAGLVIVMLPTLILYICV
FT                   QNKLTQGMTVGGLKG"
FT   CDS             271282..271485
FT                   /transl_table=11
FT                   /locus_tag="ERE_03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92424"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN70"
FT                   /protein_id="CBK92424.1"
FT                   /translation="MEFWKKHTKCRIILMAALFIAGISLSVFGWGMTGKMTGLGIMLIG
FT                   IICLLMALWIYNCPFAEKKKRK"
FT   CDS             271517..273682
FT                   /transl_table=11
FT                   /locus_tag="ERE_03140"
FT                   /product="conserved hypothetical protein TIGR02336"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92425"
FT                   /db_xref="GOA:D4JN71"
FT                   /db_xref="InterPro:IPR012711"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN71"
FT                   /protein_id="CBK92425.1"
FT                   /translation="MSEKNTGRVTIPTNLDVVPETIELMKRWGADAIRDCDGTEFPEEL
FT                   TKTGAKIYATYYTTRKDNEWAKANPDEVQQCYIMSGFYTAVESELQIPLMKGISDELMQ
FT                   VNTRDDIKRWWEVVDRSTGQVVSTKQWEYNEESGCVCIHEAEPFHEYTVSFLAYIIWDP
FT                   VHMYNAVTNDWKDFEHQITFDVRQPKTHKYSMERLRKFCEEHPYVNVIRYTTFFHQFTL
FT                   MFDELKREKYVDWYGYSASVSPYILEQFEKEAGYKFRPEYIIDQGYYNNQYRVPSKEYK
FT                   DFQAFQRREVAKLAKEMVDITHECGKEAMMFLGDHWIGTEPFMEEFATIGLDAVVGSVG
FT                   NGSTLRLISDIEGVKYTEGRFLPYFFPDTFHEGGDPVKEAKENWVTARRAILRKPIDRI
FT                   GYGGYLKLALDFPEFLDYVESVCNEFRELYENAKGTTSYCVKKVAVLNSWGKIRSWGCH
FT                   MVHHALYQKQNYSYAGIIEALSGAPFDVKFISFDDILKDKDILKDIDVIINVGDGDTAH
FT                   TGGAVWENAVISAAIREFVYQGGGFIGVGEPAGHQYQGHYLQLADLIGVEKETGFTLNY
FT                   DKYNWEEHKNHFILADTTKSVDFGEGKKNMFAYEGTEILVQRDKEVQMAVHEFGEGRSV
FT                   YISGLPYSFENSRILYRSILWSTHGENLLHQWFSTNFNVEVHAYVKNGKFCVVNNTYEP
FT                   QDTVIYRGDGSSFALKMEANEIKWYTV"
FT   CDS             273701..275707
FT                   /transl_table=11
FT                   /locus_tag="ERE_03150"
FT                   /product="dTDP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92426"
FT                   /db_xref="GOA:D4JN72"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN72"
FT                   /protein_id="CBK92426.1"
FT                   /translation="MKKPVLVIMAAGMGSRYGGMKQIDPVDEYGHIIVDFSIYDAYLAG
FT                   FEEVIFVIKKENAEDFHNVIGNRIEKIMKVRYAFQELENLPEGFEVPAGRVKPWGTAHA
FT                   ILSCKDMIDGPFAVINADDYYGREAFKQIYDYLSVHEDNEKYQYAMVGYQLKNTLTENG
FT                   SVARGVCDIDSNGKLVSVTEHTTIVKRGENAAYTEDDGKSYTDLAGDTIVSMNLWGFSK
FT                   GFLSEIAYGFRDFLQEGLQHNPLKCEYYLPSVVSRLLDSNKAEVKVLLTTEKWYGVTYK
FT                   EDKPMVMAAVKKLEENDFYPKQLCGKLEAAANFCFEGVYKEEIPWGNGHINDTYRVTFE
FT                   NEQGVKKHYILQQMNKSIFKNPVQLMENIVGVTEFLKRKISANGGNPERETLNVIPAKD
FT                   GKPYYVDSEGEYWRAYVFIENTVSYDLIDNPEILYEGGLAFGRFQSMLADYPAKTLHET
FT                   IPGFHDTRERFETFKKAVEEDVCSRVDLVREEIQFVLDREEIVDCFQDLLRSGKISFRV
FT                   THNDTKINNVLMDKDTKKGICVIDLDTVMPGAAMNDFGDAVRIGASTALEDEQNLDKVW
FT                   CDLELFEACAKGFIEGCGGKLSQEEIKLLPMGAKLMTYECGMRFLMDYIQGDIYFKIHR
FT                   PGQNLDRARTQFKLVSDMEHKWKEMENIVKKYM"
FT   CDS             276589..276804
FT                   /transl_table=11
FT                   /locus_tag="ERE_03170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92427"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN73"
FT                   /protein_id="CBK92427.1"
FT                   /translation="MNELVYRNLSEDAKRQICAWKYGGEYDLYNLPAYEEMQVRQIGFM
FT                   NPKSEKNYYGFWDESILVGLMDKLMS"
FT   CDS             276862..277536
FT                   /transl_table=11
FT                   /locus_tag="ERE_03180"
FT                   /product="sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92428"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN74"
FT                   /protein_id="CBK92428.1"
FT                   /translation="MKYDKIVEAIFIERPNRFIARVKIDGAEEVELVHVKNTGRCRELL
FT                   LPGAEVILEDCIEKNPNRKTRYDLIAVKKNGMWVNIDSQAPNKVVKEWLIKQGYDCIKP
FT                   EYAFGNSRMDLYMEKGKQKYLMEVKGCTLEIDGVGYFPDAPTERGVKHLRELAAACGQG
FT                   YKCLIAFVIQMEEISEVRPNTTMHPEFGIALEEAKDAGVEVLSLKCHVGMDRLEIIGEN
FT                   EP"
FT   CDS             277566..278156
FT                   /transl_table=11
FT                   /locus_tag="ERE_03190"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92429"
FT                   /db_xref="GOA:D4JN75"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN75"
FT                   /protein_id="CBK92429.1"
FT                   /translation="MIREIENRRSIRKYKPDEIERKLIEEIIYSASLAPSAKNRQPWKF
FT                   IIYQGKEKDKLVDVMRHGINSEKTTHELMPEWAFAIPDAENTVRIMQEVPCLIAVLNTN
FT                   QHTPFASIENEKRMVEICDSLSIGAAIENMILTATGYGLGTLWIANTCFAYNELMDFIG
FT                   TDSQLTGIVAVGFADEAPDKRPRKTFEEIVEYR"
FT   CDS             complement(278299..279594)
FT                   /transl_table=11
FT                   /locus_tag="ERE_03200"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92430"
FT                   /db_xref="GOA:D4JN76"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN76"
FT                   /protein_id="CBK92430.1"
FT                   /translation="MAKGSVRKKGKKWYYRFYVEDASGNLVQKEYAGTESKSETEKLLR
FT                   QAMDDYESKKFVAKTDNLTVGELLDMWAEEELKVGTLSNGTVENYLGAIRCIKKHPIAE
FT                   RKLKTVTAEHLQAFLDLLTFGGEFPDGKVRKGYSKDYIHSFSAVLQQAFRFAVFPKQLI
FT                   TFNPMQYIKLKKQAEDVDLFSDDEVEEGIQPISHEDYERLIEYLKVKNPPAILPIQIAY
FT                   YAGLRIGEVCGLTWQDINLEEQCLTIKRSIRYDGTKHKNIIGPTKRKKVRIVDFGDTLT
FT                   EILKTARKKQLKSRMQYGELYHRNFYKEAQDKNRVYYEYYHLDGTEEIPVDYKEISFVC
FT                   LRPDGCLELPSTLSIACRSVAKRLDGFENFHFHQLRHTYTSNLLSNGAAPKDVQELLGH
FT                   SDVSTTMNVYAHSTRKAKRNSARLLDKVAGND"
FT   CDS             complement(279681..280310)
FT                   /transl_table=11
FT                   /locus_tag="ERE_03210"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92431"
FT                   /db_xref="GOA:D4JN77"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN77"
FT                   /protein_id="CBK92431.1"
FT                   /translation="MKDKELRKLIGSRAKQRRLELNLTQPYVAEKMGVTASTILRYENG
FT                   SIDNTKKMVLEGLSEALHVSIEWLRGETDEYETDITDKKELQIRDAMGDILKQLPLDLS
FT                   KKEDAFSKDLLLLMLKQYNLFLESFQFACKNYKGNTNEADIAKVMGFESNDEYNEIMFL
FT                   REITHTVNAFNDMADIVRLYSKKPEMAEQRLENLLSEVLYEDSDSV"
FT   CDS             280485..280715
FT                   /transl_table=11
FT                   /locus_tag="ERE_03220"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92432"
FT                   /db_xref="GOA:D4JN78"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN78"
FT                   /protein_id="CBK92432.1"
FT                   /translation="MTERKIALSIEEAADYTGIGRNTLRKLVEWKKLPVLKVGRKVLIK
FT                   TDILEKFMEANEGRDLRDKGNVKTVTRNVAT"
FT   CDS             280874..281293
FT                   /transl_table=11
FT                   /locus_tag="ERE_03230"
FT                   /product="relaxasome subunit MobC"
FT                   /function="relaxasome subunit MobC"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92433"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN79"
FT                   /protein_id="CBK92433.1"
FT                   /translation="MHHDSDWNYVNRADQNRVPNLSRARFDYKRKDEDDMAKSTKTYEE
FT                   RIRALEKKEQESIEATKKLIAQRKELEKRKKAEESKKRTHRLCQIGGAVESVLGCPIEE
FT                   EDLPKLIGFLKRQETNGKFFSKAMQKEPLTDMEEV"
FT   CDS             281293..281598
FT                   /transl_table=11
FT                   /locus_tag="ERE_03240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92434"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN80"
FT                   /protein_id="CBK92434.1"
FT                   /translation="MAEGVVFPFPSLPLNEGRTYGQPEVVLISLPQVATGLRLRLPGSF
FT                   RRRGFQPDLLMPQEALLRRGRFDSFTPAKPEEDAVGNQCRIRQKGGIVSWRYFTLQ"
FT   CDS             281574..283295
FT                   /transl_table=11
FT                   /locus_tag="ERE_03250"
FT                   /product="plasmid mobilization system relaxase"
FT                   /function="plasmid mobilization system relaxase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92435"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN81"
FT                   /protein_id="CBK92435.1"
FT                   /translation="MAIFHFTVKIVGRSKGKSVISASAYLNGDVMKNEETGRISYYTSK
FT                   KEVVYTSLMMCENAPLEWLQVSEENIKRFQQSIRYKRAGDKEAALEKFKITFQKQRLWN
FT                   EVLKIEKNADAQLGRSFEFSLPKEWSRQEQIDYTTEYIQKTFVDEGMCADWSIHDKGDG
FT                   NPHVHLLVTMRPFNPDHSWGNKEVKDWDFVRDTDGNIVVDESHPDWWQDKKNPDRHGIR
FT                   IPVLDENGVQKVGARNRKQWKRVLTDATGWNNPKNCELWRSEWAKMCNRHLSIDNLIDH
FT                   RSYERQGKLKVPTIHEGADARKIEEKYLTGQIRKGSWKVEENQMIKKQNALLQKVIATF
FT                   GKVSGALSMWREWLNDIRRKQRSNSHDGSNDYTDRGTAEYHGRDASGDTGKGREADVLS
FT                   GAGRTIAAIRERIVRAATNLTGYRRTVDASGRKDRPDTETHRRKSAMAGIGTEIKQREP
FT                   AIAETEQRITELEQQLEKGRLIDERIKKLKERRSTGRVASADRADAGRTRPERPDYQGT
FT                   ESAARRIADLEREVKQREQNREHSSLKERLEENKRIVAERERENTHRPSHDRGMSR"
FT   CDS             283273..283983
FT                   /transl_table=11
FT                   /locus_tag="ERE_03260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92436"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN82"
FT                   /protein_id="CBK92436.1"
FT                   /translation="MIEECRDKQRQAEQERDYALSHQKKVEIPVEKPVLYQKCGNCKQT
FT                   AYLKAKEKYDMQREKLAGRYKTKTAMYEALMFLLIWYSVSTTLFQMIRSKIFISDCVVF
FT                   FDTIATFTQTIAGWVVLAGKNVAQISDGISNPVVAGIINWLIRILICGGCLVGVGILLA
FT                   FIEIKIAGLYKKYCWDMITIMVILVSMAIAIYFGDWIKEVLPINLLFLLLFVQLVYVGI
FT                   RWYVKGWRENRGYV"
FT   gap             284224..286061
FT                   /estimated_length=1838
FT   gap             287049..288193
FT                   /estimated_length=1145
FT   CDS             288418..289080
FT                   /transl_table=11
FT                   /locus_tag="ERE_03290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92437"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN83"
FT                   /protein_id="CBK92437.1"
FT                   /translation="MGISFSNIGTVGREQLITSGSNGEPNWSYIPSKGKSTRTQTEFVS
FT                   EIKKLAQKAANAPDKTEQDAISRQVLQLRAEYLSEVAPDRKQLYQQAKSAMKNQNTNQK
FT                   CKGIGELTLLDFLEQAEGKNQNLADKQIALAGGGTLKFTILTSGGYGVQIQSQGVNVLL
FT                   NTGAGWGYEMTPAELTKKDEFYSIYWKEYNAVKNGMNSELKELPDYLEKRPVFEAKA"
FT   CDS             289120..289620
FT                   /transl_table=11
FT                   /locus_tag="ERE_03300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92438"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN84"
FT                   /protein_id="CBK92438.1"
FT                   /translation="MQISSNYSMNGVPYENRRRQNDIPQFSTERAEQENESINPYMEDT
FT                   DFNEKAFDMIGPNAPQDVKDAWMEAAKEVNANGMGIKKNGMLSHISQMMVQRLNKQMKG
FT                   EGDVDNIDILGNTTESAIQATKQALYNLDHPLEYVPKSIEVQRACMKEREFYVAFLERL
FT                   EKL"
FT   CDS             289687..290745
FT                   /transl_table=11
FT                   /locus_tag="ERE_03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92439"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN85"
FT                   /protein_id="CBK92439.1"
FT                   /translation="MSDSTLHIGTLASNNVNNIVNDTSKYDEYKEKVKELEKELQTRKD
FT                   TFEKMTEPLVYVCDCYQKFNVVTGMPKSTFGDSFGYAMQKEISDYMQDFYAGKVSREDL
FT                   DSYFEKCCTSMRTYRTGQHQTSGTNEADNTQIVSEMYEVFAKENARAAGQANYQEGKAW
FT                   NEKYYSDGHSDWTYYNSDYYYQCNDTNAALRESVRKMTEKWELDGIDCDEIEANSSLTL
FT                   DGGFDFNSIWNSDFRNQVGRSSLAKESTIPPENFKMFFKEQVTSFTEDNKFNGNLKITI
FT                   GKNNYDLNVPFQTLRTGSEGEIRNVWDLMEDYYSDTKDNSKVKNFLRNMSVFTRWYSYE
FT                   TGINDRFGDYLR"
FT   gap             290765..291846
FT                   /estimated_length=1082
FT   CDS             291950..292582
FT                   /transl_table=11
FT                   /locus_tag="ERE_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92440"
FT                   /db_xref="InterPro:IPR024540"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN86"
FT                   /protein_id="CBK92440.1"
FT                   /translation="MAMNISGLGNTYNGINTNSKQYKALKEKGWLSGIMQNEAMMSPEE
FT                   RIIYETFGGRDTIIKNLMKQFDSDGDLLNANGVAGMDVTGKGTSWQQLTSVSEEYRQKM
FT                   FDNVKKEFIQENGLSNGDTTKRSDIFKDYQLSVSKDKRLSGTWTLEQYEGQYRAAMYAA
FT                   VKSANPNWKPGQKFDTSILDNVKRESVESTLVKNGNRLVRNSIDVSV"
FT   CDS             complement(292953..293192)
FT                   /transl_table=11
FT                   /locus_tag="ERE_03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92441"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN87"
FT                   /protein_id="CBK92441.1"
FT                   /translation="MRTIFAEYNPHRNSIDIYTSAGYMLRIDCWEAEKDLKTTPGSDCA
FT                   LNAFAIDKPLEYAKLYLDGTMQIWVDAEDSLELW"
FT   CDS             293542..293706
FT                   /transl_table=11
FT                   /locus_tag="ERE_03340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92442"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN88"
FT                   /protein_id="CBK92442.1"
FT                   /translation="MKILKSILNYIPLATFIIFVVTDGIISLTSALIFVISTIGLLINW
FT                   KRKKTEMKN"
FT   CDS             293737..294015
FT                   /transl_table=11
FT                   /locus_tag="ERE_03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92443"
FT                   /db_xref="InterPro:IPR025358"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN89"
FT                   /protein_id="CBK92443.1"
FT                   /translation="MKFPFYDAPNTATITCCHILENGEPILYVSHDEDDGMWQFLCGKA
FT                   HETDEAKLVSLKSVFDLDNSVGILKDMPCGYYAERKAQDDEWSVRKR"
FT   gap             294066..295372
FT                   /estimated_length=1307
FT   CDS             295396..295728
FT                   /transl_table=11
FT                   /locus_tag="ERE_03360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92444"
FT                   /db_xref="InterPro:IPR017259"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN90"
FT                   /protein_id="CBK92444.1"
FT                   /translation="MKLADLATGSDWIVWIVFAIFAVLSIILLSGHGSWFISGYNTASN
FT                   EEKEKYDEKKLCRTMGIGMSIIAILALTMGLFENILPAFFVYIALGIILVDVVVIIILG
FT                   NTLCRK"
FT   CDS             295781..295870
FT                   /transl_table=11
FT                   /locus_tag="ERE_03370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92445"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN91"
FT                   /protein_id="CBK92445.1"
FT                   /translation="MDKAFAEEINPEKFMETARLIRTELYGEG"
FT   CDS             296026..296616
FT                   /transl_table=11
FT                   /locus_tag="ERE_03380"
FT                   /product="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92446"
FT                   /db_xref="GOA:D4JN92"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN92"
FT                   /protein_id="CBK92446.1"
FT                   /translation="MTLETERLILRPWKEDDAESLYKYAKDPKVGPIAGWPVHTSVENS
FT                   REIIKSVLAADETYAVCLREDNVAIGSIGLITPAQSHTKAADDEIEIGYWIGVPYWGQG
FT                   LIPEAVRALQKHAFLDLGCSAMWCGYYDGNEKSKRCQEKCGFKYHHTEENKPCALMGDV
FT                   RTEHFTYLTKEQWSDSQDKVNFMGERTVKKHYW"
FT   CDS             297207..297635
FT                   /transl_table=11
FT                   /locus_tag="ERE_03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92447"
FT                   /db_xref="InterPro:IPR023127"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN93"
FT                   /protein_id="CBK92447.1"
FT                   /translation="MLIVPLIDHIAGYSIDSDWFINLSDLDNAVSVGEGVKSALDYIRN
FT                   SPLSSLTPNERKENAAWKKNTKYRSRVAFWKNNHYVRVKITEDNQYIIHSMKKSHKRQY
FT                   AYDEIIKEFILFADADAEEIGKAVIESFIESERYYNMG"
FT   CDS             297716..298132
FT                   /transl_table=11
FT                   /locus_tag="ERE_03410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92448"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN94"
FT                   /protein_id="CBK92448.1"
FT                   /translation="MGLFDRFKRTSKESLLGYLQNSISDNSSLEHIVSMFEEMCNMPLK
FT                   EDMILFETGTYSFTGKPMFNFSLVRQFPNDEEEYYQIHVDVLYIPTEENKDFQRTIWNE
FT                   DIEEDIFSYIKKTPEFKSCKDKVFSKIEIYLDET"
FT   CDS             298319..299017
FT                   /transl_table=11
FT                   /locus_tag="ERE_03420"
FT                   /product="Transglutaminase-like enzymes, putative cysteine
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92449"
FT                   /db_xref="GOA:D4JN95"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN95"
FT                   /protein_id="CBK92449.1"
FT                   /translation="MEKYLRETKMLDYSSKNIQRLIQERNWNDIEVFERLKSIYNFVRD
FT                   EILFGYNIDDNISASKVLADGYGQCNTKGTLFMALLRACNIPCRVHGFTIDKKLQKGAM
FT                   TGIVYKNAPQNVFHSWVEVNFEDKWYELEAFILDMEYLRKLQRKNSHCTGAFCGYGVAV
FT                   KDFKNPIIDFDRNNTYIQSEGINQDFGVYDSPDDLLKEHHQEMSVIKVFLYRNLGRHLM
FT                   NRNVNKIRNS"
FT   CDS             299046..299231
FT                   /transl_table=11
FT                   /locus_tag="ERE_03430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92450"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN96"
FT                   /protein_id="CBK92450.1"
FT                   /translation="MKKSISRIIGVIMLIVAIAFIIFALNHPEKSFLWSNRITWLLYGV
FT                   YFLVTIVLLIAPKMKK"
FT   CDS             299284..299430
FT                   /transl_table=11
FT                   /locus_tag="ERE_03440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92451"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN97"
FT                   /protein_id="CBK92451.1"
FT                   /translation="MEDNKSTRITFGSALAMVISYTTWKSVGWAIFHGLLSWVYVIYFL
FT                   LRY"
FT   CDS             299622..300095
FT                   /transl_table=11
FT                   /locus_tag="ERE_03450"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /function="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92452"
FT                   /db_xref="GOA:D4JN98"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN98"
FT                   /protein_id="CBK92452.1"
FT                   /translation="MNYLIRELKQDENKVLDTFLYEAIFIPEGVSAPPKDIINQPDLQV
FT                   YVKDFGKNKGDLCLVAQVSDKIVGAVWVRIMNDYGHIDNETPSFAISLLKEYRNYGIGT
FT                   ELMKQMLTKLKLEGYKQASLSVQKMNYAVRMYRKIGFEIVDENDEEYIMICKL"
FT   CDS             300166..300936
FT                   /transl_table=11
FT                   /locus_tag="ERE_03460"
FT                   /product="Predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92453"
FT                   /db_xref="GOA:D4JN99"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniProtKB/TrEMBL:D4JN99"
FT                   /protein_id="CBK92453.1"
FT                   /translation="MRIGAYQFAISGDVNENYKEIEKAIYLAKHKDVQLLIFPECSLTG
FT                   YPPRDISNSSCVNFNLVQSMCDRLQSVADQNDISFIVGTIFKEKEIYNRALLFQPNKQI
FT                   KSYDKRALWGWDNDNFAKGNSDGIVEIDGVVFGIRICFEIRFPEFFRELYKRNTDINVV
FT                   LFYDVADTDDKERYSMIRGHLQTRAVENVTTTISVNATSPFQTAPTMVFGKSGQCIKEC
FT                   VRNKPELLIYDFEKTVNDFGENGRTSISDSLINW"
FT   CDS             301961..302533
FT                   /transl_table=11
FT                   /locus_tag="ERE_03480"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92454"
FT                   /db_xref="GOA:D4JNA0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNA0"
FT                   /protein_id="CBK92454.1"
FT                   /translation="MNQKKIGSFLKELRKEMGITQEEFAEKLDVSSRTISRWETGANMP
FT                   DISLLVNIAEIFNVSIPEIINGERKSEIMEKEAKKVAEAMSDYATAEKAVLLKRVKVIS
FT                   IIGLVALIIGLIMESICYDSMIPIYESIKGICLGLGVGALVTMVLYTTGILEKIKNKKS
FT                   KQIKIVAGIGCAIMIICILVSLIVSII"
FT   gap             302621..303318
FT                   /estimated_length=698
FT   CDS             303362..304276
FT                   /transl_table=11
FT                   /locus_tag="ERE_03490"
FT                   /product="Predicted AAA-ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92455"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNA1"
FT                   /protein_id="CBK92455.1"
FT                   /translation="MNYNIAQTEDFEKYLNKYDVIHLDMQWILMDAGAPERISGYINKN
FT                   VISELADLYKDIDLRNQKTLYGALSVINSMTNNKFVIIIDEWDVLIRDEAANSSVQEEY
FT                   INFLRGMFKGSEPTKYIELAFLTGILPIKKLKTQSALNNFDEYTMLYAGRLSPYIGFTE
FT                   DEVRDICDRYGRDFTQVERWYDGYMLGDYHVYNPRAVVNYMLHGDLKSYWSETGSYDVI
FT                   VPLINLDFDGLKTAIIQMLSGGEIKVNTGSFMNDTVSFKNKDDVLTYLIHLGYLGFDQK
FT                   RSCAFIPNEEIRQDIENACRHNL"
FT   CDS             304377..304523
FT                   /transl_table=11
FT                   /locus_tag="ERE_03500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92456"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNA2"
FT                   /protein_id="CBK92456.1"
FT                   /translation="MSRRKRQKTGMINNENENNSMAQEPQTPQQTVDAQQVVIPQESER
FT                   ILT"
FT   CDS             305041..306051
FT                   /transl_table=11
FT                   /locus_tag="ERE_03520"
FT                   /product="Predicted phosphosugar isomerases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92457"
FT                   /db_xref="GOA:D4JNA3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR024713"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNA3"
FT                   /protein_id="CBK92457.1"
FT                   /translation="MIKFDEEEYRGNLTKQIAAINKGYEYAKEITADGYSNIFFVAVGG
FT                   TMAMMLHFAAIAKQKTKIPVYVEQAAELVVAGNTQLNKDSLVIMGSKSGDTKETVAAAK
FT                   WCKERGIRIASMVIDKESPLGQLTDYQLPLVVFKGVEYEYLSMFGLFYGLLNCNGDFPE
FT                   YDQFVEALAKLPDTLVDAQKKFDEPADAIAKKYFNADYMMWIGSGELWGEVYLFSMCIL
FT                   EEMQWIRTKSITSPEFFHGTLELVEKDMPVFLVKSAGVYRTLDERAEKFLKEHTDNLIV
FT                   IDVMDYMIPGLKPEFAPLVAPIISTAVLNGRLSKHIESYTGHDLDMRRYYRQFEY"
FT   CDS             306061..306711
FT                   /transl_table=11
FT                   /locus_tag="ERE_03530"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92458"
FT                   /db_xref="GOA:D4JNA4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNA4"
FT                   /protein_id="CBK92458.1"
FT                   /translation="MIEAVLFDMDGILIDSEREYDKAMREAITRYGHIITDEFLLRVRG
FT                   IPVEAFKKSLKLEFGRDFPVEKFRNDFKSIVWQNIRQYGMPVKNGVYQLIQYLEVNNIR
FT                   YAVATSNDRAMALELLEAADLRGVFEYMVCGDEVEHGKPFPDIYQKAADMLGVNIKHTL
FT                   VIEDSYNGIRAGHAAGANVIMVPDLVQPTDEIRQMTDYVVSDLGKVISCISNF"
FT   CDS             complement(306698..307426)
FT                   /transl_table=11
FT                   /locus_tag="ERE_03540"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92459"
FT                   /db_xref="GOA:D4JNA5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNA5"
FT                   /protein_id="CBK92459.1"
FT                   /translation="MNHYLHAKADDAAEAIENYISMHNLNPHDRIPSERAMAEELGINR
FT                   TTCREALKRLENEHILYSIVGSGTYVAPPKLRTSIGMGFSLDAYCEANGFKRSNKLIYC
FT                   YQTLATDYISKILGLSPYSPIYIIKRLRFINQKPAMIETTHLSEAMFPELLRKFKENET
FT                   QSLYALMKNDYNIIPTHHSYKVSMNICDIDNAVLLGIETNSPLLNFSIISKDSNNNVIE
FT                   YCQSLRRIDRCCINASFKNY"
FT   CDS             complement(307436..308131)
FT                   /transl_table=11
FT                   /locus_tag="ERE_03550"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92460"
FT                   /db_xref="GOA:D4JNA6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNA6"
FT                   /protein_id="CBK92460.1"
FT                   /translation="MDSHSSKYIYDTLKGDIENNLYSFGSALPSERTLAEKYFVSRTTV
FT                   RNAIEQLVHDGLLYKIQGKGTYVSMPKLLATNSVTSTRKYLKDHHLKPSTRIITSGIRN
FT                   AGYKYSNIFNISESDQLFFVYRQRLGNKIPYSVEYTFLPFAYVPNAQSYNFAKESLYDC
FT                   FNDNNIIVDHTVQTIDLVKIFKPQSDILQQPDGSASFKRVNTVYDIHNRVVEYTLSYSL
FT                   ADKFKFVFD"
FT   CDS             308240..308659
FT                   /transl_table=11
FT                   /locus_tag="ERE_03560"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92461"
FT                   /db_xref="GOA:D4JNA7"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNA7"
FT                   /protein_id="CBK92461.1"
FT                   /translation="MVKIMLASHGNLAAGMLSSAEMVFGKQDNVSVICAYVDGEDDVST
FT                   RIKGFIDSIAPDDSWIIFTDLFGGSVNNEFMKYISNPQIRLIAGMNLALVITAMSISEM
FT                   KNNAAEVEEELLGIADSVINFCSRTGIDSLEDDEF"
FT   CDS             308677..309147
FT                   /transl_table=11
FT                   /locus_tag="ERE_03570"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92462"
FT                   /db_xref="GOA:D4JNA8"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNA8"
FT                   /protein_id="CBK92462.1"
FT                   /translation="MIVNVRVDHRLLHGQVAMAWNQVLGSDCILIANDSVPNDEIRKAG
FT                   IKLAKPANTKLVIKNMDASVEALVSGVTDKYKLFIVVESIADVYKLCKETGMIDKITLG
FT                   GVKSREGTRQISKAVFTTPKEEELLKELITDGVTVEIRQVPSDSVIYAKDVL"
FT   CDS             309159..309935
FT                   /transl_table=11
FT                   /locus_tag="ERE_03580"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92463"
FT                   /db_xref="GOA:D4JNA9"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNA9"
FT                   /protein_id="CBK92463.1"
FT                   /translation="MILKAILLGLVAMLGHTNFLFGTNLLDRPLIMCTLTGLVMGDLKS
FT                   GIIIGAMMELAFIGAFSVGASLPPDMISGGVLGAALTLAAGNDPEVALTIGVPIASLAL
FT                   LMKNACKIFILPIFVHKADDYAVKGNSKGVARMHMLGGFLYLNLPYGIFVFLAFLLGNT
FT                   VIQSVLDAIPQFVKSGLTIATGLMPALGFAVLASMIINKKNWYFLLLGFLISAYMGMSV
FT                   TGVALFATVIALIIVNMQNNQVITATEMGGDEDDDF"
FT   CDS             309922..310743
FT                   /transl_table=11
FT                   /locus_tag="ERE_03590"
FT                   /product="PTS system IID component, Man family (TC 4.A.6)"
FT                   /function="PTS system IID component, Man family (TC 4.A.6)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92464"
FT                   /db_xref="GOA:D4JNB0"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNB0"
FT                   /protein_id="CBK92464.1"
FT                   /translation="MTTSKLITKRDLRKVFFRSFPMEWTWNYEKQQNLGYTYALIPIIE
FT                   KLYKDKPEEKAAALQRHLEFFNTTPHMVTLILGISTAMEEENALDENFDTSSINSVKAG
FT                   LMGPLAGIGDSFMWGTLRIIATGIGTSLAMNGNILGPILFFLLFNIPHVILRYICMMGG
FT                   YKFGAGFLSKIAAGGLMEKLTYAASILGLMSIGSMIATMVTVNIPLKYTNGDTSVVIAD
FT                   VINGIVPCLLPLLFTGFIYWLVTKKKMKTTWALILIFIIGILGSLTGILGV"
FT   CDS             310820..311932
FT                   /transl_table=11
FT                   /locus_tag="ERE_03600"
FT                   /product="Glucosamine 6-phosphate synthetase, contains
FT                   amidotransferase and phosphosugar isomerase domains"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92465"
FT                   /db_xref="GOA:D4JNB1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNB1"
FT                   /protein_id="CBK92465.1"
FT                   /translation="MAKTMFDYINSSTELIEENLKKRIALTETMVNEYIKGPYHNITIV
FT                   ASGSSNNAAQCARLYMEKVLKCKVTVISPFEFIHAEHSVASDEMVIAVSQSGYSVNTME
FT                   ALKFINDKLNRKAIVLTGDLNSDIVSVADMAVDFGVGEETVGYVTKGVIALSLYLMLFA
FT                   LEAAKMCKIIGRNEYDTWVREFEKVSGAHEKMIVATKKFYADNIKALTSLQTVYICSVG
FT                   ANMGTAMEGALKVGETIQVPGIAYELEEYIHGPNLQLTPNYTVFFIDGGLASDRTQEIF
FT                   EATGVITDKTYMLTNKKGLEGKNIINPDFEINELITPLAFLPFFQILSYQITEDTHKWK
FT                   KHPLMDEMKRLAGAKTLNYESSPLRKDMPQ"
FT   CDS             312106..313227
FT                   /transl_table=11
FT                   /locus_tag="ERE_03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92466"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNB2"
FT                   /protein_id="CBK92466.1"
FT                   /translation="MSRRKRQKTGMINNEKENNSMTQEPQTPQQTVDEQQMVIPQESER
FT                   IQRAEWIHEQVKLQREAEDEAWEKIMEEQKLLTERRRSIDADINSNRELKRYHEDCMED
FT                   ITDQVYSLHGISVDKLEGIKEYRNALFRGEAFIVFCISVIMAAIVAYAYGPTSQLCLYV
FT                   LMCVGAEGALLSQKRKNILFFIPLILIAAEMAGYKLYPQYLEYVTMAGEALALLLMMIG
FT                   TVGYFVHNPYRKDRKNIKAAKSDLKELHKVAKKSVKKNKKSRIKNEAKEAKLAAKQAKR
FT                   ETKAAIKEQKRQNKLAKKQAKYELKEKKRQQKSERVELKHELKKTQLMDKVRRFTPKEQ
FT                   NSESTPSAESIDNNITENNIIENNIIDIERKVN"
FT   CDS             complement(313241..315088)
FT                   /transl_table=11
FT                   /locus_tag="ERE_03620"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92467"
FT                   /db_xref="GOA:D4JNB3"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNB3"
FT                   /protein_id="CBK92467.1"
FT                   /translation="MCGIAGFCNFKEDFEENTDYWNFRLEKMRAVLAHRGNDARGRYLK
FT                   KHIGLSHSRLAIRDILCGDQPMTRTHNGYEYTICYNGEIYNTDELIPELSENGFVCSTT
FT                   SDTEVILYAYIHWGADFVNRLNGIFAFAIWDAAKNRLLLYRDRVGVKPLFYAIRGDSLV
FT                   FGSEPKACFAHPAVKPELDKQGLQELLAIGPAHTSGLSLFKDLFEVLPGHFMIYSQNGL
FT                   HDETYWELTSREHTESYRDTVAHTRFLVEDAIKRQMVSDVPVCTFLSGGIDSSIVTAIA
FT                   ANYMNTRGKTLNTFSFDFKDNDRYFKANAFQPERDLPYVNRMLEEYETAHSYLECDENS
FT                   LFKALFAAVDAKDMPGMTDVDSSLLYFCSLVSRKNKVALTGECADEIFGGYPWFYRKEL
FT                   LERYGFPWSSDVAPRLALLRDDVGLELDLSGYQAFRYEESRSKAPLLYGEAGEDESRRI
FT                   IGYLNIKWFMQTLLDRMDRTSMYSELEARVPFADHRIIEYVFNVPWHMKYQNGVEKTLL
FT                   RDAFSDVLPPELLHRKKSPYPKTYHPGYEALLINGMEEILDSPNAPVRTLIDTDKTREF
FT                   LKAPAEYGSPWFGQLMAGPQLIAYFIQINYWMEKYQLSA"
FT   CDS             315374..316090
FT                   /transl_table=11
FT                   /locus_tag="ERE_03630"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92468"
FT                   /db_xref="GOA:D4JNB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNB4"
FT                   /protein_id="CBK92468.1"
FT                   /translation="MSEEERKFLEIVDLKKGFGSGETRQEVLRGMNFSVAKGEFCVLLG
FT                   PSGSGKSTLLNIIGGIDSADSGYISINGDKLKDMSEKKLTQYRRKHLGYVFQMYNLIAN
FT                   LNVKENIEVGAYLSDNALDIDELLHTLGLYEHRYKLPNQLSGGQQQRVSIGRAIVKNPD
FT                   ILLCDEPTGALDYNTSKEILKLIEDVNKKYGNTIIMVTHNEAIKNMADHVIKLRDGAVR
FT                   HNDINTNKVSAEELEW"
FT   CDS             316105..318474
FT                   /transl_table=11
FT                   /locus_tag="ERE_03640"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92469"
FT                   /db_xref="GOA:D4JNB5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNB5"
FT                   /protein_id="CBK92469.1"
FT                   /translation="MSRKKIKNPLIKRILKEIIGDWKKYLVVFLFLVLTIGFVSGMYVA
FT                   NDSMLTSADEGVSKYKQEDGHFELKDKADSELVTAIESGEVKTAPDEKDSDSSKTPVTL
FT                   YENFYRNETEDYDADGKKDGTIRVYAKTEDINLACLIEGSFPQNEDEIAVDRMHADNVG
FT                   MKVGDTIKVSGKEFKVSGLIAYVNYSTLHEKKTDMMFDAIKFDVAMVTKEGFERLNKSI
FT                   HYTYAWKYEDEPADDIEQKEKSDNFLEAMVSQVMAAGNEVEDYTPRYSNPAINFATDDM
FT                   GSDKAMGGVLLDILIVIIAFIFAVTISNTIANESSAIGTLRASGYTKGELIRHYLSMPV
FT                   IVTFLAAVVGNILGYTVFKDVVVGMYYNSYSLPTYHTIWNPGAFIKTTLAPVIIMLVVN
FT                   LIVIIRMMQHTPLQFLRHDLKKTKRKKAMRLPHWSFMSRFRLRIMFQNVANYLILFVGI
FT                   FFIMVMLAMAVGMPDTLDYYKKNTDSMMFAKYQYVLKSYVDADGNVLETDNSDAEKFDM
FT                   TSLLRRTDEFDEEVSVYGVETDSAYVKLKDMDSLKDNEVYISDSFADKYGIKPGDTIKL
FT                   DAQYEKKTYKFKVKGTYDKSQSIAVFMPIEHFADTFDFEDGRISGFLSDTKIKDIDESN
FT                   IATIITIRDITKMADQLDHSMGSYMQYFQVLCILLSAVMIYLLTKLIIEKNETAISMTK
FT                   ILGYDNREIAGLYLVSTSIVVVISDIISVVLGAKVMDIVWRIMLQTFSGWFSFHMTPVG
FT                   YVKMFAFVLIGYLIVTVFDFSRIKRIPMDMALKNVE"
FT   CDS             318653..320341
FT                   /transl_table=11
FT                   /locus_tag="ERE_03650"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92470"
FT                   /db_xref="GOA:D4JNB6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNB6"
FT                   /protein_id="CBK92470.1"
FT                   /translation="MEQSKTKKRGTFAAKIIVMVILAVIVSNVICMVFILESSKKQITD
FT                   STKHTMVDVINTTSKIVENEISNADTEDLDYDEYAKSLSDVKLEGMDSSYVYVVKNDGT
FT                   MLYHPTKEKVGQPVENAVIKGVVQQLQDGKKPGTTVVEYDFNGTTKYSAYTILNNENIL
FT                   VLTADESEALAGITTVTGVAVGIIAIVVLIAIIISFIMGRRLMRPLVKVSTIIEDVANG
FT                   NIEADFSVVKESNDEIGLIIEKMKELTQSLGSIVGKIRNSSDTMSSNSYELNDTSSQTL
FT                   AANNEISKAVEDVAEGSTGMAASISKINENLLEMSNETKDINASVDEIKNQTTAVQDSS
FT                   KIMNDKIKSMQDSSHKMDEGISAISKRIETVNTTVDKVSNIVSVIEEISSETNLLSLNA
FT                   SIEAARAGDAGKGFAVVAQEIRVLSDNTNTELENIKQIISSLVEECRYCVQASGTIVED
FT                   NAKQKEEIKAVLDEFGSLDEQIQKTAEKADEIEELVTAMIELNDDITKSSNSLTDVSAA
FT                   NAAATEEMNANIEELNAMMHGVSEMAEHMNNESDGLKEALSFFHN"
FT   CDS             320605..321105
FT                   /transl_table=11
FT                   /locus_tag="ERE_03660"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92471"
FT                   /db_xref="GOA:D4JNB7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNB7"
FT                   /protein_id="CBK92471.1"
FT                   /translation="MTDNFEFRSIHPDEVEQAIAIEQICFPPNEACSPKAMTERIAKVP
FT                   QLFLVAIDKSTGKLAGFLNGVATDEEKFRDEFFTDIDLCDENGKNVMLLGLDVLPEYRG
FT                   QGLARELVYRYSQREKANGRKKLFLTCLEQKVEMYKKFGLQDLGIADSTWGGEEWHEMV
FT                   LKV"
FT   CDS             321116..321439
FT                   /transl_table=11
FT                   /locus_tag="ERE_03670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92472"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNB8"
FT                   /protein_id="CBK92472.1"
FT                   /translation="MENKVSDNVIEKNYRECLKFNEINESGACNFDMATAKAALENLYE
FT                   LYKNGILTGRFTKDKDYVVRCADLVTLAEENKDSLFYDAWRVWFRYFVSMGYAGWNELW
FT                   EAI"
FT   CDS             321436..324459
FT                   /transl_table=11
FT                   /locus_tag="ERE_03680"
FT                   /product="DNA or RNA helicases of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92473"
FT                   /db_xref="GOA:D4JNB9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNB9"
FT                   /protein_id="CBK92473.1"
FT                   /translation="MNKQKIAELRAGLETGFINGGYNSSLAYQPQFLSNNHKEGKKVLS
FT                   SIEDELMSCDKFQISVAFITMGGITPLLQTLKELEKNGIPGEILTTNYLNFSEPKALEK
FT                   LHGLSNITLKMYDVEKAAEGFHTKGYIFKKEEIYRIIIGSSNMTSAALTSNREWNTKVV
FT                   STEQGEVAKQIVEEYNELWNSRYAISFDNFYEEYKERYQIIKRQREIAKSEETPSIEKY
FT                   RLKPNAMQVGFITNLRKILEKGEDRALLISATGTGKTYASAFAMRELGFKRVLFLVHRG
FT                   QLARQTKKSYEKIFDKSVSMGLVGAGYSDYDRDYVFATVQTLNRDEHLRKYAPDDFDCI
FT                   ILDEAHHSSANTYQKVMNYFTPKLWLGMTATPDKRDDDIDGKNIYQIFNYQIAYEIRLQ
FT                   QAMEENMLCPFHYFGITDVSLLGDKEIKSKKLTESSFNQLVGDERVKHIIEQANYFGHS
FT                   GDRVKGLIFCSRIDESVELSNKFNQTINPETGRFFRTIALNGDATEEERQRAFERLAMD
FT                   EDENMQPLDYIFSVEILNEGVDIMEVNQVIMLRPTESPIVFIQQLGRGLRKANGKEYVV
FT                   ILDFIGNYNNNFMIPVALSGDRSYNADTIRKYVISGNNTIPGASTVHFDEIAKDRIFAS
FT                   IDKIKGMKSIIRESYVSLKNRLGRVPYLLDFYENGEVDPLVIIKEYKTYQAFLEAVEKE
FT                   LYIGRLNEQEKTTLEYLSKTILSGARPFELEILRQLMKKPSISINEIREIFIRRYDYKV
FT                   NMQSIDNAADVLQGKFVSKDDEYKRFCRIDILEEDNNNIFHRMNNFTTRLQNEEFKKQI
FT                   DDIIEVGLKRYHDKYQSSLKNDSPFVLYEKYSRRDVSLLMNCGRDLSSTMYGMKRIDDD
FT                   VFIFVTYHKEESTDEQKNYVDGKPDYADAFEDNMIFRWDSQIGRGVDSSYVSDVVNTKR
FT                   KHLLVKKSDAESNFYYMGEFDIVDVCAARKRDNNGKERDITKFEMKMHHPVREDLLRYL
FT                   QSNLQQGLQNNTQEFKAI"
FT   CDS             324456..324860
FT                   /transl_table=11
FT                   /locus_tag="ERE_03690"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92474"
FT                   /db_xref="GOA:D4JNC0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNC0"
FT                   /protein_id="CBK92474.1"
FT                   /translation="MKTIRVVAAVIRAVNNENKPVIFATQRGYGEFKGGWEFPGGKIES
FT                   GETPQQALKREIMEELDTEIAVGELIDTIEYDYPNFHLSMDCFWCEVIRGELILKEAED
FT                   AKWLTKEHLADVKWLPADVTLIENIREAMY"
FT   CDS             325031..325168
FT                   /transl_table=11
FT                   /locus_tag="ERE_03700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92475"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNC1"
FT                   /protein_id="CBK92475.1"
FT                   /translation="MQDGRGVEISTGQAPGERGGHACKIAKWSRGDLKIRGMKMRHSNI
FT                   "
FT   CDS             325246..325539
FT                   /transl_table=11
FT                   /locus_tag="ERE_03710"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92476"
FT                   /db_xref="GOA:D4JNC2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNC2"
FT                   /protein_id="CBK92476.1"
FT                   /translation="MNELLGSRIKALRIAKNLTQEQVADQIGVSRQKYARVESGTNSIT
FT                   LDILSKVAEILDVTVGDITRVLDETPVVAYRTGGTESSSEKIFDMLDLFLCQ"
FT   CDS             325594..326412
FT                   /transl_table=11
FT                   /locus_tag="ERE_03720"
FT                   /product="Predicted Zn peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92477"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNC3"
FT                   /protein_id="CBK92477.1"
FT                   /translation="MQESRRKDIRRTAAVVRENCKVSRYGIIDLFKECARLGYKLIRYP
FT                   LGENADLGFTIKKDQDIVIFTNSSIRLSREIFTLAHELGHAVLHMEADSSFIDDSITIA
FT                   DRSTDEREQEANYFAACLLMPDDEVDRFFDLELSDIEKNGLTAIDIAKIMSEFNVSFDM
FT                   ALNRLDSLGKITGNQKALLDCQRNKTRVGNLLKSAGGNARLNQASEEIDIPFEYIDYVI
FT                   YNYNHDAIPVETLEKVLECYQLSMDDISDRLIEKKHEEDDLDDLIGGLED"
FT   CDS             327130..327177
FT                   /transl_table=11
FT                   /locus_tag="ERE_03740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92478"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNC4"
FT                   /protein_id="CBK92478.1"
FT                   /translation="MAGRKPKPTAVKPVG"
FT   CDS             327177..327497
FT                   /transl_table=11
FT                   /locus_tag="ERE_03750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92479"
FT                   /db_xref="GOA:D4JNC5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNC5"
FT                   /protein_id="CBK92479.1"
FT                   /translation="MRLTGFSYVGRIENLRDLVYYKLYGKDNFWLPFEVSDMVKNNIEL
FT                   DVKTKCIEQGKTQVNLAEEIETTKAYVNRVIKKQDGVVNQTFVKMMEALGYDIELRYVE
FT                   RE"
FT   CDS             327554..328639
FT                   /transl_table=11
FT                   /locus_tag="ERE_03760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92480"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNC6"
FT                   /protein_id="CBK92480.1"
FT                   /translation="MEDGAKENTALNIQKPLEILVTDEDKHGTDIACMSDFFGIYIEQL
FT                   SAELRNQVMRGVVEKIPAADVQILGELVHGVDVLLSGKYGYIPDFDSLPNDVKNKLKKG
FT                   IYTLGESRQVEDNVRAVVLDENGTRIKDVTLKRVLNTPDTLEMSRSITSQVQMRQIASK
FT                   LEEIAETQSYLIEMERNNNIIKPFLNARDLILRAQNAKTIDERKHYMIEASKELNDVIN
FT                   ASRLDLKTSSEHLAKLTRFPILRNSSQIKNYMGYVAQDLQLTTKYVGVQMHVLDYLGDY
FT                   ETANEVLSSYQMMLSDFADRPINKKNQSTAILMQNNSTYSEQTQDYWLNFRSNIKETIK
FT                   TGSLLQDREMIVVSIEDIKDA"
FT   CDS             328632..328832
FT                   /transl_table=11
FT                   /locus_tag="ERE_03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92481"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNC7"
FT                   /protein_id="CBK92481.1"
FT                   /translation="MRENKKCWACGKSLTGGEKLGLCDGCLNKYGTPAAAAAALGIGIG
FT                   AKFFIKNGGKSVKNALKILNK"
FT   CDS             330130..333168
FT                   /transl_table=11
FT                   /locus_tag="ERE_03790"
FT                   /product="Protein of unknown function (DUF2726)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92482"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JNC8"
FT                   /protein_id="CBK92482.1"
FT                   /translation="MNQICRDIFRAIHEGKWLKIEYRNKADQVTKYWIGIRDLDPRSRT
FT                   MKVDGLHLGQLTIGEYDRIFIDSILSTEIIEGTYCPENKILVEDIEMHPERYKNIFDSS
FT                   ANLKILNYLEICNKLDTTPYITDYDLIHYIDRDRINGGMYQLTDQQFREVVAQFQYFSS
FT                   REKRKSGSLKVKRLAINVLSINTNKGLYVLAYRNLNLDVKNHIFKPDEEITVCTQFSID
FT                   GKQENARKFLDADEYELLEDFEKNLEKIKDAITEHGGNKSIVDDMPYVIGLGMDVVLNL
FT                   HEEYKAIMDMFEADNVTYPIKAFFGELLERPRRTKAYPIALINKNINLDQLLAINNAMK
FT                   YPLAYIQGPPGTGKTNTIINTIVTAFFNNVTVLFASYNNVPIDNVFEKLSSMKYRGKTI
FT                   PFPVLRLGNTEKVMEAIKYINELRTQVQSLQIFASTLDKRKDDRIDRAKRLSARLKEYE
FT                   EILDLKERKETLTHLMKYQEHMKNTMKLLPFQTDLQGYQMQKLDKRIAAIGEISDADAM
FT                   QLLDRNEDEFYQYLFYTSARYIKALEEPKFQELRQILDSDETPEKLVNEFNKYMRKSEN
FT                   VRKLQRVFPIIITTCISAHKIGEPEPLFDMTIMDEASQCNVAISLVPIIRGEKLMLVGD
FT                   PQQLNPVILLGELTNKKLRRRYHVSDEYDYRENSIYKTYLACDAVSDEVLLRNHYRCNK
FT                   EIIGFNNKKYYNSKLKIQSKSNEPEPLVYMDVKSDNTQIKNTSPAEVEEVVEYALLNKD
FT                   KSIAVITPFVNQKQLIENAIKQNKLSNLVCGTVHAFQGDEKDVVLFSTAISERTSSGTY
FT                   NWLKNNKELINVATSRAKEKLVLLTNGKELERLHAGQADDDLYELAQYIKTNGHSKITE
FT                   KHISSRALGIQPFSTATENAFLENLTHALENIWLSQSKYVIHKEVAISQVFRDNITYDD
FT                   LFYMGRFDFVVYEKQGRSELPILAIELDGKEHFEDAVVKERDRKKNAICKAHNMEIIRV
FT                   ENSYARRYNHIKGILMDYFSRVH"
FT   CDS             333557..334162
FT                   /transl_table=11
FT                   /locus_tag="ERE_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92483"
FT                   /db_xref="InterPro:IPR025911"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGJ9"
FT                   /protein_id="CBK92483.1"
FT                   /translation="MELYEVTVEYVKYLRKFEPTKIMSNADGKEQRKFLGVIVQKNGYK
FT                   YVIPLSSPKYKKDYKIRDYQGENLPEDFSFVAYADRIILLKDTNVPVVYMYEKKESGEI
FT                   DFFGKIQCNNMIPAPESELTKINIEGITDIAYKTLLQKQVQFIRKNQDDILKKHANVVY
FT                   VNRKKGRMDIGYIKNATPDFELLEAKCDEWIRWHENKE"
FT   CDS             334218..334322
FT                   /transl_table=11
FT                   /locus_tag="ERE_03810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92484"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGK0"
FT                   /protein_id="CBK92484.1"
FT                   /translation="MSWIRKLLPADVTLIDKIGEALYETQDSKEYGAI"
FT   CDS             334309..334554
FT                   /transl_table=11
FT                   /locus_tag="ERE_03820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92485"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGK1"
FT                   /protein_id="CBK92485.1"
FT                   /translation="MELYDILIRRGYPEPFCDEITKNLNTDWTAQRMIGYLSHYKKLPM
FT                   EEIADEMLAILNDRNRIMQKHELEETNARWNEYLNR"
FT   CDS             334723..334992
FT                   /transl_table=11
FT                   /locus_tag="ERE_03830"
FT                   /product="Protein of unknown function (FYDLN_acid)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92486"
FT                   /db_xref="InterPro:IPR012644"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGK2"
FT                   /protein_id="CBK92486.1"
FT                   /translation="MYYVPDGTEQCGYYECKECGSRFLNLKIAPTLVCPYCGEEADMEI
FT                   GPDEEMPKVVESAKLIQMVRGVEEVEKMDKLLSLVVTGGDFSWI"
FT   CDS             complement(335109..335570)
FT                   /transl_table=11
FT                   /locus_tag="ERE_03840"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92487"
FT                   /db_xref="GOA:D4JGK3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003562"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGK3"
FT                   /protein_id="CBK92487.1"
FT                   /translation="MKITTLCYIEHDGQYLMLHRIKKENDINEGKWIGVGGHAENGESP
FT                   EECLLREVKEETGLTLTSYRFRALITFISDKQEPELMCLFTADEFSGKLITCNEGDLKW
FT                   VDKTIVPTLPTWEGDAIFLKLLLENEENFFTLKLVYEGESLVDQKLEIY"
FT   CDS             335874..337862
FT                   /transl_table=11
FT                   /locus_tag="ERE_03850"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92488"
FT                   /db_xref="GOA:D4JGK4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGK4"
FT                   /protein_id="CBK92488.1"
FT                   /translation="MAKKVTIKDIADMAGVSIATVSHVINRTRYVSPDLVEKIENIIIE
FT                   TGYHKKIEEKERRLKVGRQSEIVAVIPNVESTIYRDMVGYLKKYVSIQGYQFYIAITDN
FT                   DIKEEAQVLEGLIQNKKTAGIIHVPVSDVAADYKKLIESGIPFVCMERNILGDGIDAVE
FT                   FRDREAIFKGTDYLLECGHKNILFLRESLKSTTRDERTRGFLLALEEHGINTNDANISD
FT                   INIESGADNCILEIQKAMRRYMPTAIMAGGNRITLYLMKTMRDRGIECPEEISVVGFGD
FT                   EGWSELTYPPLTILKRDVEGLSRRAVNMLFEKINTGHVIEQDYYADVELIIRKSTRMLD
FT                   NGPFGEEAATPESIVITKEEKSRLRAGNFRVAISFHYTGTSWAELHEKGIRDELEQYGI
FT                   DIISVTDAHFDASLQNAQLEGIRLQKPDAVIAIPADDKETKEQFRELAKVSKLVFLSNV
FT                   PENMEKNSYVCCVSVNEIENGVNVGRMMGEYCKGKHVEAGFIIHGAVFYGTRARDEAVE
FT                   KIISEQYKNIDIKAIRGFGEIENAYQVCKDMITENPQIKVLYVSWDRPALLAIKALKEM
FT                   HREDIAIFTTDLDYKIAQFMESGIVKGLSTQRPYEQGRTAAHVVAKSLLSNDVPKYVGV
FT                   QPYVVDAKQLGRAWKDIFHEGMPEEIK"
FT   CDS             338137..339132
FT                   /transl_table=11
FT                   /locus_tag="ERE_03860"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92489"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGK5"
FT                   /protein_id="CBK92489.1"
FT                   /translation="MAKIKKLLALGLCLCMTAGITVGCGDSKSSKNSTDSGKNTNDGLS
FT                   FAFCTNTLNNTFQSSIDSKLKELCDKDGISYTCLDPDYDLNKQLSQLSDVANNGYDAVF
FT                   VIPVDSAGITSGLAEISEAGIPIFNVDTAVIDDDLESFVTQYVGTNAYMAGQLVGEQMV
FT                   KDHPDGGNIAILDFPSNESCVDRVNGFLDGLGDSKDKFKIVAQQDGGAALDKSMELAED
FT                   IITASPDMDAFFCINDPSALGAAAAIKAANKTGKIGVYSIDASPDGKQALLDDEFTAVA
FT                   CQVPVQIADYSFKEAVKYVNGDTKIDEKKVYLDSHLVSKDEAEKTLKEWQ"
FT   CDS             339148..340647
FT                   /transl_table=11
FT                   /locus_tag="ERE_03870"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92490"
FT                   /db_xref="GOA:D4JGK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGK6"
FT                   /protein_id="CBK92490.1"
FT                   /translation="MGQTVLEMTGIKKSFAGIYALNGIDFSLELGEVHALLGENGAGKS
FT                   TLIKVLGGIYQPDCGLIKVNGKEVKIDGVPAARANGIGIIHQEIVLVPYLTVAQNLFLG
FT                   REIRTRLGTLDEAEMNRRAADMISALGVNIKAETVVEKLTIAQQQMVEIVKAVSFNGKI
FT                   IVMDEPTSSLSNEEVEQLFGIIENLRKKKVSIIYISHRMEELFRISDRITVIRDGTYVG
FT                   TKKTVETNANELVAMMVGRDLDNFYVRDYCDVEHAPIALEVKNLSRQGTFEDISFSVHK
FT                   GEILGFAGLVGAGRSEIMEAVFGARPYDAGQIFLSGDEVHFKNPMQAIKSGIALVPEDR
FT                   KKQGLVLGNSVAFNLTLSSLRFCMNGIAVSEKKRDSIIEHYSKRLRIKAASPEIEAGSL
FT                   SGGNQQKVVLGKWLATKPDVLILDEPTRGVDVNAKYEIYTVINELAKEGIAIIMVSSEL
FT                   PEIINMCDNVCVIRAGKLVGKLGKDQMNQEEIMKYAAGGVE"
FT   CDS             340649..341662
FT                   /transl_table=11
FT                   /locus_tag="ERE_03880"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92491"
FT                   /db_xref="GOA:D4JGK7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGK7"
FT                   /protein_id="CBK92491.1"
FT                   /translation="MSEKKREVNAFGKRNPFTSIIKGNIGIIAVLIIMCVIVSIATDKF
FT                   LTTNNIISVLRQISINTYIALGMTLVIILGHIDLSVGSIVAMSGTLTVGLTVNQGMPLI
FT                   VAIIIGLAVGTLAGFISGFIVSHFKVPAFIITMAMMNIASGIAYVYTGGQSTRITDKMF
FT                   IAIGTGYLFNVIPLPVVYMVILIAIFSFLLSKTKFGTYVYAIGGNREAARLSGVPIKKI
FT                   EIIVFTLSGALAAFAGLVLCSRMYSGQPSVGSGYELDAIAACVLGGTSMTGGKGRISGT
FT                   VFGAMVIGIISNGLNLIGVSSYWQLIIKGLIIACAVLLDCQKDKIALLKNKVRAAK"
FT   CDS             341713..343191
FT                   /transl_table=11
FT                   /locus_tag="ERE_03890"
FT                   /product="Beta-fructosidases (levanase/invertase)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92492"
FT                   /db_xref="GOA:D4JGK8"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGK8"
FT                   /protein_id="CBK92492.1"
FT                   /translation="MEIFRKMSFADSTGDAIPFYHEGKYHIFSLTSPPGTTVYPERLRT
FT                   TWSHSISDDLVHWQELPTALYPGEGDEPDASGVWTGSVIYGEGQYHAFYTGYCLTAEFQ
FT                   QTICHATSDDGITWTKDIANPVITPMTELYEKLDWRDPYVFYNEEDENYWILISARRLD
FT                   MPVTRRGCIVLYRSKNLKDWTYYGPIYSPGHTNCPECPEMYKMGGHWYLSYSRFSEFVN
FT                   TIYRVSESPFGPWRKPKKDGIGGRRFYAAKSMQNDDGRRFYFGWAHDRAEQSDKGEWYW
FT                   GGTFCIPHEVVPTENGELNVKLPCEYEHIFDKAVNWKYISVLGNAKDYGEKTITLNALE
FT                   SCSYGFLRHTEESYMLTCKIVPRETYDTFGILLKSDKEASGCLFLEFDKAMQRVSFLNL
FT                   PMGVDPFWVQSCQAVPPATEPGPDGVRVCEKTMQIEDGRAIDVKIIVDHDMIEAFIDEQ
FT                   IAFTYRIYAKPEFETGIIAQDSNVEFYNLSISGK"
FT   CDS             343213..344181
FT                   /transl_table=11
FT                   /locus_tag="ERE_03900"
FT                   /product="Sugar kinases, ribokinase family"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92493"
FT                   /db_xref="GOA:D4JGK9"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGK9"
FT                   /protein_id="CBK92493.1"
FT                   /translation="MEKEYDIVAMGELLIDFTPAGVSETGMCLYERNPGGAPVNMLTAA
FT                   AKAGLRTAFIGKVGNDMHGKFLIEAVENQNINSDGIILDDNVFTTLAFVNLTKDGERSF
FT                   AFARKPGADTMIGYKEVDTQILQNTKVFHVGSLSLTDEPARSTTFQAVKCAKNAGAVIS
FT                   YDPNYRAPLWNDEKTAIERMRSMLPFADMIKLSDEETALLTPYENPDEAANYLLDHGIK
FT                   IVAVTLGKEGVLICNRKDHQKVSGFSSQVVDTTGAGDSFWGGFMSQFVKSKLNPEDCSI
FT                   EELKKFARYGNAVASLCIEKKGGILSIPEEKETFKRLQLSV"
FT   CDS             344582..345217
FT                   /transl_table=11
FT                   /locus_tag="ERE_03920"
FT                   /product="Uncharacterised ACR, YkgG family COG1556."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92494"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR009501"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGL0"
FT                   /protein_id="CBK92494.1"
FT                   /translation="MDVRKMRNELLGKRLVAALESRNMEAYYVETKEEAVKKALELIPK
FT                   GSSINMGGATSVKECGLYEALSNGEYQFYDRDKVSTQEEKQEIALKAFTSDYFLGSVNA
FT                   MSEDGVFINIDGNANRVAAYAYGPKHVLLIVGMNKVVKTEADAMSRARNEAAPINAQRF
FT                   GIDTPCSKNGTCFDCKSPQCICCQILTTRFSRVKGRFQIILVDENLGF"
FT   CDS             345249..345476
FT                   /transl_table=11
FT                   /locus_tag="ERE_03930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92495"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGL1"
FT                   /protein_id="CBK92495.1"
FT                   /translation="MGYLISETTKEEREAIVAESLGNIEATCDGCMAGLAEMYQDYIDG
FT                   KKELREINMEFNARYVHGEDMPGRSGCGYK"
FT   gap             345505..345886
FT                   /estimated_length=382
FT   CDS             complement(345901..346695)
FT                   /transl_table=11
FT                   /locus_tag="ERE_03940"
FT                   /product="ABC-type uncharacterized transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92496"
FT                   /db_xref="GOA:D4JGL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGL2"
FT                   /protein_id="CBK92496.1"
FT                   /translation="MLEIRNVHKTFNPGTINEKHALNGVNLKLEEGDFVTVIGGNGAGK
FT                   STMLNAVAGTWPVDDGSILIDGVDVTGLPEFKRASFLGRVFQDPMTGTTATMQIDENLA
FT                   LAARRGKRRGLGWGITKAEKEHFHELLKELDLGLEDRMTSKVGLLSGGQRQAVTLLMAS
FT                   LQKPKVLLLDEHTAALDPKTAAKVLTLTDKIIKENSLTAMMVTHNMRDAIAHGNRLIMM
FT                   NNGQVVLNISGEEKKNLTVEDLLMKFEEVSGEEFASDKALLG"
FT   CDS             complement(346696..347658)
FT                   /transl_table=11
FT                   /locus_tag="ERE_03950"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92497"
FT                   /db_xref="GOA:D4JGL3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGL3"
FT                   /protein_id="CBK92497.1"
FT                   /translation="MNYFATLNPVAFTNALPGNIAQGLIWGIMALGVYITFRLLDFADL
FT                   TVDGSFATGGAVTVMMTINGYNIWVSLLCACIAGLLAGLCTGLLHTKLGIPPILAGILT
FT                   QIALYSINLNIMQRHANQALSADKYNLVLSSRNLTHAIIVGVIFSVVIIAVLYWYFGTE
FT                   QGSAIRATGCNPAMSKAQGINIDNMKLIGLALSNAIVALSGGLLSQYSGFSDVNMGRGG
FT                   IVIGLAAVIIGEVLGDAILGKHMNFMGKLIFVIFGGIVYYIVIGIVLWLQMPSDDLKLF
FT                   TAIIVAIFLAVPYLKGKSKASFKKAGKRSAAALNAKEGK"
FT   CDS             complement(347697..348701)
FT                   /transl_table=11
FT                   /locus_tag="ERE_03960"
FT                   /product="ABC-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92498"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGL4"
FT                   /protein_id="CBK92498.1"
FT                   /translation="MKKRSKILASLVLAGTMVLGLAGCGDSGSANGGTQSGKNSGAKYQ
FT                   VGICQLVQHEALDAATKGFKDALKDKLGDDVSFDEQNAAGDASTCSTICTKFVTNDYDL
FT                   ILGNATAALQAASAATDSIPILGTSITDYATALDMSDWSGTTGKNISGTTDLAPLDEQA
FT                   KCIKELFPDAKNIGIIYCSSEPNSIYQSTTITKYLEDEGYTVKEYTFSDSNDVAAVTQS
FT                   ACDASDAIYIPTDNTAASCTEAINNVASQAKKPIFAGEEGIAKGCGVATLSISYYDLGY
FT                   TTGEMAYDILVNGTDIKTMEVKSAPKFTKEYLPDRAKELGITVPDGYEEISAE"
FT   CDS             349178..349330
FT                   /transl_table=11
FT                   /locus_tag="ERE_03970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92499"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGL5"
FT                   /protein_id="CBK92499.1"
FT                   /translation="MLKNKNDDSYWICGEGVGTEQKTVSGETEYTVTCSSKFVPYEFPA
FT                   NEFSK"
FT   CDS             complement(349382..350608)
FT                   /transl_table=11
FT                   /locus_tag="ERE_03980"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92500"
FT                   /db_xref="GOA:D4JGL6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGL6"
FT                   /protein_id="CBK92500.1"
FT                   /translation="MTIYDELVARGLIAQVTDEKEIKELINNGKATFYIGFDPTADSLH
FT                   VGHFMALCLMKRLQMAGNKPIVLIGGGTAQIGDPSGRTDMRQMMTTETINHNVECFKKQ
FT                   MSRFIDFGEGKAIMVNNADWLMDLNYVDVLREVGAHFSVNRMLTAECYKQRMEKGLSFL
FT                   EFNYMIMQSYDFYTLFQKYGCNMEFGGDDQWSNMLGGTELIRRKLGKDAYAMTINLLLN
FT                   SEGKKMGKTQSGAVWLDPNKTTPFEFFQYWRNVSDADVLKCIRMLTFLPLEEIDKMESW
FT                   EGAQLNEAKEILAFELTKLVHGEEEATKAKEASHALFAGGANNANMPTVTVTAEDFPDG
FT                   ELDIISVLVKAGLCDSRGDGRRNIQQGGVSVADEKITDISTKYTLDDFKGEGLIIRRGK
FT                   KKFAKVVAE"
FT   CDS             351226..352290
FT                   /transl_table=11
FT                   /locus_tag="ERE_03990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_03990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGL7"
FT                   /protein_id="CBK92501.1"
FT                   /translation="MQNPFTTTFSKTPEYTYIHTEKTEEILENFIYDNPSESVYKITGV
FT                   RGSGKTVILAKVEEELRTNESRYINWLVFDVNPARDILGQIAAMLVKAGFGSQDKKTTG
FT                   INLSATVMGTGGGIGYTAENNNNFFDIGVEVETMIQAAQKKGKKILIGIDEVSKSEEMI
FT                   KFASEYGRWLRAGYPVYFVCTGLYENIQELSNVKNLTFFRRAATVKTEPLNMIRMTEMY
FT                   KSKLDIDSNEAREMAKITKGYAYAFQELGVLYFKKKLDELLEDILPKLKAELFAYSYEK
FT                   IWEEMTEMDRFLAGLLTEKEEYKREEVLKLMGEKSGSYSMYRDRLIKRGILNSRQGYIS
FT                   LALPYFGEYIKEYC"
FT   gap             353042..353524
FT                   /estimated_length=483
FT   CDS             353553..353690
FT                   /transl_table=11
FT                   /locus_tag="ERE_04010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92502"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGL8"
FT                   /protein_id="CBK92502.1"
FT                   /translation="MYGNGANQQYGQNPYGTAQGGDAQNSYGTSQQQSWNDEYNNKDYE
FT                   "
FT   CDS             354139..355167
FT                   /transl_table=11
FT                   /locus_tag="ERE_04020"
FT                   /product="Predicted Na+-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92503"
FT                   /db_xref="GOA:D4JGL9"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGL9"
FT                   /protein_id="CBK92503.1"
FT                   /translation="MKVLQKVSKFLSDYTSIVVIAIAVVTFLVPNLMAWVNQMLFVDPV
FT                   SNKFTCQSIIIGIIMFSMGLTLTTQDFKILAQRPFDICVGAIAQYLIMPFLAFGISKAL
FT                   NLPDGIALGLILVGCCPGGVSSNIMSYLCGGDVAFSVGMTTVSTLLSPFMTPLLVSFLA
FT                   SGTHVSIKALPMFVSIIETVIFPVAVGFLLNYLLGKKKAFAEAQKVMPGIAVLGLAFVV
FT                   GGVVSSQGSKFFTSGVVIFAAVLLHNGLGYLLGYGAGKLVGMNTAKKRTISIEVGMQNA
FT                   GLATNLATTTAQFASTPESAIICAVSCTWHSISGTLLAGAFALKDKMAAKKAEEAAETK
FT                   TA"
FT   CDS             355325..357037
FT                   /transl_table=11
FT                   /locus_tag="ERE_04030"
FT                   /product="Carbon starvation protein, predicted membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92504"
FT                   /db_xref="GOA:D4JGM0"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGM0"
FT                   /protein_id="CBK92504.1"
FT                   /translation="MSGILMMVIAIVVLGGAYLLYGRYLQNKWGIDPNAKTPAYEMEDG
FT                   VDYVPADTNVVFGHQFASIAGAGPINGPIQAAIFGWLPVLLWILIGGVFFGAVQDFASM
FT                   YASVKNKGRTIGYIIEEYIGKLGKKLFLLFCWLFCILVVAAFADVVAGTFNGFAADKAG
FT                   EVTKVVANGAVATTSMLFIIEAVALGFFLKYSKFNKWINTLVAIVLLIVAIALGLNFPM
FT                   YLNLSVWHIIIFAYILIASVTPVWALLQPRDYLNSYLLIFMIVGAVIGVFVANPACNLD
FT                   AFTAFAIPDANGNPQYLFPILFVTIACGAVSGFHSLVSSGTASKQIKNEKNMLPVSFGA
FT                   MLMESMLAILALIAVASFGKGEAAAQGLTTQPQIFAGAIANFLSVIGLPHSLVFTLINL
FT                   AVSAFALTSLDSVARVGRLSFQEFWLDSDTDDDNMSPFVKLMTNKYFATIITLVLAFLL
FT                   TKVGYAEIWPLFGSANQLLSVLALVACAVFLKKTKRQGCMLWIPMVFMMAVTFTALGMT
FT                   IYKLTKALFSVGLDLGNSLQLIFAVLLLILGVLVAIQGVKKLCEKSESKKAAA"
FT   CDS             complement(357065..357961)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04040"
FT                   /product="EDD domain protein, DegV family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92505"
FT                   /db_xref="GOA:D4JGM1"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGM1"
FT                   /protein_id="CBK92505.1"
FT                   /translation="MFEIIVDSAANIPAELCKKYKIKVLSFVNLVNGKEMTCFEPDLTP
FT                   EQERAKGKEYYDAIREGAEVKTGLISSGIFEDTFREIIEADKDILYFSLSKNISGNYNS
FT                   ARVAADAVLDDCNNGRKIRLVDSLNASLGQGLLAIYASEMREKGMSFDEVADTIETYPA
FT                   RLNGVFTVGNLKYIARTGRLSGTTALVGNMLSIKPILRGSKDGYIVQFRKCRGRKAVLN
FT                   ELVNLLCDNITDPENQIIGVAHADAYEDSLYVIEQIKKRIKVRDVINTTYDFCTGSHVG
FT                   PESLAVFFMGKDRELGA"
FT   CDS             358241..359107
FT                   /transl_table=11
FT                   /locus_tag="ERE_04050"
FT                   /product="Endonuclease IV"
FT                   /function="Endonuclease IV"
FT                   /EC_number="3.1.21.2"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92506"
FT                   /db_xref="GOA:D4JGM2"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGM2"
FT                   /protein_id="CBK92506.1"
FT                   /translation="MSDIKLGCHVGMAGKDMFLASASEAASYGANVFMLYTGAPQNTRR
FT                   KEIFELNIDAGWEYAHEHGINEIVVHAPYIINLANTVKPETYELAVEFLEKEIVRTAAM
FT                   KSRILVLHPGSHVNAGEQAGIAQIVKGLNTVLNQNDDDVFIALETMAGKGSEIGRSFEE
FT                   LKAIYDGVDRKERLRVCFDTCHVNDAGYDIVNHYDDVFAEFDRVIGLEQIAVFHVNDSL
FT                   NPLGAHKDRHANIGKGTIGYDTLHRLVHDETFANVPKILETPWLCEESSAKKTIPPYKE
FT                   EIEWLLK"
FT   CDS             359227..360732
FT                   /transl_table=11
FT                   /locus_tag="ERE_04060"
FT                   /product="Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin
FT                   synthases and related enzymes"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92507"
FT                   /db_xref="GOA:D4JGM3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGM3"
FT                   /protein_id="CBK92507.1"
FT                   /translation="MFFSVLAILLQAVFMVYMFTRLNEYAAAINTTTSVLAIILVLGLY
FT                   NREQTASMTTPWIILILAFPIMGVSLYLLVGLNGAPNKMRARFEEVDSMLLPCLPENAD
FT                   ILSDMYEKVPQAAGISTYLAKNALYPVYQNTDVTYYDQASKGLEAQLSDLSKAKKFIFM
FT                   EYHAIEDKESWHRIQKVLMERVQAGVEVRVFYDDMGSIFFIDRDFSEKMEKLGIKCRVF
FT                   NPVAPAFNMFLNNRDHRKITVIDGKIAYTGGYNLANEYFNVTHPYGIWKDTGIRLEGDA
FT                   VKSFTIAFLEMWNASERKVPREVDVSQYLLHYDYEAKQSGFIQPYADSPLDNEQVGEDV
FT                   YISMANKAQRYCWFITPYLIITDEMSHALTLAAKRGVDVRIITPGIPDKKPIYSVTRSF
FT                   YNQLVKHGVRIFEWTPGFCHAKMSVADDIMATCGTINLDYRSLYHHFENGCFMADCEVV
FT                   HEIRDDFIRLFTESAEVTEKYRTGRSARRRLGQSIMRLFAGLL"
FT   CDS             360832..361155
FT                   /transl_table=11
FT                   /locus_tag="ERE_04070"
FT                   /product="Acylphosphatases"
FT                   /EC_number="3.6.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92508"
FT                   /db_xref="GOA:D4JGM4"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGM4"
FT                   /protein_id="CBK92508.1"
FT                   /translation="MSDYDSKIIRKQIRVYGSVQGVGFRYRTEHAAESVGATGWVRNDP
FT                   DGSVFMEIQGTEEQIDRVFAMVSQGTYVNIEKMDAKSIPVVEDERGFHTRESLGDFWGL
FT                   WHR"
FT   CDS             361171..361566
FT                   /transl_table=11
FT                   /locus_tag="ERE_04080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92509"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGM5"
FT                   /protein_id="CBK92509.1"
FT                   /translation="MFFMMGITDGRKDFDFNQVITCDECGRYGRYQVYMTYMVLSLFFI
FT                   PCFKWNRHYYVQTTCCNALYELDPEIGRRIARGEDVEILPQHLQRVNPQYGYGFENGSG
FT                   NTTKRCSNCGYTTTEDFEFCPKCGRRL"
FT   CDS             complement(361680..362099)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92510"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGM6"
FT                   /protein_id="CBK92510.1"
FT                   /translation="MRILADTNVIIDALTSREPWNKSAEEIFLMAANHTIEMYITASSA
FT                   TDIYYLIRKHLHNIEAAKMIMGKLYSLTGILEVTADDCMDALASAISDYEDAVVEKVAS
FT                   RKDMDYIVTRNIKDYQAGGTKIILPDDFVKLVEEE"
FT   CDS             complement(362100..362315)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04100"
FT                   /product="prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92511"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGM7"
FT                   /protein_id="CBK92511.1"
FT                   /translation="MSITATELKNNLGKYLLLSAKEDVFITKNGKVVAKLTNPHQDRVE
FT                   VAKSLFGILPKDADLNEAKEERLGAK"
FT   CDS             362442..362564
FT                   /transl_table=11
FT                   /locus_tag="ERE_04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92512"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGM8"
FT                   /protein_id="CBK92512.1"
FT                   /translation="MSSFLCVSPNSKCALNALAIDNPMEYARLVLDNEMQAWVD"
FT   CDS             362757..362909
FT                   /transl_table=11
FT                   /locus_tag="ERE_04120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92513"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGM9"
FT                   /protein_id="CBK92513.1"
FT                   /translation="MMSKAVTQSTGGYEKKDKNGNPTGKYTNAQDNYTCSTYSKAKNKV
FT                   NWNYQ"
FT   CDS             362944..363114
FT                   /transl_table=11
FT                   /locus_tag="ERE_04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92514"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGN0"
FT                   /protein_id="CBK92514.1"
FT                   /translation="METWYYEVVSIDGDYANLKRSDIESDDLKLVARALLPPEIMEGSR
FT                   LKYELMQYEII"
FT   CDS             363217..363600
FT                   /transl_table=11
FT                   /locus_tag="ERE_04140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92515"
FT                   /db_xref="InterPro:IPR016621"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGN1"
FT                   /protein_id="CBK92515.1"
FT                   /translation="MQQKSTQKILLFSVATQKVEKIKALCKTLGISVQQVEKSDYGQKL
FT                   GAIAGITGFKKDGSRYSGADFPAELLVFSGINSSQMDIFLAEYKKAGIEPIGCKAVVTP
FT                   DNVFWSADKLFREIFREHLFMSR"
FT   CDS             complement(364391..365095)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04150"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92516"
FT                   /db_xref="GOA:D4JGN2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGN2"
FT                   /protein_id="CBK92516.1"
FT                   /translation="MIINITILEDNESDFITLSDSIKKWAANTGILINIIWLNSYKKFI
FT                   KSLPTLKCDLFFSDIELNCNNSFTGIDACKQLRESGYTGIIIFLTAFKEYVFDGYDVQA
FT                   FNYLLKPINYGTINNCLDKFIHLFSREFYYYHKGNDIISIPYNDIMYIEKNGHDVIFHT
FT                   TSNVFVERTSLNEISKRLPVFFIRAHKSYIVNINKVLSLRINELFLPNNVTIPVSRSYL
FT                   TNIKKKLLEIAR"
FT   CDS             complement(365110..366426)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04160"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92517"
FT                   /db_xref="GOA:D4JGN3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGN3"
FT                   /protein_id="CBK92517.1"
FT                   /translation="MFNIIWEFIINLLESFLFAVICNAKFTKRQYHYHTAEQTLFILCK
FT                   SLLITLMNISKISTIISLTSVLLLNIIFLILFFVNPIFNSFFVSFIYCLILIISDALTL
FT                   LIPIKFYNINLSQVLYLGNMRILFSLIYISIIALFVIIFLLFTPQVFVLGKLDKISYFI
FT                   ISTICVILEENVLIILLKQSIYTENFFHLLLFIFGLTLFLFVYISIYIYRLGKEKEKND
FT                   RLIQSITINQMEARQNEEIINSTHSLRVFKHDIMNHMSILYKLVENEKNSDALKYIYQI
FT                   NNSIERTSYTISTGIIPIDCIMTAKLSKALDNNISIKHQIHFPANYNISDMDLCSLISN
FT                   LLDNAIEANCKLDMTKRRLQIEIKPYNNMLLLFISNSSNGIYLYGGNGNLLTTKTSNKN
FT                   EHGIGIKRINEIVKKYNGIIEFDPGTEIFSVSILFPLDN"
FT   CDS             366790..366945
FT                   /transl_table=11
FT                   /locus_tag="ERE_04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92518"
FT                   /db_xref="InterPro:IPR009229"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGN4"
FT                   /protein_id="CBK92518.1"
FT                   /translation="MAEENYSKRIIRNLVITFALKKSCTNCAGFMYEVKKPKSLSPKIE
FT                   KELIGN"
FT   gap             367172..368444
FT                   /estimated_length=1273
FT   CDS             368450..368845
FT                   /transl_table=11
FT                   /locus_tag="ERE_04180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92519"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGN5"
FT                   /protein_id="CBK92519.1"
FT                   /translation="MRKKIIAMILGLVLIFGETISANADVLYTSGGKSNKNWSMSIGKT
FT                   SHGGILYRITGYASQPEMYKFDSVSLKVVHFCNSNDNQVKSVSAQNTYHITASADAAYG
FT                   FSASRGSSCLKVKDDTYGQGTKTIYYK"
FT   CDS             369118..370071
FT                   /transl_table=11
FT                   /locus_tag="ERE_04190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92520"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGN6"
FT                   /protein_id="CBK92520.1"
FT                   /translation="MRIRCIIKILLLSTILSSCGNINNYTNDEMNLVQNSNASVEKEVS
FT                   CIANIYKCVKDEQTGKEKYGLLLNEPLVYQGGTFSIGASMYIKNEMIDDKAISILCVLL
FT                   LDGVPIQYSIDGSKSAVMQYIMLQNGVEKRIKIDFIPDGLSEKSKNIVLLGIPFAEKEK
FT                   ITIYENDILYCAQKIVSLYDNSECDEIIQPTYNYIESIDEVIRDEIKEQGLIYEQEKYI
FT                   HNFIYSNEVGEYFTSDITEGKNETLLFCDGKLFPGFDKKEYFLWQGKDKYINMKVNTDT
FT                   LSKGEHVMFVVTVECIDDYITAGKSLNRKVYINEEK"
FT   CDS             370058..371119
FT                   /transl_table=11
FT                   /locus_tag="ERE_04200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92521"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGN7"
FT                   /protein_id="CBK92521.1"
FT                   /translation="MKKNKILVGVISIMFAGIITLGIIECNNSNTKDNDKLFIGNGKFC
FT                   QAKRLNGLGAIYDDDYIFFDCENQIYESYNYSNKKNDKKLNVNCRNSACSHSNDTCEAY
FT                   VELGEYFVFNSKIYKCYNKSKVVSGENRLYGSIVEAESGKTVFKNSIPTDMSSELAIDD
FT                   SEAILYVRVLSDDIVKVDGDRHAYLLDKNFNIIYCHYNIGKFPWGAILNGNYYYINDIN
FT                   EIVKVNLTTFESKSIASNGKAFMADNDENFIYYSNEFSELYKLSPDDESSIKIADNALF
FT                   FSVQNKYIYASGGDNGNKIIYDKNGKIIADYSACVNMGADSAFQINDKIYTIFNGGVAY
FT                   MDLDGKNYGEMMQ"
FT   CDS             371116..372273
FT                   /transl_table=11
FT                   /locus_tag="ERE_04210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92522"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGN8"
FT                   /protein_id="CBK92522.1"
FT                   /translation="MRYEIKKILSCKILMISMIVAFIFSMAISYNAYANEKIDLREFSA
FT                   YIGDFSERKYDVIEQKVMELQNKYEETQNVDVMDEMFVYLTLDKDALNCHNVVEYRDSV
FT                   ISDSEIKIKTESGYYKRMNETINKLYGKKTNLVIGESETLNEVYDLFCVTDIVDIVFII
FT                   VIILFSSYLFLNEHNNNTFYMIKSSYRGGKLSYRNKIVITLFFSIMASVVETLGMTIWS
FT                   VFWNKIDQWNTSILLNNAFLHSPYSITLFEMIIGVVIMRAIGFFVLSSVFIFVSLFFKS
FT                   NIVPIAINTFIGLGGIAINYILSGKYFALSGGTIREAENYDILRKYTPFPLISESVNYF
FT                   KEYEPINLMGVPIQLLSYSLIVNLVFAIIVIALGYYFYNTNFRES"
FT   CDS             372287..372949
FT                   /transl_table=11
FT                   /locus_tag="ERE_04220"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92523"
FT                   /db_xref="GOA:D4JGN9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGN9"
FT                   /protein_id="CBK92523.1"
FT                   /translation="MLELIDIKKRYGSKEVLHGISIKFENGIYGLIGPNGSGKSTIMNI
FT                   MSDVLDMSSGKILYNGIDIKELDDRYREKIGFLPQNVGYYPNFTAKKTIEYFGYLRGVN
FT                   KKELDSNVEQVLRDVNLYENRNDKVKSFSGGMKQRLGIAITCVANPEIIIFDEPTVGLD
FT                   PEERARFKNLIRKLSKTKTIVLSTHILSDVEEVADYIILIKEGCLTKFEKIGGKDNE"
FT   CDS             372942..373847
FT                   /transl_table=11
FT                   /locus_tag="ERE_04230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92524"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGP0"
FT                   /protein_id="CBK92524.1"
FT                   /translation="MNNVTKMELYKVLSKPQVYIIFVVGLIIQSIMAGQMRTTMFNGYH
FT                   KSVYENYMNEMEGEYSIEKKEYINSEYQKFQAIMDDEQKNEIAFNNGKIDGKDYHSIIN
FT                   EEKKAKYRIATVKYIVEKTEYYDNLDKSAQYFYDIEISDYIENLRFNVIPIIVILLIVV
FT                   PMYTDDIYAGTLAMIKSSKNGRMILLKSRLNISLLISLLICILFAFVEFVTKYIIFDLG
FT                   NLNAGVESLMIERTMHLPYIISDLSIWQFIVLLYLFYLIISVMISIIGLLVSKISRGNI
FT                   EAFSIMSVIIVGVSYILNIL"
FT   CDS             374007..374192
FT                   /transl_table=11
FT                   /locus_tag="ERE_04240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92525"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGP1"
FT                   /protein_id="CBK92525.1"
FT                   /translation="MCKAWDDHKKRGIQEGRYLEIYSLVHDGIIEPELGAKRLNMTFAD
FT                   FERAMQKAGYKLPELA"
FT   CDS             complement(374261..375580)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04250"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92526"
FT                   /db_xref="GOA:D4JGP2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGP2"
FT                   /protein_id="CBK92526.1"
FT                   /translation="MQVQRKTLTQLSIPICFETLFYMLSGMVDTLMLSSVSDQAVGAVG
FT                   TANTYISVFIIMFGVISSGMVAVMTQNIGAGKPGIAYQARQLGLIFNAVIGVLMSVFLA
FT                   VFSGNILKMVSIAPALFDSANTYLRIVGGACFLNALIPIFSSYLRVFGYTKQSLWASII
FT                   GNVINFILNAVFLFVMNWGVMGVATATVISRIINLIIVATMGAVLIKAKDSPERIAPGK
FT                   ILGQIIKIGFPSACETALYNIAMTLVVRFMNQMDADGMNVTARSYATQIANFSYCIGAA
FT                   LAQANAILTGWHIGAKEYDECDRGTRKAAIYGVITASCLSITFALLGNYIVRIFTNDVQ
FT                   MINLVTKLLAIDIVLEFGRVTNLVYGQALKTSGDAVFPVVMGAVFMYLAAVGGTYFFGL
FT                   HLGLLAVGAYIGLASDECIRAIGMVLRWKSGKWKNKGLVD"
FT   CDS             complement(375968..376252)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04260"
FT                   /product="prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92527"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGP3"
FT                   /protein_id="CBK92527.1"
FT                   /translation="MQRSSSSNKGFSLVELIIVISIMAVLIGILAPQFISYIHKSKVAS
FT                   DWANLKAYYSEIETDYVDNDGTYNPDVPTISQNLALTGMMSTVEERLNS"
FT   CDS             376468..377346
FT                   /transl_table=11
FT                   /locus_tag="ERE_04270"
FT                   /product="transcriptional regulator, AraC family"
FT                   /function="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92528"
FT                   /db_xref="GOA:D4JGP4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGP4"
FT                   /protein_id="CBK92528.1"
FT                   /translation="MYFELKENRPHGTPENPFSQYHISDVKRAFQIPVHWHDELEIIYV
FT                   KQGKLHVTISGENYIGSPKDAFVVSPGSLHFMGSPTGDADYYTFLFPLEYISFQTDDLM
FT                   EKSILSPLKRGRLMISPQINDTAADICERLIEINAQISGKNAENTDAANIEAQFETKIT
FT                   LIKFIRKMWRNGMILENGTNGTNTTEKEMITYIRQNYTREISLKEFGAQFHLSEKYISR
FT                   YFKEHFHITLSQYVNHLRLEHARQLLEESAASVTEVAMCSGYQNVSYFIRSFKKMYGVS
FT                   PLKYRNFQTLP"
FT   CDS             377834..378862
FT                   /transl_table=11
FT                   /locus_tag="ERE_04280"
FT                   /product="ABC-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92529"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGP5"
FT                   /protein_id="CBK92529.1"
FT                   /translation="MKKKVLSVILAAVCTMGLMAGCGAEGSKGSTQSGSKGDSYTVGIS
FT                   QFAEHGSLDNCREGFLEGLKEEGIEEGKNLKVDYQNAQTDTGTASTIADSFVSEKVDMI
FT                   CAIATPCAASAYNSAMNADIPTVYTAVSDPVVAGLAKEDGSSVGNITGSSDVLPVEEQL
FT                   KMIREMMPDAKKIGILYTTSEANSCSTIEEYKELADKYDFEIVDTGINTSADIEIAASD
FT                   LVSKVDCLCNLTDNTVVNALQTVLDKANGAKIPVFGSEIEQVKSGCVASMGIDYYQLGI
FT                   ETGKMAAKILKGEEKASDTPFITASKAELYVNTAAADKIGMTLDADYIKDAAETFDKIE
FT                   VK"
FT   CDS             379778..380551
FT                   /transl_table=11
FT                   /locus_tag="ERE_04300"
FT                   /product="ABC-type uncharacterized transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92530"
FT                   /db_xref="GOA:D4JGP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGP6"
FT                   /protein_id="CBK92530.1"
FT                   /translation="MLELNHIHKLYNPGTVNEICLFDDFNLKIDDGQFVSVVGSNGSGK
FT                   TSMLNIICGSIPIDGGSIVVNGTDITKQKDFIRHRRIGRVFQDPSKGTCPSMTILENLS
FT                   IADNKGKTYGLGRGTNHSRIEHYKEMLAELNLGLEDKLHTKVGALSGGQRQTLALLMAT
FT                   MNPIEFLILDEHTAALDPKTAEIVMQLTGKIVAEKKVTTIMVTHNLRYAVEYGDRLIMM
FT                   HQGKAIIDKAGADKKAMQVDDILGTFNEISIECGN"
FT   CDS             380639..381307
FT                   /transl_table=11
FT                   /locus_tag="ERE_04310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92531"
FT                   /db_xref="InterPro:IPR025051"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGP7"
FT                   /protein_id="CBK92531.1"
FT                   /translation="MLLYHGSDHIIEKPEFGAGKKHNDYGRGFYCTQNIELAKEWAVSE
FT                   DADGYVNKYSIYTSKLEVLDINSDKYTMMHWLGILLKNRIFTLTTPLEREAKQYILDNF
FT                   NISLDGIDIVKGYRADDSYFSYARDFISGVISYEQLSKAMRLGKLGEQYCLISKKAFAA
FT                   LEYTGSEYADFKEWYPRKMLRDMYARKGYRDMEKESYRRGELYISRIIDEEMKKDDLRI
FT                   "
FT   CDS             381291..381926
FT                   /transl_table=11
FT                   /locus_tag="ERE_04320"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92532"
FT                   /db_xref="GOA:D4JGP8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGP8"
FT                   /protein_id="CBK92532.1"
FT                   /translation="MIYAYDKVYLRIAQRSLGEMLSYAVYDLGYELEDYYKRFLQSEYS
FT                   MRFSKGDLFVITGMSGAELAIRVLDIPDDDIIMPSYNTAKSQEYWTGWILAYYQWENGK
FT                   TFEMIDKEIPICKIRNMYNPYHEMDISSAILKLREMSQVSRAETYLKKLRKRAGISQSI
FT                   LAEETGIPVKTIQQYEQRRKDINKAQVEYVVRLSKALCCEPQDILEEK"
FT   CDS             complement(381949..382671)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04330"
FT                   /product="Thiamine monophosphate synthase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92533"
FT                   /db_xref="GOA:D4JGP9"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGP9"
FT                   /protein_id="CBK92533.1"
FT                   /translation="MNKEKLLYENSKYALQSDNIIAITNRHLCSRPFMEQLERVCKLHP
FT                   HAIVLREKDMPEAEYLSLARDVIALCKKYDVQCMLHSFINVAMELEHPYIHLPLPILEA
FT                   YVKKGLSDNISTDMSKSTDNYQQFFKVIGTSVHSVEDAIKAEQLGATYMTAGHIFATDC
FT                   KKGLPPRGLDFLKNVCDAVEIPVYAIGGINIASSDDSTASNAPSTYDAMPDINVPRLAD
FT                   VMECGAAGGCIMSGMMRV"
FT   CDS             complement(382761..384026)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04340"
FT                   /product="tyrosine lyase ThiH"
FT                   /function="tyrosine lyase ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92534"
FT                   /db_xref="GOA:D4JGQ0"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGQ0"
FT                   /protein_id="CBK92534.1"
FT                   /translation="MTNDTNITNDKDINANIAHDDHFNDSIVNEVILEDMKKNRIDHMK
FT                   YLPDMEVLDSDIMDRVVAEMDAYDYDQYTAADVRAALSHEYRTLEDFKALLSPAAQPFI
FT                   EEIAQAAQLETRKHFGNSVCMFTPLYISNYCENYCIYCGFNCHNKINRAKLNASEIEKE
FT                   MAAIAKTGLQEILILTGESKKMSDVEYIGEACKIARKYFKVIGLEVYPMNSDEYAYLHE
FT                   CGADYVTVFQETYNSDKYETLHLAGHKRIFPYRVNAQERALKGGMRGVGFAALLGLDDF
FT                   RKDALATGYHAYLLQKKYPRAEIAFSCPRLCPIINNDRINPKDVHETQLLQVVCAYRLF
FT                   MPFASITISTREVARVRDNLVNIAATKISAGVSTGIGSHVDDIEDKGDDQFEISDGRSV
FT                   DEVFNALLDNGLQPVMSDYIYV"
FT   CDS             complement(384063..384851)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04350"
FT                   /product="thiazole-phosphate synthase"
FT                   /function="thiazole-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92535"
FT                   /db_xref="GOA:D4JGQ1"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGQ1"
FT                   /protein_id="CBK92535.1"
FT                   /translation="MSKNIDLANDKLVLGGHEFTSRFILGSGKFSLDLVKACIEKADAQ
FT                   IITLALRRANDGGLANILDYIPDNVTLLPNTSGARNADEAVRIARLSRELGCGDFVKIE
FT                   IMRDSKYLLPDNFETIKATEILAKEGFVVMPYMYPDLNVARDLANAGAACIMPLGAPIG
FT                   SNKGICTKEFIQILIDEIDLPIIVDAGIGRPSQACEAMEMGAAAVMANTAVATAGDVEI
FT                   MAEAFKKAIEAGRMAYLSGLGRTLTKGASASSPLTGYLRD"
FT   CDS             complement(384902..385099)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04360"
FT                   /product="sulfur carrier protein ThiS"
FT                   /function="sulfur carrier protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92536"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGQ2"
FT                   /protein_id="CBK92536.1"
FT                   /translation="MVKINGKEAADVCGMTVSQYLSANNYNPKHIVVELNEEILPKTEY
FT                   DSTAIADGDVVEILSFMGGG"
FT   CDS             385567..385785
FT                   /transl_table=11
FT                   /locus_tag="ERE_04370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92537"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGQ3"
FT                   /protein_id="CBK92537.1"
FT                   /translation="MFDEEMITKYRYIILLIGTAVSFVLGFAGAFALAKLCGVMTVKAV
FT                   LNIAFTAGGITGMLGFVCICLAELRRI"
FT   CDS             386088..387668
FT                   /transl_table=11
FT                   /locus_tag="ERE_04380"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /function="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92538"
FT                   /db_xref="GOA:D4JGQ4"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGQ4"
FT                   /protein_id="CBK92538.1"
FT                   /translation="MITWNNLDTLESFKELSKVGRVDIKEAMSGDNGAKRVKEYNIPMA
FT                   EGFTYNFAAKQVDADVLEALAKLAKEAQLTEKFEALYNGAVINTGENRLVLHQLTRGQL
FT                   GDAVVADGVDKRKFYVEQQERIAEFANKVHSGEITNAAGEKFTTVVQIGIGGSDLGPRA
FT                   MYLALENWAKKNNTFKMEAKFISNVDPDDAASVLASVDVAHSIFILVSKSGTTLETLTN
FT                   ESFVKDALKNAGLDASKHMIAVTSETSPLAKSDDYLAAFFMDDYIGGRYSSTSAVGGAV
FT                   LSLAFGPEVFAQFLDGAAAEDKLSKNADIMENPEMLDALIGVYERNVLGYPSTAVLPYS
FT                   QALSRFPAHLQQADMESNGKSVNRFGEPVDYVTGPVIFGEPGTNGQHSFYQLLHQGTDI
FT                   VPLQFIGFKNNQLDTDVVIQDSTSQQKLCANVAAQIVAFACGKADDNKNKNFEGGRPSS
FT                   IIIGDQVNPASLGALLAHFENKIMFQGFLWNVNSFDQEGVQLGKLLAKKVLAHETDGAL
FT                   KELSDMLNI"
FT   CDS             complement(387848..388039)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92539"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGQ5"
FT                   /protein_id="CBK92539.1"
FT                   /translation="MLETIIIVVCAAVCIGAAAYAWWMENGPEKDDSDAAGKNSQGRAY
FT                   TKYDSNIKDDIVFHKAHK"
FT   CDS             complement(388104..388625)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92540"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGQ6"
FT                   /protein_id="CBK92540.1"
FT                   /translation="MKKILVLPLLLCLIFCSFLSLDKNLDEFDPDRTAYGSYDHRVVWG
FT                   SYASSDKAALPQQEVLDSRAVLYSESDMSALMDCQYIEEIPSFPEVICRIRTSSLGFLG
FT                   RLTSNLSWLGALLQLIHIILFAYAAIVVMRICLTNTSRRFIIRFIHDKDGHKLISFADY
FT                   FKTRAYAEEI"
FT   CDS             389455..389700
FT                   /transl_table=11
FT                   /locus_tag="ERE_04410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92541"
FT                   /db_xref="InterPro:IPR023860"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGQ7"
FT                   /protein_id="CBK92541.1"
FT                   /translation="METRIALIGIIVENPDSVEQLNHLLHEYGSFIVGRMGIPYEKKNV
FT                   NIISVAIDAPQDIISALSGRIGRLDGIGVKTVYSNK"
FT   CDS             389726..390784
FT                   /transl_table=11
FT                   /locus_tag="ERE_04420"
FT                   /product="iron-only hydrogenase maturation protein HydE"
FT                   /function="iron-only hydrogenase maturation protein HydE"
FT                   /EC_number="2.8.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92542"
FT                   /db_xref="GOA:D4JGQ8"
FT                   /db_xref="InterPro:IPR005244"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024021"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGQ8"
FT                   /protein_id="CBK92542.1"
FT                   /translation="MTENTAIIKIIDEITACRNITLEQLHMLLETDDMQAVDYLRKRAS
FT                   EKAHETYGNQVFIRGLIEFTNYCKNDCLYCGIRHSNTHADRYRLSTGQIMACCESGYEL
FT                   GFRTFVLQGGEDPYYTDERICEIVSGIKAKYPDCAVTLSIGEKSKESYQSYFDAGADRY
FT                   LLRHETADEKHYNRLHPAEMSLANRKQCLWDLKEIGYQVGCGFMVGSPGQTVETLYEDL
FT                   QFIKELEPHMVGIGPFISQKDTPFANEKSGTMDETLRLLSIIRLIHPKVLLPATTALGT
FT                   IHPLGREKGIQSGANVVMPNLSPVNVRDKYKLYDNKICTGDEAAECRFCMEKRMKSIGY
FT                   QVVVSRGDYADF"
FT   CDS             390841..392268
FT                   /transl_table=11
FT                   /locus_tag="ERE_04430"
FT                   /product="iron-only hydrogenase maturation protein HydG"
FT                   /function="iron-only hydrogenase maturation protein HydG"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92543"
FT                   /db_xref="GOA:D4JGQ9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024007"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGQ9"
FT                   /protein_id="CBK92543.1"
FT                   /translation="MYNVKSLKAEEFISDEEIKETLEYAEANKNNIGLIDAIIEKAKLK
FT                   KGLTHREASVLLACEIPEKLDEVYKLAQQIKKDFYGNRIVLFAPLYLSNYCVNGCVYCP
FT                   YHMKNKHIARKKLTQEEIVKEVTALQDMGHKRLAIEAGEDPVNNPIEYILECINTIYSI
FT                   KHKNGAIRRVNVNIAATTVENYRKLKEAGIGTYILFQETYHKESYEQLHPTGPKHDYAY
FT                   HTEAMDRAMEGGIDDVGLGVLFGLDKYKYEFAGLLMHAEHLEAVHGVGPHTISVPRIKH
FT                   ADDIDPDVFDNGISDDTFAKICALIRISVPYTGMIISTRESQTVREKVLPLGVSQISGA
FT                   SKTSVGGYADPEAEKNAEATSEQFDVSDQRTLDEVVNWLMKMDYIPSFCTACYREGRTG
FT                   DRFMALCKSMQILNCCHPNALMTLKEYLEDYASPQTRELGMKLIDREIEKITNPKVKQT
FT                   CYEHIHDIADGKRDFRF"
FT   CDS             392279..393595
FT                   /transl_table=11
FT                   /locus_tag="ERE_04440"
FT                   /product="iron-only hydrogenase maturation protein HydF"
FT                   /function="iron-only hydrogenase maturation protein HydF"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92544"
FT                   /db_xref="GOA:D4JGR0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGR0"
FT                   /protein_id="CBK92544.1"
FT                   /translation="MGNLNETPSANRLHIGIYGKTNSGKSSLINAVTKQEVSIVADVAG
FT                   TTTDPVYKSMEIHPLGPCVIIDTAGFDDDSELGERRVEKTHLAAEKTDIAVVVLDIAEV
FT                   IAAKKAGVPFKKAFKDEAEWSLLFAKKHTPVVFALNKIDEILLSTEAQEKSRGKLDNAA
FT                   IEAAKCWVYEENSAVMGKNADNSFEVVAVSALKGKGMDAVISALTRLLPEDFGQEFILG
FT                   DLVSQTDLVLLVMPQDIQAPKGRLILPQVQTLRELLDRKCLVMSTTTDKMTDALAALSH
FT                   APKLIVTDSQVFGYVYEHKPAESMLTSFSVLFAAYKGDLPYYVESARAIDALKPSSRVL
FT                   IAECCTHAPLAEDIGRVKLPNLLRKRVGEELTVDITSGTDFPDSLSQYDLIIQCGACMF
FT                   NRKYVLSRIDRARTQHVPMTNYGVAIAHLTGILDKVSMP"
FT   CDS             393634..394296
FT                   /transl_table=11
FT                   /locus_tag="ERE_04450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92545"
FT                   /db_xref="InterPro:IPR024539"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGR1"
FT                   /protein_id="CBK92545.1"
FT                   /translation="MTKISDFDDKMNYSGDYKGNYSNYYSGDYSATGYARLAKSLIDIV
FT                   NEQQAKLGYRKEIVRLYYPLSTLRHFFECAGADNKIAAGMISEQQMLEILAPNNLPKQL
FT                   TDTIGEIKVTTKNERFCIEIPPEGSEYVHENTADNEFISELIALVGTHGCTMEQITELF
FT                   YKYSDNIEKKEMQNGEFDCYIRFLNEPDDTYYYCFHDEGCHIIYHRFLPQDYADFGF"
FT   CDS             394443..395048
FT                   /transl_table=11
FT                   /locus_tag="ERE_04460"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92546"
FT                   /db_xref="GOA:D4JGR2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGR2"
FT                   /protein_id="CBK92546.1"
FT                   /translation="MATFTRKAIMQTFLHILKNKPLDRITVKDICEQCEINRNTFYYYF
FT                   KDIYDVLEAIFEDEVRLVMDEAKEGVTFHDAYARVAALILNNREAIMHIYASENGRVLR
FT                   TYLDAVVTQVVRRFVLEKAEGYSLDDSDIAFITAFYSNGIVGSTIKWIERGSMMSRLPE
FT                   NITANGVGLSKSQYNRDIVKRIGDSFDATIYDMIECCL"
FT   CDS             395187..395744
FT                   /transl_table=11
FT                   /locus_tag="ERE_04470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92547"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGR3"
FT                   /protein_id="CBK92547.1"
FT                   /translation="MHTLVRVKNAYTVMTICLIALGAALLFAPQLGLRTLCVVYGVFLI
FT                   VYGVTKLSGYFAKDLFQLAFQFDLALGIVSIVLGIIIIKKTEYIIEILSTAIGIFMLVD
FT                   GAFKIQTAVEAKRFGIERWWLILVMSFVVAFVGILLLVTPFETAGMIVRLIGLNLSLDG
FT                   ILNLFVVRNTVETIRRNTKWEI"
FT   CDS             397102..397881
FT                   /transl_table=11
FT                   /locus_tag="ERE_04490"
FT                   /product="hydrolase, TatD family"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92548"
FT                   /db_xref="GOA:D4JGR4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGR4"
FT                   /protein_id="CBK92548.1"
FT                   /translation="MIFETHAHYDDDRFKDDRDETIKRVHEKGVAPIINVGASIGSTMT
FT                   TIELAKKYDFIYAAVGVHPSDVADLNEETFAWLREQTAWERTVAVGEIGLDYYWDKEPK
FT                   VQENQRYWFKRQLELAAEASLPVIIHSRDAAQDTMEIMTEAAKKNIRGVIHCYSYSPEM
FT                   ALEYVKLGYYIGVGGVVTFKNAKKLVQTVSELPLDRILLETDCPYMAPEPHRGTRNDSS
FT                   NIPYVILKIAEIKGTTPDEVERKTRANAFELFTRVNN"
FT   CDS             398309..399175
FT                   /transl_table=11
FT                   /locus_tag="ERE_04500"
FT                   /product="dimethyladenosine transferase"
FT                   /function="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92549"
FT                   /db_xref="GOA:D4JGR5"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR019825"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGR5"
FT                   /protein_id="CBK92549.1"
FT                   /translation="MAYLGNPKNTIEVLQKYNFNFQKKFGQNFLIDTGILEEIIDSAGI
FT                   TKDDMILEIGPGIGTMTQYLCESARQVIAVEIDTNLIPILKDTLSEYDNVKVINDDILK
FT                   VDINALAEEYNNGKPIKVVANLPYYITTPIIMGLFESHVPIDSITIMVQKEVADRMQAG
FT                   PGKKDYGALSLAVQYYSHPEIVVNVPPSCFMPQPKVGSSVISLKRYEKPVVDVDDEKLM
FT                   FKIIRASFNQRRKTLANGLNNFGGMGLTKEQIQQSIEALGVPVNVRGEALSLAQFAQLS
FT                   NIIGAAK"
FT   CDS             399250..399927
FT                   /transl_table=11
FT                   /locus_tag="ERE_04510"
FT                   /product="Membrane-bound metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92550"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGR6"
FT                   /protein_id="CBK92550.1"
FT                   /translation="MKKQQIAAAACLVAGAIGFAAVYSTQNHGKEELPTEISQTSSIVE
FT                   PTEKKTPQKQTQKEDSETKMGQEESAAGQQENQQPTEKQLHFVPENVTNWPVKGDVLLP
FT                   FSMDKTVYFPTLDQYQYNRGMVIRANEGDAVYSVTEGRIIDIYDSAETGCTVVQDLGDG
FT                   YTATYGQLANLTCSEGDVLEAGETLGTVGKVTRYYTVEGTNVYFAMEQDGKPVNPMDYF
FT                   GDI"
FT   CDS             401628..401927
FT                   /transl_table=11
FT                   /locus_tag="ERE_04530"
FT                   /product="Predicted endonuclease containing a URI domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92551"
FT                   /db_xref="GOA:D4JGR7"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGR7"
FT                   /protein_id="CBK92551.1"
FT                   /translation="MDKADMDENYTYIVRCADGTLYTGWTNDLKKRIKAHNSGKGAKYT
FT                   KTRRPVELVYFEHFATKEEAMSREYHIKQLKRAQKQALIDEMNKNNKSIFTQNG"
FT   CDS             402176..403564
FT                   /transl_table=11
FT                   /locus_tag="ERE_04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92552"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGR8"
FT                   /protein_id="CBK92552.1"
FT                   /translation="MKKKLVTVLLASSMVATMLAGCGSGSGDGTEKGSSAKGGDGSVYM
FT                   LNFKPETDQAWQDLAEKYTDETGVQVTVVTAADGQYKTTLKSELAKKEAPTIFNIGSTA
FT                   DCAEYDKYIYDLKDSEIYKHLTDKSLALEYNGKIASVANCYECYGIIYNKAILENYCKN
FT                   YSGAVIKSVDDIKDLDTLEKVATDINEHVDDINKACDLHLTEAFASAGLDSGSNWRFTG
FT                   HLAGLELYYEFKDAGCDLTAGQKEVTGKYMDNFKRVWDMYTNTSAADKATLDSGSLNAE
FT                   SELGMEEAVFYQNGDWEYANFADDNENGYTVKQSDLSMMPIYFGVDDANEGLAVGTENH
FT                   WTVNAKADQKDIDATLEFLNWVITSDDGRDAIVNKMGLSAPFDTFTGDYESKNAFANVA
FT                   SELAKEGKTSVAWSFNATPSVDDWRADFLAPLTEYTERNGSWDDVVKAFSEKWAYYWDL
FT                   QNEQ"
FT   CDS             403652..404509
FT                   /transl_table=11
FT                   /locus_tag="ERE_04550"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92553"
FT                   /db_xref="GOA:D4JGR9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGR9"
FT                   /protein_id="CBK92553.1"
FT                   /translation="MEKSIRKKFWIFALPTMAAFTIGFIVPFVYGIFLSFCKFSTVTDW
FT                   KWVGFKNYTRIFVVNGSVDTTFIHSIWYTALFTVVSVLIINIVSFAIAMALTKGIRGTN
FT                   LFRTVFFLPNLIGGIVLSYVWLMIFNSILQNYSKTIVSSEWSAFWGLIAVVCWQQIGYM
FT                   MIIYIAGIQNIPGELIEAAKIDGANRWQLLKSVILPMLMPTITICTFLTLTNGFKLFDQ
FT                   NLALTGGNPGKMSELLALNIYNTMYGTTGWQGVGQAKAVIFFIIVAIIALAQNKITTSK
FT                   EVQD"
FT   CDS             404509..405420
FT                   /transl_table=11
FT                   /locus_tag="ERE_04560"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92554"
FT                   /db_xref="GOA:D4JGS0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGS0"
FT                   /protein_id="CBK92554.1"
FT                   /translation="MAKQKKAQEVSAVRQAKHGWIITLLFAVLSILWISPIFMVLLNSF
FT                   KRKAYIFKHPFGISTVSITEGFEAFKDGMSRLFCSTLNYKNGLRMTHFWDCFGNSLFIT
FT                   VGSVVLIVLCCSMCAWYIVRVKTKGTKLMYTLCLFSMIVPFQMVMFTLSKFANMLHLSN
FT                   PLGIIIVYLGFGAGLAVFMFTGFVKSISLEIEEAAMIDGCTPLQMYFRVVFPILRPTAV
FT                   TVAILEAMWVWNDYLLPSLVLNINQYKTIPIAIQYLKQSHGMIDWGAMMAMLVLAILPI
FT                   VIFYIVCQKYIIEGVLAGAVKG"
FT   CDS             405603..406607
FT                   /transl_table=11
FT                   /locus_tag="ERE_04570"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92555"
FT                   /db_xref="GOA:D4JGS1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGS1"
FT                   /protein_id="CBK92555.1"
FT                   /translation="MTIVDIAKESGYSVTTVSRVLNNRQDVSPAAKETIMKIVEAHNFV
FT                   PNTNAKRLKQTISRNIYLLVKGTSNMLFANVVEEIQSIIDRTDYSLSITYLDEDSNLSS
FT                   VTDRICRERKPLGIIFLGGSREDFSEDTSSFKVPCVIVTTSAENWSMEELSSVSIDDEK
FT                   AGETIVDYLIEHGHTKIAEIGANLELSQTARLRHNGYLNSLKKHGITPDERYYERARFS
FT                   YDSAYRAMKKLLEKDIEITAVYAISDVMAIGALRAILDKGLRVPEDISITGFDGSTLAE
FT                   YYNPKIVSIRQPHKDMAARSVELLFNMIDLHKGSCHEIIPFELTEGESVARID"
FT   CDS             406668..407834
FT                   /transl_table=11
FT                   /locus_tag="ERE_04580"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92556"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGS2"
FT                   /protein_id="CBK92556.1"
FT                   /translation="MEVNNKMKHTIKVAWAKGFSQFLALAGAILLVFVLFKFDAIMAQI
FT                   VRIINILMPIIMGIVLAYLINPMVEFYDRKLSNSLGKAIEKKCGKRPSMRGVSILISLA
FT                   IIIAIIVVLIMMVVPQLVSNITNAVSLLPDQIQDLVKKITELAKNNDRAKEIITELYNN
FT                   GISYFTEWVKDNMLGQVTFVINGIMGIFGTAVNCLVAFIVAIYVLLSKDTFKRQTKKLV
FT                   SAFLPERHIQVLSSILKESDKIFGGFISGKIIDSLIIGAICFVCCLILRMPYVALISVI
FT                   VGVTNVIPFFGPYIGAIPSTILIMLDSPSKGVIFLLFIIILQQVDGNIIGPKILGESTG
FT                   LSPFWVVFAIFLGNGLFGVVGLFIGVPTWGVVYYLIKRYVNYRVRKKE"
FT   CDS             408024..409367
FT                   /transl_table=11
FT                   /locus_tag="ERE_04590"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92557"
FT                   /db_xref="GOA:D4JGS3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGS3"
FT                   /protein_id="CBK92557.1"
FT                   /translation="MKTDMTKGNPMKIILLFSIPVLMGNLFQQFYNMVDTIIVGQYLGS
FT                   KALAAVGSTGCIMFLVLGFANGIAQGFGVMASHAFGAKKEKLLKHYVALAIILTVIVSV
FT                   VLTIPTVLASRQLLIWLNTPDDILVMADAYIKVIFAGIFCTMSYNVASGLLRSIGDSKT
FT                   PLYFLIFSSVLNIVLDIFFIVVVKAGTAGAAYATVISQGIAAVLSFIVMFKKYDLLRTS
FT                   REDYYMDWNGIWRMLSIGLQMALNYSITAIGTMIFQAAVNVFGSQVVAAYTAASKVSNI
FT                   ATQTMPTLGTAAATYCGQNLGAGRYDRIFKGMKSCFFICIGCAVLAAAINCFVGPYMIG
FT                   WFITSPTATDIDCAMKYLKIASVFMLPLAWIFAYRNGLQGLNKGLVPMLSGAMELVSRW
FT                   IAILALSKPFGYGGVCFADPAAWLTTGILLIVTYYVWEMRMRKKIQIK"
FT   CDS             409451..411070
FT                   /transl_table=11
FT                   /locus_tag="ERE_04600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92558"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGS4"
FT                   /protein_id="CBK92558.1"
FT                   /translation="MNYYELSNTVTPDTIGYKNGLWQKRYVQIYRVLTVVWSVLTLCLL
FT                   FGMFHRDDYSSGMIKSCLLLFFAGIIFLVLMLIAVVNISAKRTENWSLQDRHDYNLAMY
FT                   RTRYRNNRQLQSVVLIVMAKQQLLMSNYDLAAQALAMVDINCVKLPYLRDYYFCNAAVL
FT                   FLCDKPGWQEWLDKCYAVPANQKQMTDMQIGALFLSENAKMDLCQAIYADTRIKHKWPT
FT                   EIVVTAILVLYAGIFYGVGGLLSRGYHYRYWFELSSVLITYAGCMVLSLYWIIRWILFG
FT                   DSVSKKSGGVRLFRKVILIVMWLCLMAAMVINLIISFIGMDTEKKAYANGLICMSTSDG
FT                   YSTDEYYNIKVGPFLRRSLTFKETIKFGLINYDDSTDDSGNDAGDSGANDSESSTENNS
FT                   QQFNNGSENTENENAGNENAGESLDTESKAVYDYMAAAGILSAGDAGIIRNGSTAKGTF
FT                   YSVFETGEADGSTYENRLVYDRVSENGQCDLFVYEQLVSGSDTRLLGFYAVNKTTNEVF
FT                   SADRNSWGGVSSREYQDATGEN"
FT   CDS             complement(411098..412123)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04610"
FT                   /product="transcriptional regulator, LacI family"
FT                   /function="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92559"
FT                   /db_xref="GOA:D4JGS5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGS5"
FT                   /protein_id="CBK92559.1"
FT                   /translation="MGKKQVTFADIAEYTHFSKTTISRYFNHPDSLTLENQEKISRALD
FT                   ELGYKKNKLAKVLANGKSEFVGIIVPNLYLHYYSEMLTQLLATYANYHYKFLVFMSDKG
FT                   AAEEENYIDELLAYQIEGLIVLSHTLSSEKLTSYHIPIVAIERESMHISSVTSDNYMGA
FT                   LQATSLLIRDKCDILIHINVDVPKYVPAYDRIRAFEDTCTEHNIPYELSLNVSGDSYND
FT                   LFSQMKVIFNNIDEKYPDKKKGVFLANDTYANMFLNLVIQKYGCLPDSYEIVGFDNSPI
FT                   ANEAIIPITTIGQQIDVIARTAMDLLVKQMDNRKQRKPEPDLAPTHKKIAPVLIRRETT
FT                   S"
FT   CDS             412359..413273
FT                   /transl_table=11
FT                   /locus_tag="ERE_04620"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92560"
FT                   /db_xref="GOA:D4JGS6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGS6"
FT                   /protein_id="CBK92560.1"
FT                   /translation="MKEKKQSLKSKVTYVKKNWMLYIFFLMPALLLTIIFKYVPMGGLL
FT                   IAFKDYNVIKGVLGSPWVGLEYFKRFLSSPDFMNYLMNTLKVSIYGLLWGFPVPIILAL
FT                   LLNRIRKEGIKKKIQLLIYAPNFISVIVLCGMVRMFLSPIGPMNKILGISTNWMTMPAA
FT                   FRTIYIASGIWQGAGWASIMYTAALSNASKELEEAARMDGANIFQQMWYVELPAIKNII
FT                   VIQFILQAGNIMSIGFEKAYALQTDMNLPASEILSTYVYRIGLLNGDYGYSTAVGLFNS
FT                   VINVILLIIVNAVVKKLNDGEGI"
FT   CDS             413286..414188
FT                   /transl_table=11
FT                   /locus_tag="ERE_04630"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92561"
FT                   /db_xref="GOA:D4JGS7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGS7"
FT                   /protein_id="CBK92561.1"
FT                   /translation="MEKDMTIKIKYSRTDKIVLGIGYTLLGLFVLAIIVPLVYVVLASF
FT                   MDPTVLNNQGLSFNIKDWTIDAYRRVLENDMIWRGFFNSFFYSIAFAAISVFVTILAAY
FT                   PMSKKEFVGRKFFNVIFIITMFFGGGMIPTFILINQLHMVNTVWAILIPGAFNVWNMIL
FT                   ARTYYQSVPNELREASAIDGANEIQHFFKIMLPVCKPIIAVLMLWSFVGMWNSYFDAMI
FT                   YLNDANLQPLQLVLRSILVQNTPQPGMIADIQSTAEMAKVAEQLKYATIVVSSLPLLIM
FT                   YPFFQKYFDKGIMVGSVKG"
FT   CDS             414209..415897
FT                   /transl_table=11
FT                   /locus_tag="ERE_04640"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92562"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGS8"
FT                   /protein_id="CBK92562.1"
FT                   /translation="MKKRSFKKLITLSLTLAMLTGVAGCGKQQSLNAETNPDTPVSDVQ
FT                   FPLKEKAELSFITSAPATSTQDPNERTIFKRMEKQTNVHIDWTCFVSDQFSDKKNLALA
FT                   QFGNLPDGLFNAGMSDYDLLRYAKQGIIIPVENLIDKYMPNLQAVFEKYPEYRTMCTAP
FT                   DGHIYSFPWIEQLGSGKEAIQAIGDIPYINKKWLDYLGLEVPTTTDELEQVLIAFRDHA
FT                   DELEKEFDIEGGVIPMSFIINNGDQDPAILMNGFGEGYGDTGDHFAVTDEGKVIYTPTQ
FT                   EGYKEGIEWLHKLVTEDLIDPEAFTQEWSTYVAKGKNHRYGLCFTWDIANIDNNTDYVM
FT                   LPALTGPDGVRNITRQNNSETSGFDRGRCVLTSSCRDTALAAAWIDQMYAPIQSPQNNW
FT                   GTYGEKDSFNIFEMSTNADGGQMLKHMDLGDQSPVEVREAQSVNGPLAVLNEYYDVYVT
FT                   EPADAKWRLDNMHEAYLKDMNSKYVYPNVFMSIDDTNKVSQYDTDIKKYAEQKKADWIL
FT                   NGGIDKEWDSYLKKLDKYGLQDYLKIKQKYFDSYQKSLESTSEGK"
FT   CDS             415953..417416
FT                   /transl_table=11
FT                   /locus_tag="ERE_04650"
FT                   /product="sucrose-6-phosphate hydrolase"
FT                   /EC_number="3.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92563"
FT                   /db_xref="GOA:D4JGS9"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGS9"
FT                   /protein_id="CBK92563.1"
FT                   /translation="MSELLEKARSYEAKKIAATDKESKPLFHISAPAGWINDPNGFSVY
FT                   NGKIHLFYQYYPYLREWGPMHWGHSTTSDMIKWEQLPCVLAPDEEYDKKGCFSGSAIEA
FT                   DGKHVLVYTGVTRIKLPDGSEQERQNQCIAFGDGLNYVKHENNPVVTGDMLPENCSRID
FT                   FRDPKIWKEDDTYYLIVGSKDLNNVGQVVLCSSKNLTDWQFETILAANSTGKIGTMWEC
FT                   PDFFGLEDKHVLICSPQSMKADKYEFHNGHNSVYFLGDYDKENHVFIKEEPHTLDYGMD
FT                   FYAPQTTLLPDGRRVMIAWMKSWDACVVPDSQDWQGMMTLPRELEIKDGRIWQKPVKEI
FT                   ENYRANKCHYTDKKIDCYTTFDGIKGRTLDMTVELSGEEYHDFTVEMACDDEYSTAFTY
FT                   NRVAGVLEIDRTCCGVTKDVVCVRKIKIADTDRKVKLRFIMDRQSIELFINDGQQVATT
FT                   AICTPLQADGISFNCDGSAVVDIEKYDII"
FT   CDS             417539..418486
FT                   /transl_table=11
FT                   /locus_tag="ERE_04660"
FT                   /product="Sugar kinases, ribokinase family"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92564"
FT                   /db_xref="GOA:D4JGT0"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGT0"
FT                   /protein_id="CBK92564.1"
FT                   /translation="MDVVALGELLIDFTENGTSAQDNKLFEANPGGAPCNVLAMLQKLG
FT                   HQTAFIGKVGQDAFGRLLVDAVKEQGIDTTGVRYDDNVHTTLAFVQTAADGDRDFSFYR
FT                   NPGADMMLTADEVDLSIVRNAKIFHFGSLSMTDKTCEKATKHAIAAAKEAGALISFDPN
FT                   LRKPLWKSMDDAKEKISWGLSQCDILKISDDEIEFMTGEKDIKTGVKKLIDEYHVPFIC
FT                   ATMGKNGSMAFFDGHIVEAAPFLRDDTVETTGAGDTFCACLLHDVLEHGINDRKDDDVK
FT                   KMLTFANAAASLITTRKGALRVMPEKGEVEAVIK"
FT   CDS             418641..420338
FT                   /transl_table=11
FT                   /locus_tag="ERE_04670"
FT                   /product="Protein of unknown function (DUF1703)./Predicted
FT                   AAA-ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92565"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGT1"
FT                   /protein_id="CBK92565.1"
FT                   /translation="MVKTIGIGKQDFASVIEDNCFFVDKTSFIKEWWDSKDDVTLITRP
FT                   RRFGKTLNMSMLNCFFSNQYKDRSDLFDSLSIWEDEDYRKIQGTYPVIFMSFASVKADN
FT                   LGDAKIQIKAQIEAVYKRHRYLLEGDTLTADEIADFEGTNTRMGDAESGLKLNILCEYF
FT                   HRYWGKKTIIILDEYDTPIQEAYLHGYWNEFTAYIRSLFNATFKTNPYMERAIMTGITR
FT                   VSKESIFSDLNNLNVITTTSSSYATSFGFTENEVFDAMEEYGLSGEKDTVKKWYDGFKF
FT                   GNHSDIYNPWSITNFLKEKQISPYWASTSSNGLVNRLIRTASAEIKSMMETLLEGDSVE
FT                   VSIDEQLVFEQLDNDENAIWSLLLASGYLKVDSLEKRGLTLEPWYHLSITNLETVSMFS
FT                   NMFRGWFNASVSNYNGFIRALLRGNVKEMNIYMNEVALSTFSSFDSGKHPSGKSEPERF
FT                   YHGFVLGLLVELRDKYEVQSNRESGYGRYDVMIIPRDKNSQAVIIEFKVIDSQEETSLD
FT                   MTADSALKQIEEKNYDAKLLERGYKREAIQHYGFAFEGKKVLIKKAQI"
FT   CDS             420339..422477
FT                   /transl_table=11
FT                   /locus_tag="ERE_04680"
FT                   /product="Sulfate permease and related transporters (MFS
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92566"
FT                   /db_xref="GOA:D4JGT2"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGT2"
FT                   /protein_id="CBK92566.1"
FT                   /translation="MKQKLSVAPTLKNYDKKNLPKDILAGIIIMAVSIPISMGYAQISG
FT                   LPAVYGLYGSVFPIILFALFSTSPQFIFGVDAAPAALVGAAVLGMGIEAGSKEAMTVVP
FT                   VFTFLVALWLLAFYFMNAGKLVNYISAPVMGGFITGICTTIILMQVPKLMGSAAGTGEL
FT                   FELSEHIWEALHHINAAALVMGIVALAILVVSKRLVPKFPMAVVLMVTGALFTYFGPVK
FT                   EWGVPTLSAVEPGMPRWYIPDFEAVFSVQKGSEVIVLSLSVAVVIMAETLLAENNFAQK
FT                   NGYRIDDNTELLAFSIGNMAAAFTGCCPINGSVSRTAMSEQYEGKTQLTGLVAGVSMIA
FT                   VLLFCTGFIGYLPVPVLTAIVISALMGATEFHLAKRLWKVSRTEFFIFVGAFFGVLILG
FT                   TINGVLIGIILSFAEMIIRSAKPATCFLGVQPGHSHFRDIRESTNIHEIDGVIIYRFSS
FT                   GLFFANAKVLVRDIEDHLKHDTKAVIIDAGAIGSIDITGADSIESLYRSLKQKGVKLYI
FT                   TEHIAELNEQLRKLGLGYLIEQGCVRRTIHIALKDMGINRPYPLEGGVDNEERSASRKR
FT                   ADNRVQEFVWAFGAESEEQIEKQIKLQIEQLKKTKDIEEIMHGRWAHMDEFDQDEWLEH
FT                   LEEHLKEIVNISGKDVHTLAADIEMHRREVHERIAREHPELAERFAQRRHLLDKHLKER
FT                   RPEVYRIIVQLREDNKHK"
FT   CDS             422474..424453
FT                   /transl_table=11
FT                   /locus_tag="ERE_04690"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92567"
FT                   /db_xref="GOA:D4JGT3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGT3"
FT                   /protein_id="CBK92567.1"
FT                   /translation="MNINQTLKQYFGYDSLRTGQRELINGILAGQDVLGIMPTGAGKSL
FT                   CYQLPALMLKGITLVISPLISLMSDQVKALNQAGVHAAYINSSLTENQIRMALSYASQG
FT                   RYKIIYVAPERLNTQRFLDFAYNADISMLTVDEAHCISQWGQDFRPSYLEIAGFLTRLP
FT                   RRPIVSAFTATATERVKNDIVASLGLNNPVTMVTGFDRPNLFFRVVTRRGGSQKDNSII
FT                   NYVKKHEDESGIIYCATKKNVDKLYTLLNEQGISAGRYHAGLSNDERKQNQEDFTYDRI
FT                   RVMVATNAFGMGIDKSNVRYVLHYNMPQSLEYYYQEAGRAGRDGEEAECVLFFSKQDIM
FT                   INKFLLQNKASAGDVASDMQKTANDQRKLQLMINYCETDKCLREFILSYFGDTTPCICN
FT                   KCSNCVVVEDEEEETYVETGKKRKKAAQLAGLNELGIALFEKLRSVRTGLAAEKSVPPY
FT                   IICSDKTLKDMCAKLPRDKEQLADVYGMGEQKIQNYGEAFVTAVNSFVADNPNPSGSTT
FT                   GERPQTVLSDEEAAETGSTRKKKLPFYIEPQRLDEVELTDKSRLTELTNKINELCPADK
FT                   EHKKLAASFINELLIAEGYLEEVTEGGNKIKRVTEKGRSVGIDEEERKAKFGGSYYAIT
FT                   HSKQSQQVIIEMLKKHYGSIKPQE"
FT   CDS             424641..425231
FT                   /transl_table=11
FT                   /locus_tag="ERE_04700"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92568"
FT                   /db_xref="GOA:D4JGT4"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGT4"
FT                   /protein_id="CBK92568.1"
FT                   /translation="MRNEKVQKLTLTALMAALSYVIFTFLQIKVTLPGGSATSFHLGNA
FT                   VVVLAALLLGGVYGGIGGAIGMTIGDLLDPIYITGAPKTFFLKFMIGIITGLVAHKLGK
FT                   ITYSTDKKHVFKWTVLAACAGMLFNFIFDPIISYFYDMLILGKPMAQLKIAWSVTTTGV
FT                   NAVISVIAATIVYMALRPVLIKANLFFKIGKEK"
FT   CDS             complement(425297..425962)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04710"
FT                   /product="Phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92569"
FT                   /db_xref="GOA:D4JGT5"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGT5"
FT                   /protein_id="CBK92569.1"
FT                   /translation="MNTQNTDKEISHNNINTNSSTKIKICGLTSPAEARYLNENHVDFA
FT                   GMVLFFPKSKRNISIEQAKEIMAALDASIKRVAVVVSPSIEQVRQIEAAGFDYVQIHGE
FT                   IPETEAQAAIAIPILKAFNVSDMGSYEKYHNDSRIAGYVFDAIEPGSGKTFDWKLVDNI
FT                   PRDEKLLLLAGGLNPDNVRMAIEAVHPDGVDVSSGVENDNGAGKNPEKIHDFVSAIKS"
FT   CDS             426391..427416
FT                   /transl_table=11
FT                   /locus_tag="ERE_04720"
FT                   /product="Cellulase M and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92570"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGT6"
FT                   /protein_id="CBK92570.1"
FT                   /translation="MSTEEIKEYIGTQLKALTSIASPTGFTKNATDYLMKQLEAMGYAP
FT                   QLSNKGNVSVEIGGEGAPLVLAAHVDTLGAMVRSIKDNGRLRPTTIGGHQWSTADGENC
FT                   MVFTRDGRMYTGVVLNTEPSAHVADEKVETKEENMEILLDENVNDKQGVAALGIQTGDI
FT                   IAMDPRTVITESGYIKSRFLDDKLSAAILLGVAHSVKEEGWKLNRKVTLLFTVYEEVGH
FT                   GGSFVPADTEEMISVDMGCVGADLGCTEHMVSICAKDSGGPYNYELVTELSNLAKSEGL
FT                   DYAIDVYPHYGSDVEATLHSGYDIRHGLIGAGVYASHNYERSHMDGVENTYKLLKKYIT
FT                   K"
FT   CDS             427476..427856
FT                   /transl_table=11
FT                   /locus_tag="ERE_04730"
FT                   /product="Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92571"
FT                   /db_xref="GOA:D4JGT7"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGT7"
FT                   /protein_id="CBK92571.1"
FT                   /translation="MNLKKVHHIAIIGSDYEKSKHFYVDLLGFSIIRENYRPERDDYKI
FT                   DLQLDDIELELFIIKNCPKRPGYPEAYGLRHLAFAVDSVDDTVRELNKMGIITEPIRLD
FT                   TYTGKKMTFFHDPDNLPLEIHE"
FT   CDS             427891..428310
FT                   /transl_table=11
FT                   /locus_tag="ERE_04740"
FT                   /product="Predicted DNA-binding protein with PD1-like
FT                   DNA-binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92572"
FT                   /db_xref="GOA:D4JGT8"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR025707"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGT8"
FT                   /protein_id="CBK92572.1"
FT                   /translation="MEYRKFDNIIIARIDKGEEILEQLKAIAITENIKLASINALGAIN
FT                   DFTVGVYKTDEKKYYSNSFKGYYEITSLTGTINTMDGEYYAHLHLSAGNEKGEVFGGHL
FT                   NRAVVSATCELVITVIDGKVDRVYDEETGLNVFNF"
FT   CDS             428816..429460
FT                   /transl_table=11
FT                   /locus_tag="ERE_04760"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92573"
FT                   /db_xref="InterPro:IPR009706"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGT9"
FT                   /protein_id="CBK92573.1"
FT                   /translation="MKKRITLIVFSVLIIVALYVLYCFNYIPHKKYTNADFNIEAYNSN
FT                   IDKDNDGIDDQTDILNNANNYIKTNPKYKSKYYNTGYPDDEYGVCTDVVAFALKDAGYD
FT                   LMVLVNEDIKNNKELYDIDAVDKNIDFRRVKNLKVYFDNNAISLTTDINEIEEWQGGDI
FT                   VVFKKHIGIISDKRNRKGICFVIHHANPYQIYYEEDILEHRDDIIGHYRIS"
FT   gap             429486..429904
FT                   /estimated_length=419
FT   CDS             430317..431159
FT                   /transl_table=11
FT                   /locus_tag="ERE_04770"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92574"
FT                   /db_xref="GOA:D4JGU0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGU0"
FT                   /protein_id="CBK92574.1"
FT                   /translation="MYEEIFNQIQSAANKRNLKDSTIHAYCTSVAHFLNHTAKDIDALT
FT                   TDDVDIFLTEKKLSGISPETYNHYHSGIRFFYKKILKKNWDDDDIPRMKRDRKLPTVLT
FT                   KTEISAILDATPNLKHKAMIATMYSGGLRVSEVTHLHYDDISRTKKNIHIRDGKSRSDR
FT                   YTLLADRTLEILTEYWFQCGRPRGILFPSSWTGDYLTKDSVIQFFRESAKRAGIQKHVS
FT                   THCLRHSFASHLFESGCDVKYIQALLGHRDPKSTEVYLHVSNKTLLGIRSPFDEMGGE"
FT   CDS             431156..432337
FT                   /transl_table=11
FT                   /locus_tag="ERE_04780"
FT                   /product="Putative transposase."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92575"
FT                   /db_xref="GOA:D4JGU1"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGU1"
FT                   /protein_id="CBK92575.1"
FT                   /translation="MIMEKSCTIQDVFERFYPSYEKRNSPPAHHRKTAYHIMNCKTGAF
FT                   GVNISVCEDCGCISIHNNSCRSRCCPMCQEFPKEKWIDAQKENVLDAPYYHVVFTVPEE
FT                   LNSIIYSNQKLLYDVLYHAASATLNELAKDAKYLGANIGYICILHTWGSAMNYHPHIHT
FT                   IVLGGGLDKDSKWKDTGGKFFLPYGVIAKVFRGKYLCELKSLWNDSKLEFHGTAEKYQN
FT                   HYCFKGLLDECYKKDWVAYCKETFNGAQSVINYLGKYTHRIAISNHRIKSMTEATVTYA
FT                   VKDYKNKGQWKEKTVPGEEFTHRFLMHVPPKRFVRIRHYGLLSCRNKSKKMTHCRNLLG
FT                   CKKYISALKNRSATEMIKLLYNIDVCRCSSCGGKMVPHLPDKHTPSVLAHMRC"
FT   CDS             432800..433429
FT                   /transl_table=11
FT                   /locus_tag="ERE_04790"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92576"
FT                   /db_xref="GOA:D4JGU2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGU2"
FT                   /protein_id="CBK92576.1"
FT                   /translation="MIASGILYALETEGYETNHATGIKDAGSLIEHYNFDLAIIDMQLP
FT                   DGTGFDVSEIFKNNATSVIFLTVVDDENTIVRAFDEGAQDYIVKPFRIRELLARVRRIL
FT                   SANIKNGEKDNIIYMGQAAIHTDEAKVYVNDKSIELTALEYRLLLIFASNKGILLTRQQ
FT                   ILDKIWDADGNFVEDNTLTVYVKRLREKLGEAIHIETVRGMGYRVD"
FT   CDS             434343..435023
FT                   /transl_table=11
FT                   /locus_tag="ERE_04810"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92577"
FT                   /db_xref="GOA:D4JGU3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGU3"
FT                   /protein_id="CBK92577.1"
FT                   /translation="MAVLEVKELTKKYGEGESEVIALDHVSFSVERGEFVAIIGASGSG
FT                   KSTLMNMIGGIDYPTSGSIIIDGNEIQAMSEDELAIFRRRNLGIVYQFYNLIPTLTAEE
FT                   NIALPWKLDGRKENKERLSEIVNMLGLEKRAKHLPGQMSGGQQQRVSIGRALINEPAFI
FT                   LADEPTGNLDSKTSREILDILKFTNQKYKQTILLVTHDEKIALQANRIITIGDGKIIKD
FT                   EVMK"
FT   CDS             435023..437011
FT                   /transl_table=11
FT                   /locus_tag="ERE_04820"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92578"
FT                   /db_xref="GOA:D4JGU4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGU4"
FT                   /protein_id="CBK92578.1"
FT                   /translation="MKITAQLALSQMKVNKKRTIAGIFAIALATSLITTVMCFVTSANK
FT                   MLTDFLGLDYGEYGGAYSLMLAIPALLLGLLIAAMSITVISNIFSASANKRIQEFGILK
FT                   CVGATGRQIRASVIYESLWLSLTAIPLGLIAGTILGYISVKFTGHFISDINDAAKEIIM
FT                   RPFTFSLPFHISVWTYLFAGVFSFCIVLFSAYRPAKKVGKFTAIQCVKGIGAGTVLKEI
FT                   QVKDSFIQKIFGCESAIAYKNMKRNKYGYKATIRALSLGILLFLLTGGLSGQAKEFQEW
FT                   MTPKSKEMMVDYSSNYDIEVNAKTGKEERKISRPVTSDQYNEITQKLEKYGIDVYGVGA
FT                   DTFTYNALLDKNTLTEDMLQVPKFSDDNGETRTEIVSVDDELYKKLCDRAGAEYGSILL
FT                   LNTYQYNDNGEYVSIKPFKDDVTQISLINAANEKNTLTIGGILEQSDLKEYGFVEETPY
FT                   PVRIVVPDADARYFDWFSMPSDEEDYTEYARSVMDEYYPIAAEDSYVEQGYTVRIARTD
FT                   AMVKMLNIAIVLAEIVMYGFVILLVLMGFTSVISTLTTNIRIRSREFAVLKSVGMTNKS
FT                   LCRMLYSESVFCVVNALVPGVILGIAIPFLINLSIRKAFPVLYHIPWAALFGDIFVLIG
FT                   IVFFITRAEIHKLRDKSIIDEIRMDIV"
FT   CDS             complement(437124..437711)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04830"
FT                   /product="Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92579"
FT                   /db_xref="GOA:D4JGU5"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGU5"
FT                   /protein_id="CBK92579.1"
FT                   /translation="MAKWVCTVCGYVYEGENPPAECPVCHVGADKFKKVEGDLTLAAEH
FT                   EFGVYASTVKNNPEISDEDKKYIFEQLKANFEGECSEVGMYLCMARVAHREGYPEIGLY
FT                   WEKAAYEEAEHAAKFAEMLGEDLEPNMKATTKDNLAWRVDCEFGATAGKTDLAKCAKKN
FT                   NLDAIHDTVHEMARDEARHGRALKGLLDRYFG"
FT   CDS             complement(437775..438161)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04840"
FT                   /product="Fe2+/Zn2+ uptake regulation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92580"
FT                   /db_xref="GOA:D4JGU6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGU6"
FT                   /protein_id="CBK92580.1"
FT                   /translation="MIKYSRQRESIVNFLASRTDHPTAETIYQNIKKEFPNISLGTVYR
FT                   NLSLLEEIGEIIKISTGVGPDHYDYNTAPHYHFICRGCGRVMDIDLDFADELMTQVQES
FT                   TDLAIESCSVSFTGLCPDCKNELS"
FT   CDS             438372..439133
FT                   /transl_table=11
FT                   /locus_tag="ERE_04850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92581"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGU7"
FT                   /protein_id="CBK92581.1"
FT                   /translation="MKRFVTYLYLYDGRIKGNNAGFIKVEINGEKSAFLVQIKNLGKYS
FT                   GKGRVYLIYEAEAAIEAGELTVKNGEAREIYNVDTENVKDSGKTFLQVLGVKIELENAD
FT                   EKFLASCWTDNTAAVIGKQLKVQADLLNKKNPVSTPKPEPGCQKEIHSQNVDDSQDKIR
FT                   RIDISELRTLPAKNWYIVNNSFLTHGYANYKHLVIKTDTDGRQYLGVPGVSEPQERMLA
FT                   GIFGFTEFEPAAPANAADVDSGVFGYWFCQL"
FT   CDS             439234..440016
FT                   /transl_table=11
FT                   /locus_tag="ERE_04860"
FT                   /product="uridine phosphorylase"
FT                   /EC_number="2.4.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92582"
FT                   /db_xref="GOA:D4JGU8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGU8"
FT                   /protein_id="CBK92582.1"
FT                   /translation="MKNYSKDPDRQYHIQVAKGEVGRYVIMPGDPKRCVKIAQYLDNPV
FT                   LIADNREFITYTGTLDGVKVSVTSTGIGGPSASIAMEELYRCGADTFVRIGTCGGMQTD
FT                   VKSGDIVIATGAIRMEGTSKEYAPIEFPAVADLDVTNALVAAAKQKNFTHHTGVVQCKD
FT                   AFYGQHEPEKMPAGYELINKWNAWRMLGCLASEMESAALFVVAAKLGVRAGSCFLVVAN
FT                   QEREKLGLENPVVRDTDMAVQVAVSAVRNLIHEDCAGE"
FT   CDS             439994..440704
FT                   /transl_table=11
FT                   /locus_tag="ERE_04870"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92583"
FT                   /db_xref="GOA:D4JGU9"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGU9"
FT                   /protein_id="CBK92583.1"
FT                   /translation="MRIAPENKSDIKHRNGEQTLDINEILKHVDHTLLSPQATWDEIRQ
FT                   ICDDAIKYHTASVCIPPSYVKQASKYLGERVKVCTVIGFPNGYSTTAVKAFETEDALAN
FT                   GAKEIDMVINIGWLKDKRYELIGDEIKKLKSICKDKVLKVIIETCFLTDDEKIRMCDIV
FT                   TSAGADYIKTSTGFGTAGATFDDIKLFSEHIGEGVKMKAAGGISSLDDAERFLELGADR
FT                   LGTSRVVKLIKAMD"
FT   CDS             440740..441159
FT                   /transl_table=11
FT                   /locus_tag="ERE_04880"
FT                   /product="cytidine deaminase"
FT                   /function="cytidine deaminase"
FT                   /EC_number="3.5.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92584"
FT                   /db_xref="GOA:D4JGV0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGV0"
FT                   /protein_id="CBK92584.1"
FT                   /translation="MDKKTIEKLIDTALAQLDFSYAPYSGFNVGAALLAKNQAVYTGCN
FT                   IENAAYTPTNCAERTAFFKAVSEGVRDFEAICIVGGKNQKATDYTAPCGVCRQVMMEFC
FT                   NPKTFKIILAIDRENYRIFTLDDMLPQGFGPANLE"
FT   CDS             441279..442265
FT                   /transl_table=11
FT                   /locus_tag="ERE_04890"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92585"
FT                   /db_xref="GOA:D4JGV1"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGV1"
FT                   /protein_id="CBK92585.1"
FT                   /translation="MEREENIRDNIIKLPKIELHCHLDGSLSREFVEKRLGRTVQEAEL
FT                   SVSDDCTSLAQYLEKFDLPGQCIQDEKGLEGAAYDVLKGMHRENVVYAEIRFAPLLSEN
FT                   ERMSCERVIEAMIKGLERGKKNFGIEYGLIVCAMRHHSEEQNRRMLHTAREFLGAGVCA
FT                   ADLAGAEVPYPMSGFMELFKYAKQLGLPFTIHAGECGNAQNIIDAVEAGAARIGHGIAM
FT                   RGHGDMERQLSAKGIGIELCPISNLQTKAVASADEYPIREFLDAGLKVTINTDNRTVSN
FT                   TTLSKELEFIERTYGIRDEELPLMMKNALDVAFADDAVKERIFRQLV"
FT   CDS             442341..443528
FT                   /transl_table=11
FT                   /locus_tag="ERE_04900"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92586"
FT                   /db_xref="GOA:D4JGV2"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGV2"
FT                   /protein_id="CBK92586.1"
FT                   /translation="MKKYNRIFVIVLDSLGIGAMPDSERFGDTDVDTFGHILERMQTLD
FT                   IPNLTRLGMLNLHCGGQMQPTAEPIGRFTRLAEASNGKDTMTGHWEMMGIKTEKPFKTF
FT                   TEHGFPPELIAELEKQCGKKVIGNKSASGTEIIEELGEEEIKNGSMIVYTSADSVLQIC
FT                   GNEETFDLQNLYRCCEIARIITLKDEWRVGRVIARPYVGKKKGEFVRTSNRHDYALKPT
FT                   DLTALNALKDSGLDVISVGKINDIFCGEGITEAFRSKSSVHGMEQTIDICEKDFKGLCF
FT                   VNLVDFDALWGHRRNVTGYGEEIEKFDKNLGILMEKLRDDDLLILTADHGNDPTYKGTD
FT                   HTREYVPFIAYSKSMKGGGAIEEEATFAVIGATIADNFGVKMPEGTIGHSILEEL"
FT   CDS             443584..444405
FT                   /transl_table=11
FT                   /locus_tag="ERE_04910"
FT                   /product="purine nucleoside phosphorylase I, inosine and
FT                   guanosine-specific"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92587"
FT                   /db_xref="GOA:D4JGV3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001369"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011270"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGV3"
FT                   /protein_id="CBK92587.1"
FT                   /translation="MNSIYEKLTTCLASVREKTDFVPETAIVLGSGLGDYAEQIKIETT
FT                   IDYKDIKGFPTSTVPGHKGRFVFGYVDSVPVVIMQGRVHYYEGYPITDVVLPTRLMGMM
FT                   GAKKLILTNAAGGLNTDFNPGDFMLISDHIATAIPSPLIGANIDELGERFPDMSEVYSR
FT                   RMREIVKEKADKLGIKLREGVYVQLTGPQYETPAEVRMCKILGGDAVGMSTACEALAAR
FT                   HMGLEVCGISCITNLAAGLSDKKLNHKEVQETADRVAQQFTELITAVVREV"
FT   CDS             444481..444918
FT                   /transl_table=11
FT                   /locus_tag="ERE_04920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92588"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGV4"
FT                   /protein_id="CBK92588.1"
FT                   /translation="MLNIYLGDMENAIYHPPVYFDNTYEDEWITDELSVKMIKDIDKSD
FT                   VIGPHLVQSPILGPISTKELSGGVKTLMLMAFEDSGKIFNASACGDNCAKWILRIAGKK
FT                   DLTINLHHIMDFGKDFEAKILNTGEIVHSMAEFISVAGKYV"
FT   CDS             444927..445895
FT                   /transl_table=11
FT                   /locus_tag="ERE_04930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92589"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGV5"
FT                   /protein_id="CBK92589.1"
FT                   /translation="MKGKHKIVVKNNRLHYEFEIKRNITIIKGDSATGKTTLINMIRQF
FT                   ANLGNASGIEIECDAPCTVLEGNMWQMLLKNLSGNIIFIDEENQFIRQQEFAELVKASD
FT                   NYFVIITRENLYNLPYSVEEIYGLYSSGKYQNTKQIYQEMYHIYPLNQDLSCKPDKIIV
FT                   EDTNSGYEYFKAISKEKNIVCESAGGKTKIFAMLEQLKAETESICVIADGAAIGPEMDA
FT                   LYKMSVEKGNIKLYLPESFEWIILSSELLEDKEIKDIMDKPENYIESQEYFSWERFFTK
FT                   LLVDKTAGTYLKYQKGKLNPTYLHEKNKNIILRNIKNSIDF"
FT   CDS             complement(445963..446508)
FT                   /transl_table=11
FT                   /locus_tag="ERE_04940"
FT                   /product="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92590"
FT                   /db_xref="GOA:D4JGV6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGV6"
FT                   /protein_id="CBK92590.1"
FT                   /translation="MFFQYETPRLLLKVLRADCAPQVLDFYNRDKELFEMYEIDRVPDF
FT                   YTVKHLQKVLRYEYNMAVKSQLFRFYVFEKENPYRIIGTVCIHNIAPAFYGSCEIGYKF
FT                   SSEFHHMGYATEAVGFCTKLAFNELRMHKVTAVVHPGNVPSMKLLNGLGFVQEGLLRDY
FT                   LMLHGQWCNHYIYGLVNK"
FT   CDS             446772..447245
FT                   /transl_table=11
FT                   /locus_tag="ERE_04950"
FT                   /product="Cytosine/adenosine deaminases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92591"
FT                   /db_xref="GOA:D4JGV7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGV7"
FT                   /protein_id="CBK92591.1"
FT                   /translation="MTQDEKYMKQAIKQAKKAYALDEVPIGCVIVAGDKIIARGYNRRN
FT                   TDKNPLAHAELSAIRKASKKTGDWRLEECTMYVTLEPCQMCAGAIVQARIPRVVIGAMN
FT                   PKAGCAGSIINLLQMQQFNHQVQTDIGICGDECSTMLSTFFKELRKKRKLQGE"
FT   CDS             448002..448886
FT                   /transl_table=11
FT                   /locus_tag="ERE_04960"
FT                   /product="NTP pyrophosphohydrolases containing a Zn-finger,
FT                   probably nucleic-acid-binding"
FT                   /EC_number="3.6.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92592"
FT                   /db_xref="GOA:D4JGV8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGV8"
FT                   /protein_id="CBK92592.1"
FT                   /translation="MIQDIAPHTWDITYKNIQPDPDSRVLFFSRGQLLVQQASDKPADE
FT                   SNQDIHQISFPRYEDIKTECHDAKYQYLFTLDDTAFFRVALSHADKMHILEVTGGKFIN
FT                   RHYMRSAAPKEYVLAAITGFHLDGWYDKNHFCGRCANRLVEDDVERMLRCPVCGNMVYP
FT                   RINPAVIVGVTNGDKLLLTKYNGREYKKYALVAGFNEIGESLEETVRREVMEETGLRVK
FT                   NIRYYKSQPWGFTDNILAGYFCEVDGTDEIEVDMQELSVAKWVSREEIPTSLEELSLTN
FT                   EMISVFRLDKGDF"
FT   CDS             448929..449363
FT                   /transl_table=11
FT                   /locus_tag="ERE_04970"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /function="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92593"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGV9"
FT                   /protein_id="CBK92593.1"
FT                   /translation="MKISTKGRYALRLMMDLAENNTGSPISLKDVAKRQDISDKYLEQI
FT                   ISILNKAGYVRSVRGAQGGYMLKMEPQNYTVGMILRQTEGSLAPVACIEDDEIVCDRQQ
FT                   QCVTSIVYKKINDAISGVVDNITLQDLVDWQNEKNGNYVI"
FT   CDS             449383..450576
FT                   /transl_table=11
FT                   /locus_tag="ERE_04980"
FT                   /product="cysteine desulfurase NifS"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92594"
FT                   /db_xref="GOA:D4JGW0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGW0"
FT                   /protein_id="CBK92594.1"
FT                   /translation="MSRLIYLDNAATTQVYPEVVDAMLPYFTEHYGNPSAIYSFADEAE
FT                   RAVDHARGEVADLIGAKKDEIYFTGGGSESDNWALKATAEAYAAKGKHIITSAIEHHAI
FT                   LHTAQWLEKHGFEVTYVGVDEDGKIKLDELKAAIRPDTILISVMAANNEIGTIQPLKEI
FT                   GEIAKEHGILFHTDAVQAFGHIPINVDDMHIDMLSASGHKLNGPKGIGVMYIRKGVKIR
FT                   SFIHGGAQERQRRAGTHNVPGIVGLGKAVELAKANMAERSAYETKLRDHLIERVTSEIP
FT                   YTRLNGHRTDRLPNNANFCFRFIEGESMLILLDQAGICGSSGSACTSGSLDPSHVLLAI
FT                   GLPHEIAHGSLRLTLSEKTTLEDIDYTVDKLKEIIARLRSMSPLYEDFVKKNGKSEA"
FT   CDS             450649..451095
FT                   /transl_table=11
FT                   /locus_tag="ERE_04990"
FT                   /product="FeS cluster assembly scaffold protein NifU,
FT                   Clostridium type"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_04990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92595"
FT                   /db_xref="GOA:D4JGW1"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR017787"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGW1"
FT                   /protein_id="CBK92595.1"
FT                   /translation="MAYSEKVMDHFNHPRNVGEMENPSGVGTVGNAKCGDIMRMYLDID
FT                   DNGIIQEAKFKTFGCGAAVATSSMATELVKGKTIQEALEVTNKAVMEALDGLPPVKVHC
FT                   SLLAEEAIHAALWDYAEKNGIKIEGLEKPVNDISEKEEAPEEDY"
FT   CDS             451095..452183
FT                   /transl_table=11
FT                   /locus_tag="ERE_05000"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /function="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92596"
FT                   /db_xref="GOA:D4JGW2"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGW2"
FT                   /protein_id="CBK92596.1"
FT                   /translation="MKKKVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQDEDVFKQ
FT                   SQEGGCCGLSAVEDARRVAAVLDIPYYVMNFKADFKKYVIDYFVSEYERAYTPNPCIAC
FT                   NRYVKWESLLHRSLEIGADYIATGHYARIAQLPNGRYTIANSVTAEKDQTYALYNLTQE
FT                   QLRRTLMPVGEYEKPQIRRIAEEAGLPVAHKSDSQDICFVPDHDYASFIENETGKTYEP
FT                   GNFVDESGNILGRHKGLIHYTIGQRKGLGITAATPLFVKELRPATNEVVISTNESLFSD
FT                   TCYISDINYMAQDHITPDTRSIGKVRYSHRGADCTLTPMENGMIKCVFDEPQRAMTPGQ
FT                   AAVFYQDGHVLCGGTIEKMMVN"
FT   CDS             452620..454038
FT                   /transl_table=11
FT                   /locus_tag="ERE_05010"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92597"
FT                   /db_xref="GOA:D4JGW3"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGW3"
FT                   /protein_id="CBK92597.1"
FT                   /translation="MLVGREKELHLLHDIQNDDSSHFVAVYGRRRVGKTFLIREAFGYR
FT                   FAFQHAGLSEGGMKEQIYAFTSSLKDAGYEVKKQPQNWLEAFEALKDVIRLSSEKKKII
FT                   FIDELSWMDTQKSDLMVALENFWNGFASARKDIVLIVCASATSWMLSKVVHNKGGLYNR
FT                   LTEQIHLRTFCLRECEAYVKAAGLALNRNQILQYYMIFGGVPYYWGFLKKGLSLSQNID
FT                   SILFEKDAPLRDEFKYLYASVFKKPENYVKIIEALGTKKVGMTREEIITATKIPNSGDL
FT                   TTKLEELESCGFIRKYNAFGMKKKNAIYQLMDCFTLFYFKFLKSEPTDEHFWTNQINTP
FT                   TVNTWLGLAFERVCMEHVDQIKFKLGISGVLTEVNSWYCKSDPDNGIFGSQIDMLIARK
FT                   DQVINLCEMKYSQSEYTITEKVDRSIRNKISDLRVVSGTKYAIYPTLITTYGVVENSYS
FT                   QELQSVVMMDDLFA"
FT   CDS             454191..455123
FT                   /transl_table=11
FT                   /locus_tag="ERE_05020"
FT                   /product="cysteine synthase A"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92598"
FT                   /db_xref="GOA:D4JGW4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGW4"
FT                   /protein_id="CBK92598.1"
FT                   /translation="MSNIYQGTLGLIGNTPLVELTHVEKAYGLEARLLAKLEYFNPAGS
FT                   VKDRIAKEMIEQAERDGKLKPGSTIIEPTSGNTGIGLAAIAAAKGYKIIIVLPETMSIE
FT                   RRNIIKAYGAELVLSDGTKGMKGAIAKAEELHEQIPDSFIPEQFENPANPEAHRKTTGP
FT                   EIWNDTDGQVDAFVAGVGTGGTITGTGEYLKSKNPDVKIIAVEPETSAVLSTGKAGAHK
FT                   IQGIGAGFVPNTLNTEVYDEIIPVSNEASFEYGKIIAKEEGVLVGISSGAALYAAIEVA
FT                   KRPEFKGKTVVALLPDSGDRYYSTDLFKD"
FT   CDS             complement(455265..456389)
FT                   /transl_table=11
FT                   /locus_tag="ERE_05030"
FT                   /product="HipA N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92599"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR012894"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGW5"
FT                   /protein_id="CBK92599.1"
FT                   /translation="MNRLNKLEVFYHERLVGTIALYQNRLAAFEYDSNWLANGFSISPF
FT                   SLPLEKKVFMPKIDPFEGLFGVFADSLPDGWGRLLVDRLMKKNGINPYDIGSLERLAIV
FT                   GASGMGALTYQPVITMEKNHDEKSLDEIALECEKILSTETCDNLDFLFSKGGSSGGARP
FT                   KILTKVDGEDWIIKFPSSYDSKDIGRQEYDYAMCAKECGIAMENVRLFSSERTKGYFGT
FT                   KRFDRTNDSRSRRIHMVSTSGLLETSHRIPNLDYDILMQLTLQLTKSMEECEKLYRLMC
FT                   FNVYAHNRDDHSKNFTYLYDEDEGCWKLSPAYDLTYSNSIGGEHATTVNGNGVNPELDD
FT                   ILAVAQKIGLNMTMARKTALNIRDCVNEMLGEYL"
FT   CDS             complement(456373..456654)
FT                   /transl_table=11
FT                   /locus_tag="ERE_05040"
FT                   /product="transcriptional regulator"
FT                   /function="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92600"
FT                   /db_xref="GOA:D4JGW6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGW6"
FT                   /protein_id="CBK92600.1"
FT                   /translation="MINLYQKTWTEINNNIAQKIVRLRKRKKITQKQLAARSGVSLGSL
FT                   KRFEQSGEISLQSLTKIAIALDVENELEDLFNNVPFASIEEVINEQTK"
FT   CDS             complement(456728..457327)
FT                   /transl_table=11
FT                   /locus_tag="ERE_05050"
FT                   /product="Radical SAM superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92601"
FT                   /db_xref="GOA:D4JGW7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023821"
FT                   /db_xref="InterPro:IPR023822"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGW7"
FT                   /protein_id="CBK92601.1"
FT                   /translation="MADIIYTYKNEVYANITNKCDCACTFCIRSQKDAIGNATSLWHTV
FT                   DPTYDEIIAAIDAFDFTGYEEFVFCGYGEPTCALDILEKTAKYVKEKYKLPIRVNTNGL
FT                   GNLYHGRDIVPELSEYIDSVSISLNAANAEEYNKVTRPTFDNAYEAMLDFAEECNRMIK
FT                   HTQLSIVDVLPEEDIKTCQQIADERGIHLKIRHFSN"
FT   CDS             complement(457327..457872)
FT                   /transl_table=11
FT                   /locus_tag="ERE_05060"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92602"
FT                   /db_xref="GOA:D4JGW8"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="InterPro:IPR023812"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGW8"
FT                   /protein_id="CBK92602.1"
FT                   /translation="MNSQVKKLTFTALMAAMITIFTAYICHIPVGQNGGYIHFGDSLIY
FT                   IAACLLPWPYAMTAAAIGGGMADLLTAPIWAPATIIIKALISIPFTNKSDKIVTVRNVV
FT                   STIIAFAISATGYAIAEAFITYGFTKHAFTGLIAIIPVSVPGSCIQSGGSAIIFVILGL
FT                   VLDKIGFKRRFFTLEETK"
FT   CDS             complement(457972..458859)
FT                   /transl_table=11
FT                   /locus_tag="ERE_05070"
FT                   /product="Pyridoxal/pyridoxine/pyridoxamine kinase"
FT                   /EC_number="2.7.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92603"
FT                   /db_xref="GOA:D4JGW9"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGW9"
FT                   /protein_id="CBK92603.1"
FT                   /translation="MNIKNLAKKFGGYMKKAAVFNDLSGFGKCSLTAAIPVLSAQGVQC
FT                   CPMASAVLTNQTGYEYHKCTDLTAMIKDYIDNWQKNNAHFDGIYSGFMTGSKQIELFMD
FT                   FLDVFYEKNTMLLVDPVMGDDGRTYGIYSAALLDGMKALSRKADVITPNLTEACLLADY
FT                   DIEKVYSDTRKDVLLPIAAEISEKLRCLSGKNQDVIITGIKCRDDKSPFIYNLVTTANG
FT                   TTTHRSHFFDVSFSGTGDLFASVICGSRLNGFSTEEAAERAGKFLYDSIADTMNDDTAP
FT                   NDGVNFEKFLRELM"
FT   CDS             459127..459417
FT                   /transl_table=11
FT                   /locus_tag="ERE_05080"
FT                   /product="CarD-like/TRCF domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92604"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGX0"
FT                   /protein_id="CBK92604.1"
FT                   /translation="MFQKKQIIYSETLGVCVVDNIVSLAASKREKAVPYYVLKPVFEDK
FT                   VSYIPVEHHRVVLRDMFTREEALKLKETEQYKNDKHLRQAVDYVLDKVAIK"
FT   CDS             459444..459728
FT                   /transl_table=11
FT                   /locus_tag="ERE_05090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92605"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGX1"
FT                   /protein_id="CBK92605.1"
FT                   /translation="MGQQHAIHKFVLGTKDFDDKQSEFMYDKGWYSITDIVGEEKNIIY
FT                   KSRNAQEAYLKWNIYIGRKKERLTPEERKRQREERYEKKREQNREHHRI"
FT   CDS             459738..460388
FT                   /transl_table=11
FT                   /locus_tag="ERE_05100"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92606"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGX2"
FT                   /protein_id="CBK92606.1"
FT                   /translation="MGIFNIDNKFFRALNKLVDMVILSFCWIISCIPVFTIGAASTALY
FT                   DTSRRVIHRDEGYVWRGYWHAFKVNFKQATKAWLVQLIILIVLLGDIYITWSGLKTGNQ
FT                   WGTFSIVFIIMALIAAAWAIYTSAYISRFEQVTKITLKNTMLILIANLPWTLLVIVILV
FT                   VSLILVWILIPLIFILPVGAALTYEFIFERIFRKLMPEEDRLREEEKDKEYRG"
FT   CDS             460433..461506
FT                   /transl_table=11
FT                   /locus_tag="ERE_05110"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92607"
FT                   /db_xref="GOA:D4JGX3"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGX3"
FT                   /protein_id="CBK92607.1"
FT                   /translation="MKKIGMLTSGGDCQALNAAMRGVVKALAHNIDELEIYGFENGYKG
FT                   LIYENYRILTSKDFSGILTKGGTILGSSRQPFKLMRVPDENGLDKVAAMKNTYKKLGLD
FT                   CLVILGGNGTQKTANLLREEGLNVIHLPKTIDNDIYGTDVTFGFQSAINIATDAIDCIH
FT                   TTAASHNRVFIVEVMGHKVGWLTLYAGVAGGADIILLPEIPYDIDKVVDAIHKRTKEGK
FT                   GFTILAVAEGAISKEDAALSKKEYKKKLAKSKYPSVSYEVADRISERLGLEVRVAVPGH
FT                   TQRGGSPCPYDRVLCTRLGSAAAKAIMDEDYGCMIAMVNGQTKRIPLADVAGKLKTVDP
FT                   KSQMIKEAKRTGICFGD"
FT   CDS             463163..463504
FT                   /transl_table=11
FT                   /locus_tag="ERE_05130"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92608"
FT                   /db_xref="GOA:D4JGX4"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGX4"
FT                   /protein_id="CBK92608.1"
FT                   /translation="MARRGGFPGGMPGNMNNLMKQAQKMQRQMEEAQKQLEDAEVTAKA
FT                   GGGAVEVTVSGKKEITKVKLSEEVVDPDDIEMLEDLIMAATNEALRQIDEQSQASMSKI
FT                   TGGLGGGLF"
FT   CDS             463504..464100
FT                   /transl_table=11
FT                   /locus_tag="ERE_05140"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92609"
FT                   /db_xref="GOA:D4JGX5"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGX5"
FT                   /protein_id="CBK92609.1"
FT                   /translation="MDFYSSEISKLIEELSQLPGIGAKTAQRLAFHIINMPKEQAKSLS
FT                   DAIIDAKEHVRYCKCCYTLTDDELCPICKDAARDHKTIMVVENTRDLVAYEKTGKYEGV
FT                   YHVLGGAISPMLGIGPADIRLKELMVRLEKDVNEVIIATNSSLEGETTAMYISKLIKPT
FT                   GIKVTRIASGVPVGGDLEYIDEVTLLRALQGRTEI"
FT   CDS             464101..464955
FT                   /transl_table=11
FT                   /locus_tag="ERE_05150"
FT                   /product="Transketolase, N-terminal subunit"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92610"
FT                   /db_xref="GOA:D4JGX6"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGX6"
FT                   /protein_id="CBK92610.1"
FT                   /translation="MIEGDIMNNLELEKMANEIRKDIVTAVHSAKSGHPGGSLSSADIF
FT                   TYLYFEEMNVDPANPKWEDRDRFVLSKGHVAPGLYSTLAEKGYFPKEDLKTLRHTGSYL
FT                   QGHPDMKHIPGIDMSSGSLGQGVSVAVGMAAAGKYDKKDYRVYTLTGDGEIQEGQIWEA
FT                   AMWAGHRKLDNLVVIVDNNNLQIDGSVEDVCSPYPIDKKFEAFNFHVINIDGNDFDQIR
FT                   AAFKEARETKGMPTAIIAKTVKGKGVSFMENAAGWHGKAPNDEEYEIAMADLEKAGEAL
FT                   CQK"
FT   CDS             464943..465884
FT                   /transl_table=11
FT                   /locus_tag="ERE_05160"
FT                   /product="Transketolase, C-terminal subunit"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92611"
FT                   /db_xref="GOA:D4JGX7"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGX7"
FT                   /protein_id="CBK92611.1"
FT                   /translation="MSEVKKIATRDSYGNALVELGKAHDDLIVLDADLAGATKTCIFQK
FT                   EFPERHWDCGIAECNMTGIAAGLATCGKVPFISSFAMFAAGRNYDQVRNSIGYPHLNVK
FT                   IGATHAGISVGEDGATHQCLEDLSLMREIPGMVVINPSDDVEARAAVKAAYDHVGPVYL
FT                   RFGRLAVPVINDTPDYKFEIGKGIVLGEGKDVSIFATGLEVSETLEAAKMLAADGIDAE
FT                   VINIHTIKPIDRELIVKSVSKTGKAVTVEEHSINGGLGSAVAEVLCEEQPAKLLRIGVE
FT                   DRFGESGPAVELIHKYGLDAEGIYNKVKNYMK"
FT   CDS             466257..467231
FT                   /transl_table=11
FT                   /locus_tag="ERE_05170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92612"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGX8"
FT                   /protein_id="CBK92612.1"
FT                   /translation="MIDIVTNNVRQIGTPADEGRVYISEKAYKRIKTEGFKDKEVFVLM
FT                   GHTESSGGRYATFVEAAIAVYDMEFDKNAPLWTNKVWSRVFAEIKKSYEELIIVGWAFR
FT                   QEDFPAEPTPMLENIHREHFGGAHQLMFLLNRTEQEENFFIKKNNHLKKKTGFFVYYRM
FT                   NEHCDSADSYNETDTCNKTYSYSNANNNNKIDSYSNADDNNKSSSRYEDTDTAAESSYS
FT                   RIHRRASADDRINVSFPEEFGSISKERGRYRKAMEAGKEPRKGSFASVVMIAAIAVLIV
FT                   LIGLKAGAGMSGTLDKKETLPAMSTEEDLIPVEKISGEWYTDK"
FT   CDS             468450..469064
FT                   /transl_table=11
FT                   /locus_tag="ERE_05190"
FT                   /product="Colicin V production protein."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92613"
FT                   /db_xref="GOA:D4JGX9"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGX9"
FT                   /protein_id="CBK92613.1"
FT                   /translation="MNWLLIAVICIIAWNVVRGYTRGVLRMVYSLAAWIVMLAASTMAA
FT                   PYVRDQILSQTGIEPVILNGIEKQIAAQGQKATGDFDMANILLQQSGAYDTISAQLTNA
FT                   IMTGLSFFIVFFLLGIVAYIVRHIIRKIERVPVIGTVNRIAGFAVGFIKGMVIVWLLLA
FT                   LTSLFAASEIGQTMTAYINDSMMLKYLYENNPVIKLIENIL"
FT   CDS             469576..470244
FT                   /transl_table=11
FT                   /locus_tag="ERE_05200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92614"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGY0"
FT                   /protein_id="CBK92614.1"
FT                   /translation="MGILISNATSSAITKYSVSLRSGEPDWSMIPSTGKSNKSQAEFVS
FT                   EIKELAQRAANTTSKTELESIHRQRTRLCAEYISDVSPDRKALYQQAKNAVKSQNGNPK
FT                   CKGIGELSLLDFLERAEGKNNNLAQKKFALAGGGTLECPILTGEGYGADISYQGTKVLT
FT                   YLGDSYGWGCERTPAEREKEREFYGMYFNEYHTQKNAQSSEVKELPNYLEEKTSFDRKV
FT                   "
FT   CDS             471036..471671
FT                   /transl_table=11
FT                   /locus_tag="ERE_05230"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92615"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="InterPro:IPR026272"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGY1"
FT                   /protein_id="CBK92615.1"
FT                   /translation="MIRQHKKMILLTSIITLFPIFIGLLLWNQLPDSLATHWGINNEPN
FT                   GYASKTFAVFGLPLIMLLGHAVSVIAMNIDPKVKNISEKVYFVILWIIPLLSLFVCNVL
FT                   YGYNLGYQLDMGFLCGLMIGVFYLILGNFIPKVKPNYTIGFRISWALCDPENWYRTHRF
FT                   GGKCMVIGGIIMIVTAPFQNMWILIVLILVPCILPVIYSYLYYRKIIS"
FT   CDS             471933..472244
FT                   /transl_table=11
FT                   /locus_tag="ERE_05240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92616"
FT                   /db_xref="InterPro:IPR024540"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGY2"
FT                   /protein_id="CBK92616.1"
FT                   /translation="MSKITDYAFLFQKTFGTSGENVIGSFQLSQLNSSSVQSQLKAAGY
FT                   TLEKYERIYRQAFYDAAKKADPNWKIGKPIKDGALDSVTRELAESGKSPAQATLDTKI"
FT   gap             472350..473877
FT                   /estimated_length=1528
FT   CDS             474026..474514
FT                   /transl_table=11
FT                   /locus_tag="ERE_05260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92617"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGY3"
FT                   /protein_id="CBK92617.1"
FT                   /translation="MGISFSNIGTVGREQLITSGSNGEPNWSYIPSKGKSTKKANNRTY
FT                   QFADEKTKKQIAYMSGYYLQTVPQSVKAAWQETLEETGFNPFQTDVTSILTQLSVEQDF
FT                   LTGGDDNIFGETKESYLAAIDKVLERIENPLAAVTDERAAYLQQEKEFYTVLASKIRE"
FT   CDS             474537..475490
FT                   /transl_table=11
FT                   /locus_tag="ERE_05270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92618"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGY4"
FT                   /protein_id="CBK92618.1"
FT                   /translation="MIGSIGAESRYSTGYNNLKPNRNQNKWADTLAQTVDKEDISSRAD
FT                   INRAKKSTVMDSYLALSGKTINTLKQEYSEYESENYRIVPDNEAECFDIYNKDGERLGA
FT                   FSYSDIKIRQDETTGKQFLISEHGTMSYDALVLDDELKDALQNVMDKDSLDVETLQGFT
FT                   LNTHSGTGIQYLVKDGEEGRGGKVLLQNEADWKRYEELAEMYFDKYPNLIESREEGFIW
FT                   ADLEIRGMAKRTDQGIISIGADGMSYSDNENYKNNWSVRFSGSMYEKLYEWLQNNKDSM
FT                   EEIHKFSTWQKVFDEIGGTYERVWSKEELDQGYLNN"
FT   CDS             475504..476247
FT                   /transl_table=11
FT                   /locus_tag="ERE_05280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92619"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGY5"
FT                   /protein_id="CBK92619.1"
FT                   /translation="MKIFNYMNNTNSIMEKNTDKVQKGNSQTNEKHTVGQSVKLSISNE
FT                   GLEYYRNRIQQSGQEKYDDVVQRKELLASKKISDIDYSYEIQKKAAQQNQNVDTGKSAL
FT                   NITDKANNYVKAYAELYDEIVKGYENGTREIYVADENGPRKLTKDEELSNLDAAYKKTV
FT                   DDFVTMETTNQHARGIIGEEMNKISKITTRSTLASAYIEEQKNRGKDEIPENLTEKMYG
FT                   AITSFKEKYTMIQPNREQLLMSIKI"
FT   gap             476490..477577
FT                   /estimated_length=1088
FT   CDS             477789..478376
FT                   /transl_table=11
FT                   /locus_tag="ERE_05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92620"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGY6"
FT                   /protein_id="CBK92620.1"
FT                   /translation="MEVSNNYSTAKLWGTSDKKVSKSSEKNKWKLTDSLKEKIVELAKK
FT                   DAQDNVYMGNAFMNLRKMEVSKVAPNRAALIGKFNQSMNSGNMSAMKEVEKADKKWLCI
FT                   LFGIPYEAEFQGEGTGSAAHVYNECGEEVLTYTEGVGWQEKETKAESQVHSALKSTYYE
FT                   AFCDARKALNSEQRTGGMNENIMSQDNFDMKA"
FT   CDS             478938..480128
FT                   /transl_table=11
FT                   /locus_tag="ERE_05320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92621"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGY7"
FT                   /protein_id="CBK92621.1"
FT                   /translation="MNIFFNSRIYANQSLLNVLFGQQQKATISRSNGCIGTRDTLTISA
FT                   SGKEKLTKSTSGRTHNTSIDSSIDLKSYIASAKKTNQEIIENAGTQINAKTSEYMSTGK
FT                   AFREALTEKYSKLAAEAKTHSNPENYIHSKYFDKSSEYYETNLTDTERRIAYNYEMQMC
FT                   RTGKINGVNYQDSLFRGIEVDGDSVDSDKIQFERALINSQISNILKQAGVDTSSITKDC
FT                   TFTVDPYSYEITVDGVDEETKVLMQDALNVGDNGKNLYKHIYYCSTQDGCESSQITKES
FT                   KMKYEAYHQVYSYTGYELDKLEEKNGTYYTESGENILDLVDKAVEDSGKVPKEFKQQMK
FT                   NWIHDLVSTMSTKGWNNVPDMTLSILYGKSGLKDMNQLITYQYEADSTNRQWYSVL"
FT   CDS             480320..480733
FT                   /transl_table=11
FT                   /locus_tag="ERE_05330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92622"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGY8"
FT                   /protein_id="CBK92622.1"
FT                   /translation="MKKRKIATILLAACLLLGNVSVANAASIDNGNKVHFNTEDNDTDL
FT                   TLLQSKIATEEVTCDFTDATNDGASAYADTRRVSNKYMWSASTMEYNFSDQKWTSNTEI
FT                   FSTYAKTSEGFVMSGFLLNPKGQSNYNSALREG"
FT   CDS             480741..482183
FT                   /transl_table=11
FT                   /locus_tag="ERE_05340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92623"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGY9"
FT                   /protein_id="CBK92623.1"
FT                   /translation="MGHYVHYIGGGIVDSKIYETGNAAKSFKSPMKELNEQTVLIENAK
FT                   TNKNDSYHQHTKYDDQVDRYYSTYDIGTLLHNNESYLEGTIDSKYDVDYYSFSYPQKSF
FT                   YSKMGISSEITISLESKNSQAYNLVLYDLYGNQIGIATDDGHGNKQLTVPNWDCVTSDY
FT                   VIRVENSNMTSDSGEGSYRIKITETKNRDTSSSNVQHSQEIANADNSEEKNAIKQKYEK
FT                   TYQSEIDKLHQMQFEALPEDEKYSGTDSVEELLNKMKKGEQLSVSEMAYVKIFANLSDY
FT                   ERAEKSNYIKNDFYAEIERIANEKGIELPDTSWKIEIDVSGTITINGDITEENKEQIKN
FT                   MISENFADDMWEKYIQTADISNTQYRLVNAYYEVEQFIQKATNGQYSFDDINVDDNGKI
FT                   TGLPEKMCKIMNSQEANAKYEEIRDNIYMLTDYKNQYGLEDILAFKAGYNISDSEVSTV
FT                   GTSGNNSVMDNAGYYKNMKTII"
FT   gap             482460..483121
FT                   /estimated_length=662
FT   CDS             483547..484839
FT                   /transl_table=11
FT                   /locus_tag="ERE_05360"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92624"
FT                   /db_xref="GOA:D4JGZ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGZ0"
FT                   /protein_id="CBK92624.1"
FT                   /translation="MNTILLILCNALSCFIISTILFQFMNGKYKKSSQSRYVYIVIETV
FT                   TVIFTTCINMLNHSILNLVVWGVLTGIIAYALYYEDMDKPLRRIIECEALVFCMSVCES
FT                   LGVILLQCILQAADIKNVNETMLYCLEVTFSKVILIFLYYTFINRFVKKSDIPYAKTRY
FT                   IMYGIILLYNLINMGVIVENFKNGEENYLCAVNMGCIVLADLYLLYFVKMADEKNYYEK
FT                   QLIALEQQAKVQYEYYLTQTKKYDQTVHILHDVNKHIKAIEGLYGAEQGNTAGEYAAEI
FT                   RELLKPLIPVQYTENPILNILLTDKESVMREKGISVTIKVDNVNLNFLAPIDITTIFGN
FT                   LLDNAIEAAEKLEGGKYISIKIGSYHKMIAASIENNCGEVKWKNGFPVSAKGKGGGIGL
FT                   LNVQSSVKKYDGNLILKSDGNKFIAELFLNS"
FT   CDS             485000..485656
FT                   /transl_table=11
FT                   /locus_tag="ERE_05370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92625"
FT                   /db_xref="InterPro:IPR024540"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGZ1"
FT                   /protein_id="CBK92625.1"
FT                   /translation="MSRITDYGFLFQTTFGTSKTNLVNNIQLSQMNSSSVQKQLKAAGI
FT                   DTNSKKYKAALSEMMKNGNGAMFTNVQAIKNLMSQYDKNGDWIDPNTGLTGLAVTDENR
FT                   NSYKHIISIPESSREEMFELAKKEFLNENGTLNGDTTKRESVYNNLYRKMDKDDRLSAG
FT                   WTMEQYEHQYRQAFAEAAKAADPTWKAGKPIPAGALDGITRESVESGKKSVDIKI"
FT   CDS             485853..>486029
FT                   /transl_table=11
FT                   /locus_tag="ERE_05380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92626"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGZ2"
FT                   /protein_id="CBK92626.1"
FT                   /translation="MYIGSGLNTVSSLYGQQKGNQMKTPASGEKTFCTVETLQNFIQIR
FT                   FVFLVINQIKPSTY"
FT   rRNA            complement(486009..488891)
FT                   /gene="23S"
FT                   /locus_tag="ERE_R_37120"
FT                   /product="23S rRNA"
FT   gap             489046..489769
FT                   /estimated_length=724
FT   rRNA            complement(489815..491335)
FT                   /gene="16S"
FT                   /locus_tag="ERE_R_37130"
FT                   /product="16S rRNA"
FT   CDS             491540..492958
FT                   /transl_table=11
FT                   /locus_tag="ERE_05390"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92627"
FT                   /db_xref="GOA:D4JGZ3"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGZ3"
FT                   /protein_id="CBK92627.1"
FT                   /translation="MEQKKQEPIRDARQLGTAKMLILGLQHMFAMFGATIVVPILVSGY
FT                   FQKACGEPLTRGLSVSVTLFCAGFGTLIFHLCTKFKVPAFLGSSFAFLGGFYTVANLDS
FT                   GMYADMAVNDKAAYACGGIFVAGMLYFVLALIIKLVGIKRVMRFLPPVVTGPIIICIGL
FT                   SLAGSAINNASTNWVLAIIALGVIIIFNIWGKGLFKIIPILMGVIISYVVALIMNTAGI
FT                   TNPDGSAILDFTSIASSAWVGIPKFQFMKFDITSILVMAPIAIATMMEHIGDMSAISAT
FT                   VEQNFIADPGLHRTLIGDGIATAFAGAIGGPANTTYGENTGVLELSKVYDPRVIRIAAV
FT                   FAIALSFIPKFSAVISTMPSAIIGGVSFMLYGMISAIGVRNVVENKVDLTKSRNLIIAG
FT                   VIFVCGLGFGNGLTFTVAGTSITLTALAIAAIAGIFLNAILPGNDYEFGKNPDGDASRG
FT                   VYMMNTDNDEEEES"
FT   CDS             493133..494158
FT                   /transl_table=11
FT                   /locus_tag="ERE_05400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92628"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGZ4"
FT                   /protein_id="CBK92628.1"
FT                   /translation="MDRKKIFWAIASVFIAILSIWTVVSQSKHFSFEILMSFIINANKG
FT                   WLFMSFVCTFGFIWFEGFALVRMARHFGYKTSAIDGTVYGGADVYFSAITPSASGGQPA
FT                   SAYFMIRDGIPGYAATVALLINLVMYTLSLLTIGLLCMIFKYPLLKNFSGISRIFICLG
FT                   IVVLIFLALVFYMLLRKGSILYSICDSLIRLFEKIHIIRHGDRLRIKLKNTMKEYQECS
FT                   NSITGQTGLLIEIFFWNIMQRVSQLLVSFMIFMAVGEGVNKAVDVSVIQCFVAMGSNCV
FT                   PIPGAMGVADYIMIDGFKQLVGSNAANMELLCRGMTFYGSVITSAVIILIGYIIRKKVA
FT                   K"
FT   CDS             494256..495296
FT                   /transl_table=11
FT                   /locus_tag="ERE_05410"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92629"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGZ5"
FT                   /protein_id="CBK92629.1"
FT                   /translation="MSSNDSTAKEQSFLFNVNKIFLVIHLLMLFMFSSLGVDLMAGVSL
FT                   ISICFYFLAFSLTKSEKLSIYVYSVAVEILLYMILAVVCLGIQCNFQLFLIDAMFFLFS
FT                   MDYVVLRKKKKNHVAILLCCVYAIALIILYMLDGFYTPLYKLDSVVIKSISIAMISGVV
FT                   FLIITCMMCLLHFMSSEEGAMEKQAQFDALTELPNRFYMMAKLKNLFEAEKQGEYFLAM
FT                   IDIDDFKKINDSFGHNVGDDALKMLARTIVNKARGVELSYCRWGGEEFLLLGKCVDGEV
FT                   PKNFLDELRVEINSKSFWTSKGSGRMTVTIGAGKYKVGQDYKEWINFVDKQLYVGKCTG
FT                   KNKVVC"
FT   tRNA            495458..495543
FT                   /locus_tag="ERE_T_36630"
FT   CDS             495739..497568
FT                   /transl_table=11
FT                   /locus_tag="ERE_05420"
FT                   /product="Phosphoglycerol transferase and related proteins,
FT                   alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92630"
FT                   /db_xref="GOA:D4JGZ6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGZ6"
FT                   /protein_id="CBK92630.1"
FT                   /translation="MIKKIYKKYEIIFNVIFFSIFPITAFYLMEFYEHNPFEEVRFMAG
FT                   FFNIILFELIAWILYFVTGRAKWALRAVFIVAMVFGLINHYVMLFRSTPFVPWDIFSIG
FT                   TATSVASNYDFAPTAGVVVVTVIFIALIMLMHFVDFRIKWKFRFRLIPTVLGLLVMCLF
FT                   VNALQDEDFQTDNYLYPFLFTPAYMTKVNGMAVTFAMDLKFVAVDKPDGYSRQKAKELL
FT                   DSYAGTDDNTAITDKSDYPNIIVVMDEAFSDLSVLGDFDTNTDYMPFVHSLEKGNENTI
FT                   TGYLNTSVCGGNTADTEFEFLTGNTMAFLPVGSIPYQQYIKSTTPSLASYLKSIGYATY
FT                   AQHPYYGSGWNRDTVYPLLGFDNLSFMQDYSNQRFVRKYISDETSFDKIIETYENKPDG
FT                   QPAFIFNVTMQNHGGYTDTYYGFDNTVTADKLNNSALDQYLSLIKLTDEDLKSLIEYFS
FT                   NVDEKTIVVFFGDHQPNDTVASSVLAANGMDYNNLSNEELKLRYQVPYVIWANYDIDEA
FT                   AGKDTSVNYLAANVLKAAGVPTNDYQSFLLKLQEEYPIISAVRTDKTADKTLDKASNKS
FT                   DKATGSKKKQADSDMLNDYKLLQYYRLFDWEDK"
FT   CDS             497568..500099
FT                   /transl_table=11
FT                   /locus_tag="ERE_05430"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92631"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGZ7"
FT                   /protein_id="CBK92631.1"
FT                   /translation="MNFVKKHPLLTAFLIPFFICIIICIGNGVYPFGDYCLLHMDLYHQ
FT                   YLPFFNELWEKLRNGASLMYTWNIGLGSDFVSVFAYYLASPLNWLVVLFSKSHIIEFIE
FT                   LLIIFKISLSGATFFYFLKEHFVLLGKDNRYHNNTFVPAFVFSTAYALSGFVAAYSWDV
FT                   MWMDVVAVAPLAIVGLEKLVRDKKPVLYYVSLALCILSNYYLSIMLCIFLVFWFAWLFF
FT                   TQNGGKMAAIVRFAVYSLLAGGTAMVLIIPELIILSYSGSSGIEFPKQIEWYFNLLSEV
FT                   GRMCTTASVYEGAENWPNLYAGAFSVMLLILFVLNKRINWKKKIAPVLFVLFFMASFAN
FT                   KQLDFIWHGLHFPDSLPGRQSYLYAFLVLTIGYATVRKWRGIRLWHIGVAVVFASALMA
FT                   VSTMFADEDVTEYYAVIISILFVALYGIMTVLLKLAARKNRELLMAITCGIAIVELAVN
FT                   MAVTGLGCTGRSSYNANVDDMQKALELAKEDAADNDVPFYRVEDTGRLTKNDDTRYGYA
FT                   SGTQFSSLMNINVSHFYQALYMEGGKNFYCYNGATPVTSAMLSVRYMVTKSIQPQNELT
FT                   TLVGKCGNHYLYRNNYTLPLGFMMDEGVIDAWKPSSSSKIYSINSLGRLLGAADDMLTM
FT                   TECTQDENPGTTTLTFDHDGYYYAAYDSCSTDSLTFSHGEYETTYSKTTHRYLFDLGYV
FT                   KAGETVSVTNTDADAVRFNVYELSIAAVESAYNTLNEQTLSVDDFSDTHISGHIDVKQA
FT                   GQLVLSIPSEKGWTMKVDGKDAEYEDFSDTFVSIHLDEGEHEIELYYETPGLKAGAAIS
FT                   AGCVGVFLLLLLLRQIVKRRSRLKFKANSDR"
FT   CDS             500206..500763
FT                   /transl_table=11
FT                   /locus_tag="ERE_05440"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (trigger factor)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92632"
FT                   /db_xref="GOA:D4JGZ8"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGZ8"
FT                   /protein_id="CBK92632.1"
FT                   /translation="MNKQNKKIAQEKRRIEREKAEKKAKVVNLLKFWVPVVAVVVVVIV
FT                   LIWAVATSGGSSSKGTDGTEAASQTTESQASETQSSDSQTEAATLNTEVDTVAENGDKV
FT                   NIDYTGYMDGEKFEGGSTDGQGTDLVLGSGSYIDGFEDGVVGHKVGETFDLNLKFPDDY
FT                   KANTELAGKDVTFEVTLNGVYK"
FT   CDS             500782..502725
FT                   /transl_table=11
FT                   /locus_tag="ERE_05450"
FT                   /product="Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92633"
FT                   /db_xref="GOA:D4JGZ9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JGZ9"
FT                   /protein_id="CBK92633.1"
FT                   /translation="MEKSFEEVLVQFYVDQYRENAKRSTGKPVKLAHYIHRLNNKAKSI
FT                   KYARFSKNETIALDKLHQEIKRLALITYYSNNKNARQILNREILPQLVRVDMEQFDEKE
FT                   AEYLTEDFLKLLRKEYIGAICTRSMKALYNEYRSKELRREIVTLVPARPELEFPKAQSM
FT                   KRHFILHIGPTNSGKTYQALERLKLAQNGVYLGPLRLLALEVYEKMNDAGIPCTMLTGQ
FT                   ECLEVSDSRITASTVEMLDCDKEYDIAVIDEAQMVADDDRGHSWTRAILGTLAGEIHIC
FT                   MSPVAKDVVIHLINLCHDEYEIREYERKTALKLEDKPFSFPQDVREGDAFIVFSKKSVL
FT                   NIAGRLEENGIKPSVIYGSLPPEIRRRQMTLFNEKKTQVVVSTDAIGMGLNLPVRRIVF
FT                   LEVEKFDGVSRRPLVISEIKQIAGRAGRFGLYDTGYVTALGQKNLNYLKNTLNIPEQDI
FT                   DIVSLGFPQVLLTMDAPLDAIIKLWHEAKPSAPFRKINVDEILFLYGYAYKERYFIADF
FT                   DNKYLLYKMITCPIDIKDRELVRQWLRYCMSYTSDISLDKPDKHSKYQGLMKYESYYKK
FT                   LDLYYQFSVRMGKIVEEDWLENERDKTQAKIMQLLSKSKDEYIIRCRYCGRILPIGNSR
FT                   NICRDCYSMIRR"
FT   CDS             502820..503281
FT                   /transl_table=11
FT                   /locus_tag="ERE_05460"
FT                   /product="conserved hypothetical protein TIGR00051"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92634"
FT                   /db_xref="GOA:D4JH00"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH00"
FT                   /protein_id="CBK92634.1"
FT                   /translation="MANNELQIAGSQGELRIRPYEHHAKYYETDQMGIIHHSNYVKWME
FT                   EARLDLMDQIGLNYRQMEDMEIISPVLSISVEYHSMVHFDDTVVIYTKLLKYNGIKMEL
FT                   EYVMKDKETGELRTTAKSSHCFLNKSGKPISLKRMYPELDTKFFEFKEA"
FT   CDS             503286..505076
FT                   /transl_table=11
FT                   /locus_tag="ERE_05470"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92635"
FT                   /db_xref="GOA:D4JH01"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH01"
FT                   /protein_id="CBK92635.1"
FT                   /translation="MIQDRLKALRSEMAKRGISLYVVPTADFHESEYVGEHFKARKYIT
FT                   GFTGSAGTAVITMDEAGLWTDGRYFVQAAAQLKDTTVKLFKIGEEGVPTVDEYIKDTLS
FT                   DGGVIGFDGRVVNAAWGKRLSEIAKEKHGSMYVNEDLIDLIWTDRPPMSKAPVMIFDNK
FT                   YTGEDISSKLKRVREHMAQKGATLHLMSSLYDIAWLLNVRGGDISYVPVVLSYLALSQD
FT                   SCIWFLQEEVVTETLKAYLDKNGIQTRPYDDFYEYVKYIDEKETVLLNTSIVNYRICDS
FT                   LPDGVKVIDAEDPTVVMKAVKNEVQLENLRKAHLKDAVAMCKFMYWLKTNIGKIPMTEI
FT                   SASDYLASLRAEQEGFLDLSFATICGYADHGAIVHYSATEESDRQLKPESLLLVDSGGH
FT                   YLEGTTDITRTFALGPVTDEMKDMFTRVCRSNMNLANARFKEGCSGLNFDILAREPLWE
FT                   IGMDYNHGTGHGVGYVLNVHEEPNSFHWKQYPGRTAERVIEEGMVTTDEPGIYLEGKFG
FT                   IRTENELICRKGEKNEYGQFMYFENLTYVPIDLDAIDPNQMTDREKGYLNAYHARVYEL
FT                   VSPFLNDEEAQWLKKYTRAI"
FT   CDS             505146..507857
FT                   /transl_table=11
FT                   /locus_tag="ERE_05480"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92636"
FT                   /db_xref="GOA:D4JH02"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH02"
FT                   /protein_id="CBK92636.1"
FT                   /translation="MSEKLVLIDGHSILNRAYHGLPDLTNSEGLHTNAVYGFLNIMFKI
FT                   LDEEKPDYLTVAFDVHAPTFRHRMFDAYKGTRKPMDEELRQQVPMIKEMLTAMGIKIVE
FT                   KEGYEADDILGTLSVRAEKAGMDVAIISGDRDLLQLATDHVMVRIPKTKKTGTEIENYN
FT                   TADVIEKYGVTPKEFIDVKALQGDTSDNIPGVPGIGEKTAGALIAKYHCIEAVHEDAEN
FT                   VKPPRASKNIVEYWEQALMSKELATIILDAPVDYEFSDAKLSGGVESLYTEEAFLLCKR
FT                   YEFKNMLSRFNVEAPKNNAEEHFVIVRDLKTAESVFEKAKGREVAFAVVPGESLENSES
FT                   DGQLSLFSEPVSNDYLAVSICFSEEDIYFICTGDEISSSFLDEKLNTLEVKSWISPDLK
FT                   TNLHRFKSKEIKADDRGRYFDMMVAAYLINPLVGEYPYDAVAKDYLGLMLSSKKDYLGK
FT                   LDFTQMMKEDEKKAVDCACYEVYTAWKSKPVLLQKLKEMDMLTLYRDIELPLVFVLYDM
FT                   ENEGIRADGIKLKEYGDKLAVSITELEKKIYEAAGEEFNINSPKQLGVILFEKLGLPNE
FT                   KKTKTGYSTAADVLEKLAPEYPIVADILEYRQLTKLKSTYADGLSGYIASDGKIHTTLN
FT                   QTITATGRLSSTEPNLQNIPIRIELGKLIRKVFLPEEGDLFVDSDYSQIELRVLAALSG
FT                   DERMIEAFKNGQDIHRSTASLVFDTPFDEVTDLQRRNAKAVNFGIVYGISAFGLSNDLG
FT                   ISRKEAQGYIDSYFVKYPKIKEFLDQTVLDAKKNGYTKTMFGRIRPIPELNSSNFMQRQ
FT                   FGERVAMNSPIQGTAADIIKIAMIRVHDRLLDEGLKSRLILQVHDELLIETKEAEKDKV
FT                   IKLLEKEMRGAVNMKVSMEVGTECGYDWYDAH"
FT   CDS             507835..508476
FT                   /transl_table=11
FT                   /locus_tag="ERE_05490"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92637"
FT                   /db_xref="GOA:D4JH03"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH03"
FT                   /protein_id="CBK92637.1"
FT                   /translation="MTGMMRIDDRKGNSMIFIGITGGVGAGKSAVLSYLKELDGIRVML
FT                   SDEIAHELMEPGSDCYNRLKELFAEEPIWLEDGHFDRTALAGVIFSDDKKRELLNEVVH
FT                   PAVKEYVLNAVKEAKKEGLFMLVLEAALLIEEGYGEICDELWYIYASEEVRRKRLKSSR
FT                   GYSDEKIDSIFASQLKEAEYRRHCKEVIDNDGDIENTIASINKALSKYKE"
FT   CDS             508482..510710
FT                   /transl_table=11
FT                   /locus_tag="ERE_05500"
FT                   /product="Actin-like ATPase involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92638"
FT                   /db_xref="GOA:D4JH04"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH04"
FT                   /protein_id="CBK92638.1"
FT                   /translation="MNNVFGLDIGTRNVVGTVGYQTDDKEFVVTAQYVREHETRAMLDG
FT                   QIHDIGRVAKTIKEVKDELEKQTGQPLEEVCIAAAGRVLKTVTTHVEYEYAQESVVTGE
FT                   DVHTLDLLGIEKAQEALKEVNDTSYKFYCVGYSTVKFFLNDEVFISLEGHKANKIGEDI
FT                   IVTFLPEDVVDGLYAAVGQAGLSVANMTLEPIAAINVAIPENYRMLNIALVDVGAGTSD
FT                   ISITRDGSIIAYGMIPHAGDELTEVIVQHFLVDFNMAESIKLQSTTSDTVTYKDIMSIE
FT                   HTIPAKDVWDVAAPVVDNIAQEVSTKIRELNGDKTVSACFVVGGGGKIHGFTEKLAEDL
FT                   DLPEERVALRGEEVLGDVTFEQEDIKKDPLLVTPIGICLNYYDQRNNFIMVRFNGERIK
FT                   LYDNNRLTIVDAALQAGFPNDELFPKRGTPINFTVNGVARLVRGEAGDGAVVTMNGKPA
FT                   SINTPLEPNSEIVIEPSTAGEAAVYKISQLDEYNHSVITFIINGRRVSCPRFVQVNGEL
FT                   EPEDYSIRENDVIETRNYYTVRQIAQFMDLVIDTDQMIFVNNEEAGLDTLVYENFSVEW
FT                   KTDEYGVARIDNNNYNDTQESDSDDASVLAEQDANSTESDNTVTGTSEQMMNQVLDELH
FT                   DDFAKEAEASAVPENELPENELPKNDIQEDIQEEDSSKNTVTVIVNGEPVELSGKDTYI
FT                   FVDIFTHISFDLQAGKGRAIATVINGRDARFSEELHEGDKIELYWKEN"
FT   CDS             510712..511515
FT                   /transl_table=11
FT                   /locus_tag="ERE_05510"
FT                   /product="Metal-dependent hydrolases of the beta-lactamase
FT                   superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92639"
FT                   /db_xref="GOA:D4JH05"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH05"
FT                   /protein_id="CBK92639.1"
FT                   /translation="MLELCSIASGSSGNCICVGTDDCHVLIDAGISGKKIENGLNEFDM
FT                   TATDMQGILVTHEHIDHIAGLGVMARRYHIPIYATKATIGAIKCTKSVGNIDDELFHPV
FT                   EAGVDFTIGDIEFEPLHISHDAADPVAYRFKNENHAMAVVTDLGTYDDALVSKLQNLDG
FT                   LLLEANHDINMLQTGAYPYPLKRRIMGDSGHLSNERSGQLLCELLHDKFGSVILGHLSK
FT                   ENNYEKLAYEAVRLEVTMGDNPYKASDFPMYVAKRDRASDRIAVE"
FT   CDS             511538..511822
FT                   /transl_table=11
FT                   /locus_tag="ERE_05520"
FT                   /product="ACT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92640"
FT                   /db_xref="GOA:D4JH06"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH06"
FT                   /protein_id="CBK92640.1"
FT                   /translation="MDNTKNKVIITVVGKDTVGIIAKVCTYLSEGSVNVLDISQTIVSG
FT                   YFNMMMIVDMANATASFAEISDQLDALGEEIGVTIKCQKEEIFEMMHRI"
FT   CDS             511866..513230
FT                   /transl_table=11
FT                   /locus_tag="ERE_05530"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92641"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH07"
FT                   /protein_id="CBK92641.1"
FT                   /translation="MINIGEVIETNDMVEKENLDVRTITLGISLLDCIDSDLAKVNENI
FT                   YNKITTLAKNLVSTGKEIENNYCIPIVNKRISVTPIALVGGAACKSSEDFVTIAKTLDR
FT                   AAKEVGVNFIGGYSALVSKGMTKADELLIKSIPQAMLETDLVCSSVNVGSTKTGINMDA
FT                   VKLIGEMIKETAEVTKHLPVSGCAKFVVFCNAPDDNPFMAGAFHGVTEADAIINVGVSG
FT                   PGVVKTALEKVRGENFEVLCETIKKTAFKVTRVGQLVAKEASKKLGVPFGIIDLSLAPT
FT                   PAIGDSVADILCEIGLERAGAPGTTAALALLNDQVKKGGIMASSYVGGLSGAFIPVSED
FT                   QGMIDAVNDGALTLEKLEAMTCVCSVGLDMIAIPGDTKATTISGIIADEMAIGMINQKT
FT                   TACRLLPAIGKDVGDVVEIGGLLGSAPVMPVNRFSCDAFVNRGGRIPAPIHSFKN"
FT   CDS             514305..515483
FT                   /transl_table=11
FT                   /locus_tag="ERE_05550"
FT                   /product="AICAR transformylase/IMP cyclohydrolase PurH
FT                   (only IMP cyclohydrolase domain in Aful)"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92642"
FT                   /db_xref="GOA:D4JH08"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024050"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH08"
FT                   /protein_id="CBK92642.1"
FT                   /translation="MQEYELKYGCNPNQKPARIFMKEGELPIKVLNGRAGYINFLDAFN
FT                   GWQLVRELKKATGLPAATSFKHVSPAGAAVGQPLSDVEKKIYWVDDMDIEFTPLANAYI
FT                   RARGADRMSSFGDFISLSDVCDKSTALVIKREVSDGVIAPGYTDEALEILKAKKKGNYC
FT                   VIEIDPSYEPAPIERKDVFGITFEQGRNELHIDDDFFSNIVTENKELTEQAKIDLAISM
FT                   ITLKYTQSNSVCYVKGGQAIGIGAGQQSRIHCTRLAGSKADNWWLRQSPQVLGLQFVDG
FT                   IRRADRDNTIDLYIGEDYMDVLAEGEWQKFFKVKPDVFTAEEKRAWLDKNTDVALGSDA
FT                   FFPFGDNIERAHKSGVKYVAQPGGSVRDDHVIDTCNKYGMVMSFTGIRLFHH"
FT   CDS             515603..519073
FT                   /transl_table=11
FT                   /locus_tag="ERE_05560"
FT                   /product="ATP-dependent nuclease, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92643"
FT                   /db_xref="GOA:D4JH09"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH09"
FT                   /protein_id="CBK92643.1"
FT                   /translation="MSLQFITGNSGNGKTKYLFNRIVKEAKANPRDNYLVIVPEQFTMQ
FT                   TQRQLVDLSENKAIMNIDVLSFKRLAYRVFDELGITNLTVLEETGKNLVLRKLAAQEAD
FT                   KLGVIGRNLNRIGYISEVKSLLSELVQYNISPEELGRYIASGRLSDTLSDKLKDVLVLY
FT                   EAFEKFMQDKYITAEEILNVLSNVAEESAILRNSVIAFDEFTGFTPIQNQLIKKLFVIS
FT                   KKIYVTLTIDCREDIFKSRGMQELFDMPKRTVKSLTEMAAFYGIEVEEPIILDKNYRLA
FT                   ENEELSFMEQQFFRKRRCSFKKVPKHIHIDCLRDPKQELTKIARRINELVRNENLRYRD
FT                   IAIVTGDVNIYAGYVREIFDKYNIPYFIDATQEILFHPFIEFIRSIPDIAAQNFSADAV
FT                   FRFLRCGFSELLDSEIDVLENYVLACGVRGKSAWDKKWVRLPKHKAGYDIELLNQSREY
FT                   IMELLKPVYQVFSDKKSTVKDYVLAIYKLIVLLDIPDKLAKKEQALLDAGDQTASKEYG
FT                   QIYKIVMQLFEKYVAVLGDECMDAEEFTQILDAGLDAADVAVIPPGYDTVTIGDIERTR
FT                   LTNIKVMFFAGVNDGIVPKAAGRGGIISQYEREALKELDIELAPGAREQAFIQRFYLYL
FT                   NMTKPSRELYISYTRLDSEKKAAQPSYLIGILKGMFPELVVTETEDVEQLLDISSRQSA
FT                   LDYLLSNEVDDRWCEIAAAVMLYDASVSDAGDGNEVDDKEFTQKNSVERLINARFEHYS
FT                   KDPISRNVARSIYGRHMEGSITRFEQFARCAYAHFLNYGLRLTEREESGFTSLDMGNIY
FT                   HEALERYSKKLDRESTDWFSVTDAKRDELAMEAINEVIDEYAGFGIFDTAESQHSISHM
FT                   KAVFKQTVWALTTQIRRGSFVPERFEFSFYESLDMANDVTVDIKGRVDRTDTYTDEGRL
FT                   FVKVLDYKSGNTVFDLVKLYYGTQLQLAVYMDAVMEQKKEALKQVSVEPGGMLYYHIDD
FT                   PVIDLKDVTPGTELSEEEINQMILKKLKPDGLINSDEKAYRGMDRDFEKSSDVIPVTLK
FT                   KDQTPAAGSKVANAEEFDVITRFAREKLREIGREIYDGNVAVNPIKNKKIDSCAYCAFQ
FT                   AICRYDSRIPGFSERSFNGDNKEDVLDKMRTQIAAAEHKACYGDNNIKP"
FT   CDS             519088..522750
FT                   /transl_table=11
FT                   /locus_tag="ERE_05570"
FT                   /product="recombination helicase AddA, Firmicutes type"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92644"
FT                   /db_xref="GOA:D4JH10"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH10"
FT                   /protein_id="CBK92644.1"
FT                   /translation="MDVKWTSEQKKVIDLRDRDILVSAAAGSGKTAVLVERIVNRICVD
FT                   NPPVDIDRMLVVTFTKAAAAEMRERVSRAIDSLKEQKPDDENLQRQSTLVHNALITTID
FT                   SFCLFVVQNNFAQLNLDPDFRIGDQAELKLMLKDALAQVFEDNYAREDNEEFINLIDTY
FT                   SKGRNDSAVRQMVEDIYYKAGSSSWPRKWMNSLLRLYDIKSAKQLEDSEIIKEIVDYSR
FT                   VLLEEAVQELTMAKDLASATPGLEKYALTLSEDIALFDGMADVTGYVGMQEFLNKISFG
FT                   RIAVIRKFDGDEKKKERVKSMRDATKKKVDGIKQKYFGMSIELMYEQLERQRPFVKELI
FT                   RLSLEFYDAMEAVKTRKRVFDFSDIEHFALRILVDEQTLEPTETAREFSKHFEEIMIDE
FT                   YQDSNQVQEDILTAISREHQGVGNMFMVGDVKQSIYRFRMARPELFMEKYNTYTSDDSA
FT                   HQRIDLHKNFRSRNEVLDFTNDIFYKIMAADLGNVQYDDDAALYPGASYPKETMRPELL
FT                   LVDYKDEDLSEIIEDEDGDKVQIEALLIANRIRSLMENGMVTDKKTGQLRAVQYRDIVI
FT                   LSRSVATWGNTVAAVLKDCDIPAHVESNTGYFSSYEIQVILSMLRILDNPLQDIPMAAV
FT                   LASPIVGMDDEELAQIRSAFKGVSFAQAALSAMAGENGYEDEKLKAFALVFERLRGAVA
FT                   DTPIHELLYMMLDETGFYRYASAMPAGKRRRQNIDMLIEMAAAYEKTSYKGLFHFVRYI
FT                   DIQQKYEIDYGEADTAGENDDVVRIMTIHKSKGLEFPVVFVSGLGKGFNTQDTKSDLVI
FT                   HEKLGLGLVEKTKSPRTKRPSLIRNEIESRIKRENLGEELRVLYVALTRAKEKIILTGG
FT                   LSNAQKSFEKYRGNVNANQPISFGQREGAGCYLDWVIPAMLSYPDKYTVSTVDATEFAA
FT                   RTAMDMAANDISKAQLIGHISAADETKAKELAEEFDFEYAYASDITKKSKYSVSELKHD
FT                   SMVEKYDSTEREAERPKFLLEEKETYVPDFARDDEAGGASNESKELKNAVGVNQGALRG
FT                   TAVHRAMECLDFKSLCDIDTKDHVAVSAFVKKSMDEMLKKGLITDDMYRLTRPKLIEQF
FT                   ISSDVAARMAQADKRGDLYKEKPFVMDYEGVLVQGIIDVFWLENDKIVLLDYKTDRVNA
FT                   AKELIDRYSTQLKLYADALGRIFSTDGKSIQADERLIYSFRLQQTIVICREYKK"
FT   CDS             522879..523157
FT                   /transl_table=11
FT                   /locus_tag="ERE_05580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92645"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH11"
FT                   /protein_id="CBK92645.1"
FT                   /translation="MEEYNMYEYDDEVLDTFLKKQTQLFSEEVADTPEAAEEFLEDCMA
FT                   VVCKNIKEVRDYFDEAGSDISGMSDDELMDQSEVFAIADGRFLVVEG"
FT   CDS             523163..524152
FT                   /transl_table=11
FT                   /locus_tag="ERE_05590"
FT                   /product="PPIC-type PPIASE domain."
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92646"
FT                   /db_xref="GOA:D4JH12"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH12"
FT                   /protein_id="CBK92646.1"
FT                   /translation="MKYFKKTMCMLLASATLLTGCSIGGKEIVLDINTTNSHTVFSVDN
FT                   MKCDKTEALIYLANYKNLYGTMYDVNLLETDDASNVEKYIRDVTVDELTRIYCMVSIAK
FT                   QKKITLTDKEKSSVSKAAKEYYDSLNEAEKKFTKADLSDMESAYEHYAIAQKLYNSLSK
FT                   GVDTEVSDEDARVIHIQKIFVKSKESADSVSQKLLSKEDFAAVASGSSEDSQTELYAAK
FT                   GTLPQEVEAVAFELGDGETSDMISTDDGYYFIKCISKLDREKTEQNKVTILQKRQQEQF
FT                   NDDYEHFVKKAGFSLNNDLWDSISIKDEKDVKTSSFFTVYNKYFQADN"
FT   CDS             524193..524705
FT                   /transl_table=11
FT                   /locus_tag="ERE_05600"
FT                   /product="PAP2 superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92647"
FT                   /db_xref="GOA:D4JH13"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH13"
FT                   /protein_id="CBK92647.1"
FT                   /translation="MDWEFDILYAIQSIRTPFLDKLMAFLSTLGNAGVLWIVIGVVLCV
FT                   SKKYRRGGMQMLSAELLSFIVGNLIIKNMVDRLRPCQIDETVSLIVKIPFDSSFPSGHT
FT                   LNGITAAVTLMFIDKRMGIPAIVLAVLIAFSRMYNFMHFPTDVLAGAVLGVVSAVFVNF
FT                   LFKRAGN"
FT   CDS             complement(524793..526883)
FT                   /transl_table=11
FT                   /locus_tag="ERE_05610"
FT                   /product="Molecular chaperone, HSP90 family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92648"
FT                   /db_xref="GOA:D4JH14"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH14"
FT                   /protein_id="CBK92648.1"
FT                   /translation="MTEKHGNLSIDSDNLFPIIKKWLYSDHDIFYRELISNGCDAITKL
FT                   KKLDMMGEYSLPADYKGKIQVLVNPDEKTIKIIDNGLGMTADEVEEYISRIAFSGATDF
FT                   IEKYKDKSNDDQIIGHFGLGFYSAFMVADEVTIDTLSYKEGSTPVHWSCDGGTEYNMED
FT                   GDMDDVGTEITLYLNDDCLEFANEYRAREVIEKYCSFMPTEIYLAKENAPEEYETIDKA
FT                   DKRDTDTVIEEIHEDAKYEEKENDKGEKEQVEVSPAKDQLKIVKRPVPLNDTTPLWIKS
FT                   PNECTDEEYKEFYRKVFLDYKEPLFWIHLNMDYPFNLKGILYFPKINTEYDSIEGTIKL
FT                   YNNQVFIADNIKEVIPEFLMLLKGVIDCPDLPLNVSRSALQNDGFVKKISEYITKKVAD
FT                   KLIGMCKTDKEAYEKYWDDISPFIKFGCLKDEKFCDKINDYILFKDINDKYQTLPELLA
FT                   PVAEDEKSDAESADASDDTKKADNTDANASDENKEPEKNTVYYVTDVVQQGQYIKLFKE
FT                   QGMNAVILDHNIDTSFITQLEQRNDHYKFMRIDADLTESLKDESGADLTEATTTLSEVF
FT                   KKALNNDKLTVKVENLKNADVASVLTLSEQGRRMQDMMKMYAAGGMGGMDPSMFAADQT
FT                   LTLNANNELVKYILDNKDSEHVPMFAEQLYDLAMLSNQPLSVDQMTKFVKRSNDIMLLL
FT                   TK"
FT   CDS             527642..528028
FT                   /transl_table=11
FT                   /locus_tag="ERE_05620"
FT                   /product="Thioesterase superfamily"
FT                   /function="Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92649"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH15"
FT                   /protein_id="CBK92649.1"
FT                   /translation="MLQTGIKGKKEITVTLDKTAKAMGSGTMDVFATPAMIALMENTAF
FT                   ESVASELEEGSGTVGTALDIKHVSATPVGMKVTCESELVKVDGRALTFSVKAFDEAGLI
FT                   GEGTHERFIVFEEKFQKKADDKAK"
FT   CDS             528012..528974
FT                   /transl_table=11
FT                   /locus_tag="ERE_05630"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92650"
FT                   /db_xref="GOA:D4JH16"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH16"
FT                   /protein_id="CBK92650.1"
FT                   /translation="MTKQSRPDLDSKTPEIKTEKRKAVGGDCKESNIEEKSARKYSRRW
FT                   DIIVTAFDFVTNFSESSISAYAGQAAFFLMLSFFPFLLFFFSLLSWTPLTEADFLMWAS
FT                   SFIPESFGDIMKDLASEVYASGTGRLSITMITAVYLSSKAFISFQLGLDDMYHVKENRN
FT                   FILRRIYSVLYSIVFALALIFLLGIMVFGNMLRKMYFSNVHHIIGSIIGSVVDYRLVIC
FT                   LPVLILFFWVIYVFLPNKKQRAKYQLPGAVFAAAAWMIFSGIFSVYVDKYNNYSSFYGT
FT                   MTTIALIMVWLYGCMYVLFIGGIINRTWEERMEAKKYYK"
FT   CDS             528997..529953
FT                   /transl_table=11
FT                   /locus_tag="ERE_05640"
FT                   /product="serine O-acetyltransferase"
FT                   /function="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92651"
FT                   /db_xref="GOA:D4JH17"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH17"
FT                   /protein_id="CBK92651.1"
FT                   /translation="MDNNKEMIEGLVSQILDDYHDDKIINQQALFSQPDKEAVCDLLSK
FT                   LIKIMYPGYFKGTSFRYYNLDSQIAVLLEDIMYNLRKQVVLALPQNPKYRSLSHHELVN
FT                   MSEKISNDFFKRIPKIRALVETDVAAFFDGDPAAYNYNEIILCYPGLLAITTNRIAHEL
FT                   HLLGVPLIPRMMTEHAHSKTGIDIHPGATIGKNFFIDHGTGIVVGETTIIGDNVKVYQG
FT                   VTIGALSTRGGQKLKGVKRHPTIEDNVIIYAGASILGGETVIGRGAVIGSNAFITSSIE
FT                   PGARVSIKNQELSIRTGERKELVASEMETDSSWFYVI"
FT   gap             530163..531313
FT                   /estimated_length=1151
FT   CDS             531993..532202
FT                   /transl_table=11
FT                   /locus_tag="ERE_05650"
FT                   /product="Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92652"
FT                   /db_xref="GOA:D4JH18"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH18"
FT                   /protein_id="CBK92652.1"
FT                   /translation="MPLSMSGAGEAQIIKKIGGKEEVRSFLEKLGFVVGTEVTVISEIA
FT                   GNMIVNVKGARVAIGKDMANKIMV"
FT   CDS             532233..532316
FT                   /transl_table=11
FT                   /locus_tag="ERE_05660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92653"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH19"
FT                   /protein_id="CBK92653.1"
FT                   /translation="MYDIYNIYNIYNIYNTYNTFSNVLYKL"
FT   CDS             532411..532632
FT                   /transl_table=11
FT                   /locus_tag="ERE_05670"
FT                   /product="Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92654"
FT                   /db_xref="GOA:D4JH20"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH20"
FT                   /protein_id="CBK92654.1"
FT                   /translation="MKTLKQAKVGETVKVVKLTGQGAVKRRIMDMGITKGVEIFIRKVA
FT                   PLGDPVEVTVRGYELSLRKDDASMIEVE"
FT   CDS             532706..534856
FT                   /transl_table=11
FT                   /locus_tag="ERE_05680"
FT                   /product="ferrous iron transporter FeoB"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92655"
FT                   /db_xref="GOA:D4JH21"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011619"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH21"
FT                   /protein_id="CBK92655.1"
FT                   /translation="MTVKIALAGNPNCGKTTLFNALTGANQYVGNWPGVTVEKKEGKLI
FT                   GHKDVDLVDLPGIYSLSPYTLEEVVARNYLIGEQPDAIINIVDGTNIERNLYLTTQIIE
FT                   LGIPVLMAVNMMDIVKKNGDTINIKALGEKLGCEVVEISALKKTGIKETAEKAIQIAKS
FT                   GKSVQRVHHFADDVESTIAGIEDKLGLAVAENQKRFFAIKLLERDSKISEVLKSAPNVD
FT                   AEIKALEDKYDDDTESIITNERYQYISSIIGSCVKKARAGKETVSDKIDKIVTNRFLAL
FT                   PIFALIMWAVYYVAVSSLGGIVTDWTNDTLFGEWIQPAVQTFMENVGCSEWLVSLVVDG
FT                   IIGGLGAPIGFAPQMAIVFLFLSILEDCGYMARVAFIMDRIFRRFGLSGKSFIPFLIGS
FT                   GCGVPGIMATRTIENEKDRRMTMMTVTNIPCGAKLPVIALIAGFIMGDGCWWMAPLMYF
FT                   AGIGLTIIYCIILKKTRAFAGEPAPFVMELPQYHIPSVKGVLLHVWERVWAFIKKAGTI
FT                   LFLCCAVMWFLSSFGIQDGAFGLVDKENSLLAVIGSAIAVIFAPLGFDTWQAVASSLSG
FT                   FVAKEGIVSTMGVLAGLGEVEEYAVSMHDQFAAFFPTTMVAVSFLLFNLFDSPCLAAIS
FT                   TTAKELNNRKFFWFTIIFQNVSAYCVTLMFYQIVGLCIGEVAFNFWTVVAFVLLAGVLY
FT                   LLFRKDPNKATAKSTSFAASNV"
FT   CDS             535029..535166
FT                   /transl_table=11
FT                   /locus_tag="ERE_05690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92656"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH22"
FT                   /protein_id="CBK92656.1"
FT                   /translation="MLADIIVIAILVVIVALVIRTIIKSKKAGKSLQCGMDCSHCRGCH
FT                   "
FT   CDS             535207..535527
FT                   /transl_table=11
FT                   /locus_tag="ERE_05700"
FT                   /product="Fe2+/Zn2+ uptake regulation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92657"
FT                   /db_xref="GOA:D4JH23"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH23"
FT                   /protein_id="CBK92657.1"
FT                   /translation="MERTHLPLKLHLPASVTIGGCMSKEAIEQKEVIVGKLKDSGCRIT
FT                   KQRLILLDVILEGECGSCKEIYYRASKIDRSIGTATVYRMINTLEEIGAIDRKNMYRVQ
FT                   VS"
FT   CDS             535727..536344
FT                   /transl_table=11
FT                   /locus_tag="ERE_05710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92658"
FT                   /db_xref="InterPro:IPR024523"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH24"
FT                   /protein_id="CBK92658.1"
FT                   /translation="MCQEVFQIAMSMDLKSVEMQLALQCAPLITGARISNMLMIDSADE
FT                   SAMRVILRASGISHFRLAARNEKTAFLLFRRSLLEAYLNNSEALDILKKAGYEDFSFGK
FT                   ILLRFKRRYEAYLNDEHKRFPHEMGLLLGYPIEDVRGFIEHNGCGCLYSGYWKVYRNVP
FT                   LKKKMFEDFEKAKESVIQLLAEDIDMRLILEIYKEEPQQIAV"
FT   CDS             536356..536787
FT                   /transl_table=11
FT                   /locus_tag="ERE_05720"
FT                   /product="flavodoxin, short chain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92659"
FT                   /db_xref="GOA:D4JH25"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH25"
FT                   /protein_id="CBK92659.1"
FT                   /translation="MSKISVVYWSQSGNTAAMAEAVAKGIIDAGKEAEIVFVSSASIDE
FT                   LKSETAFALGCPAMGAEVLEEGEMEPFVTELEGCVAGKTIGLFGSYGWGDGEWMRDWVE
FT                   RMTAAGATVVGGEGVICQDAPDDDAKTACEELGKKLAAV"
FT   CDS             537237..538370
FT                   /transl_table=11
FT                   /locus_tag="ERE_05730"
FT                   /product="Site-specific recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92660"
FT                   /db_xref="GOA:D4JH26"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH26"
FT                   /protein_id="CBK92660.1"
FT                   /translation="MSRRGTNIRKRADGRWEGRYYIVDAAGSKKCKSVYGHSYKEVTER
FT                   LLTAKAASLNQTAAPKQSAITVKAVAEKWLESIASSRKCSTIQKYSTIYNKYIKPNWGE
FT                   SVIDELNQNEILKELPETAGESVTKSILCIFNSILAYGAATYGTGEIHLSYRAKRSSVT
FT                   SSNNINTINTIDQQKLTEYLLTELDIYKLGILLCLFMGLRLGEICALKWEDIDMISRTL
FT                   HVNRTVQRLPVDTVHTSDSSQNNHTATKKTSLYIDSPKTSNSLREIPIPDFIYDKLSDY
FT                   YNTSMKGDSYFLKKNQPMDPRTYQNRFHIYIKEAGIGNTHFHALRHTFATNCISSGADA
FT                   KSVSEILGHSNVNITLNRYVHPNLETKRSAINSIVIP"
FT   CDS             538502..540562
FT                   /transl_table=11
FT                   /locus_tag="ERE_05740"
FT                   /product="DNA or RNA helicases of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92661"
FT                   /db_xref="GOA:D4JH27"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005114"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH27"
FT                   /protein_id="CBK92661.1"
FT                   /translation="MSIHLYKHNENAYRAVETMLEEKQMAAVIHPTGTGKSMIAFKLVE
FT                   QHPHKHFLWLSPSEYIYKTQLENIDTQFSNIEYMSYSRLMKHEDSIDTLHPDYIILDEF
FT                   HRCGAAEWGKSVSKLLEAYPKAKRLGLSATNIRYLDNQRNMAEELFEGNIASEMTLGEA
FT                   IVREILPEPKYVIAMYSYKKELEQLKKRIEGLSNPGLVSENEKLLEQLKRALEQADGLT
FT                   EVFARQMTKPDGKYIVFCSGREHMDEMKSQAADWFSKVDKKPHIYTAYYNDASTSKAFA
FT                   EFKKDTGSHLKLLYCIDMLNEGIHVDDVDGVILLRPTVSPIIYLQQIGRALSAGSKNQP
FT                   VIFDLVNNFDSLYCIDCLKNEMQEAFLLYPDTHSPREHFDDRFRIIDETKDSREIFIRL
FT                   QENLGSAWDTYYEAAKQWYEENGNLKIPKSYVTGAGLTLGAWINTQRRVKSGNISGNLT
FT                   WEKIQKLNDIGMIWDVTDSSWQEVLEELKCYRNTYGNLDIKAKYVSPTGFRLGSWINNM
FT                   RFKVKKYGIEQALTDEQRKALEELGMIWDHNKQKWEEYYSAAKAYYKEHGNLEVPAKYV
FT                   TADGIPLGRWLSNLTNSHSMTDEQLKRLHSIGYRSESKAAIQWNRKFELAKTYYEKNGN
FT                   LDVPVSYSTDGVKLGRWISNIRCKRKNPNASGMVLDTERIARLDSIGMNWK"
FT   CDS             540596..542044
FT                   /transl_table=11
FT                   /locus_tag="ERE_05750"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92662"
FT                   /db_xref="GOA:D4JH28"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH28"
FT                   /protein_id="CBK92662.1"
FT                   /translation="MYRKKGRGWTKHIDFMLLDVLCMQIAFIVSYIWRFGPGNPYTDKD
FT                   YRILAAAFLLIDFFVEIVSDAFKNVLKRGYLDELIATCKHVVLVEIITTFFLFTTQMGE
FT                   IYSRMSYYIMIPIYILVSYLGRVVLKKIIKKRGFASSKKSLFVIAPEKLLRETLHGLKK
FT                   NGFGYTQIVAAATDTDLKGKTICEIPIVANHDGIVDYACEEWVDEVLIPPCAESEYPYE
FT                   MADIFLEMGIAVHRGITKNKAMAGSFNQIEKIGDYTVITASMNYASTTQLLAKRGMDIL
FT                   GGLVGCIITLIVTIFVGPAIYIASPGPIFFAQERIGRNGRKFKMYKFRSMYMDAEERKK
FT                   ELIAQNKVSDGMMFKMDFDPRIIGNKILPDGTKKTGIGQFIRKTSIDELPQFWNILKGD
FT                   MSLVGTRPPTLDEWEKYEPHHRARMSFRPGLTGLWQVSGRSNITDFEEVVKLDTQYIGE
FT                   WSVKGDLKIIFQTIVGVLKNEGAM"
FT   CDS             542028..543275
FT                   /transl_table=11
FT                   /locus_tag="ERE_05760"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92663"
FT                   /db_xref="GOA:D4JH29"
FT                   /db_xref="InterPro:IPR015393"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH29"
FT                   /protein_id="CBK92663.1"
FT                   /translation="MKERCKDKMSNVQNVFLVGAKSLGAYGGYETFVYKLTEYHQNNPN
FT                   IKYHVACKANGDGYMDETKLDNVKRISDTEFEFHNARCFKIHIPQIGAAQAIYYDVAAL
FT                   RECCKYIKKNNIEKPIVYIMACRIGPFAKHFYKEIHKLGGKVYLNPDGHEWMRAKWSKH
FT                   IRKYWKASEQMMVKYCDLAICDSVNIEKYIHEQYDGKGINGKNPNTTFIAYGADLTPSK
FT                   LSDDDEKLVNWYKEKGLSKKNYYLVVGRFVPENSFEIMIREFMKSKSKKDFALITNVND
FT                   KFLNELENKLHFRRDPRIKFVGTVYDQELLKKIRENAYAYFHGHTVGGTNPSLIEALGS
FT                   TDLNLLVDIGFNREVAEDCALYWSKELGELAKLINQVEVLKKCQIDEIGTKAKARVLSK
FT                   YTWDEICSKYMKVFFH"
FT   CDS             543316..544275
FT                   /transl_table=11
FT                   /locus_tag="ERE_05770"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92664"
FT                   /db_xref="GOA:D4JH30"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH30"
FT                   /protein_id="CBK92664.1"
FT                   /translation="MNELISVVIPVYNVETYLDACVRSVMKQTYSNIEIILVDDGATDK
FT                   SGEMCDFYAKEDSRVKVIHKDNGGLSDARNCGIEVTKGEFITFVDSDDIVSCKYIETLY
FT                   SLIKNNNADISICNCVHCFDDTDIQFSMSTYLEVLDSDSAINNLLYQKKFLVSAWSKMY
FT                   RRRFFEDVIFPVGMLYEDSAIMYKIFEKAKTIVYSNAKIYAYFHRNGSITTQKFDARNF
FT                   DILIIAEEIFDHYSNNNIIVKSAMSYYVVAALRLYLNCPKQEKYNIQIKKIKKIIKKYG
FT                   IIVLTDINARKKTRVGLLCYFIARPFIKKIYGRVNRWA"
FT   gap             545093..545562
FT                   /estimated_length=470
FT   CDS             545656..546471
FT                   /transl_table=11
FT                   /locus_tag="ERE_05790"
FT                   /product="Glycosyl transferases group 1."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92665"
FT                   /db_xref="GOA:D4JH31"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH31"
FT                   /protein_id="CBK92665.1"
FT                   /translation="MINICIVAPFDYPIPAIKGGALEQVVENLCVENEKRECLNITVLA
FT                   TESKDIIKNNYKFTNFIYFNKTAIDKMWFYCFRLIKKIIGIYIPAYPRMIKVKKWLEKN
FT                   NNRFDLIVYEDGLTYMLPYLFKNIDRNKVVSHLHWIGDPNKKTNYFFSELLPVSKFVGD
FT                   EWINNCSHPYIDVSVVKNGIDIDKFNKKLSEKEKTVIRNELGINNEAFIILYVGRIIPE
FT                   KGISELIEAINIINNDNVVLLLIGAAKFALNGMTVYRKKSKRINRKIIK"
FT   CDS             546846..547163
FT                   /transl_table=11
FT                   /locus_tag="ERE_05810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92666"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH32"
FT                   /protein_id="CBK92666.1"
FT                   /translation="MKSIRIKPKECVFVIFALLCGVSKLYPFTISTYWTYTLACLWIIW
FT                   SYNYKKEDGNRILAKLHLRLFVVPIIVMCFYTIIIWFVSSPSGIGGEIEYYSRLFSNTI
FT                   F"
FT   CDS             complement(547153..547302)
FT                   /transl_table=11
FT                   /locus_tag="ERE_05820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92667"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH33"
FT                   /protein_id="CBK92667.1"
FT                   /translation="MFIIPHLIIPLNIPKKEYDKIIDIHNKSKQRIPNILYALYIKKPV
FT                   IIKK"
FT   gap             547709..548010
FT                   /estimated_length=302
FT   CDS             548380..549126
FT                   /transl_table=11
FT                   /locus_tag="ERE_05850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92668"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH34"
FT                   /protein_id="CBK92668.1"
FT                   /translation="MCNKKNKIAFVCSTYVQIMRMFQIKKEIPEFYGKADLYLVHDMFN
FT                   NMEFIRRLENTNEFDNVFYFNVNEYKSIKVLHYIYGKKYRDIFKKNIYDKVISFNIEEV
FT                   ISQVLFNLNKSQENFEFHCVEDGPGGYEVYKPEQYKWSHIYRWLGIEKQYYNIKTWWTG
FT                   CPEYMKFPNDCSVDIKKLPAIKIGDYKLLKTINYVFDYKNENELDNIECLIMEESHFED
FT                   GLIPNNEDYIFLQKKLFQNIVMYILQ"
FT   CDS             549315..549503
FT                   /transl_table=11
FT                   /locus_tag="ERE_05860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92669"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH35"
FT                   /protein_id="CBK92669.1"
FT                   /translation="MLLARLFLDIIKPINGYRRVNEKTIDKYEKFKQSYKEPDKFMLPK
FT                   EESEIYEMLDDYFQNTR"
FT   CDS             549533..550945
FT                   /transl_table=11
FT                   /locus_tag="ERE_05870"
FT                   /product="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92670"
FT                   /db_xref="GOA:D4JH36"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH36"
FT                   /protein_id="CBK92670.1"
FT                   /translation="MKKKYSYLSNNVKLFTISSFGQKILSFLLVPLYTSYLNTQEYGII
FT                   DLVATTINIIIPIFSLNIAEGIMRFTLEEKNSKDYLAYGILVAKKGALILALFGVVLSF
FT                   IPMMSEYRIYFPWMFVGFIFNLIYSISQNYLRAIDRIPIMIIASLINTVVMLTADIFFI
FT                   VIMKWGFCGYYFALFLGLLVSTLFMQFNENIFTGIRLKSLQKNELNKQMLSYCIPTVFT
FT                   GMAWWINSSLDKYFVTGICGVSQNGIYSVAYKIPTILGVFQTIFTQAWSISAVVDFDEK
FT                   DTDGFFTKTYELYNAGMVLITSIIMIFNIFLSKILYANKFYQAWYYVPVLLYATLFSAM
FT                   AGYLGGIFSAVKDTKTCAYSTFVSAGVNIVLNTLLIGRIGILGAAISTAIAYFISWLIR
FT                   LIVSAKYIKMSIDWKKSILVYWLLIIQLICAMSPSHIYLLQIVILILIICTYKKYYMSL
FT                   LLKLLKYIKKYK"
FT   CDS             551046..551714
FT                   /transl_table=11
FT                   /locus_tag="ERE_05880"
FT                   /product="CMP-N-acetylneuraminic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92671"
FT                   /db_xref="GOA:D4JH37"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH37"
FT                   /protein_id="CBK92671.1"
FT                   /translation="MKTVALIPIKLGSKRVPGKNIKPFFDGTPLMHFIQKACLEAKNID
FT                   EVYIYCSDDAVRDYILPGVKYLKRPEYLDGDNINANDFIKEFMNSVDADIYVNAHTTSP
FT                   FAKVSTIEDCVAKVASGEYDSAFCAEAIRTFMWEDNKPINFDPDHFPRTQDLPLIYGET
FT                   SIAYVFTKESFIKHNRRLGSHPYIKEVDKIEAMDIDYPEDFEICNAIYKEILKNECSNN
FT                   "
FT   CDS             551695..552729
FT                   /transl_table=11
FT                   /locus_tag="ERE_05890"
FT                   /product="Isopropylmalate/homocitrate/citramalate
FT                   synthases"
FT                   /EC_number="4.1.3.39"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92672"
FT                   /db_xref="GOA:D4JH38"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH38"
FT                   /protein_id="CBK92672.1"
FT                   /translation="MSVQITDCTIRDGGYLFNKNSAPEFVKGIMKGLAEAGIDYVETGF
FT                   LQKNVTGESLVYKDSGDVIKYLPDDRRNTQFLGFCDNSRYSLENLDDYNGKSFKWLRIS
FT                   FAQHEIDESLEFCKGAKNKGYFVQFNPMDSISYTDEAREELIKKVNAVKPASFSIVDTF
FT                   GAMDMIDLVHIFKQVDRLLDKDIKIGLHSHDNLGLSCALAERMIELSEETGRDIIVDGS
FT                   LYGMGRGAGNAKTELLAYYINKHCNGKYDIQKLLETIDRYITPELKNLNWGYDLPMYVC
FT                   GTKHAHVDNVYHLKKEYTCTANEMYDIVETLSSQQRTRYGTGYSKTDFSILDRAYENYK
FT                   KGNK"
FT   CDS             552729..553253
FT                   /transl_table=11
FT                   /locus_tag="ERE_05900"
FT                   /product="Thiamine pyrophosphate enzyme, N-terminal TPP
FT                   binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92673"
FT                   /db_xref="GOA:D4JH39"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH39"
FT                   /protein_id="CBK92673.1"
FT                   /translation="MKCSEYLVDFLIKKGITDVFGYSGGYIVPFMDALYARKNEIKVHV
FT                   CYNEQGCAYAADGFARASGKLGVYFTTSGPGAVNAFGGLADAWFDGIPLLGISGNVPTN
FT                   EQRGYSGVRQNGFQEMEIVSMTKHITKYSVSPNSAESFPDIVSRAYNLATTGRKGGVVI
FT                   DFPYDIQKNQY"
FT   CDS             553355..554329
FT                   /transl_table=11
FT                   /locus_tag="ERE_05910"
FT                   /product="Thiamine pyrophosphate enzyme, C-terminal TPP
FT                   binding domain./Thiamine pyrophosphate enzyme, central
FT                   domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92674"
FT                   /db_xref="GOA:D4JH40"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH40"
FT                   /protein_id="CBK92674.1"
FT                   /translation="MIQDEYRFGFIGTYGNRISNMMLNEADLVISVGARLGLRQIGHMK
FT                   ELFASKAKLIRCDVDQYELARQIKSDEEKYNLDAKYFMEQLLAEEISDYSGWWNNCMKA
FT                   KKLLDGYDDTEGNRLMNKISELLPVDPVVTVDIGQTVCWAAQSLWLRGTKGRIIIGGSY
FT                   GAMGVGLPYAIGTSISNENGITYCITGDGGLQMNIQELETVRRENLPIKIIVVNNQELG
FT                   KISEIQHGSYDDRYFITTENSGYTVPDFVKVANAYGIKAAKVENYKKLDDYKDWLIDNE
FT                   PCLLNVMLSSGTLLIPKIKWETCKIMPELEENKAREVQKLIAE"
FT   CDS             554357..555253
FT                   /transl_table=11
FT                   /locus_tag="ERE_05920"
FT                   /product="conserved hypothetical
FT                   protein/3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92675"
FT                   /db_xref="GOA:D4JH41"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH41"
FT                   /protein_id="CBK92675.1"
FT                   /translation="MIKYLIMDVDGTLTDGKIYMGPNGEAMKAFSIKDGYVVNYILKPA
FT                   GIKPVIITARTSSIVQNRCKELGITEVYQGKTDKQMTLMDIVGDNNLSHCAYFGDDIID
FT                   INCMQPIKDAGGIVGCPADAVREVKQLSDYVCINKAGEGALREFTEWLITEKRDARDIK
FT                   RRVDAAVNYLQSIDVSLKDVGKKIKVNDDFYYNIQYYDTKSPDLCDFESHRKYIDIQFM
FT                   VSGKECLEFSDISRLSVKQSYNENLDVMFWNVPENISKIVLSEGDYIVLYPEMAHRGAV
FT                   ICQKSEKVLKIVGKVRI"
FT   gap             555494..556919
FT                   /estimated_length=1426
FT   CDS             complement(558467..559837)
FT                   /transl_table=11
FT                   /locus_tag="ERE_05950"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92676"
FT                   /db_xref="GOA:D4JH42"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH42"
FT                   /protein_id="CBK92676.1"
FT                   /translation="MAKGKTSVFFCQECGYESAKWMGQCPACKEWNTFVEETVDKKSIS
FT                   SSGKVKKESKAAQVLPLSAVKSEKEERIVTGIAEFDRVLGGGIVRGSLVLVGGDPGIGK
FT                   STLLLQVCRELSQKKVPLLYVSGEESLHQIKMRADRLGDFTDSLELLCETSLDIAKDVI
FT                   QRKKPEVVVIDSIQTMYNEEIASAPGSVSQVRETTGVLMQLAKTLGISVFIVGHVTKDG
FT                   AVAGPRTLEHMVDTVLYFEGDRYESYRILRGVKNRFGSTNEIGVFEMKAEGLVEVENPS
FT                   EYMLSGKPEGASGSIVTCSIEGSRPILLEIQALVCHSFFNNPRRTANGTDYNKVNLLMA
FT                   VLEKRANLSLSDCDAYVNIAGGIRMNEPAIDLGIVLAIASSKKDIIVREDTICFGEVGL
FT                   SGEVRGVTMSEQRVAEAKKLGFKKCIVPKVCLAGVSHISGIEIVGVANIKEAIEAVR"
FT   CDS             complement(559895..560308)
FT                   /transl_table=11
FT                   /locus_tag="ERE_05960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92677"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH43"
FT                   /protein_id="CBK92677.1"
FT                   /translation="MAVISELIRTEENGKLSFGDYTLAAKAKLDNFEKDGDIYKVKTFK
FT                   EITKLERNGLFVYESVPGTAVMDFEETADTVTFTVEGPEDAQITLGLEEETEYEIDIAG
FT                   AVAGTMKTNLGGKLSLSVELEGVDSVDIKVSRK"
FT   CDS             complement(562818..564836)
FT                   /transl_table=11
FT                   /locus_tag="ERE_05980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92678"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH44"
FT                   /protein_id="CBK92678.1"
FT                   /translation="MKKLFGCILSLVVAVMLVFTPAEHVYAQGLGLSVSSSSVAVGKTV
FT                   KVTVSMPSGYFGTVVISSSDEGVLSNGGDGVANIGDAAGYPTSQSFSFTAKAAGSCTIK
FT                   AYCTVVGDAEGNDAGGTITGASTKVTVTSASSNNDSNSNKDNKDNSGSNTGNDSNANKD
FT                   NENKEEKKSSNASLGSLVISAGTLSPEFSAATKDYTATVDYSCSSLAVTANPADSKASV
FT                   TSVTGNDSLEVGENTVSVVVTAEDGSTSTYNIVVTRRAEDDPENADKQDNWKKFDINGI
FT                   EWTMVNDIPEDVVPVGFEHSKTVIDGLEYNTLHGTFGDITLVYLQSESGNGLFVYDAAQ
FT                   NAAYEFVRINSESHFIVVLLPKVDDVPEGYNEISLSIEGKGVATAYQTKVEKNDDQTKD
FT                   FYLVYAMNDNGESGWYTYDSVDGTYMRTELGTPTVAQEENDTTMSELVPGIANKYLVLA
FT                   AILVLIIIILLLLLIVSAVKNRKYKAMDYHDDDDDVDDAAEDVSNEALEETTDETADEI
FT                   ADEPEEEVTEGSLDEVAEEAAEESVDEVAGEAAEESAGEAAEETAEGAADEQKMATDEN
FT                   ISNASYVGRTVEITPDSKKAVENENSEFDLKDDSRQENVSDTENDADEDALKNQLQMAL
FT                   DGFVNEGNKLSETIDSSAKDDNEDDSEDDDLQFIDLN"
FT   CDS             complement(564853..567225)
FT                   /transl_table=11
FT                   /locus_tag="ERE_05990"
FT                   /product="Beta-N-acetylglucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92679"
FT                   /db_xref="GOA:D4JH45"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018242"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR025883"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH45"
FT                   /protein_id="CBK92679.1"
FT                   /translation="MIKINKFLAASVVTLSLAACDLAPYSSMAVYADQAAKVVCDERYW
FT                   VAARSGPGTEYELEHKLSNGKDITILEQTTGADGKVWYKAKYNLAANNEECVSYIRSDF
FT                   VSAGTGTAASDNAQTGDASADTGNADAIQQNNEEQLALATASGAYATGTITGGNVYVRN
FT                   AAGTSGTTKVVSLNWNHQVDIIGETRVNGVVWYNVKGTLNGKAFTGWTISTYIKVTYNN
FT                   SGDNTDFVTAMKNAGFPDSYIPNLTALHNKYPSWTFEAVNTGLNWDTVIENESVNGLNL
FT                   VSKSADNAKKSTAAGAYNWSTNTWVEYEPGWVSASSAYIAYLMDPRNFLDETNIFQFQS
FT                   LAYSPNEALEGVKSIVKGTFMEGTKTYSNNGEKINYASTFMDVAKSSGVSAYHIASRIK
FT                   QEQGQKGTSPLISGTYSGYEGYYNYFNFSATGNTKDKIYKNGLSFAKKQGWNTRVKSIS
FT                   GGAVKVGSNYINKGQNTLYFEKFNVVNTSSLYFHQYMGNATAALTEGQSLAKGYSDKNQ
FT                   AFVFKIPVYNNMPSSAVGFDKAGDTNNYLQSLAISGVTLTPTFNGATTSYSAVVSNAIS
FT                   SVTVSADAVSGNSGVSGTGSYSLAVGNNTIKVKCKSQSGDTRTYTININRQAASANNTG
FT                   GNNNQNNNNQNNTDVNITSGKYSIGTYITGIEPGTGAADFVKNIAVSASGTVKLLTSSG
FT                   SENSGKIATGNKVAVYDASGKLKKTYDIVVYGDINGDGAVNALDMIKLNRHILGKGTLT
FT                   GSYLEAADANRKGDGGNALDMIIMNRHILGKSKISQN"
FT   CDS             complement(567438..568472)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06000"
FT                   /product="Predicted secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92680"
FT                   /db_xref="InterPro:IPR009343"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH46"
FT                   /protein_id="CBK92680.1"
FT                   /translation="MIRLIKKKAKSIVCSVLAAVTLFTMNPAVFATETATQTDTVSSVD
FT                   VSGSDAADKSNTDSTADSTTTAGSEANDKVTISNNDKPYLSLGADLTPDQRATVLGFMG
FT                   IELTDLDNYDVVYVNNDEEHKYLDSYISKSEIGTRSLSSVLITEDKKGAGLSVSTHNIN
FT                   YCTVGMYKNALATAGIADAKIIVAGPFPISGTAALVGTLKAYEEMTGKKLDDKVTDAAM
FT                   DELVTTGELNKSIDGDSQDIEAMIADLKKQLADGRLKDESQIKDAIKEAAKDYDLKLSD
FT                   DDIAKLTSLLMKLKDANIDWDSVINQAQDWASKLGDKINDPGFWEKLGNFFMDLWDKIK
FT                   SLFS"
FT   CDS             complement(568485..569522)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06010"
FT                   /product="Uncharacterized proteins, homologs of microcin C7
FT                   resistance protein MccF"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92681"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH47"
FT                   /protein_id="CBK92681.1"
FT                   /translation="MRYPEFLKDRGTIGFVAPSMGCTTEPYRSAFDNAIKRFHSMGYKT
FT                   IEGPNCRCDSGIGISNTPKKCAEELNESYASADSDVLISCGGGELMCEVVPYIDFERVK
FT                   QSKPKWYMGYSDNTNFTFLEATIADTAGIYGPCAGSFGMEVWHESLTDAFDLLCGRKLS
FT                   FTNYHMWEKESIKDENAPFVGYNLTEKSCISSIPTVAKESRLTMRGRLLGGCMDCLINL
FT                   LGTSFDHVRKFNERYSDDGIIWFLEACDLNVMGMRRAMWQMKNAGWFSNVKGFLIGRPA
FT                   HFGEEMFGIDHRQALSSLLREFNVPIIMDLDIGHMSPMMPVVCGSMADVSFDGSNFTIS
FT                   YDIEQ"
FT   CDS             complement(569519..569818)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92682"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH48"
FT                   /protein_id="CBK92682.1"
FT                   /translation="MKNIEEQQIIIECPNTIFHLYIDSEDELSKVKVFMNNMKNVDSIS
FT                   LHDIYNWCNRQHVQYTTTFNYDSKMTLTEMIKSYIFYFRQKLRYVNNSDRMIET"
FT   CDS             complement(570029..570934)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06030"
FT                   /product="Uncharacterized Fe-S protein PflX, homolog of
FT                   pyruvate formate lyase activating proteins"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92683"
FT                   /db_xref="GOA:D4JH49"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH49"
FT                   /protein_id="CBK92683.1"
FT                   /translation="MKNMNKYENCLLCPRKCGINRSTGQTGVCGVSSEIKVARAALHYW
FT                   EEPCISGKRGSGAVFFSGCSLHCVFCQNREISDGKAGKVISKERLSDIFMELADKGANN
FT                   INLVTPGQYIPDIVWAVNDAKSRGMKLPIIYNTSGYENVTELKLLEGIVDVYLPDFKYM
FT                   DSTLSARYSRAKDYPSVAKQALSEMVRQQPDVVIDDATGLIQKGVIVRQLLLPGHVNDA
FT                   KAVLKYLYDTYHDHVYISMMSQFTPIALKDYPEINRTVTRREYERLVDYALEIGITNAF
FT                   IQEGDVAKNSFIPAFDCEGV"
FT   CDS             571083..572321
FT                   /transl_table=11
FT                   /locus_tag="ERE_06040"
FT                   /product="6-phosphofructokinase"
FT                   /function="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92684"
FT                   /db_xref="GOA:D4JH50"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH50"
FT                   /protein_id="CBK92684.1"
FT                   /translation="MNQSNCIVAQSGGPTVAINASLAGVIAGVKSSEKYDICYGAVNGI
FT                   LGILNENYLNLSDIFADDANLEKLKTTPAMYLGSCRHKLPDYKDDDSPYVYIFHQFDKL
FT                   SIKAFFYIGGNDSMDTVLKLSDYAKKINSDVKIIGIPKTIDNDLCMTDHTPGFGSAAKY
FT                   IASSMLEIAHDTFIYAVKSVTIVEIMGRDAGWLTAASALARNEYNTAPQFIYLPEVDFD
FT                   KDKFVADIKEALTRTNNVIVAVSEGIHDADGSYITSSKAACDQFGHQQLSGAGKALEFI
FT                   VNENIGVKVRSVEVNVLQRCASHLASLTDIEESFAQGKKGVTIAAEGVTASMVCLKRIS
FT                   NDPYQVEYTYSAIKDIANEAKSVPREWINDAGNDVKPELIEYLKPLIQGETAVAYKNGL
FT                   PDYMDVSHLHKCN"
FT   CDS             572386..573828
FT                   /transl_table=11
FT                   /locus_tag="ERE_06050"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92685"
FT                   /db_xref="GOA:D4JH51"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH51"
FT                   /protein_id="CBK92685.1"
FT                   /translation="MKKKVLITCAVVLGVLLAVYLGFAFYFSSHYLFNTKINSVKYAGK
FT                   TAKEALEKNTALSRDYLLTITDRKGNSFSLKGPDFSYEYVSNGDEKQILKNQNAFTWPV
FT                   SLFKAQNYTLKGSSKYNDAALAEKLKALDIFSDDYIENPEDAHIEIKDGEYNVIEEKKG
FT                   CKPIYDSILAEVKDALDNELPKLTLSNDCYEAPKITKNSDTIKNEKEALDKYTASTVTY
FT                   KIEGADEKLDSAKILDMLSISDDGSVSIDDAKVTKYVQQLASKYNTFGRKRSFKTSSGD
FT                   TIEIGGGDYGWVVSKKNEKAQLLSDLEGGKPVEREPVYEQTALYRGADDIGNTYIEIDY
FT                   TKQHMWYYKDGALQMESDFVSGNLARQNGSVDGVYKIVYKQRNATLVGEGYSSPVSYFM
FT                   PFAYNIGIHDASWRDTFGGTIYKTSGSHGCINVPPSFAEQLFNAVDKGTPVVAYYREAV
FT                   TLTNNAAKMSNAYSYVAPDAAQ"
FT   CDS             complement(574366..576120)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06060"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92686"
FT                   /db_xref="GOA:D4JH52"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH52"
FT                   /protein_id="CBK92686.1"
FT                   /translation="MATDNAKMNKAGTMRKVLSYMKRYIPLLVISLALSVVTVALTLYF
FT                   PILTGRAIDLIVGKGKVDFTAMTAILTRAAIIVVIAAAAQWLTNICNNRMTYNIVRDIR
FT                   RDAFLNIEKMPLSYIDSHSHGDMVSRIIADVDTFSEGLLMGFTQLFTGIATIAGTLIFM
FT                   LTIDVKISCIVVLITPLSLFVASFITKKTYSMFQLQTRTRGEQTSLIDEIVGNEKVVQA
FT                   FNHEDEALEQFDEINDRLQKCSLRATFFSSLTNPSTRFVNSLVYAGVGIFGAMSALTGG
FT                   ITVGQLSCFLSYANQYTKPFNEISGVITELQNALACAARIFELIEEKKEIPDASDAVTL
FT                   DEADGRVDIEDVYFSYVPDKKLIEDFNLHVKPGQRVAIVGPTGCGKTTIINLLMRFYDV
FT                   NSGTIKVSGHDIRKITRESLRDNYGMVLQETWLKKGTIRDNIIMGKPDATDEEIIAAAK
FT                   ASHAHSFIRRLPKGYDTEIGEDGGSLSQGQKQLLCITRVMLCLPPMLILDEATSSIDTR
FT                   TEIKIQKAFLTMMQGRTSFIVAHRLSTIREADIILVMKDGKIIEQGNHESLLAADGFYA
FT                   NLYNSQFA"
FT   CDS             complement(576124..577872)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06070"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92687"
FT                   /db_xref="GOA:D4JH53"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH53"
FT                   /protein_id="CBK92687.1"
FT                   /translation="MKQILKYLKEYKKECICAPLFKLLEASFELIVPLVMAAIIDNGIT
FT                   ASDKPYIWKMGGVLVLLAAVGLVSSVTAQYFAAKAAVGFSTKLRHILFEKIESLSFSKM
FT                   DTVGTSTLITRMTSDINQVQSGVNLVLRLFLRSPFIVFGAMAMAFTVNVRAAMVFVVTI
FT                   PLLSIVVFSVMAASLPLYKKVQSSLDTVLSHTRENLEGTRVIRAFNKQNDEIDSFNRDN
FT                   ELLTNMQQVVGRISALTNPLTFIIINIATIAVIVSGGKQVYAGILTQGEVVALVNYMSQ
FT                   ILVELIKLANLIVQVTKAVACGNRIADVLSIPSKLPEKNPKLIGAKDGAPEVEFDHVCM
FT                   TYEGAADETLTDISFTVQKGQTIGIIGGTGSGKSSLVNLIPRFYDATKGTIRIQGNDIN
FT                   DYDAVQLRDKIGVVMQKAVLFAGTIADNLRWGKNDATEEEMWKALDIAQATEVVKGKEG
FT                   GLDYMIEQGGKNLSGGQKQRLTIARAVVKDPDILILDDSASALDFATDASLRAALKNMH
FT                   GDKTIFIVSQRTSSIQFADNIIVLDDGQMVGFGPHEKLLETCETYKEIYDSQFKKESDM
FT                   TRQKEV"
FT   CDS             complement(577995..578360)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06080"
FT                   /product="Mn-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92688"
FT                   /db_xref="GOA:D4JH54"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH54"
FT                   /protein_id="CBK92688.1"
FT                   /translation="MRNNESSENYLETILILSKKLPVVRSVDIANELGFKKSSVSIAMK
FT                   NLREKNNITVSDAGFITLTESGRQIAEMIYERHELLSECLEKLGVDKEIAAEDACRIEH
FT                   VISPESFEAIKKHIHKS"
FT   CDS             complement(578668..579816)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06090"
FT                   /product="Bifunctional PLP-dependent enzyme with
FT                   beta-cystathionase and maltose regulon repressor
FT                   activities"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92689"
FT                   /db_xref="GOA:D4JH55"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH55"
FT                   /protein_id="CBK92689.1"
FT                   /translation="MYDFDTVVDRRNTGSLKWDVAENELPMWVADMDFKTAPQIIEAIS
FT                   ARVSHGVFGYSIIPDEWNDAYISWWDRRHGLKIERDSLIFCTGVVPAISSTVRKLTTPG
FT                   ENVLIMTPVYNIFFNSIFNNGVNVQESPLGYENGRYFVDYDRLEHDLSNPQTSLMIFCN
FT                   PHNPCGIIWTKDELAKIGALCRKYNVTVISDEIHCDITAPGKSYVPFAAASEDCADISI
FT                   TCIAPTKCFNMAGLQTAAVMVPNKFLRHKVWRALNTDEVAEPNAFAITAAVAAFTKGEP
FT                   WLEELRKYLWENRKTVCDFMAENLLQIHVVDADATYLMWLDCSALTDDSVAFTQMIREK
FT                   TGLYLSEGAEFGGNGRYFVRLNIACPGSVLMEGLDRLKRALA"
FT   CDS             complement(579820..580671)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06100"
FT                   /product="Protein of unknown function (DUF3737)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92690"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR022208"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH56"
FT                   /protein_id="CBK92690.1"
FT                   /translation="MSERKQIHQEFLTGERALFASNDLDIYDTIFDDGESPLKESHGIS
FT                   LTGCFFRWKYPLWYCSDIAVKDCTWFDMARAGVWYTDNISVTDSIVEAPKNFRRCNYLK
FT                   LKNVTFPNAQETLWSCDHVDIENVSAKGDYFGMNTNNLIMKNFQLVGNYSFDGSRNVEV
FT                   HDSKLISKDAFWNTENVTVYDSFITGEYLGWNAKNLTLINCTIESLQGLCYIDNLVMKN
FT                   CKLINTTLAFEYSSVDAEICSKVDSVLNPTSGVIRAKEIGTLTIEKDRVDPSKTKIICE
FT                   GK"
FT   CDS             complement(580832..581803)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06110"
FT                   /product="L-lactate dehydrogenase"
FT                   /function="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92691"
FT                   /db_xref="GOA:D4JH57"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH57"
FT                   /protein_id="CBK92691.1"
FT                   /translation="MSNKTSAVVKTNPRKAVMIGCGFVGSASVFALMQSGLFSEIVLID
FT                   ADKDKAEGEAMDISHGIPFARPMKIYAGGYDDVADAAIIVVSAGAGQKPGETRLDLVNK
FT                   NVAIFKSIIPEIAKRNFGGILLIVANPVDILTQVAQKLSGLPEERVIGSGTVLDSARLK
FT                   YALGEHLEVDSRSVHAFIVGEHGDSEVVAWSSANVSGVELHKMCEMRGHYKHKENTEEI
FT                   AANVKNSAYEIINRKHATYYGIAMSVRRICEVIMRDEKSILPVSHMMHGQYGIDGVVLS
FT                   MPAIVGANGVESDIPIELNGEEALKLKESADALKSILDGLEL"
FT   CDS             complement(582139..584133)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06120"
FT                   /product="Isopropylmalate/homocitrate/citramalate
FT                   synthases"
FT                   /EC_number="2.3.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92692"
FT                   /db_xref="GOA:D4JH58"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH58"
FT                   /protein_id="CBK92692.1"
FT                   /translation="MKGYEKYERSYFLPPECTYDWVKKDYIDKAPLWCSVDLRDGNQAL
FT                   IEPMSLEEKLDFFKMLVDIGFKEIEVGFPAASETEFNFTRALIERDMIPDDVTIHVLTQ
FT                   AREHIIKKTFKALEGAPRAVVHLYNSTSVAQREQVFKKSKEEIKQLAVDGAILLRDLAA
FT                   ATDGNFRFQYSPESFSGTEVDYAVDVCNAVLDVWQPKADNKAIINIPTTVENAMPHVFA
FT                   TQIEYIDKHLKYRDGVVLCLHPHNDRGCGVATSELGVLAGAEEIEGTLFGNGERTGNVD
FT                   IVTLAMNLYSHGVDPQLDFSNLPEIREKYETYTRMKVGERQPYAGDLVFSAFSGSHQDA
FT                   ISKGMAWREEKKLDKWTVPYLPIDPKDVGRTYEADVIRINSQSGKGGVAYILKQSFGIN
FT                   VPQQMREQVGYMVKQVSDEEHKELSPDWVHSIFTDNYVDFHPYFTIPECHFKQVNGIFA
FT                   EAVILHNDSTRKVDANGNGRLDAVSNIIKQYFDISFELTVYEEHALSHGSSSKAMAYVG
FT                   ITVDGKMFWGAGVDEDIIKASIGALVVAVNHYLATKADSHVKDERYIAMLNFIQANYKT
FT                   VSLADMAAQFNLTEPYISKYIKEKSGKTFGELVTNAKMKKARTLLRNSITTVENIAIEA
FT                   GYQNVEHFNRQFKKLYGMTPLEYRNSSTK"
FT   CDS             complement(584302..585222)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06130"
FT                   /product="EDD domain protein, DegV family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92693"
FT                   /db_xref="GOA:D4JH59"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH59"
FT                   /protein_id="CBK92693.1"
FT                   /translation="MIKGQKVKENNMSNYVISCCSTADLTREHMLERNIKYACFHYELD
FT                   GKEYMDDLGQSMPLPDFYKAMEAGAMTKTSQINQEEYMEYFRQFLDEGYDVLHCALSSG
FT                   ISGTVNSARLAKEALEEEYPDRKIYVIDSLAASSGFGLLMDKLADLRDSGMDIDTLADW
FT                   TMEHRLEVNHWFFSSDLTFFIRGGRISKTAGFVGNVLNICPFMNVSNEGKLIVREKIRT
FT                   KKKAIKEMLVKMQALCKDGADYSDKVYISNSACYEDARAVADLIEAAFPKMKGKVEIND
FT                   IGTTIGSHTGPGTVALFFWGNKRED"
FT   CDS             complement(585222..586448)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06140"
FT                   /product="Predicted acetyltransferase involved in
FT                   intracellular survival and related acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92694"
FT                   /db_xref="GOA:D4JH60"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH60"
FT                   /protein_id="CBK92694.1"
FT                   /translation="MHSFKSDEFKIRVLTKDDAEEYNALLRYAFQVTEADLAETGWKDD
FT                   EIKQSKFPVLERADVLGCFNIIDKREELVAQFAVYPLDMNIYGERYEVGFVTSVCTYPE
FT                   YTGHGLMKKLMRKSLTRMRDSNKSFALLYPYSIPLYRGLGWEIISNKMTYVIKDRQIPT
FT                   KLKEPGYVRRVQWDDEQFKKLHTHFAAKTHGCLYRNNLAWEEYFRWDEDDTMVAIYYNE
FT                   DDEPCGYMVYLISSDVMHIKELIYLNREAQLGLWEYIHAHDSMIDEVRGNNYYSEPIAF
FT                   ELDDSDIKETIRPYAMGRIIDVAQFISQYNCDPDGPGGCFSFEIADDLLPWNNGTFVID
FT                   FEKGHCALTDKNPQYHLSMSIGTFTTLLLGYKSAEKLLQMGKIQTTYDAVAKLDDILYH
FT                   EIPYVSDYI"
FT   CDS             complement(586435..589755)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06150"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92695"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH61"
FT                   /protein_id="CBK92695.1"
FT                   /translation="MIEKYYSGVIEQIYNRIGKETRNIVMANYSNDFSIENLEVIRRYQ
FT                   SNEDNVFFAYSEFSYNTLVGAYEPFLDIICNMHRRFIGGSFDDFQKECGVYYLHRQVLN
FT                   SYYETGECFREETVLLNEVAYEQRRMTMAIADMLKRLSEVRPLMIVINRFQMASKSSIE
FT                   TIKYLIDNPCANIGIVLGVNAIVKGADSTVEVWDRIVESLEDRSAIYYIGSAGPLKNNI
FT                   KTTNDDELYITMNFEQSIQEASNIMEFLDYEQAMRGCRIIEHKIKFENAWIDEKSLRRF
FT                   YLVYARTSVLLGEMSKAIELMNEYKALIPENDSEHYFSLYYFMKGTCYMYQGKLEKAEG
FT                   CAKKAYDYALLADDELLEFKSELLSVMIKMSGWYNIFFCVQDIPVSDEIIEKLIKHGYR
FT                   NHLAHIYIYAYDNSRDVVKQSFYDESLLKHFTKGLELAKEIGNEQLVYDAYQKTIMLAS
FT                   TSGLNEIAFLYVIRTYEFMKGHGNIYVARVLTSIGYNLSAMGKNELVDNYYNAAINMLY
FT                   YLKLPEDIAEVYYNKSLNYIMQGNYKEAVHALLVAMKTIIKLHLNSLRVCNTSKVYALL
FT                   ALASIFSGDRFSCERYLLSCKQFLNYVIYRVIDTTRTEAVHDYSRCDDEMFLYSFASAM
FT                   LLWHDGEKEEAFLRFEDAERYLVNAEGNEFFAYSIYRESRMKLFELLGKNELIEHERIL
FT                   LEAHNKRMHEIAEAAPLDMLKNINLESLSDGHINERQINMLVKQHGLEKDYQGSKRQME
FT                   FISIWQTIIDVNDQKKDTMIENAMSNFINHFSLDCALIIDLHAKEPQVLYNDTGCDMTD
FT                   EVIKGICDIMIDYPEGIATSKIAEGFYEYENVISYFGVDDVCSFVAVPFIKNDALSSVL
FT                   IAYVRMKDNWHGSIERYMLNEDDLSIFKLLFRELEYSIARIEANEKANEMNKRLKQAAV
FT                   TDMLTGIYNRAGMYQEIEKLEKRISVTSGGMDVGLMFIDLDNFKHYNDTYGHDVGDLIL
FT                   KEMAFVFREVAKDRGFVSRYGGDEFIIVIESCARYELENIAKDIYARIAEADGFSSQIK
FT                   KYLNHDVEFNEEKNITCSIGISYERNVTSESQITELIKKADDLMYTVKTGEKGHYAFF"
FT   CDS             complement(589865..590509)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06160"
FT                   /product="thiamine diphosphokinase"
FT                   /function="thiamine diphosphokinase"
FT                   /EC_number="2.7.6.2"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92696"
FT                   /db_xref="GOA:D4JH62"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH62"
FT                   /protein_id="CBK92696.1"
FT                   /translation="MRYLIVCGGKIDKEFGLNEIKTDGIDAIIAADSGMDFLYENGVTP
FT                   DIIVGDFDSTKTNALEYFERKGQTEIRRLNPVKDDTDTEYAIRLAISEGARSIVVLGAT
FT                   GSRIDHVLGNISLLGIGLESKTDISIIDTNNRIRMADKPVTIEKSAQYGRFVSLIALTD
FT                   DNEVSLRGFKYPVTDYSFDRFTSLGISNEIVDDHAVVDIHRGKFIIIESKD"
FT   CDS             complement(590586..591317)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06170"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92697"
FT                   /db_xref="GOA:D4JH63"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH63"
FT                   /protein_id="CBK92697.1"
FT                   /translation="MIIISFYMRSLKTDKSINLKHNQTEENMNCLSPSILSADYSILGE
FT                   QLKQLDEAGAQYVHIDVMDGSFVPSISIGLPVIKTIRKCTERMFDVHLMIDEPVRYIDD
FT                   FATAGADIITVHAEACKHLDRTIEAIKEKGILAGVALNPATPLSAIEYVLPKVDMVLIM
FT                   TVNPGFGGQKLIPYTVDKVRDLKALLEKTANKADIEVDGGVNLENVETLLAAGANIIVA
FT                   GSAVFSGDIEENVKGFLNIMM"
FT   CDS             complement(591265..592173)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06180"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92698"
FT                   /db_xref="GOA:D4JH64"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH64"
FT                   /protein_id="CBK92698.1"
FT                   /translation="MTGKIIKGIAGFYYVYVEETKEAKETATGGTLYECKAKGTFRKQK
FT                   IKPLVGDIVDIAVLDDEKHIGNVERILPRKNELIRPAVSNIDMALVIFASAKPDPNFNL
FT                   LDRFLCMMEYQHVPVTICFNKKDLITPKEQQELKSIYEPAGYRVLFTSTKTGEGIDEIK
FT                   HILEGRTTTVAGPSGVGKSSIINCLQDDVQMETGHISEKIERGKHTTRHSEIIPIKDGT
FT                   YIMDTPGFSSMDVPGFEKEDLWTCYPEFVEYEPYCRFQGCSHINEPDCGVKEALADGKI
FT                   SQVRYDNYKLLYEELKNRQKY"
FT   CDS             complement(592673..594823)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06190"
FT                   /product="Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92699"
FT                   /db_xref="GOA:D4JH65"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH65"
FT                   /protein_id="CBK92699.1"
FT                   /translation="MLEIGSFLSDRYEILSKVGAGGMSDVYKAKDHILSRFVAIKVLKQ
FT                   EFSEDSSFVTKFRAEAQSAAGLEHPNIVNIYDVGSENGLYYIVMEYVEGITLKTYIEKK
FT                   GQLSFKESASIAIQVARGIEAAHNKNIIHRDIKPQNIIISTDGKVKVTDFGIAKATSSN
FT                   TISSDVMGSVHYASPEQARNGFVDGRSDIYSLGIVMFEMVTGRVPFDGDTTVAVALQHL
FT                   QEEIARPSIYAPDLPISFEKIILKCTQKTPDRRYQTIEELLTDIRRSLAHPDEDFVTIA
FT                   PLVDGGKTKVISPEELDKIKEGRGVAEDLNDDDIDADNGDEYADDEEDDDEYDESLLDD
FT                   DDDEEDEDDDDDGKLLNPKMDKAITIMGIVTAVIIVIVIIYLALSVAGVFKFGGKKNSE
FT                   SQQTESQTQTESESESETQTETEGQMIEIRGMSVEDAQKAVDRLKLDLTVFAFETKQSD
FT                   EKDGTILEQDVKAGDTVKRGSQINVVIAGKGDNTSEMVKIPSVIGKTKSSAKSTLESAG
FT                   FSVTFEYGDYNDSVAADVVTAQSPSAKKQAAKGSTVTVTLSPGQKPITVPNVVGASQSH
FT                   AESALAGAGLKYTYADSQYSDTVPAGSVISQTKSGETVAAGTTITLTLSKGKQEISTNV
FT                   SKGISYSGEGTVVKAEYKLVGKSGTVYDKGSYENTSSFTVSGTMKEATGSIVVTWTVQT
FT                   GETDEAGNPATVTLDPVTYSVP"
FT   CDS             complement(594840..595568)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06200"
FT                   /product="Serine/threonine protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92700"
FT                   /db_xref="GOA:D4JH66"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH66"
FT                   /protein_id="CBK92700.1"
FT                   /translation="MKTFSITDAGAIREMNQDFYFSSDTAVGNLPNLFIVADGMGGHKA
FT                   GDYASRYTIERVVASVSRNAGDEPVSIIKEAINKANELLVAESREDEAKRGMGTTLVVG
FT                   TIIGNKLFVANIGDSRLYIVGGTEQIRQITRDHSLVDEMVRMGEINADEARVHPDKNII
FT                   TRAVGAADHVEADFFEVELCEDDRILLCTDGLTNMVRDKEICDTIRQNDNIETAASQLV
FT                   AMANANGGRDNITVMIIKPF"
FT   CDS             complement(595569..596633)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06210"
FT                   /product="23S rRNA m(2)A-2503 methyltransferase"
FT                   /function="23S rRNA m(2)A-2503 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92701"
FT                   /db_xref="GOA:D4JH67"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH67"
FT                   /protein_id="CBK92701.1"
FT                   /translation="MEQIKEQLTDIKSMNMDELTEFIISLGEKKFRAKQIYEWIHVKHV
FT                   ESFDEMTNISKKFIQVLKDNAILISLKKEEVQVSKLDGTRKYLFALDDGNVIESVLMKY
FT                   KHGNSVCISSQVGCRMGCRFCASTLDGLVRGLRPSEMIDQIYQIGKDIGERISNVVVMG
FT                   TGEPLDNYDNLLRFIELLTDENGINISQRNLTVSTCGLVPRMRQLADEKLSITLALSLH
FT                   ASNQEKRKALMPVANSYDIHDVVDACKYYFAQTGRRVTFEYSLVGGVNDTAEDAAELSA
FT                   LVHGMNCHINLIPVNPIKERDYVQSNKGVIEAFKNRLEKNGINVTIRREMGRDIDGACG
FT                   QLRKKHIDKERGIN"
FT   CDS             complement(596828..598237)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06220"
FT                   /product="ribosomal RNA small subunit methyltransferase
FT                   RsmB"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92702"
FT                   /db_xref="GOA:D4JH68"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH68"
FT                   /protein_id="CBK92702.1"
FT                   /translation="MINNHSKNNHNNKNSQINKNNIPGRPAKSNVTAHNEHSVDTRELA
FT                   LEMLIEINERGAFSHIVLRSVLDKYQYLSKQDRAFMTRLVDGTIEYMLQLDYIIDSFSK
FT                   TKVRKMKPFIRNLLRMSVYQIKYMDAVPDSAVCNEAVKLAKRHKFAQLSGFVNGVLRNI
FT                   ARNIDSVQFDTLSIRYSMPQWIVDRFVAEYGEKKAEEIFKAFHSKSTISIRTNLTRCTP
FT                   DELRAMLEAEGVIVTPVDELNYAFVISGFDYLNGLQSFRDGLFYVQDISSMLVAQTAAP
FT                   KKGDYVIDVCAAPGGKSTHIAELLKGSGHVLARDLTDTKVGMIEENIDRHGLNNMSAEV
FT                   WDATVPDADSAEKADILICDLPCSGLGVLGRKKDIRYKMTPESVDELAALQRQILDTVH
FT                   TYVKPNGVLVYSTCTIDEAENEDNVRWFIEKHPEFELDMSFAEGTGMKQILPGEHGSDG
FT                   FFIARFIKSKL"
FT   CDS             complement(598343..599047)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06230"
FT                   /product="Predicted Zn-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92703"
FT                   /db_xref="GOA:D4JH69"
FT                   /db_xref="InterPro:IPR007395"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH69"
FT                   /protein_id="CBK92703.1"
FT                   /translation="MGYYYWDPTYILVVIGAVICMIASARVKGTFNKYSQLRSMSGMNG
FT                   AQVAQRVLQAAGIYDVQVRHVSGSLTDHYDPRTKTVNLSDPVYNATSVAALGVAAHECG
FT                   HAIQHAKSYAPLSIRSALVPIANFGSMLAWPVILIGLLFNTRSSGLIIDIGILLFSAAV
FT                   LFQLVTLPVEFDASRRALVMLRTQGILADDELRYTRRVLKSAALTYVASAAAAILQLLR
FT                   IILITNGRRRDD"
FT   CDS             complement(599513..600445)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06240"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92704"
FT                   /db_xref="GOA:D4JH70"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR015518"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH70"
FT                   /protein_id="CBK92704.1"
FT                   /translation="MRVIFMGTPDFSVGTLEAIIEAGHEVALVVTQPDKPKGRGKTMQY
FT                   TPVKECALSHGIEVFQPVKIRETANIEYLRKFNADIIIVVAFGQILSKSILDMPRYGCI
FT                   NVHASLLPKYRGAAPIQWAVINGDEFTGVTTMRMDEGVDTGDMIAKSTVRLAPDETGGS
FT                   LFDKLSAEGARLCVETMKMIEDGTAEYTPQNSEEATHTSMISKELGFIDWTKPAVEIER
FT                   LIRGLNPWPSAYTHLNGKTFKVWSAKVIDGSDDYEPGCIYHIGKNDMYVQTGKGALSLV
FT                   EVQLQGKKRMDTGSFLRGCHVEEGSFFTL"
FT   CDS             complement(600500..600976)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06250"
FT                   /product="peptide deformylase"
FT                   /function="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92705"
FT                   /db_xref="GOA:D4JH71"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH71"
FT                   /protein_id="CBK92705.1"
FT                   /translation="MALRTIRVEGDPVLGKVCREVTEVTPKIVTLIDDMLETMYEANGV
FT                   GLAAPQVGILKRIVVIDVGEGPIVMINPEIIESDGEQTGDEGCLSVPGKAGQVTRPNYV
FT                   KARFMGEDMNEYEIEGEELLARCICHELDHLDGHLYVEKVEGALHDVTYEDTQE"
FT   CDS             complement(600998..603259)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06260"
FT                   /product="replication restart DNA helicase PriA"
FT                   /function="replication restart DNA helicase PriA"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92706"
FT                   /db_xref="GOA:D4JH72"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH72"
FT                   /protein_id="CBK92706.1"
FT                   /translation="MYANVIVDISHEKLDKTFQYSIPDELLCDIRPGVCVDIPFGSRTI
FT                   TGYVIEVTDKPEYDPARTKPLIGIKADSVAVEAKLIALAAWIRRNYGSTMNQALKTVIP
FT                   VKKQAKEQVSRSIALKIDKVKARAQLALCEAKKQKAKARLFRALIDADDGARLEYSFVT
FT                   GKLSVSAATIRALEQSGFIEVITQTGYRNPVEHMSVDTYDKVLNAAQQSVVDAIEGDIA
FT                   AGLRNTYLIKGVTGSGKTEVYMELIAHCIQSGRQAIVLIPEIALTYQTVMRFFARFGNR
FT                   VSIINSRLSNGERYDQFERAKNGDIDIMIGPRSALFTPFSNLGLIIIDEEHENSYKSES
FT                   VPRYHAREVAIEYARMSDAIVVLGSATPSVDSYYKAKTGVYRLLELDKRVDDRPLPKCE
FT                   VVDLRQELLEGNRSILSTRLQELMEERLLNGQQTMLFLNRRGKSAFMSCRACGFVVKCP
FT                   HCDVSLSEHSGGVMVCHYCGYRQPVPKVCPSCGSKYISGFKAGTQKIEAMVAKRFPQAR
FT                   ILRMDYDTTRAKDAYEKILQAFSNHEADILIGTQMIVKGHDFSNVTLVGVLAADMSLHV
FT                   NDFHAAERTFALLTQAAGRAGRGKLPGNVVIQTYDPDHYAIRTAKEQDYEAFYDKEIEY
FT                   RRLMNYPPVWNMLLVHVTSPDENECGSMAQQVYDIASQMISHTDENQSPDDRNLIQLIG
FT                   PADATIAKVNDIYRKVIYMKTSDYAALISIKDGIEQAVKADTVMKHANISFDFNPMSGF
FT                   "
FT   CDS             complement(603268..603699)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06270"
FT                   /product="Aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92707"
FT                   /db_xref="GOA:D4JH73"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH73"
FT                   /protein_id="CBK92707.1"
FT                   /translation="MLNISGIHEGFVLDHIKAGMSLQIYRDLKLDKLDCTVAIIKNAKS
FT                   SKMGKKDIIKVECPIESLDLDILGFIDHNITVNVIKGDKIVDKMELKLPHQVKNVIKCK
FT                   NPRCITSIEQELDQIFVLSDEKNEIYRCKYCEEKYEGVK"
FT   CDS             complement(603711..604631)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06280"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92708"
FT                   /db_xref="GOA:D4JH74"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH74"
FT                   /protein_id="CBK92708.1"
FT                   /translation="MRHLMSPLDFSVEELDKLLDLANDIEAHPEKYAHKCDGKKLATCF
FT                   YEPSTRTRLSFEAAMLNLGGSVLGFHSADSSSASKGESVSDTIRVISCYADICAMRHPK
FT                   EGAPLVASEKSRIPVINAGDGGHQHPTQTLADLLTIRSIKGRLNNITIGFCGDLKFGRT
FT                   VHSLINALIRYDNVKIVLISPEELKVPDYVRDDVLRANNIEFKEVEKLEDAMGELDVLY
FT                   MTRVQKERFFNEEDYVRLKDFYILTKEKMELAKDDMIVLHPLPRVNEISVDVDDDPRAC
FT                   YFRQAQYAVYVRMALILTLLGLAED"
FT   CDS             604832..605293
FT                   /transl_table=11
FT                   /locus_tag="ERE_06290"
FT                   /product="Bacterial membrane flanked domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92709"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH75"
FT                   /protein_id="CBK92709.1"
FT                   /translation="MSVNESQIKNTTAGAIDDDDAVIFKERKRLLFLGLPWTFTKYTVT
FT                   PSFITVESGLLSTTEDDCYMYKVADVKLTTSLMERIFKLGTIVCYTGDVTNPELKLVHV
FT                   KHSREIKSYLLKQSEAARLKRRTLNTVDIGAHGADMADLDHDGIPDSME"
FT   CDS             complement(605511..606233)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06300"
FT                   /product="DnaJ-class molecular chaperone with C-terminal Zn
FT                   finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92710"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR028061"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH76"
FT                   /protein_id="CBK92710.1"
FT                   /translation="MIDPYQVLGVSRSASDDEIKKAYRSLSRKYHPDANINNPNKDQAE
FT                   EKFKQVQQAYDQIMKEKQSGAAGAGGYGGAGSSSSYGGSSYGGGYGSGPGAGDPFGAGG
FT                   PFGGFYGRYTYNNAGSSAQDDNPKVRAAGNFISNGYYNEALKVLDEVPFAERRGRWYYY
FT                   SAIANQKLGNTATAIEHIQRAVSLEPNNMQYRQFMQIIENGGSWYSDMGDIYGRPSGRG
FT                   SECCSLLATFLCWQMFCC"
FT   CDS             complement(606675..607082)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92711"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH77"
FT                   /protein_id="CBK92711.1"
FT                   /translation="MFGYITVNKDTLSEENKKIYQSYYCGLCQTMKSQYGRRAQMALNY
FT                   DMTFLIVLLTGLYEPDSVTRDGFVCSVHPTKKRTLRTNEITEYAAAMNILLAYYNLIDD
FT                   WKDDKSLTKKTYAEMLKKDFEKAKKRLSDTG"
FT   CDS             complement(607287..607682)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92712"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH78"
FT                   /protein_id="CBK92712.1"
FT                   /translation="MREKFIRFMNGRNGMDELARAESWVVMILLVVSIFTRSAILDILA
FT                   IGLMIHMYFRVFSRNVNKRYAENQKFLNARYEWTVKAERRKKRFAQRKQYKFFKCPMCK
FT                   QEVRVPRGHGKICITCPKCREQFVRRS"
FT   misc_RNA        607907..608252
FT                   /locus_tag="ERE_37150"
FT                   /product="Bacterial RNase P class A"
FT   CDS             complement(608412..609224)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06340"
FT                   /product="alpha/beta hydrolase fold."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92713"
FT                   /db_xref="GOA:D4JH79"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH79"
FT                   /protein_id="CBK92713.1"
FT                   /translation="MFKTKKSRIPAVYRILLVAIAVMAIGGIAVNCYVGNYYRADSIAE
FT                   AAIDSDREVSVTIEKKDKRIQATQYDLKLKNYTITFAPQDKEKATKALIFYPGGRVQYT
FT                   AYAPLMHELAKNNFVCILVHMPGNLAVLDQNAADGIIEKYKEIYPSIQEWYMGGHSLGG
FT                   AMAAEYVSKHVDEFDGLYLFAAYSTADLSDSDLRVFSVYGSEDGVLDMDKYRKYRSNLP
FT                   EDTYEYVIDGGCHSYFGSYGLQKGDGTPDVAFEEQIEMTVDFITYNSK"
FT   CDS             complement(609217..610956)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06350"
FT                   /product="Uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92714"
FT                   /db_xref="GOA:D4JH80"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH80"
FT                   /protein_id="CBK92714.1"
FT                   /translation="MQEYSVKVTLPDGQVMAVTASESDTLEAVADRFKDYYEDDIILGI
FT                   VNGRLRELNKKIKSDCELSFVTTADRDGRRTYRRSVVLLLQRAIYDVYGSMTQLHVMHS
FT                   LGEGYYCQLEKAVECADSQQEKYNEDTDQGSRENSEKSVTEHDIDRIVCSMYSFVEKDL
FT                   PITKHSEKTQYAEQLFKEKGLHDKERLLHYRRSSRVNLYELDGVVDYFYGFMAPSTGML
FT                   KYFDIVPYESGFVLLFPGAHSRSVEPLVTSNKLFHTLDDSREWSKMLGIGTIGSLNDAI
FT                   AAGRGQEIMLLQEALMEQKIGNLAAQIASDDKKKFVMIAGPSSSGKTSFANRLSIQLIA
FT                   KGRKPHPLSLDDYYVDRELCPKHPDGSFDFECLESIDVKLFNEDMNRLLKGEAVDMPSF
FT                   NFKTGKREYRGRKLTLGADDILVIEGIHGLNDRLSQLIPPEHKFKIYISALTQLNIDEH
FT                   NPLSTTDERLIRRIVRDARTRGTNAMETIAMWPSVRKGERENIFPFQEQADVMFNSALV
FT                   YELAVLKVYAEPLLFGIERDCPEYLEAKRLLKLLDYFLPMPADGIPNNSLLREFVGGSC
FT                   FNV"
FT   CDS             complement(610943..611665)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06360"
FT                   /product="Predicted SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92715"
FT                   /db_xref="GOA:D4JH81"
FT                   /db_xref="InterPro:IPR006901"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH81"
FT                   /protein_id="CBK92715.1"
FT                   /translation="MKAVASMVTAGYTLCDVGTDHGYVPIALVQSNIIPKAIAVDINKG
FT                   PLERANEHIRANGLTEQITTRLSNGLEAIHDGEVDSIVIAGMGGELVIHILTAGETVCR
FT                   SAKELILQPQSEVSKVREYVRNTGYKIVDEDMILEDGKYYPMFRCVPCADNSAWDNMDE
FT                   TTVTVCDLYGPVLIKNGNPVLRKFLVREHHKLAAIMQQLRTQEMSDSIMDRIEQINEMM
FT                   AYNEAAYSTMGAIRNAGI"
FT   CDS             complement(611688..612944)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06370"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /function="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92716"
FT                   /db_xref="GOA:D4JH82"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH82"
FT                   /protein_id="CBK92716.1"
FT                   /translation="MAKKKEQKDMAQEQEQRLNFQQKLIEILELGKKKKNMLEYQEIAD
FT                   FFKDLNLDPEKFEMVIDYLEQNGIDVLKISNDDDVDDDIILDDEDEVEVEKIDLSVPEG
FT                   VSVEDPVRMYLKEIGKVPLLSADEEIELAQNMEDGAVATEKINVLKGRIDGASEEEKAE
FT                   IKEEIKTLQRDVDKGADAKKRLAEANLRLVVSIAKRYVGRGMLFLDLIQEGNLGLIKAV
FT                   EKFDYKKGYKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRVSRQLLQELG
FT                   REPSPEEIAKEMNMPVERVREILKISQEPVSLETPIGEEEDSHLGDFIKDDNVPVPADA
FT                   AAFTLLKEQLEEVLGTLTEREQKVLTLRFGLEDGRARTLEEVGKEFNVTRERIRQIEAK
FT                   ALRKLRHPSRSRKLKDYLE"
FT   CDS             complement(612958..614730)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06380"
FT                   /product="DNA primase"
FT                   /function="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92717"
FT                   /db_xref="GOA:D4JH83"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH83"
FT                   /protein_id="CBK92717.1"
FT                   /translation="MPYYSDELIEEVRSRNDIVDVIGSYVHLQKKGSTYFGLCPFHNEK
FT                   TGSFSVSPNKQMYYCFGCGAGGNVFTFLMQYENFTFPEAMQELADRVGIELPKQEMTSA
FT                   QRREADRRTQLLEINKEAAKYFYMLLRGPRGQRAHEYFKKRELSDETMQKFGLGYSDQY
FT                   SDDLYKYLRSKGYDDEILKETGLVTIDEVRGGHDKFWNRAMFPIMDVHNRVIGFGGRVM
FT                   GDGEPKYLNSPETKIFDKSRNLYGLNIARSTRKNQLLLCEGYMDVIALHQAGFDNAVAS
FT                   LGTALTSGHASLLKRYTNEVYLTYDSDGAGVKAALRAIPILKEVGITTKVINMRPYKDP
FT                   DEFIKALGAQEYEERIKKAENSFMFQIRIMQAGYDMDDPESKTAFYNEIAKKLLGFTEE
FT                   LERTNYTQAVSREYSIPYDDLRKLVNSMAMKGGIVKPQTKLKSGINEKNKKEDGMKQSQ
FT                   KLLLTWLIEDNSLFDRIKGRISADDFTEELYHKVAKEVFSQYETTHTVNPARIVSMFTD
FT                   EDEQREVAGLFNATIHQVEGKNDKATALRETVVRIKQNSIDYRSKHLAPTDMEGMMRII
FT                   EDKRALEELQKIPE"
FT   CDS             complement(614853..615866)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06390"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase,
FT                   putative"
FT                   /EC_number="3.1.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92718"
FT                   /db_xref="GOA:D4JH84"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH84"
FT                   /protein_id="CBK92718.1"
FT                   /translation="MTIREQIEKREQEILSPFACLSINSRGRDYDEPQCDIRPVFQRDR
FT                   DRILHSKAFRRLKNKTQVFLTPKGDHYRTRMSHTLEVSQNARTIAKALRLNEDLVEAIA
FT                   LGHDLGHTPFGHAGERILNEIYEGGFKHNEQSVRIVEKLEKDGAGLNLTWEVRDGMLNH
FT                   QTSLMPHTLEGKIVRLSDKIAYINSDFDDAIRAQLLCEDDIPLEIRNTLGHSTKARLNH
FT                   MVHNIITNSMGKDDICMSKESAQAMQDLRKFMFANLYNNPVAKSEEKKAKAMLKQLYFY
FT                   YMEHIEELPQKYLAMLGQGDDKGRIICDYISGMTDQYATTKFHEYFVPVAWEIDGY"
FT   tRNA            complement(617577..617660)
FT                   /locus_tag="ERE_T_37110"
FT   CDS             complement(617752..618786)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06410"
FT                   /product="L-threonine aldolase"
FT                   /function="L-threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92719"
FT                   /db_xref="GOA:D4JH85"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH85"
FT                   /protein_id="CBK92719.1"
FT                   /translation="MIRFNNDYNRGAFDCILKALADTNTTSYPGYGEDEWCDKAEQIIK
FT                   GLIGRDDSMIKFIPGATQANYVVVAAALSPVQSVIAADTGHINCHEAASIENTGHKILA
FT                   LPNTDGKISAAQIEACAAEYYDNAKPEYLTEPKMVYISFPTEQGTLYTKRELCDISAVC
FT                   KKYGMYLFVDGARMGYGLGSDKNDLTLCDFAMLSDVFYIGGTKCGALFGEALVINDEDI
FT                   KYRFKAYMKQNGAVLAKGWLMGLQFATMLENGGYFEKTKRADELAMQIKEAFEQKKVPF
FT                   WVESFTNQQFVILSDEQKKTLAEKYYFEEMGREKDGTVVRFCTSWATKQEEVDALVLDI
FT                   SKLV"
FT   tRNA            complement(619056..619140)
FT                   /locus_tag="ERE_T_37100"
FT   CDS             complement(619238..619753)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06420"
FT                   /product="Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92720"
FT                   /db_xref="GOA:D4JH86"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH86"
FT                   /protein_id="CBK92720.1"
FT                   /translation="MRRIVAATEENKEEILKLYKIQLGREFCPWDDSYPGMKEIEFDLG
FT                   RESLFVMIDGQEINADAGSKEDRIIAAISIDDDPQVERLDCWSHKLAPGAELSRLAVHP
FT                   DFQNQKIARQMLVFGMEELARRGYKSVHFLVNKLNVKALRSYAVFGFDTVGECSLFGQP
FT                   FLCYEKSL"
FT   CDS             complement(620080..620385)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06430"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92721"
FT                   /db_xref="GOA:D4JH87"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH87"
FT                   /protein_id="CBK92721.1"
FT                   /translation="MSSLFEDLKEGLEEAIAYEKGYGAGRVKTYMILPVKEYSGKEIRD
FT                   IRTKAGMTQSVFASYMGVSIKTVEAWEGGRTHPTGPVFRLLDILSKNEEMEYIVAK"
FT   CDS             complement(620393..620740)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06440"
FT                   /product="Protein of unknown function (DUF1044)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92722"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH88"
FT                   /protein_id="CBK92722.1"
FT                   /translation="MTRTFIEVPLFSKRWKEIGLGEDELRALQIMLLKDPVSGPIMEGT
FT                   GGIRKVRFPLQNRGKSGSVRVCYTDFAEYEVIYLITAFKKKSQENLTEEEKSVLKKLVK
FT                   SLREEAAKNRR"
FT   CDS             complement(621085..622077)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92723"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH89"
FT                   /protein_id="CBK92723.1"
FT                   /translation="MVKNDLIDRYIYAVTKHMKSAMKKDVAAELETIIQDMLEERCEDV
FT                   TPTERDIKVVLTELGTPNELASKYKGETQDCLIGQPYYSLYVYVLKIVTVCISGGMLLA
FT                   QIMAALTSHTIWYIAIYRTVGGIFGGILTGFAFVTLLFAFFYKKGIKVDGLNDGIDNLP
FT                   PVPQKSNRISKVDAIVGIVFSVIFTLVFLVCPQILCIAFVKNGVGVYEPLFNLEYIRQT
FT                   WYFILAFGILGVTRDSVRLIDGSYTKRVMLVTIITNIIDGVLTSIWLLNDRIMNSGFFD
FT                   GIEQLLGTDAEGISHVFIHYNKVFLSIIILALTINCVETVVKAVKYSRQ"
FT   CDS             complement(622078..622413)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06460"
FT                   /product="transcriptional regulator, PadR family"
FT                   /function="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92724"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH90"
FT                   /protein_id="CBK92724.1"
FT                   /translation="MNCDEIVSGLILEFRRGTLIMVVLAQLNKPMYGYSLVKELEGKGI
FT                   SIEGNTLYPLLRRLESQGLLKSEWETEATKPRKYYIITEDGKLVYKKIKEHWKKFSQSI
FT                   NVLMEEE"
FT   CDS             complement(622734..623048)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06470"
FT                   /product="Plasmid stabilisation system protein."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92725"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH91"
FT                   /protein_id="CBK92725.1"
FT                   /translation="MQFNVELSELAEKQYDNILSYISNVLKNPQALENVMDDFDDTVGK
FT                   LEKMADTFNYCKSDRLRELGLRKIRFAKHRYLLVYRIAGSRVIIEGIYHELQDYENSIM
FT                   "
FT   CDS             complement(623038..623271)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92726"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH92"
FT                   /protein_id="CBK92726.1"
FT                   /translation="MGIAELTAKIESLSAEDYNMVIMLVNKLSEKPENNGLKRLSENEL
FT                   VEELSASIRKSDTGATKSARAVSKSMREKYAV"
FT   CDS             complement(623376..625106)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06490"
FT                   /product="Mismatch repair ATPase (MutS family)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92727"
FT                   /db_xref="GOA:D4JH93"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH93"
FT                   /protein_id="CBK92727.1"
FT                   /translation="MSQKKYSLLYPDTNAQYRTLSDVTMHDLGMDQICKKLSAKEREQN
FT                   YIQNVMARLYADPAVTQYRCDIFEDVLQQKKMRDDLMEILERISFLREYGSFNREYDES
FT                   ACIWDLLHRLDELNDYIECVDALHTCLAASDIHSAGFLGLKAYVEKIYADNGFAELKKD
FT                   ISELKMDTSQLKSITVGINLNDRFEADGIGLISVNSKYFTKSGILGNFYDHIASKNRIN
FT                   EDTIWKKNFKFQPFDVNADAVISTPMQKVMDTAVIRSESWGGIVKLPEGDQAKDVTRYT
FT                   DRIVNHMISHMVKRVREVLNKYVSITITDMTDLIPELLYYIKWAEYIQKLQEQGFTFAK
FT                   ASVYKAGENESDPYMMQARGIYNLKLAVFETEESGNIVPNDMDFDRNRRVYILTGANRG
FT                   GKTTITQAVGQLFVLAQGGIYIPGKAFTFSPVTGIYTHFPADEDKTLDLGRLGEECKRF
FT                   KAIYEEADSRSLLLMNESFSTTSFEEGYYIAKDSVRAILHKGMRTIYNTHMHKLAFDVE
FT                   EMNEEQQKAEHTDGKAFSMIVHMKGTERSYQIEVAPPEGKSYASEIAQKYGVTYEMLVE
FT                   "
FT   tRNA            complement(625497..625581)
FT                   /locus_tag="ERE_T_37090"
FT   CDS             complement(625702..625806)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92728"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH94"
FT                   /protein_id="CBK92728.1"
FT                   /translation="MELEYMNKKHWIDDIPVLLQCLVNIQDRIKAGLD"
FT   CDS             complement(626007..628589)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06510"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92729"
FT                   /db_xref="GOA:D4JH95"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH95"
FT                   /protein_id="CBK92729.1"
FT                   /translation="MSDSKLFKKIQDYFCMVNGIYLSCLTKKDGVMTEVCQCNDKWKSM
FT                   LTFIGEEKYENLLLRLSDCRVENLIDEPLDKDYIRLYGLIVRVDNTHDIYWIIAAVIDE
FT                   QMSNDERNLLPDGIIITSEARLNRTIEFLETMTRQLLITKRDEDAANEALSLIRKSDEE
FT                   IKKQFHMLEAINSVIKLLEMDGSFTDMAQKALEGAVTTIKLTGAFIIRKNVDGMHLDVI
FT                   VSYGRKPFDTISITEVPFFTGKPYIISSDSVMPEKFRLFMEKQAMRAAIFQPVNIDNRT
FT                   QMYVCFFDEEDDRSWGKYDVKFLNDTKRVIQSILTKKITTNSLAGSYASLEAILENSGC
FT                   GIYVADMSKSEILYMNNYCKQLLSNIIEQNKLEKYIFSHTAESRSFTEVYVTEEDKWFD
FT                   IHRTGIAWVDGRKVQLVTLYDITQKKRYQQRIENQANNDFLTGLYNRMRCEQDLAKFID
FT                   DSVKNDTRGAMIYIDLDDFKHINDGLGHQYGDVLLKAISHSLTQVKEIENHCYRMGGDE
FT                   FIVIVTGSSVDRLESIINDIQQIFVRPWFLKGEDYYCTISAGVAFFPTDASTVEDVIRR
FT                   ADIALFNAKKEGKNRIEFYNEGIDGTSTKRLDLEKHMRKATMNECDEFTVYFQPIINVK
FT                   GEDVCAGAEALVRWNSATMGFINPVDFIPLAEYLGLINPIGEHVLREAAKHCRYWNDMG
FT                   HPDYKVNVNLSVVQLLQNDIVKKIKGIIDEVGIEPGNLCLEVTESLAINDMVRMKRILS
FT                   EIKALGVKVALDDFGTGYSSLNHIREMPLDIIKIDKCFIEHLGEDDFSDAFVKMVTELA
FT                   NTIGVHVCVEGVETDRQYAIIKKMGIYYIQGYFFDKPMCIESFEEKYI"
FT   CDS             complement(628616..630079)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06520"
FT                   /product="Putative RNA methylase family UPF0020."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92730"
FT                   /db_xref="GOA:D4JH96"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH96"
FT                   /protein_id="CBK92730.1"
FT                   /translation="MKEIIGNLLKKENVRQNLSSLRQEIKDENALAEALKLLAGEDELL
FT                   VSFMGAEDAKTRKNAALLIGDLHMSQLSDEVFKAYEAEQMRFVKGSYLAALSQLDCKEL
FT                   LPLLMERAKELEHMTVTAENRKHIEEELNEINKILIKYNGIKHHTPVLEGVKAELLLMT
FT                   NRLHREVVRRQIPVKDTKLHPLGVLVKTDNIPLIMQVRTFRKMYFTIHAASLLPKDAQE
FT                   AAGLLAESDMYDILRRMHREGGPFYYRIESTADAAYQSRLAKAIDMHFAGRMINSPNDY
FT                   DVVIKLIPTKNDNYFVCMRLCSIQDNRFAYRKNVLPTSMHPSQAALIVSLAKPYLKETA
FT                   QIMDPFCGVGTLLIERAHLVPAREIYATDTYGDAITMGRENAAFAKTRINFIHRDFFDF
FT                   RHDYKFDELITDMPVRNRQTKAEMELFYERFFDKAAEHLVSGGIIVMYSNEIGFVKKQI
FT                   RLRVEYRLLQETCILDKNDFYLFVIRYED"
FT   CDS             complement(630113..630859)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06530"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92731"
FT                   /db_xref="GOA:D4JH97"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH97"
FT                   /protein_id="CBK92731.1"
FT                   /translation="MDEYEKIRQRKREEYRKRHRAQVRRKQLIGNGIVIGMIILIIATI
FT                   IIVGALRGKKAKQEEVKAEVTSTLYNPIQPKLDVQLLTPNPYSRPQKALEKVNGIVVHY
FT                   TANPGTSARQNRDYFNGLAETKKTKASSHFVIGLEGEIVQCIPCNEISYASNNRNSDTI
FT                   SIECCIEDETGKFNDSTYQSLIELTTWLMGRYDLSADDVIRHYDVTGKKCPLYFVEHED
FT                   AWEQFHKDLDTYIKENGVPKEEASQN"
FT   CDS             complement(631076..632107)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06540"
FT                   /product="branched-chain amino acid aminotransferase, group
FT                   II"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92732"
FT                   /db_xref="GOA:D4JH98"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH98"
FT                   /protein_id="CBK92732.1"
FT                   /translation="MEKKDIDWSNLSFGYQETDYSYVSNYKDGKWDDGQLTKDHTVTLN
FT                   ECAGVFQYAQTCFEGLKAYTTEDGRIVCFRPDLNAQRLKDSCERLEMPVFPEDRFVKAV
FT                   EEVVKANAAWVPPYGSGATLYIRPYIMGTNAVIGVKPADEYQFRILVTPVGPYFKGGAK
FT                   PITIRVSDFDRAAPHGTGHIKAGLNYAMSLHAIVDAHAQGFAENMYLDPATRTKVEETG
FT                   GANFIFITKDGTFVTPKSDSILPSITRRSLMVVAEKYLGLKVEHREVLFDEVKDFAECG
FT                   LCGTAAVISPVGKIVDHGKEICFPSGMDEMGPVTKKLRDTLTGIQMGHIDGPDGWVHEI
FT                   KCD"
FT   CDS             complement(632269..634416)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06550"
FT                   /product="YhgE/Pip N-terminal domain/YhgE/Pip C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92733"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:D4JH99"
FT                   /protein_id="CBK92733.1"
FT                   /translation="MKKIFQIYLADLKRISTNVVAIVIIMGLGIIPALYAWFNIMSNWD
FT                   PYGEEATSQMHIAVYSEDEGMSVGDLKLCMGDSVIKGLKENDAIGWIFTDSSKETLEYV
FT                   YSGKCYAAFIVPKDFSADMLSFLSGEPVNPQIEYYENSKKNAIATKITSKVKTTVQQSV
FT                   NSSMVSTITEIASKSGELIVGDGKSGDNLAGTVVDKLKDMDTTLSTYAGMLDTFAMLTD
FT                   SADSLIGSTQSLLPSVQGLIDGGQSSVSGMQSSVLSGAQTAQTITQMVDISLSNINSQL
FT                   DVLENSIQLLNASGLADADTADISVSVAGFDTVEQLAENTLAAIQGLKGVDSSQIEAVR
FT                   KNIQSIKTQIKDLKSDTELTADKLKLLKESIKADVSGAKSAIDTLKNTFDHSVSPNLTG
FT                   AVYDIEYALIETQSMLGSLDNSFPDIQKALDDYSVVLKSGNADIVNTRQYVQQIRDGLQ
FT                   NVISGFDNLSNDEQFNEIVKLLRTDPTLIAQFVTSPLSMDEQKIYEISTYGSAMAPFYT
FT                   VLALWVGGLITVALVKTKVKDTDDIKSLGKVNSVHKFFGRYITFFVIGQLQTLVTVLGD
FT                   LFFVGIQCRHPFLFWCASALTSLVFTLLMYSLTAALGNVGQAVAVVIMVIQVAGAGGTF
FT                   PVEVLPQVYRALYKFMPFNYAMNALRECVGGMYRFDYCKDLAILLIFIAISLVIGLLLG
FT                   RPFGRFNTAIEKSKKKSGLIL"
FT   CDS             complement(634413..634901)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92734"
FT                   /db_xref="UniProtKB/TrEMBL:D4JHA0"
FT                   /protein_id="CBK92734.1"
FT                   /translation="MQDIGRNSNKDSNMDNDMNNNANNNVNEQPLSDDKRLLEMYDKLV
FT                   GYEKTIHEQNQKRIKIGLRCIYIIPLFFLVLLMIVPDSSKIIFLVLWIVSLFAIAVYLI
FT                   GVEYVDYKLQEKMNEISGCDVQSVSPVVQIEDRVQEIAERVEQRFDTMQQSTGEDAEQ"
FT   CDS             complement(634987..637122)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06570"
FT                   /product="YhgE/Pip N-terminal domain/YhgE/Pip C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92735"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:D4JHA1"
FT                   /protein_id="CBK92735.1"
FT                   /translation="MADILRIFKRDMCGIFRNVLVLIIVIGLCVLPALYAWFNIYANWD
FT                   PYGNTGNIAIAVVNLDKGWTKNDSETVNMGDGVVESLKQKDTIGWKFVKSEEKAVEGVK
FT                   SGRYYSALVIDEQFTYSMYHGVADNIENPRITYYLNDKKNAVATKITDSAASAVKSSIN
FT                   KQFIKVLAEQVFKETNVISDDMKEKDAVGQMTGKLEAVSESLAQYDAMIDTFIDGNKAL
FT                   SQVSKETGEALKDGQDKLAKGTDRLEESKNDLQSTRQSFDSFSADITSALAKVKSSIDD
FT                   ISKQISDANLSQDVNTIQSDVQNIKQSADALKGNIDTLEDKINKIKPDMDDTHVGTLIS
FT                   NIELVKEQTKSMIESTLSVDLSGKTQNSEETLKSVMSALSSTASAVNDTYTSQIVPQVD
FT                   GMISSMSSVLDSMQTTLGNLSQTSGSMAQVFDGVDSTLDTLNMSMTQLKGVIESASDKI
FT                   NTTLDKLEAASEDEKADIIVNLLSGNPEKLGSFFSEPVQVSDNYIYEIANYGSGVAPFY
FT                   TTLAIWVGMTILVSLVKVHADAKGLGKLKPSQLYFGRYLTFFLLSQVQTFIIVLGDLYL
FT                   LKIQCVHPVSFIVTGAVTSLTFSLLIYSLTISFGDIGKALAVVVMVLQIAGSGGTYPIE
FT                   ALPAFFRAVYIFFPFPYAINAMRECIGGMYENTLGKCYITLLLFGAASLVIGLVIRKPF
FT                   IRLNHFIEKRMEDTEML"
FT   CDS             complement(637134..638408)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06580"
FT                   /product="folylpolyglutamate synthase/dihydrofolate
FT                   synthase"
FT                   /EC_number="6.3.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92736"
FT                   /db_xref="GOA:D4JHA2"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:D4JHA2"
FT                   /protein_id="CBK92736.1"
FT                   /translation="MGNLDYTQVLNKIENTRRFGNEPGVVVTAQVIKVLREKGKQKRII
FT                   PYIHVAGTNGKGSVCAFFSSILKKEHMRVGTFVSPHLVDFEERITVDGRMIAKEDVTRL
FT                   GNYLLDIDFGIGLTMFDYCLAMALLYFEEQQCDYMVIETGLGGRLDSTNAIGTPQCAVI
FT                   TKIGYDHMAILGSDIADIAAEKAGIIKENSTVVVEQQDKRAMQVIEQEAQKKHARIITV
FT                   EQSDIARCSGYALRLCGTFQWENAAAAELAARYVLGKHYSGPEYEIQYDKTGPKSEKTN
FT                   LNDRIKSALEEAVWPGRMEIVSKEPFLLVDGAHNSNGVDALRESLMQMYPGEKFCFFMG
FT                   VMADKDYDAMIREILPLAEEFYTVTPDSDRALQASHLADFIRKEGVEATELSGVDEIRK
FT                   HLKRDTKNVAFGSLYFIGELKQHRI"
FT   CDS             complement(638454..639296)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06590"
FT                   /product="EDD domain protein, DegV family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92737"
FT                   /db_xref="GOA:D4JLQ2"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLQ2"
FT                   /protein_id="CBK92737.1"
FT                   /translation="MYKIIIDSCGELTDSLKKDGHFCNVALELDVDGYRIRDDESFDQH
FT                   DFLRRVKESVKGPKSSCPSPEEYMQAFEGEADHVYVVTLSGKLSGSYNSAVLAVNLYNE
FT                   EHEDCGKQIYVFNSRSASIGETLIGMKVQEFEESGLSFDEVVKQTEEYISSMNTFFVLE
FT                   TLDTLRKAGRLSNLKAFVASTLNIKPVMGSTDEGSIQQLGQARGIKRALAKMVEDVVAA
FT                   TKDCEHRILAISHCNCPERAQYVKACLEKLARFKKIVIVDTAGISSMYANDGGIIIAV"
FT   CDS             complement(639460..640746)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06600"
FT                   /product="Aspartyl aminopeptidase"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92738"
FT                   /db_xref="GOA:D4JLQ3"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLQ3"
FT                   /protein_id="CBK92738.1"
FT                   /translation="MKQEKLFDLLKAAVSPCECVKAAKQELLENGFEEIDYTGNWKLVR
FT                   GGRYVLNHHDTTMFAFTVGSGYNKKDMVRIAAAHTDYPYLRIKPNPDFMTNSYAQVNVE
FT                   VYGGPILNTWFDRPLGVAGRVAIKSEDVFNPRMVLYRSKKPVMIIPNLAIHMNRDVNKG
FT                   VEINNQVDLMPVLDSIPEDEMTTDYFLSFLARELSVEKSDIIDFELNTFCVEEPCFVGV
FT                   NDTMISSPRIDNQSSCRALLDAIEDGNRADGINIIALFDHEEIGSNSKQGAASIMLHDM
FT                   LRRILRNMDLSENEIDESIYDAMLLSVDVAHALHPNKKEKMDITNKPVMGKGFCIKQAC
FT                   SQSYATDAQAIAILCQLCDEKGIPYQRFVNRSDSRGGSTLGSIAGTLLPVKTVDIGIPI
FT                   LAMHSACELMGVRDMKALSDCVTAFFGYH"
FT   CDS             640962..641465
FT                   /transl_table=11
FT                   /locus_tag="ERE_06610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92739"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLQ4"
FT                   /protein_id="CBK92739.1"
FT                   /translation="MISIELTDTKDFMNKLLRTEIFDNFLLQEAVITKAASYVIDGHLQ
FT                   KGFYSSTELEENGIAGYSILPFRMLRTNCFHLIKGRQTPSSFKFVFLLSPENMEHTLSS
FT                   LHSAFTVSDISGFFINIRYQSQLLTLTTGISYNIFSADKTLDSEWDKLVMKFLANNDIN
FT                   FKEL"
FT   CDS             641551..641754
FT                   /transl_table=11
FT                   /locus_tag="ERE_06620"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /function="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92740"
FT                   /db_xref="GOA:D4JLQ5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLQ5"
FT                   /protein_id="CBK92740.1"
FT                   /translation="MSKGTVKWFNNQKGYGFITAEDGKDVFVHFSGLNMEGFKTLEEGA
FT                   AVEFDITDGAKGPQAVNVEVVK"
FT   CDS             complement(641925..643394)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06630"
FT                   /product="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92741"
FT                   /db_xref="GOA:D4JLQ6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLQ6"
FT                   /protein_id="CBK92741.1"
FT                   /translation="MDKNKKMIIGILTAAIVLVVAFIVYITCFDSHIEFSSKFKNGITV
FT                   EYGKKFEAPKIKAYVRGRLINRKGKEIKCTIDSNVDATKTGSYEIKVTAQYGKKTATQT
FT                   IKVEVRDKKAPEITLNGDAEMTVEAGSEFSDPGYTATDNYDGDLTDKVSVTGAVDTSKP
FT                   GDYEIKYSVADSSKNESDVKRTVHVTDTTAPQIKLSGDDFMSVKKGDKYSDPGYTATDN
FT                   CDGDITDSVKVSGDKVDKDKAGKYTVTYEVSDSSGNKAKATRVVSVYDPAATADTVNPG
FT                   NKIIYLTFDDGPGKYTQGLLDVLDKYNVKATFFVTNTHPDYQNMIAEEAKRGHTVAIHS
FT                   ASHKYNQIYTSEQAFFDDLEQMNSIIKAQTGNDASIIRFPGGSSNTVSKDYCPGIMTQL
FT                   VNDVTARGLLYCDWNVSSGDANSKPISTEQVVQNVISGVQSHNVSVVLQHDIKDFSVNA
FT                   VEQIIQWGQANGYTFLPLTTSSPMSHHRVNN"
FT   CDS             complement(643747..645204)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06640"
FT                   /product="Iron only hydrogenase large subunit, C-terminal
FT                   domain"
FT                   /EC_number="1.12.7.2"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92742"
FT                   /db_xref="GOA:D4JLQ7"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027631"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLQ7"
FT                   /protein_id="CBK92742.1"
FT                   /translation="MYADENVIKIKHAVLLEVAKAAFAGNLDEIRDDIPFTLIPGPTPQ
FT                   FRCCIYKEREIIRQRVKLAEGKAPSANDDGNIIQVISSACEDCPISSYTVTENCQNCLG
FT                   KACINACKFGAIEAGRLRSHIDPQKCKECGRCAQACPYNAIAHLKRPCKFSCPVNAITY
FT                   NEYGISVIDESKCIRCGKCIHSCPFGAIGSKTYIVDVIDAIKSENKHVYAMVAPAAEGQ
FT                   FGVNITMNSWKKAMQAVGFNGFVEVALGGDMTAAYEADEWLEAYEAGEKKVTSCCPGFV
FT                   NMVRKHYPELADKISTTVSPMCAVSRMIKAKDPDAVTVFIGPCVAKKSEVHDQKIEGNA
FT                   DYVLTFSEIRAIMKAKGVQLEADDTSYQEGSVFGKRFANSGGVTAAVIESMKEKGEDVD
FT                   CKVCKANGAAECKKALLLMKAGKLPENFIEGMACEGGCVGGPSSYNDMVSTKKFRDDLL
FT                   SRADDRKIRDNIANYHMETFEMHRKEQ"
FT   CDS             complement(645450..646709)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06650"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92743"
FT                   /db_xref="GOA:D4JLQ8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLQ8"
FT                   /protein_id="CBK92743.1"
FT                   /translation="MLENIRLSFRGIWSHKMRSFLTMLGIIIGIAAIIAIVSTIQGTNE
FT                   QIEKNLIGSGSNNVKVTLQKDGYDMDLSYETAPAGVTEVSAATLDSIKELDHVKNAALY
FT                   RTRQASNAVYYLNTALSGGNITCVDDGYFDTASYVVMKGRGFSKNDYANARRVALIDES
FT                   VESSLFSGESALGKTVEIQGYPFTVVGVVTEKDSYDLVINSMDDYYMYAHDDSQGNVFV
FT                   PSGTWPVIFGYDEPQNLLLKADSTDTMATVGKAAEEILNSNLNVTDGSDVTYKAQDLQE
FT                   QAKQIQQLSQSTNMMLIWIAGISLLVGGIGVMNIMLVSVTERTSEIGLKKAIGAGKGAI
FT                   LGQFLTEAVVLTSLGGLVGVLVGVILSKVISMLNGTPTAISPAAAILAVLFSMAIGIIF
FT                   GMLPSYKAANLNPIDALRHE"
FT   CDS             complement(646730..648295)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06660"
FT                   /product="Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92744"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLQ9"
FT                   /protein_id="CBK92744.1"
FT                   /translation="MKKKKRIKIIIIAVLVVAVAAGSITGVVYYRNSKGLASVMSVSMI
FT                   STTNDYTSMTSEGMVCDDACQTINLKDGQKVTEVYVTKDQQVKAGDKLLAYDVTSLSLS
FT                   VEMKQLEIQSLENQLASEKQKLDKLKNTKPVEKQPETPVTPEPQPDTQPSAPDEQHDVI
FT                   SDLSEAKGIGTEDDPYVFTCTEASYVSGALLNTLSEKSAVARFVIGDANAPDMELIVRG
FT                   DRLGGYDESDEIKLFLAGTTTAGDASDDTEGSEPSDTKTDSATEQTAQTEADTAAEEKT
FT                   YTADELKDAIKEQTRSVADVDLQKRIAQADLKELQSELEDGVVYAKKDGIVTTVCDPAN
FT                   PPKDGTPFLQLSGASGLYISGTIGELDLDTVKIGQSVSAVNYMTGDTYDGTISEISNVP
FT                   SDSVNYYGDSNPNSSFYEYTAYIENPQNLKKGDSLELTIDTSSEGSDSGLYIDKSYVRT
FT                   ENGQSYIYKDDNGKLKKQSVKTGKSLWGSYVEIKSGLTNDDYIAFPYGVREGEKTKVSE
FT                   DGMY"
FT   CDS             complement(648273..648977)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06670"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92745"
FT                   /db_xref="GOA:D4JLR0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLR0"
FT                   /protein_id="CBK92745.1"
FT                   /translation="MILELQHIYKNYDQDKLVVPVLKDVSLQIEEGEYVAIMGPSGSGK
FT                   TTLMNIVGCLDLPTSGTYILDGRPVSELKEKELTRVRRDTIGFVFQNFQLMPRECALDN
FT                   VCLPLIYAGVSKKDRRQMGMEALERVGLSDRADFRPTQLSGGQKQRVAIARAMVNHPKL
FT                   LLADEPTGALDSKSGKQVLELFESLNESGVTVVVITHDRKVAEQAKRIVHIIDGEITEE
FT                   GQEAGNEKEKEN"
FT   CDS             complement(648978..650327)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06680"
FT                   /product="RND family efflux transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92746"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLR1"
FT                   /protein_id="CBK92746.1"
FT                   /translation="MSKKKKIIISVIAAVLIIAVIVSAVVIAMTKGKNAAKASGVYANK
FT                   VADVMYQAGSTDKYSGVVEAADTMDIKADSEKTVKDILVSEGDEVQVGTPLFTYDTKEL
FT                   AAKKESATLELESLNNTLSGYDAQIEQLTKEKKEAPKDQQLDYTLQIQQAQTQQKQTQY
FT                   DIATKKAEIEKYDESIKNATVNSTMIGVVKKINENQSADTADTAFMTIVATGDYRVKGT
FT                   IDEQSFLNSGLAEGQAVIVRSRVDESKTWQGTISKVDTENTQTDNSNSGMYDDGSSEQK
FT                   ASKYNFYVQLTGTGDMLLGQHVYVEPDFGQTQVKDGIWIDESYVVKDGDDAYVWTLNKK
FT                   DKLEKTKVELGDYDENLMMYEIKSGLTKDDYIVWASDDLYEGEPAQTWEEYVENGGGED
FT                   SVYDDMGTEALDDQMLEGTEGGPVDDGTMDDGTMDEGAADATSSGDAEVQ"
FT   CDS             650447..652249
FT                   /transl_table=11
FT                   /locus_tag="ERE_06690"
FT                   /product="Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92747"
FT                   /db_xref="GOA:D4JLR2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017310"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLR2"
FT                   /protein_id="CBK92747.1"
FT                   /translation="MEIAFSEKISPQLSAALLSTPYELGKEGGLSSGYLPESDSWEVIV
FT                   KYVGDIEKIKEKYPSVLITRLLGNYAVLVIEKSLVNTVALCDEIIYMEKPKQFNYDVYE
FT                   GSQASCITPVHTNPYNLTGKGVLVGIIDSGIYYAHPAFIQDGVSRIAYLWDQTVSDDTS
FT                   HSDIIPFGTLYDRDTITKAINAENSLEMQRICPSIDISGHGTHVAGIAAGNGNGNDNEQ
FT                   NTKYRGVAYESTLIIVKLKTSGGASFPTTTQIMLAVDFCIRKSIDMNMPIVINLSFGTS
FT                   NGSHSGTSLLEAYLDYIAGNYRCAVSVGSGNDGAGFGHANGSSYPADAELAIGYPEPSL
FT                   SIDLWKKYWDEIQLRISAPNNDMLEIPDTITNQAKGFTYRYRLDGTDIYITGGGPSPYS
FT                   PFQEIFIELMGSEYISPGIWKISLEPISVKDGSWDIWLPSGALRNAQTSFIHASPDITL
FT                   TIPSTAQNVISVGAYDSQTNRTAAFSGRGYTWAFDNIKPDIIAPGVDIISCSNTGGYTS
FT                   KTGTSMAAPFVTGAAALLMEWGIVRGNDLYMYGDKLKASLIKGAGENVFTAASRAVSEN
FT                   TSKNTKYPNPVTGWGTLCLLDSIP"
FT   CDS             complement(652258..652338)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92748"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLR3"
FT                   /protein_id="CBK92748.1"
FT                   /translation="MDKNPKHPLKKKNKADAKKHQKHVYE"
FT   CDS             complement(652569..653504)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06710"
FT                   /product="K+-dependent Na+/Ca+ exchanger related-protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92749"
FT                   /db_xref="GOA:D4JLR4"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLR4"
FT                   /protein_id="CBK92749.1"
FT                   /translation="MIFVAILLLIAGFVALVKGADVFVDGAAALAGKFGIPQLVIGLTI
FT                   VAMGTSLPEAAVSITAGIKGNAGITVGNIVGSNILNILIILGVTALITNVAIQKTTFKY
FT                   EIPYMLLITAVLLVMGMTGNEITFIEGVILWILFIAYLLYLYFLAKKGNDSGDEQSVKL
FT                   YPVWKCLLFIVLGGVCVVIGSQLVVNGATTIARACGMSERFIGLTIVAFGTSLPELVTS
FT                   VSAARKGNAGIAIGNIVGSNIFNILFVIGTVALICPVPFESRFVIDTVVAILCGVLLWG
FT                   GTIRHKELRKPCGVVMLLCYAAYFVYLAAM"
FT   CDS             653852..655303
FT                   /transl_table=11
FT                   /locus_tag="ERE_06720"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92750"
FT                   /db_xref="GOA:D4JLR5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLR5"
FT                   /protein_id="CBK92750.1"
FT                   /translation="MKTSEIIVFIVYLLCMLGIGIFFFVKNRNGGEKTYFLGGREMGPW
FT                   VAALSAGASDMSAWVLMGLPTSIYALGLGQVWIPVGLAIGYTISWLLEAPRLRKFSIVA
FT                   NDSITIPQYLTNRFLSKSLALQVICAIVFLVAYTIYAASSVKACGTLFHTVIGMDPQIA
FT                   MYLAAVVIVGYTFLGGFSAVCWTDFFQGMLVLGSMFIAPIFAAFMLDTSSMSALPGGYL
FT                   NPFSSWQDIVSGLAWGLGYFGMPHIIIRFMSIKSQKDLKKSAKIGITWTLLIVFFATLI
FT                   GVIGRLFLGFDESINENSLVFIQIVRKIFPGVISGILLSAVLAASMSTADSQLLAASSA
FT                   FSSDVYKPVIRKGKANDKEMMWTGRIVVLGISVAALIIASNPNAGSIMALVSNAWGIFG
FT                   AAFGPAIMLSLFWKRFNFKGAVAGIITGAAVDILWYAFLTSTGIYELLPGFVLGLIAAV
FT                   VVTLCTNEPSKEVYELFDKAQKFDE"
FT   CDS             complement(655500..657707)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06730"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92751"
FT                   /db_xref="GOA:D4JLR6"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLR6"
FT                   /protein_id="CBK92751.1"
FT                   /translation="MKIIKRSGSEDIFDAAKIVAAIRKANDSVLDYEKLTADQIEEIAS
FT                   NVETACENMKRSPSVEEIQDMVENQLMNKRAFTVARNYITYRYKRAIVRKSNSTDQQIL
FT                   SLLECNNEEVKQENSNKNPTVNSVQRDYMAGEVSKDITRRFLLPEDIVEAHEKGLIHFH
FT                   DADYFAQHMHNCCLVNLEDMLQNGTVISETMIDTPKSFSTACNIATQAIAQIASSQYGG
FT                   QSISLAHLAPFVQVSREKFRKQVQKEFESVGLDLDEEKINEVAELRVKEEINRGVQMIQ
FT                   YQVITLMTTNGQAPFITVFMYLNEVSDPQTKADLAAIIEEMLHQRIKGVKNEKGVYITP
FT                   AFPKLIYVLEDDNITEDSKYWNLTVLAAQCSAKRMVPDYISEKVMKELKDGDVYTCMGC
FT                   RSFLTVDRCSQTAGNVAHAENFDPNKRKYYGRFNQGVVTLNLVDVACSSEKDEEKFWKI
FT                   LDERLELCHRALMCRHKRLLGTKSDVAPILWQNGALARLKKGEVIDPLLFNGYSTISLG
FT                   YAGLCECVRYMKGVSHTEPKEGTPFALKVMQRLNDACEQWKKESNIDFSIYGTPLESTT
FT                   YKFAKCLQKRFGIIKGVTDKNYITNSYHVHVTEQINAFDKLKFESQFQKLSPGGAISYV
FT                   EVPNMQDNIPAVLSVMQYIYDNIMYAELNTKSDYCQVCGYDGEIKIVEEEGSGKLIWEC
FT                   PHCGNRDQNKMSVARRTCGYIGTQFWNQGRTQEIKERVLHL"
FT   CDS             complement(658093..658545)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06740"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92752"
FT                   /db_xref="GOA:D4JLR7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLR7"
FT                   /protein_id="CBK92752.1"
FT                   /translation="MKEFTPDKYLGHKINRISRSIDRYFDRKRCSKTECIPRSQGMMIG
FT                   YIMDNQGQNIFQKDIEAKFHLSGATVTNMLKSLEKNGYIVRTPMENDARLKRIELTQKA
FT                   LDHENRVRENIMVIEEAMHEGFSKEEFNMMLGFLDRVIDNMEKLNK"
FT   CDS             658715..660463
FT                   /transl_table=11
FT                   /locus_tag="ERE_06750"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92753"
FT                   /db_xref="GOA:D4JLR8"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLR8"
FT                   /protein_id="CBK92753.1"
FT                   /translation="MLKTLGAQIKEYKWASIATPVFMLLEVAVDTIIPLLMASIIDNGV
FT                   NMGDTRHIYIMGVWMIVAALFGLLTGCLGAKYGAKAAMGFGKNLRAAMFRNIQTFSFAN
FT                   IDRFSSASLVTRMTTDVTNIQNAYMMLLRMAMRAPASIICAMAMSFFISPRLATIYLIA
FT                   VIVLGALLLFISKAAMKYFDRAFKRYDDLNESVQENVSAIRVVKAYVREDYEKKRFSKA
FT                   AQNIYDVFVKAESLVVYNSPLMQFTVYACILLISWLGAHMVVSSTLTTGDLMALLTYCM
FT                   NILMNLMMLSMVFVMISLSLASARRISEVLNEQSTLHNPKEPLYDVPDGSISFKHVTFR
FT                   YSDTAETPVLSDINLDIKSGETIGIIGGTGSSKSSLVNLISRLYDTDTGSVIVGGHDVR
FT                   EYDMDTLRNKVAVVLQQNVLFSGTILENLRWGDKNATTDECIEACKMACADDFIESFPD
FT                   KYNTYIEQGGTNVSGGQKQRLCIARALLKKPRILILDDSTSAVDTATDSKIRAALAKTI
FT                   PGTTKLIIAQRISSVMDADRIIVMNDGKVDGFDTHENLLKNNEIYRDVYDSQTNGGGDF
FT                   DEGGAA"
FT   CDS             660463..662355
FT                   /transl_table=11
FT                   /locus_tag="ERE_06760"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92754"
FT                   /db_xref="GOA:D4JLR9"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLR9"
FT                   /protein_id="CBK92754.1"
FT                   /translation="MPGPRGPRGPKPKIKNPGKLFARLMGFIFKKYLPACIIVVICIFV
FT                   SVLANVQGTMFTKNLIDDYIVPLLKTGNPDYGPLLAAMGRVAVFYGIGVISTFAYSKIM
FT                   IYVSQGTIKNLRVELFSHMQDLPIRYFDSHAHGDIMSIYTNDIDTLRQLISQSLPQILN
FT                   SAITVVSVFVSMVILNIPLTILTIVMVIVTTVVTKKFAGFSSRYFLAQQRDLGKVNGFI
FT                   EEMLNGQKVVKVFTHEQENIEAFDKINDELFESAYNANMYSNMLGPVNAQIGNLSYVLC
FT                   ALAGGVMALSGFGGLTLGKLASFLTFNKSFNMPISQVSQQFNSIIMALAGCDRIFSLLD
FT                   EAPETDEGYVTLVNAKEENGKLTETPEHTGLWAWKHTHQADGSVDYKKLEGDVVFDDVD
FT                   FGYVPEKIVLHDVDLFATPGQKIAFVGTTGAGKTTITNLINRFYDIADGKIRYDGININ
FT                   KIKKADLRHSLGIVLQDTHLFTATVMENIRYGKLDATDDEVYAAARLANADTFIRQLPD
FT                   GYNTVLTGDGANLSQGQRQLLAIARAAIADPPVLILDEATSSIDTRTERIVQDGMDKLM
FT                   HGRTTFVIAHRLSTVRNSDCIMVLEQGRIIERGSHDELISKKGKYYQLYTGKTA"
FT   CDS             complement(662721..664673)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06770"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92755"
FT                   /db_xref="GOA:D4JLS0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLS0"
FT                   /protein_id="CBK92755.1"
FT                   /translation="MNTGFYRVAASSPEIYLGDCVNNADNIIHIAESLAKKDVQLVVFP
FT                   ELCITGYSCADMFLRKELLAQAQQELDRIKTALQDLSILVCVGLPIEDEAGRLFNCAAY
FT                   VHSGEIVGIVPKTYIPNYGEFYEKRWFTSADKRLSDEITLNYVANRPTVPFSPNIIIKD
FT                   LRGAIVGTEICEDLWVSAPPSGELCKAGANIIINPSASNDVIGKREYRRSLVAMQSGRC
FT                   RAGYVYASSGAGESSTDLVFSGHCIIADNGRIAGETSDYSKRMNKKVSEDDVMSSGFVI
FT                   SEIDIDRCMNDRHRYNSDSWADVPDVIKVILNGENRMKDYQIWPKKVNPYPFVPSDKNN
FT                   RKNRCMEILSLQAKGLEQRLISTGIKNVVLGISGGLDSTLALLVCCDAFEALGIPKRNI
FT                   YGITMPGFGTTSTTKTIADRLMEEFGVTAVEVNIEAACRQHMKDIGHPDDVFDVTYENI
FT                   QARERTQVLFDYANMVDGLVIGTGDMSELALGWCTYNGDHMSNYAVNCSVPKTLVKYIV
FT                   QAYASECASTDEMKNVLCEIADLPISPELLPPDKDGNIAQKTEESIGKYDLHDFFLYHF
FT                   LRNGESRDRILKLAEIAFANVSKGEIEKTLETFFTRFRQQQFKRSCIPDGPKVGTVSLS
FT                   PRGDLRMPSDMVELY"
FT   gap             664870..666169
FT                   /estimated_length=1300
FT   CDS             complement(666658..670008)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06800"
FT                   /product="Type I site-specific restriction-modification
FT                   system, R (restriction) subunit and related helicases"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92756"
FT                   /db_xref="GOA:D4JLS1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLS1"
FT                   /protein_id="CBK92756.1"
FT                   /translation="METNFDYLLKKEEYADFAKQAVEAEKSLSISPATCAILSRRALEL
FT                   AVRFVFSYDAELSLPYRDNVSSLIHEPTFRRIIEPRLFPMLKYTIHLGNVAVHTNNNIG
FT                   RDEAIIALRDLFEFCDWIDYSYSREYDEKTYDESILASGNEKRIKADELMKLYESLSSK
FT                   DKKLESVLKENEELREQMAKKRSQNVKTREFHVDKISEAETRKRYIDVALKEAGWVIGR
FT                   NVTEEEPVTGMPNSTGTGYVDYVLWGKDNLPLAVVEAKKASVDAMVGSQQAKLYADCLQ
FT                   NKYNRRPLIFITNGFEFFYTNDYMGYPRREVSGFFTQEELQLEMDGRTSRIPLENIRIS
FT                   DDITNRPYQKEAVTAVCDAITNKHRKMLIVQATGSGKTRVSISIVDVLRRHNYVKNILF
FT                   LADRKALVKQAKNNYTNLLPDLSCCNLLDNKDDPESCRMIFSTYPTMMNAIDERKNKYG
FT                   EKLFSPGHFQLIICDEVHRSIYKKYQEIFEYFDAMLLGMTATPKNEIDKNTYGVFDLER
FT                   GVPTFAYELEKAVEEGYLVNYSTLEYKSKIMESGIHYDELSDEEKEEYEDTFSDDDTVG
FT                   DDISGEAVNTWLFNADTIDKVLRELMEKGLKIEGGDKLGKTIIFAKNSLHAQAIVKRFN
FT                   KLFPEYGGDFIKRIDYSIKYSDSLIDEFSTSDKMPQIAVSVDMLDTGIDIPEILNLVFF
FT                   KKVKSYAKFWQMIGRGTRLCPNLLGEGMDKERFLIFDFCNNFEYFRVNKNGAENGITES
FT                   LNEKIYNTKAQIVRELQAPVYSGDEIYADYRKSLVDDLKEDVISLNDDSFMVKRHLRYV
FT                   EFFRASSSWDNLETIEISDIREHIAPLIRPKKEDELARRFDYLVYSIDLGLLQSKSIQS
FT                   PVNIVVQTAEKLSAKYSIPQVEKKKEIIEKVQTNEFWDKVTIIELDTVREALRGLLQYL
FT                   DRQVRPIYYTNFTDSITDGTPGEPLYGGNDLKNYRKKVEFYLKEHSDKLSVYKLKNNKK
FT                   LTETDLRELERILWTELGSKEDYIKEYGETPIGRLVRKIVGVDRAAVNEAFSCFMSEER
FT                   LNINQMRFVNLIVDYIVANGNIEDNKVLMGEPFKSVGSITTLFKDDMSTAKQIMEIVNQ
FT                   IKRNSEEIA"
FT   CDS             complement(670022..671722)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06810"
FT                   /product="Protein of unknown function (DUF1703)./Predicted
FT                   AAA-ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92757"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLS2"
FT                   /protein_id="CBK92757.1"
FT                   /translation="MTESIKLPVGIESFEEIRSDGYYYVDKTKLIEQLVDSRGKVNLFT
FT                   RPRRFGKTLNMSMLKSFFEIGAASELFDGLYISHNKKLCDDNMGKYPVIFLSLKNVEGL
FT                   DFQAAKYQMIEIIAKEAKRFAYLKQSDRLDIDDKSTYASLIRLEDGRYEMRDEALYASL
FT                   QTLSELLYKHHGRKTVILIDEYDVPLDKAFQNGYYKEMVSLIRAIFGKALKTNEALDFA
FT                   VLTGCLRVSKESIFTGLNNFKILSITDTRFDEHFGFTDAEVERLLAFYHVENRFAETKE
FT                   WYDGYHFGNVDVYCPWDVINHVDRIKDDPMAGPEAYWINTSGNELVKSFIDKAGKTTRD
FT                   EIERLIAGEAIDKQIRLDMTYDEIDNNIDNLWSVLFTTGYLTYTKISEDKKYSLVIPNK
FT                   EIKEVFKLQIQEWFRNKIFSNTEQLQDFWKAFKEGNTQIMEMYLNKVLSNSVSVFDTKA
FT                   RNEEKESSYHNLLIGILSGNEDWLVKSNVEAGEGFADIIVETDDPDEGIIAELKYTKDF
FT                   KAMEKSCEIALKQIKDRRYQEYLLNDNRQNIMYYGIAFCRKRCKVLVER"
FT   CDS             complement(671729..672877)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06820"
FT                   /product="Restriction endonuclease S subunits"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92758"
FT                   /db_xref="GOA:D4JLS3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLS3"
FT                   /protein_id="CBK92758.1"
FT                   /translation="MRVKLKDIFDLQMGKTPSRSNLEYWNTTDYKWISIADLTKTSKYI
FT                   FETKEYLSKSAIKDSGIKVIPANTVVMSFKLSIGKTAITKEDMYSNEAIMAFKDKHVIN
FT                   IIPEYIFYLFKYKNWEECSNKAVMGKTLNKATLSEIEVEICSIEKQRQIVNILDKIMSA
FT                   VDGRKQELQLLDELIKARFVEMFGDLKTNSKMWQIVGFNECAVIDTNMIHNFQGYEDYP
FT                   HIGIDSIEKETGKLIGYRTISEDGVVSGKYLFTPQHIIYSKIRPNLNKVALPDFDGLCS
FT                   ADAYPILVKKEICNREYMGYTLRNKYFLDYILAFSSRTNLPKVNKKQVEGFKLPLPPMG
FT                   LQNQFADFVHQVDKSKFDTMTFAPIYAIINLYLHTYFYQGRR"
FT   CDS             673073..673174
FT                   /transl_table=11
FT                   /locus_tag="ERE_06830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92759"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLS4"
FT                   /protein_id="CBK92759.1"
FT                   /translation="MLTISDLIAVLALCATFYSLGYMHGKHDSKTQK"
FT   CDS             complement(673350..674360)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06840"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92760"
FT                   /db_xref="GOA:D4JLS5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLS5"
FT                   /protein_id="CBK92760.1"
FT                   /translation="MQEKDVGISKGDINMEEKIVKVLNVMSEYLSIAQMKKLQEVILQT
FT                   FAENEAEKAEIANDKFLEMFLDAKTIEGCSERTIKYYRETVQHLLSQTETSVRKITTEE
FT                   IREYLSDYQKLNNCSNVTIDNVRRNISSFFSWLEEEDYILKSPMRRIHKIKTKTVVKSV
FT                   ISDEGIEKLRDNCNEKRDLAIIDLLYSTGIRVGELVNLNIDDIDLEGRECIVYGKGDKE
FT                   RRVYFDAKAKVHLKDYINTRTDKNKALFVTLDAPHDRLKISGVEIRLRKLGRKLSLERI
FT                   HPHKFRRSMATRAIDKGMPIEQVQKILGHSQIDTTMQYAMVNQNNVKTAHQKYLA"
FT   CDS             complement(674441..674830)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06850"
FT                   /product="nucleotidyltransferase substrate binding protein,
FT                   HI0074 family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92761"
FT                   /db_xref="GOA:D4JLS6"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLS6"
FT                   /protein_id="CBK92761.1"
FT                   /translation="MKKFENFKAALVNLNDIFSYKEPYGNVEIAGMVGLYEICFEQSWK
FT                   AMKELLENFGYAEGATGSPRTILKTAYKAGMISDEELWLDALVSRNNVAHAYNQAIAMD
FT                   IIRQTKEKYYDMFIQLEKKIEQDWL"
FT   CDS             complement(675154..676344)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06870"
FT                   /product="Restriction endonuclease S subunits"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92762"
FT                   /db_xref="GOA:D4JLS7"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLS7"
FT                   /protein_id="CBK92762.1"
FT                   /translation="MRKKLKDVCMFYSGTGFPIQYQGQTKGEYPFYKVGDIANNAIAGK
FT                   IYLELCNNYISSDVAKMIKGCILPKDTVVFAKIGEALKLNRRAITSCDCLIDNNAMGIA
FT                   PKLDSLRIQYFYFCMKNLKMQTLAESTTVPSVRKTVLEKYEIEVPSLVEQEEIEKKLTL
FT                   TQKIIEKRRQELSYLDEIIKARFVEMFGDPATNPFNWDKINISEVVGDKVSNGFFAKRD
FT                   DYADDGNVSVMGVAYIVNRMYSQWQDLPRTNGTDKDIEKFEVKYGDMLFCRSSLVAEGI
FT                   GKASIVPEDVPQNTLFECHVIRLPLDLSKCVPEYMQVFSTMEYFRRQIIAQSKTATMTT
FT                   IGQDGILKADILLPPMSKQREFYAFVHQVNKSKVAVQKALDETQILFDSLMQKYFG"
FT   CDS             complement(676378..677838)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06880"
FT                   /product="Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92763"
FT                   /db_xref="GOA:D4JLS8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLS8"
FT                   /protein_id="CBK92763.1"
FT                   /translation="MITGELRNKIDKIWETFWTGGITNPLDVIEQFTYLLFIKQLDEVE
FT                   TTKENEANFLGVDYESMFPGECQKYRWSKFKNLGSAEEMYELVLNGVFPFIKNLHQDGD
FT                   SAYARYMGDAIFKIPTAAMLSKIVDGIDKLELGDEDSKGDLYEYLLSKVATAGTNGQFR
FT                   TPRHIIKMMVELVKPAPDDTIIDPAMGSAGFLIEAQSYLRENHPELFLHQESLQHFNNT
FT                   MFYGNDMDRTMLRIGAMNMLLHGVENPNISYRDSLSEQNTDVEKYSLVLANPPFKGSLD
FT                   YEAVSADLLKVTKTKKTELLFLALFLRILKKGGRAAVIVPDGVLFGSSKAHKQIRKEII
FT                   ENNKLDAVISMPSGVFKPYAGVSTAILIFTKTGSSDTDKVWFYDMKADGLSLDDKRQEI
FT                   ADNDIPDIIERFNHLDAETDRKRTDQSFFVPVDEIVSNNYDLSINKYKEIVYEAVQYEP
FT                   TDVIIGKIDALESEIQGELAELKKLLDV"
FT   CDS             complement(677853..678986)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06890"
FT                   /product="Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92764"
FT                   /db_xref="GOA:D4JLS9"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLS9"
FT                   /protein_id="CBK92764.1"
FT                   /translation="MIGFHGIGNSHMFEDEEMGNYHPEIENGDSNGDNETGIIGALGNK
FT                   LEKTFKNSLSAMKSEHAEKVHSNAAVADEEVSMQGKILANLMGHITNDLAIGKKIKSGE
FT                   LRKRMKEPAWLVPDCFVTEDIDMGGFTMKLLSSKENPNTERVILQLHGGGYMGAVRNAY
FT                   YVFAGLYNEVSEGCSVLTPDYRVAPEHPYPAALEDAIACYKWLLSQGWFGSQIVLAGDS
FT                   AGGGLAMCLTMYLRDHDMPLPAGIVAMSPWTDLTAGGESYETNYEKDPLFGNTRDSLIY
FT                   VNDYPGDHDKMDPYISPLFGDFRGFPPMLIQAGSIEMLLSDSVDAAAKARNQGVKVRLS
FT                   VYEGMFHVFQMGYLNFPESKRAWAEVKRFLKVIKEEE"
FT   CDS             complement(678983..679765)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92765"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLT0"
FT                   /protein_id="CBK92765.1"
FT                   /translation="MTKCMKCGVYIADNTDKCPLCQQVVAPVELSSDNHQGTEGGFEQH
FT                   NDVPDKCVNDTDSAAKRADSTASHDNGTRYPDVKGASRKYRLLENIILFLSIVGQIVLT
FT                   TVDYMTDNEINWSFIVLLVVIYANVTLRLAIVGRNGYIFKIVSTFVFTVLFLEGIDLLT
FT                   GASGWALTFVFPSAILAMVLATIILMIVNIRNWQSYMMMQLFLVLMSVIAMILVAVKII
FT                   WFPYLAMGAMGASLFLFLGTLIIGDKRARTELKRRFHI"
FT   CDS             complement(681079..682326)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06920"
FT                   /product="GTP-binding protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92766"
FT                   /db_xref="GOA:D4JLT1"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLT1"
FT                   /protein_id="CBK92766.1"
FT                   /translation="MADTIKIEDIEERVVLVGVSEQDGDDADDSLSELAELVKTAGATV
FT                   VGTLIQRREKIHPGTYVGTGKVAEIAELVESTGATGIVCDDELSPAQQKNLETYLDTKV
FT                   MDRTLVILDIFASRATTSEGKIQVELAQLKYRLSRLSGLGKSMSRLGGGIGTRGPGEKK
FT                   LEVDRRLINDRIAQLRRELKEVQKHRDITRAKREKNKVPVVAIVGYTNAGKSTLLNHLT
FT                   EADVLEEDKLFATLDPTTRILALDGKQQVLLTDTVGFIRKLPHHLIEAFKSTLEEAKYA
FT                   DIIFHVVDASNMQREKQMFITYQTLDDLGVKDKKFVTLFNKQDARTDNEPLHDFRADYT
FT                   LNISAAKDLGLDEVKSLLEEILRENKVYIERIIPYDKAGVIQLIRKQGELVSEEYVADG
FT                   IQIKAYVPMEVYGRLD"
FT   CDS             complement(682330..683292)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06930"
FT                   /product="Tetratricopeptide repeat."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92767"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLT2"
FT                   /protein_id="CBK92767.1"
FT                   /translation="MIKNKFMALTLTVVLTAGMLTGCGSGDKAKDKDAYRQYGINCIEN
FT                   GSYDDAVDAFQKALDQSVGSVGAEELDICYYKAKAQYLSGDVDGAIDTYTAIIDYNKDS
FT                   DAYYLRGCIYFAKNDSDKGLKDFKTALSENNDNYELYLGVYETLSKYGMNDQGKEYLDN
FT                   ALKLKAKTADDYMQRGRIYTLLGDYDSAIKSLQKAIDEKLVKANYYMGEVYQKKGDNDS
FT                   SQKYFKKYLDSGEADSYELMNMGQAQMDNGNYDTAITYFQNALELESVPNKQQITKAMI
FT                   IAYEYSGDFATAKSKMEEYMKDYPDDEDAAREYQFLETR"
FT   CDS             complement(684168..686423)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06940"
FT                   /product="glycogen/starch/alpha-glucan phosphorylases"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92768"
FT                   /db_xref="GOA:D4JLT3"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLT3"
FT                   /protein_id="CBK92768.1"
FT                   /translation="MAIMQEIETKLQKGISVSTDEEVYYALLELVKDKAEKKVSNKGKK
FT                   KLYYISAEFLIGKLLSNNLINLGIYDEVKETLEKNGKSLAEIEEIELEPSLGNGGLGRL
FT                   AACFIDSIATLGLNGDGVGLNYHYGLFKQVFENNLQKETPNPWITKESWLTKTDITYPV
FT                   SFGGFTVQSRLYDIDVVGYNNRTTKLHLFDIESVDESIVGDTIDFDKDDIKKNLTLFLY
FT                   PDDSDDKGRLLRVYQQYFMVSNAARLILAEAEAKGSNLHDLADYAAVQINDTHPSMVIP
FT                   ELIRLLQEKGILMDEAIEIVSKVCAYTNHTILAEALEKWPISFLEKAVPQLMPIIRELD
FT                   NKVRAKVADESTYIIKDGLVHMAHMDIHFGYSVNGVAYLHTEILKNTELNNFYKLYPEK
FT                   FNNKTNGITFRRWLMSCNPELSAYITELIGDGWKKDANELEKLGNFINDDAVLTKLVDI
FT                   KNAKKAELASYLKKTQNLDVPDNSIFDIQVKRLHEYKRQQLNVLYIIRKYFEIKAGKKP
FT                   STPITCFFGAKAAPAYIIAKDIIHAILCLQQIINNDPEVSPYLKVFMVENYNVTLAEKL
FT                   FPAANISEQISLASKEASGTGNMKFMLNGAITLGTSDGANVEIAELVGDENIYVFGEDS
FT                   QTVIDRYERGDYCSKDYYDKDADLKKAVDFLVSDEMMKVGSKENLERLYNELLNKDWFM
FT                   TFPDFEDYCKTKEKAYADYEDKKAWAKKMLVNISKAGFFSSDRTIKQYNDEIWHLEA"
FT   CDS             686643..687518
FT                   /transl_table=11
FT                   /locus_tag="ERE_06950"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92769"
FT                   /db_xref="GOA:D4JLT4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLT4"
FT                   /protein_id="CBK92769.1"
FT                   /translation="MNILEYENYHEAKTHVELTFPYNTYLCSIPLDFSGVPLHWHDDME
FT                   LIYIKKGCGHISVDFKEYHVTAPSLVLILPGQLHSIDQYMDESMEYENIIFSLSMLLPG
FT                   KYDYTKEDFLTPLLAGRFTVPTVFTPVYPYYEDVVAPIDACDEICKTMPQGYQLYIKSK
FT                   LYEFFFVLDNRCRNLTKPLKSKKTLDKMKVVLKYVENNYADKISIADIADVAGFSESHF
FT                   MRYFKETMGTSFVDYLKDYRLTMAARLLQSSDSSVLSISGEVGFESLSYFNRAFKKHYG
FT                   MTPLQYRKGS"
FT   CDS             687575..688090
FT                   /transl_table=11
FT                   /locus_tag="ERE_06960"
FT                   /product="PAP2 superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92770"
FT                   /db_xref="GOA:D4JLT5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLT5"
FT                   /protein_id="CBK92770.1"
FT                   /translation="MKKNTYIKMTAPFRENNRAARKLELINKICTYLVFITYPVYVLYL
FT                   CFTAGHMLALSIIAPLVGFIAVSVFRYIVNRPRPYEKFDMTPVIPKDTHGRSFPSRHVF
FT                   SAFIIAFTVLICSPSASPLWFTGILLAVLAAIIACVRVISGVHFISDVVGAFVFAVIEA
FT                   YIVTVFFL"
FT   CDS             complement(688098..688436)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92771"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLT6"
FT                   /protein_id="CBK92771.1"
FT                   /translation="MKKMKYLLALCLILAAASAFAACGNNSNVADTSMVENTQRGGSAA
FT                   DDAGNAGKDIIDGAGNAGKDVIDGAGDAGKDVIDGAGDAGKDVIDGAKDAVDDAGNAIK
FT                   KSVDGGNN"
FT   CDS             complement(688619..688918)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92772"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLT7"
FT                   /protein_id="CBK92772.1"
FT                   /translation="MCGGKLLIRKRIFSIVLCVVLLLSMNVTAFAAESQENYIETEKSV
FT                   TFEVTPTALTAGSSRHSVGMLNSFFGTYDTVATSALGSFTMMRKQSCGAMVRHI"
FT   CDS             complement(688947..689702)
FT                   /transl_table=11
FT                   /locus_tag="ERE_06990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_06990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92773"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLT8"
FT                   /protein_id="CBK92773.1"
FT                   /translation="MSMNVNTTATTYGNYQNNYQTSGTDKKNETTKSTKTTETKKSSVE
FT                   SLGEKNLSRAAQKVLKDLRGSRNDMDFYVADFENGDNAKDILSRSDKEFTVIFSKEEME
FT                   KMASNSKYYAEKMHSIQGALRMSEEINAQFGFERAFGKTTEIGNSIDSDMKITKFGISF
FT                   NSDGSTSFFAQLEKTSENQKDYLEKIQEKKAAEKKEAKKKERSTQVNIKRATVEANSKE
FT                   ELLDKIKNIEWDSIKPEDNKIGSRFDFSI"
FT   CDS             690418..690636
FT                   /transl_table=11
FT                   /locus_tag="ERE_07010"
FT                   /product="Phage integrase family."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92774"
FT                   /db_xref="GOA:D4JLT9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLT9"
FT                   /protein_id="CBK92774.1"
FT                   /translation="MIPIQIAYFTGLRLGEVCGLTWQDINLEEQYLTVRRSIRYNGARH
FT                   KTEIGPTKRKKVRIVDFGDTLTEMLPS"
FT   gap             690870..692362
FT                   /estimated_length=1493
FT   CDS             complement(692836..693012)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92775"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLU0"
FT                   /protein_id="CBK92775.1"
FT                   /translation="MAVREIILTAQHSTAQHSTAQHSTAQHSTAQHSDCAFFSTVRIHK
FT                   RKRIKASINMYMD"
FT   CDS             complement(693199..693555)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07060"
FT                   /product="SpoVA protein."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92776"
FT                   /db_xref="InterPro:IPR005562"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLU1"
FT                   /protein_id="CBK92776.1"
FT                   /translation="MDYVKAFVVGGIICAIVQILMEKTKLMPGRIMVMLVCTGALLGAV
FT                   GIYGPFSKWAGAGANVPLLGFGNVLWKGVKEAVDSEGFIGLFKGGFKACAVGVSAALIF
FT                   SYIAALITKPKLKS"
FT   CDS             complement(693674..694756)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07070"
FT                   /product="Stage V sporulation protein AD (SpoVAD)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92777"
FT                   /db_xref="GOA:D4JLU2"
FT                   /db_xref="InterPro:IPR010894"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLU2"
FT                   /protein_id="CBK92777.1"
FT                   /translation="MQQKLGKWSLRFAEAPFILESSSVVGTKEADGPLGGLFDIVGKDD
FT                   RFGQNTWEKAESSMQRDALTMALGKAHLDASDMDYVFAGDLLGQSMATTFGVENFRIPW
FT                   FGVYGACSTCGESLSLAAAFVAAGYARHAVAVTSSHFGSAEKQFRFPNQYANQRPVSAT
FT                   WTVTGSAAFIVGSGAGGNETQTGCDNEWTGGDNADSISKKVQIEGITTGVVVDYGIKDA
FT                   MNMGAAMAPAACELIVNHLSDFGREASYYDRIVTGDLGSVGQKILIDLCRQKGVDISKN
FT                   HEDCGMKMFDATNQNTGSGGSGCACSATVLSAYYLPKLRSGELKRILFVPTGALLSPVS
FT                   FNEGESVPGIAHGVVLEAVM"
FT   CDS             complement(694853..695377)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07080"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /function="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92778"
FT                   /db_xref="GOA:D4JLU3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLU3"
FT                   /protein_id="CBK92778.1"
FT                   /translation="MKTVKDYIRTIPDFPEKGIMFRDVTSVIQDADGLKLAIDEMIKRL
FT                   DGLDFDVIAGAESRGFVFGMPIAYVLHKPFVMVRKAGKLPCETVSKTYDLEYGTATIEM
FT                   HKDSVKPGQKVVLVDDLIATGGTMQAAAELVEELGGEVVKMLFLIELAGLNGRKLLSKY
FT                   DVDAVVSYDGK"
FT   CDS             complement(695495..696214)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07090"
FT                   /product="conserved hypothetical protein TIGR00104"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92779"
FT                   /db_xref="InterPro:IPR001378"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLU4"
FT                   /protein_id="CBK92779.1"
FT                   /translation="MYEKTIEPVAIMHTGFGEKFGIPRQSGLVPEAAGQIVFEPKYQNS
FT                   DALRGIEEFTHLWIIWGFSENRVEKFTPLVTPPRLGGREKRGVFATRSPFRPNGMGLSS
FT                   VRLDKVEYKSSKGPIIHVSGVDMLDGTPIYDIKPYLAYSDSHPEASDGFAAEHRWDTVH
FT                   VIWRDEALKSCMDEDTRITVEHILAQDPRAAYNKARDYIYGMRYGSFDIRFVADSHAGT
FT                   IEIADVVECIDGYHKVK"
FT   CDS             complement(696219..697277)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07100"
FT                   /product="Glycerol dehydrogenase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92780"
FT                   /db_xref="GOA:D4JLU5"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLU5"
FT                   /protein_id="CBK92780.1"
FT                   /translation="MQTGKAISIPSILKVGNGTLNKIGEYLKSEELTSVVIFMGNGLID
FT                   MFGDTIMKSLTDAGITVLEYSELDTVEIDDIITLAFDIPNKAKAVVSVGGGKVIDAGKY
FT                   AAFLRNLPFISVPTSSSSDGFSSASASLLVHGKRTSVPAKLAHGIIVDTQVIRTAPEKF
FT                   IYSGIGDMVSKITALYDWIFEEAHGAGVVNDFAVMVAKKAVNSFVRTPYESIKDELFLK
FT                   ELVDSLAMSGIANEIAGSSAPTSGSEHLISHALDKILEHPQLHGIQVGIATYIMSVVQN
FT                   HRYVRVCTVLKRTGFFDYAATLGMRKQDFLDAIDMAPSMKPFRHTYLHEKEYRDAAKKL
FT                   VLEDDILNKILV"
FT   CDS             complement(697314..698768)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07110"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92781"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLU6"
FT                   /protein_id="CBK92781.1"
FT                   /translation="MKTIIKYELVINEALRSALNYDTPDEQINEFIRFFGKHIGSDRIY
FT                   IFEDCDEKHVTKNTYEWCADGIVPEIHELQNVDMDIIGWWYQTFDKDRNVIITDIEQIK
FT                   DEHKVSYNLLKAQNVKNLVVCPIRYKDEIKGFFGVDNPPESDTLGLTTFLDMIGTLLIS
FT                   LLKLRNSFTKSNKEAMLSSYSSLSSIYISMALVNVQTHRYHIVKTLDEVVHFLGVKPQS
FT                   EGEYRIDEDFPGLINSVMNEFCTKAQRKETLDFVDISTVEDRLRGKNTIVHEFIGKVSG
FT                   WCRERFIPVDYDADGRLWHVLYCVENIDEEKQREDRLMYLAQIDLMTGIRNRGSGENKI
FT                   TEYLVRKQCGLLCLLDCDKFKSINDTYGHAVGDKVIIAIADTLRKSCRDDDVVLRLGGD
FT                   EFAVFIPGMLDKERAEAFFDRLFSNIEHIDIAEMNGKHILLSLGACFYDGMDCITFDQL
FT                   YRRADTAMYDSKKKQGYSATIYDAKQ"
FT   CDS             complement(698899..700143)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07120"
FT                   /product="Uncharacterized conserved protein related to MYG1
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92782"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLU7"
FT                   /protein_id="CBK92782.1"
FT                   /translation="MSRLIEQIKQKDACAFTHGGKFHADDVFSSALLLYINPEISITRG
FT                   NSVPDDFTGIVFDIGRGEFDHHQKDSRIRENGVPYAAFGLLWEAVGADILGKELAVKFD
FT                   ESFVQPLDNNDNTGEKNELATLIGNFNPSWDYEGGSDEAFFQAVSVAGMILENKFERYR
FT                   GNERADKRVEEVLAKHDPASRILVLPEFIPCQKALSETDIAFVIFPSNRGGFCIQPQKR
FT                   EYSMNYKCSFPAEWLGLEGEELVNATGISGAIFCHKGGFIMTVKEQDEAVKACEKALSL
FT                   HKDSSVIVWYGSKGDTAAMACDSQTDELLINVAKARGIKGVHICHVDAMPVPQLDLTEL
FT                   DSETAYAEVLMEKPQWKAYVKEQVKQIVKYRPEAVYVEGNAFETYPVIRALRKKHIPVL
FT                   TMIENKEKKIMVRIP"
FT   CDS             700396..700779
FT                   /transl_table=11
FT                   /locus_tag="ERE_07130"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92783"
FT                   /db_xref="GOA:D4JLU8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLU8"
FT                   /protein_id="CBK92783.1"
FT                   /translation="MIIELDMSSSTPIYVQLRNQIVKGIGKGELKTGEKLPTVRQLASD
FT                   AGVNTMTVNKAYQILKNEGFIRTDRRLGAFVSESIADDTDFTEKLESELELLSAEACLT
FT                   GMSREEFLSMCDKIYSQMKPCTA"
FT   CDS             700795..702195
FT                   /transl_table=11
FT                   /locus_tag="ERE_07140"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92784"
FT                   /db_xref="InterPro:IPR027783"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLU9"
FT                   /protein_id="CBK92784.1"
FT                   /translation="MEIMMFIIFIVTNLIIILCMQFAYTHAYKYENGMYLNVHIPSSHK
FT                   EDAEVTEIVTTGKCKMKHFQIANVIISIAICFIVFINIAVFVLVYIIWMFAYIFGIIHI
FT                   PNSSHRKMYALKIQNGWIIEAQRKKVYIDTRVSAEAGATTVSYKWHALFLITELAAYIP
FT                   YFMLGDTHYNLLMISLFLCSVLISTLSLVFHAFINKSERHVYSMDSKLNLIVNNTMKKY
FT                   KSIAMLLLSGLNAVAWIYVALYTGITGILPASSYYVYIFIQLIAGFGFIVPIYMGLNRK
FT                   KELLSANTSPIDVDDDEYWKTGYYYNPDDKHILIENRMQSGNYTFNYAKKGAWIFTGIT
FT                   GAIIAGCIILVFVCMLPLISIQEKITLTNNNLTISAGGYTSKIDVNDITELKLLDELPD
FT                   DSFLRTNGASTDSYDIGRYEGRTLGKCSLYVFDGYSPILMIKSDDTLVFVNSKEDGEIE
FT                   GLYEELSQ"
FT   CDS             702255..702926
FT                   /transl_table=11
FT                   /locus_tag="ERE_07150"
FT                   /product="O-6-methylguanine DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92785"
FT                   /db_xref="GOA:D4JLV0"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLV0"
FT                   /protein_id="CBK92785.1"
FT                   /translation="MKTRQEALDYGLSFPNAYQEAPFHDPNWQLIRVKDSKKVFLWTYE
FT                   RNGFINLNVKVSPAWRDFWRDAFPSVIPGWHQNKDNWNTIILDGSIPDDAIKNMIADSY
FT                   DLVTYNPTRLIYEAVKRIPKGCVATYAQVAELAGNKKMCRAVGNALHKNPNPDEIPCYR
FT                   VVNAKGELSGAFAFGGADEQANRLRSDGIEVIDGRVNLDKYGIRIVDDVIYTKTTVEPL
FT                   T"
FT   CDS             complement(703329..703658)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07170"
FT                   /product="Nucleotidyltransferase domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92786"
FT                   /db_xref="GOA:D4JLV1"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLV1"
FT                   /protein_id="CBK92786.1"
FT                   /translation="MSDRNRILCEFRNKTKSIMGDSLKQMILYGSYARGDYGDNSDMDI
FT                   MVLTELTDDRIIQIEDEIFDAAYDIELEYGVPISVNIKNEKHFKNWVNSLPYYSNIQKE
FT                   GIIIA"
FT   CDS             complement(703774..704640)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07180"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92787"
FT                   /db_xref="GOA:D4JLV2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLV2"
FT                   /protein_id="CBK92787.1"
FT                   /translation="MPIYFGSNFAREPFQFDSVGNDWEQESVTRPEGYPLYHYLQTKEG
FT                   VGEVTVYSRNQAVSDNILSNSHTIELQKGQGILIAPNVPHSYHNKNISSGNSLPWKTEF
FT                   ATFTGTMAAAFREMFDEKEYRLIDENKGTEVSEAINRAVEDFKERSSDTQMLSLDCYGV
FT                   MLLLSDQSNHTHDNDDQSYVRFIKPVIDAIEESYMDDISARELADGVFVSQQYLSRVFT
FT                   EFMNCSVYEYLTNYRINKAKELLLINSRRKVQDIASDVGYSDASHFIVMFKKLTGMTPA
FT                   QFRKLYI"
FT   CDS             704805..706814
FT                   /transl_table=11
FT                   /locus_tag="ERE_07190"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92788"
FT                   /db_xref="GOA:D4JLV3"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLV3"
FT                   /protein_id="CBK92788.1"
FT                   /translation="MQSKFKRILFGGDYNPNQWPKEVWKQDMAYFKDAHINSATINVFS
FT                   WAKIQPSENEYNFTELDEIVDMLSNENYDIVMATSTAALPAWMVKKYPETMSTDSEGRQ
FT                   HKFGARHNFCPNSLVYQKYAKALATELAKRYSGNKNISVWHINNEYGGYCYCDNCQKQF
FT                   RVWLKDKYKTLDAVNDAWNTEFWGHTFYDWDEIVVPNELSEEAWGGMTSFAGISTDYRR
FT                   FYSDSLLNCYKLERDAVKSIIPDALVTTNLMGTFKGLDYFKWAKEMDIVSWDNYPAYDT
FT                   PWSMVAMTHDLMRGLKDEPFMLMEQTPSQQNWQHYNSLKRPGQMRAQSYQTIAHGADTI
FT                   QFFQLRRSKGGCEKFHGAVIAHVGTNDTRVFKETAQLGRELESFGTRTLGTRNKSDVGI
FT                   IFDWDNYWALEYTSGPTQDLKYVDQIHHYYEYFYNKNISVDMIPVDGDFSKYKVIAAPV
FT                   LYMVKEGMKEKLEQFVKNGGTLITTFMSGIVDQSDNVHLGGYPGPLREMAGVWVEEIDA
FT                   LAPEQSNTVSFSDGKEYKCNLLCDLMHPEGAEVLATYESDFYAGMPAVTKNSYGKGHVY
FT                   YVATQLEAAGLARVLDEATNEVSVSGVIAEKTGLEITCREGENTRFYFVMNFTDENQTL
FT                   PASLAGMVDLITGEVAKESDVMNKWDVKILQEAL"
FT   CDS             complement(706959..708479)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07200"
FT                   /product="Alpha-L-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92789"
FT                   /db_xref="GOA:D4JLV4"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLV4"
FT                   /protein_id="CBK92789.1"
FT                   /translation="MAKIIVNNENKKSTIAPEIYGHFSEHLGRCIYEGLFVGENSDIPN
FT                   VNGMRTDVVDALKEMKIPVLRWPGGCFADEYHWMDGIGPKEKRKKMINTHWGGVVEDNS
FT                   FGTHEFFELCRQLGCKTYVNGNLGSGTVREMSEWVEYITFNGVSPMADLRKENGHEEPW
FT                   TIDYFGVGNENWGCGGNMRPEHYADEYRRYQTYVRNYAGNQPINKICCGPNVDDYEWTK
FT                   KVMATCFDHCDPKLHGLMDGLSLHYYTLPETEDDWNIKGSATDFTEDIFYQTLKRGYFM
FT                   EELINRHGAIMDEYDPDKNIGLIVDEWGIWSDVEPGTNPGFLYQQNTMRDALVAGMTLN
FT                   IFNKHSDRVKMACIAQLINVLQSVMLTDGDKMIKTPTYYVFHMMRHHQGATLLDSSLVG
FT                   GTTVGSGKNELPKVLESVSEDKDGVITVTLTNNSLESSEDVDIILTNEGDKYSVSEARY
FT                   IEGAMDAHNTFEAPEVVDEKDFTAYENTQTGVKVTLPACSVVTLRLSK"
FT   CDS             708859..709794
FT                   /transl_table=11
FT                   /locus_tag="ERE_07210"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /function="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92790"
FT                   /db_xref="GOA:D4JLV5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLV5"
FT                   /protein_id="CBK92790.1"
FT                   /translation="MIHITSLDDGLELFKALGSDIRIQILKILLENNQMSMNQIANELN
FT                   ISNGALTGHIKKLEECGLISASNDSSGHGNQKLCSLIQDRILVEIEKPIDLSNVYNTSI
FT                   KVGQFSSHNICPTCGLATSSFVIGELDDVRYFDHPDHFNADIMWFTKGYVEYVIPNLIP
FT                   RNQKITQLSLSAEISSEAPGIDNDWPSDISFYINDTLVGTWTSPGDYGDVRGMFTPEWW
FT                   PQNWNQYGLLKLLVINHKGTFIDGLKISDITTSELKLDYTSTIRFRIAVEEDSAHVGGL
FT                   TIFGKSFGNYDQDIVVSINYEPLDTEKNTK"
FT   CDS             complement(709852..710094)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92791"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLV6"
FT                   /protein_id="CBK92791.1"
FT                   /translation="MELICKKCLLREMAEADAAMIKKYVDAIKGEDRVPEKEYEARLAV
FT                   CKACDRLNAGTCNACGCYVELRALTGVSHCPHKKW"
FT   gap             710257..711756
FT                   /estimated_length=1500
FT   CDS             complement(711860..712798)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07230"
FT                   /product="Transketolase, C-terminal subunit"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92792"
FT                   /db_xref="GOA:D4JLV7"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLV7"
FT                   /protein_id="CBK92792.1"
FT                   /translation="MSEVKKIATRVSYGNALVELAKEHDDVYVLDADLAAATQTAIFKK
FT                   EFPDRHIDCGIAECNMMGIAAGLAATGKVPFASSFAMFAAGRAFEQVRNSIGYPHLNVK
FT                   IGATHAGISVGEDGATHQCNEDIALMRAIPGMVVINPSDDIEARAAVKAAYEHEGPVYM
FT                   RFGRLATPIINDNAEYKFEIGKGVTLREGTDVAIIATGLCVAESLAAAEKLAADGVNAK
FT                   VINIHTIKPLDEELVVAAAKECGRVVTVEEHSVIGGLGAAVCETLSRKAPTPVKTIGIQ
FT                   DCFGESGPAVALLKKYGLDAEGIYASVKDFL"
FT   CDS             complement(712786..713625)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07240"
FT                   /product="Transketolase, N-terminal subunit"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92793"
FT                   /db_xref="GOA:D4JLV8"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLV8"
FT                   /protein_id="CBK92793.1"
FT                   /translation="MNKLELQITANEVRKGIVTAVHSAKAGHPGGSLSAADIFTYLYFE
FT                   EMNIDPKNPKKPDRDRFVLSKGHTAPGLYSTLAQRGYFPVEDLKTLRHLGSYLQGHPDM
FT                   KHIPGVDMSSGSLGQGISAAVGMALSAKLTNDDYRVYTLLGDGEIQEGQVWEAAMFAGF
FT                   RRLDNLVVIVDNNGLQIDGPVDQVCSPYPIGEKFKAFNFHVIDLKDGNDMDQIADAFKE
FT                   ARNTKGMPTAIIAHTVKGKGVSFMENQVGWHGKAPNDEEYAVAMEDLRKEGEALCQK"
FT   CDS             complement(713691..714344)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07250"
FT                   /product="transaldolase, putative, TalC family"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92794"
FT                   /db_xref="GOA:D4JLV9"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLV9"
FT                   /protein_id="CBK92794.1"
FT                   /translation="MKFFVDTANVEDIKKANDMGVICGVTTNPSLIAKEGRDFNEVIKE
FT                   ITSIVDGPISGEVKATTVDAEGMIKEGREIAAIHPNMVVKIPMTVEGLKAVKVLSSEGI
FT                   KTNVTLIFSANQAILAANAGATYVSPFLGRLDDISQPGIELIRQISEIFDIYGYDTEII
FT                   AASIRNPIHVTDCALAGADIATIPYKVIEQMTKHPLTDQGIEKFQADYRAVFGD"
FT   CDS             714608..715396
FT                   /transl_table=11
FT                   /locus_tag="ERE_07260"
FT                   /product="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92795"
FT                   /db_xref="GOA:D4JLW0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLW0"
FT                   /protein_id="CBK92795.1"
FT                   /translation="MLQLERQQKILDYLKENRKATTNELSELLGVSTTTIRTDLNQMDK
FT                   EKLLTKTHGGAIYKDKTHDMTDLTSRAYLFHDRALENKEAKEEIANEAIKLVSDHMCIF
FT                   LDASSTAYTLGMKLSGFTELTVITNGINLALELKDIPGVTVILTGGIVTSASASIEGLL
FT                   GADLLKKIHTDIAFVSARGFSVEDGLTDFSIYEADLKHMCIKASAKTVALVDHTKFDTT
FT                   SISSYASLDDINMVITDSGISPETADIYEKAGTDIVISGI"
FT   CDS             complement(715499..716953)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07270"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92796"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLW1"
FT                   /protein_id="CBK92796.1"
FT                   /translation="MGILQKADRCMDEAAALFGENKLFLAENKAQETAGLYKSCGAYEQ
FT                   MAKTVNFMGVIYASIGDLSMSIDCYLEAMDVAVEQGSTEIIMLVNNNIGSLYMELRLYE
FT                   KAIRYFNEALELCKPPLHGERDSYYQELLMLHLNLCISYTGINEFEKAEKHLSDAILFN
FT                   EIAGSDKNRFLIDMSQAHMLWKMGNEDEVRDHVEELVEGAINNINSANYVLEILSLCNL
FT                   FMNMGEFDAWKKVIVEYERFAIETENLFFQKTCVKMWMKYESAMGDTEAYNKLCVYYAN
FT                   LHSMQVKEQIKRLGDTIDLKLQLQETEYERRKAVRLNYTDMLTGMGNKFKMRNDFEKLV
FT                   SKNQDSDGAGITFGVVDIDFFKSFNRNSGRVTGDAVLKELSSIINESIKDKGMGYHFYG
FT                   DEFYIILQETDEDIIKNIAEHIRLELAKKQILHESSKVDEYLTVSQAYVTAPDVKVPDE
FT                   FSRLFKTVDEVLNDVKEKGRNAYKIV"
FT   CDS             complement(716983..717495)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07280"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide mutase"
FT                   /function="5-(carboxyamino)imidazole ribonucleotide mutase"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92797"
FT                   /db_xref="GOA:D4JLW2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLW2"
FT                   /protein_id="CBK92797.1"
FT                   /translation="MAKVGIVMGSDSDLKVMSKAADMLEELGIEYELTIISAHREPDEL
FT                   IEWTRGAENRDVKVIIAGAGMAAALPGMCAALFALPVIGVPLSGKNLDGMDAVFSIMQM
FT                   PPGVPVATVAIDGAKNAAILAAKILAAGDDAILEKIKKYTADMKAQVVAKDAKLKQVGY
FT                   KQYLAEK"
FT   CDS             complement(717521..719524)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07290"
FT                   /product="Leucyl aminopeptidase (aminopeptidase T)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92798"
FT                   /db_xref="GOA:D4JLW3"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLW3"
FT                   /protein_id="CBK92798.1"
FT                   /translation="MSYKEIYELSNELYAERLELVEERIEQIIREPAIEPAFADYFRSV
FT                   AKCINTIKNHSADKEFNDLFYSQFDKENYEKSYANPAYAVKVLGDEYGQLLSAVYAKIA
FT                   GSITHIYQGDIKYLCIYAELIVELYNYFENANELSPDEIRGCIYSFMHDYEEIFAEDDN
FT                   RALLDPAYDYYTELVNEADLSNDDYLYSYGLYVGENERAGRAHLASFSDEEIQAMADTY
FT                   TEGYRIGFITCNKDISKKSVVQVLYPLGFERMIRAALKNFEKMGMKPAMRPFSTSVNKQ
FT                   FDYDHKEDMALWLDKAYVEYRLECMHNALERMKNVACKCGGPAVIEIFGEEPFAPVSKK
FT                   EAAHFNDEKQKLVVHMTSVRSQYMNSYIHSEDRSFTIIAYPCAAIGPDYKEIFTETVKI
FT                   NTLDYALYRDMQQKIIDVLDTADRVHIVGTNGNRTDLYVKIHELKEPSKETAFENCVAD
FT                   VNIPVGEVFTSPVLEGTNGKLHVSQVYLNELNFLNLEIDFKDGMIDKYTCTNFEDEEEN
FT                   KKYISDNVLFHHDTLPMGEFAIGTNTTAYRMARVYDIAAKMPILIAEKTGPHFAVGDTC
FT                   YTYDEDNMTYNPDGKAIIARDNSVSIRRKEDISKAYFNCHTDITIPYDELGAITVIRHD
FT                   GSTCDIIRDGRFVLEGVEELNKPLDTLDAESK"
FT   CDS             complement(719939..720619)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07310"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92799"
FT                   /db_xref="GOA:D4JLW4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLW4"
FT                   /protein_id="CBK92799.1"
FT                   /translation="MEQYKQEFIDFMVESDVLKFGDFTLKSGRKSPFFMNAGAYVTGSQ
FT                   LKRLGEYYAKAIHANYGDDFDVLFGPAYKGIPLAVVTAIAYHELYGKEVRYCSDRKEAK
FT                   DHGADKGGFLGSKLKDGDRVVMIEDVTTSGKSMEETVPKVRGAADVTIVGLMVSLNRME
FT                   VGQGGKVSALDEIHEKYGFEGKAIVTMAEVTEYLYNREHDGRVVIDDTIKAAIDEYYKQ
FT                   YGCK"
FT   CDS             complement(720703..721842)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07320"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92800"
FT                   /db_xref="GOA:D4JLW5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLW5"
FT                   /protein_id="CBK92800.1"
FT                   /translation="MGKSLNGKELGKGLSQRKDGLYQGRFVNRFGKKQTVYAKTLNEVR
FT                   QKLRNEQYEDEKALNVVAKDVTLDEWYEIWMDTCKKNCRDSTKETYAGHYRRIQKALGW
FT                   RKLTSLNLLIMQQAINELETDNERKNSKKILVDMLEKAIDSDLLIKNSAKQINTVISKE
FT                   VKKERRVLTVGETELFFSYAKDTFYYNLYVVAIDTGMRIGELMGLQWSDVDFEKKVVHV
FT                   RRSLCYFRKDGKYVFEWHDTKTHNSKRTIPLTTRAMEALKKQRVRGQEILLKNAQTAQD
FT                   EYKNLVFVTRNNRPTQQFIVQECMDVTTRRIQKEHPEFERFSPHCFRHTFATRAIENGM
FT                   QPKSVQKLLGHGSLQLTMDLYCHVTDDTLFDEMRKMEAV"
FT   CDS             complement(721972..722163)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07330"
FT                   /product="Excisionase from transposon Tn916."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92801"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLW6"
FT                   /protein_id="CBK92801.1"
FT                   /translation="MKTELDTRALLNVKEMCEYLGIGQTKARELLSNPANGFTVRIGNR
FT                   LYAHKGRLDHWLLNQILS"
FT   CDS             722709..725117
FT                   /transl_table=11
FT                   /locus_tag="ERE_07340"
FT                   /product="Archaeal ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92802"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLW7"
FT                   /protein_id="CBK92802.1"
FT                   /translation="MRNRLTFANVIGVLLENKKKTYPQHQLVRSLFSAYLDDTLTASEL
FT                   IADDTTMYSRWCNGARPIPIDILKTYEDEDEWDTMEDDFRDKIIPNLLNEAQARIQMEE
FT                   LITDSIKTIGQEMADALIQEPDNAAFFCSVVRYAILNDHSTGALYSPDLSEVILCNKLP
FT                   SCNQAFIGRKDEIKAIASHLSNQSVLFITGMAGIGKSEVAKAYAQTNRKKYTNIIYLYY
FT                   TGDLRKDIANLTFADDSVEMNEEVRFQNHYKVMQRLHTDTLLILDNFNVLPKDEPFLKE
FT                   LMKNDMQLLITSRCKLKNYDSIEIKELDKEKELTELFYKHCPSAKRDPDSVSAIIEEVN
FT                   CHTLTVCMAALTLEASGMEPEELLQELRSCGIGQNMEEIEVFKDDEFSYASMIGHLRML
FT                   MKLNRLNEDSIDILRNLSLLPVSGVYKSAFKMWLELDSLKNVNELIRYGIISEDTENKT
FT                   IALHPLIQEVAIAETIPTVSDCHVMLNHLHLICLAHGLDVKRPVTVMECLKSINRHIIL
FT                   DNRAYYLLFLQDMYPYFDKYLDTDYLSELVERIEYVMNLMNDSGKSDETSKSYNSDKSG
FT                   TPDITQETNHISACDKALLLDYKAQLLFPRKEYDNAIKKYKKAIALMENYHKTNTADAR
FT                   SANLLSNLHNNLSTAYLFRKKLEEAVSELKTAFTVRREYASLGLIENNDTLQQTLSLAN
FT                   MLVQNKEYDSALEIIDFCESTIDEVMGRNNLDYGMCEFYRGVIAYTRSQPVIAEQHLLN
FT                   ADAVFHAVMNENPDNDYSKSTARYLYSLYMRWGKKELAEQYKKILISTH"
FT   CDS             complement(725667..725780)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92803"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLW8"
FT                   /protein_id="CBK92803.1"
FT                   /translation="MKVGKYQIGRFHAIIRKEYADGSVDYWQGYKTLLNEE"
FT   CDS             complement(725873..726040)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92804"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLW9"
FT                   /protein_id="CBK92804.1"
FT                   /translation="MAGKAKFDQEAAFKSIIGAGASEGSEKPVAKGRPKAEWETKKPIK
FT                   KRVSIGTRVA"
FT   CDS             complement(726018..726593)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07380"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92805"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLX0"
FT                   /protein_id="CBK92805.1"
FT                   /translation="MDFCMKGGYDILPNIMLVGAEQELSQTGKEHRLKEAIAPVAEKYD
FT                   YIIIDTPPSLGVLTVNAFTVAGDILIPTTAGIFATTGINQLNETVRSVQRYCNPNVKIT
FT                   GILFTRFNPRANISKQIKELTEQLSEYISAPIYKTYIRSAVAVEEAQANRTDIFEYAEK
FT                   STVSEDYKAFIEEFLKGEVESNGRKGKI"
FT   CDS             complement(726675..728246)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07390"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92806"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLX1"
FT                   /protein_id="CBK92806.1"
FT                   /translation="MAVYGNVNVKYAPCKSVAQLHSAADYILGKKKEQLSSSVIKTKSE
FT                   LYNAFGCNRDNFANSVLMTKKMHQKKYSRFFPRDILAQKLSISFHPEDNDKLTYAEAYK
FT                   MAEDFAREFFWKKGFEVLFAVHVDTEHVHVHFLVNNCNQKDGSSFRRGPKELVEMSEYF
FT                   GEQCRSRGLTHSVRDSFYNPDKTREERTLAENHMQKRGKLSFKDEMRVYIRLAMNDPTT
FT                   QNIHDVVNMLERTYHMNVRLKGNTISYALPYRSSNGGKVKAVRGSKLGKRFTVAGIREY
FT                   MKQKEKEDWFDYPRQEQDIEHSSQSMKDYPRWEEDEEEVKESASKAKKQIPTQESQPTR
FT                   KPDVSVYEAYDEFQEKHEIPENDESFFYGAAFDDFNKEWQGLDAGAGSVSTEFGTTNNS
FT                   TDAEPYNEDELDELLDNNSSTVPVQNKPFPSPAEYRKLSLEKRAKLLPPPSDDRIEELK
FT                   KYQDRMGYTEESMRSMRYKMSVYDDFTEEYDYRVKYNRNHSSEEQLKAQAEQQIITPVR
FT                   RRGRGR"
FT   CDS             complement(728796..728972)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92807"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLX2"
FT                   /protein_id="CBK92807.1"
FT                   /translation="MMCPADEASLTQRLRRNTKTDADDSGSYGQYSYNRYSLDNICNQM
FT                   ATKQSNSRTTTGA"
FT   CDS             complement(729185..729361)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92808"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLX3"
FT                   /protein_id="CBK92808.1"
FT                   /translation="MIINSIIQVNIGYIPGYNCSKDRKTHHPLCRWCVFLSGGLGGVAH
FT                   EQVAPMAQTMRRK"
FT   CDS             complement(729493..730446)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07430"
FT                   /product="ORF6N domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92809"
FT                   /db_xref="GOA:D4JLX4"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR018873"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLX4"
FT                   /protein_id="CBK92809.1"
FT                   /translation="MAKDNSELIDVNSDVKDRVMEVSHIQSLIYVIRGKQVMLDSDLAI
FT                   LYQVETKTFNQAVKRNIERFPENFRFQLKKEEYDSLRSQFVTSKEGRGGRRYLPYVFTE
FT                   QGIAMLSAVLRSDIAIQVSIRIMETFVEMRKYMANTSLLYDRMNAIEERQITYQNETNE
FT                   KFDKVFAYISDHEESQQKIFFDGQIYDAFSLLIDLVASATKSLVLVDNYVDVGTLNILS
FT                   KKKENVSVTIYTVRKTRLSEKDIETFNQQYPKLEVNYTGVFHDRFLIIDDKKAYHIGAS
FT                   LKDAGKKCFAISLLNDSGVIYDILQRLDIETEENES"
FT   CDS             complement(730422..730547)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92810"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLX5"
FT                   /protein_id="CBK92810.1"
FT                   /translation="MILFEVTVCDLRMSTQIVDLKSQFATSKMDWRIRWQKIIVN"
FT   CDS             complement(730765..731262)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92811"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLX6"
FT                   /protein_id="CBK92811.1"
FT                   /translation="MTKHYRNHNIRFNMTDEGGVQAWERLHSAEVEQDFKSQNAFVVAA
FT                   INDYYERHLAKKNDPYLESREKEDAFADRLVQTVEQKLLSNLPALAAMYQMQQQAFFQA
FT                   GLQAGGIMPYPYQQGNPGAEASVGVKLVTEPIQGSEQPIEVVKQELSEPEENEFLDYSF
FT                   GV"
FT   CDS             complement(731273..732289)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92812"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLX7"
FT                   /protein_id="CBK92812.1"
FT                   /translation="MDFFILVTGTDAGEREDYMTEKIREYSMNGALIIGVDNGYGNMKT
FT                   ARRCFKTAIAKYDSAPVLSRDYIEYDGGYYVIGEGRKGFVADKQTDDDNYMLTLAAIVK
FT                   ELEARGMTDSVNRARIHLAVGLPLKWVQAQREDFKRYMLRNSSVEVGYKDRLYCIEFAG
FT                   CTVMPQCYSAVTENLKDFAGVTLLADIGNGTMNLMYLNNGRPMESKAWTEKLGVFQCFQ
FT                   KIHNMVQDKTGDNLMDDVIDNILRSGKIELPDPHASLVEKAICDYVEEIFQKLRDHEYN
FT                   EKLMKVYFMGGGARLVENFGEYNPENTVFNNDIRANAKGYEYYCYMLLRHQERAGRR"
FT   CDS             complement(732823..734463)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07470"
FT                   /product="sulfate adenylyltransferase subunit 1"
FT                   /function="sulfate adenylyltransferase subunit 1"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92813"
FT                   /db_xref="GOA:D4JLX8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLX8"
FT                   /protein_id="CBK92813.1"
FT                   /translation="MSGLLKFITCGSVDDGKSTLIGHILYDSKLLYADQEKALELDSKV
FT                   GSRGGAIDYSLLLDGLMAEREQGITIDVAYRYFTTDKRSFIVADTPGHEEYTRNMAVGA
FT                   SFADLAVILIDAKQGVLVQTRRHARICALMGINYFVFAVNKMDLVGYDEKRFDEITKQI
FT                   IELTKELELKNVVIIPVSATEGDNVTTKSENIPWYKGPALLSYLEDVDIKDENEEEGFY
FT                   MPVQRVCRPDHTFRGFQGQIEAGEVKVGDEITTLPSNETAHVKSIHVGDKLSDSAFTGQ
FT                   PVTIQLDREVDVSRGCVLTIGSGAKVASSITATILWMDDDELFKGKNFFFKLGTKSIPG
FT                   IVTEIEHTIDVNTGEEKPADKLKKNEIAVVKIAFSDKIVCDKFKNHKTLGEFILIDRVT
FT                   DMTSACGVVEEVHTEESGLYEGRVDRNVRAAIKGQKAITAVFVDGVDGVNRGFVEDVEK
FT                   ALNIDGRHTYLYAPKEGEDFVNVVKHLSHAGILVLLLISQKQEKELAADKVEFTKDWNK
FT                   NGRDVDKAAEFIKKQSVYDGVIVNTSEYI"
FT   CDS             complement(734465..735364)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07480"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /function="sulfate adenylyltransferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92814"
FT                   /db_xref="GOA:D4JLX9"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLX9"
FT                   /protein_id="CBK92814.1"
FT                   /translation="MGELSHLDELEAEAIYIIREVAAECEKPVMLYSIGKDSSVMLHLA
FT                   MKAFYPEKPPFPFLHVNTTWKFHEMIEFRDRIAKEKGIEMLEYINQDGVKQGINPFDHG
FT                   SAYTDIMKTQALKQALDKYGFTAAFGGGRRDEEKSRAKERIFSFRNENHAWDPKNQRPE
FT                   MWKLYNSRIKKGQEVRVFPLSNWTEKDIWQYIKRENIEIPSLYFAKERPVVYRDGNIIM
FT                   VDDNRMKLRPGEKIQMKSVRFRTLGCYPLTGGVESTADTLDEIIDETLSAVSSERTTRV
FT                   IDNEAAGSMERRKREGYF"
FT   CDS             complement(735385..735699)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92815"
FT                   /db_xref="GOA:D4JLY0"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLY0"
FT                   /protein_id="CBK92815.1"
FT                   /translation="MSIMIDKAKCKGCGMCTSVCPGSLIYQDSEKKAFIKYPKDCWGCA
FT                   SCIKECHFGAIALYLGADIGGMGSLMTVKSTPDTLTWDIKKRDGSKEEILINKKESNKY
FT                   "
FT   CDS             complement(735683..737389)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07500"
FT                   /product="Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /EC_number="1.8.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92816"
FT                   /db_xref="GOA:D4JLY1"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLY1"
FT                   /protein_id="CBK92816.1"
FT                   /translation="MKIENKKILHTDILIIGGGTAGCYAALTIREKSDYSIIIAEKANI
FT                   KRSGCLAAGVNAINAYIVKGRKPEDYVDYAKKDADGIVREDLLMTMSEGLNRVTDKMEK
FT                   LGLVILKDENGEYVARGNRNIKINGENMKPLLAEAVSKLTDCTVINRINITDYIVENNT
FT                   IKGAYGFLIEDATAYEIRAKKVLCATGGAAGLYRPNNPGFSRHKMWYPPFNTGAGYAMG
FT                   IRSGAEMTTFEMRFIALRCKDTIAPTGTIAQGVGAKQVNSLGEVYETKYGLTTSERVYG
FT                   TVMENLEGRGPCYLRTEGISPQQDESLRKAYLNMAPSQTLKWVEAGKNPSEQNVEIEGT
FT                   EPYIVGGHTASGYWVNTERETTIHGLYAAGDVAGGCPQKYVTGAMVEGEIAAIDMVSKL
FT                   DADTSDGSLGTSAFDEKKALDAKASEYDHFLTERSQMFTTEAIEEAMQKVMDNYAGGIS
FT                   THYQFNGKQLALAKEKINHLIELTGDLYASDMHELMFIYELKERLTVCLSVIAHLGARK
FT                   ETRWHSFAENLDYPDKSDDWMKYVNSKYENGQLHMIYRELVGREARYEHND"
FT   CDS             complement(737442..738503)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07510"
FT                   /product="sulfate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92817"
FT                   /db_xref="GOA:D4JLY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLY2"
FT                   /protein_id="CBK92817.1"
FT                   /translation="MYVEMKNIYKKYGDFLASDNVSFGVEKGKLVALLGPSGSGKTTLL
FT                   RMIAGLETPNSGDIYIDGKRVNDIPASKRGIGFVFQNYALFRYMTIYDNVAFGLELQKM
FT                   PKKLIKERVTKLLEMTGLSGLEKRYPNQLSGGQRQRVAFARALAPNPQVLLLDEPFAAI
FT                   DAKVRGELRTWLKELVEKLGITSIFVTHDQDEAVEVADEIIITNHGTIEQMGTPLEIYK
FT                   SPDTPFVAQFIGHTTVVENYDRLKGFDRIENADKAVIRPEFIKISKSGNLDRYQSAAEE
FT                   GIVTDVVFRGNRMDITVSINGIEVVAERSLEKDLIAVGEKVHVLIYRLYIFDEEKTYLM
FT                   ENSEMQEQDVFYI"
FT   CDS             complement(738576..739430)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07520"
FT                   /product="sulfate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92818"
FT                   /db_xref="GOA:D4JLY3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLY3"
FT                   /protein_id="CBK92818.1"
FT                   /translation="MTEQVKLERRKKITKIILVTVTVLFIFVMLVVPLFSVMASALKEG
FT                   LGFYLKAISTSYVISALKVTLIATVFAVVINTFFGIWTAWLLTRFSFKGKQVLATLIDI
FT                   PFSISPVIVGLAYLMTFGRLGWFYPVIRWFNEIFGTNVRITFAILGVVLATIFVTFPYV
FT                   SREIIPVLNAEGKDEEEAAALMGASGFTIFRKITLPQMKWSLIYGIILCTARALGEFGA
FT                   VNALSKTRGETFTLPLEIDALYMSGTDSSITSAFAVSSILLIIALIILFARNIVEHKFK
FT                   KLH"
FT   CDS             complement(739486..740364)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07530"
FT                   /product="sulfate ABC transporter, permease protein CysT"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92819"
FT                   /db_xref="GOA:D4JLY4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLY4"
FT                   /protein_id="CBK92819.1"
FT                   /translation="MKYTATDKTAKEKTKSKNIKTRVIPGYHLSLGIVVTMLSVIVLIP
FT                   LASVLVYSLKISPGDFVALIMKENVRNAFITSITSSFIAAIVNVVFGLIVAWTLVKYDF
FT                   PGKWLLDGLIELPFALPTAVAGITLSKLYSGTGFFGKGLGKLGIDVAYTQAGIVVALVF
FT                   VGIPFVIRAVQPVLEKMDNTYEEAAYMLGATPSKTFFKVILPELRPALLTGFGLAFARG
FT                   IGEYGSVIYISGNSARHRTQVVSYVIMQKLSYIDYASATAIALVMLVISFLLLLFVNIV
FT                   QVKQSQRTNLL"
FT   CDS             complement(740345..741364)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07540"
FT                   /product="sulfate/thiosulfate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92820"
FT                   /db_xref="GOA:D4JLY5"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLY5"
FT                   /protein_id="CBK92820.1"
FT                   /translation="MRNIHKYTAALLSTAMILSLLLTGCSGRKDDGTVTITNVSYDPTR
FT                   EFYEKYNKIFESYYESEHGKKINVIQSHGGSGAQARSVVEGCNADVVTLALEHDIDLIQ
FT                   NTGLIDKGWIDEFSDSSAPYTSTIVLLVRKGNPKHISDWDDLVKKNVDVITPDPKSSGG
FT                   ACWNFLAALSYAKTNYDSLKEQKSFMKMLYENVTIMDSGARGSTTTFVENGQGDVLIAW
FT                   ENEALTTMDSYPGKYEIVNPSVSILAQPSVAIVDDNAKSNGTQEVSKEYLQYLYSDEAQ
FT                   QLIGESGYRPTNQDILNRFSDKFDLNIRLWSIEDYGGWNEAYKTYFDDGAMFDEIYGN"
FT   CDS             complement(741432..742367)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07550"
FT                   /product="cysteine synthase"
FT                   /function="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92821"
FT                   /db_xref="GOA:D4JLY6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLY6"
FT                   /protein_id="CBK92821.1"
FT                   /translation="MAKIAKQLTELIGHTPLLELTNYEKALGLEAKIIAKLEYFNPLGS
FT                   VKDRVAAAMIEQGIKDGKINQDTIIIEPTSGNTGIGLAFVAASKGLHLILIMPDTMSVE
FT                   RRKIVTALGAEIKLTPGREGMKGAIDEAQRLKEHYGNAFIPQQFENQANPDIHRATTAQ
FT                   EIWEDTDGKVDIFVSSVGTGGTCTGTGLGLRDHNHDVRIVAVEPKSSPVLSGGRPGPHK
FT                   IQGIGAGFIPKVMRMDIVDEVIPVENEAAFDKAREVAKSDGLLVGISSGAAIYAATELA
FT                   KRPENKGKNIVVLLPDTGERYLSTPLFTVN"
FT   CDS             complement(742674..744251)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07560"
FT                   /product="transporter, NhaC family (TC 2.A.35)"
FT                   /function="transporter, NhaC family (TC 2.A.35)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92822"
FT                   /db_xref="GOA:D4JLY7"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLY7"
FT                   /protein_id="CBK92822.1"
FT                   /translation="MILAAEYVPSMYATVWALVPPVVAIVLALITKEVYSSLFVGIVIG
FT                   GLFYGNAFQPGFSAERSVLHIFEDGLVGVLSDSYNVGILIFLVVLGVMVSMMNKAGGSA
FT                   AFGEWASEHIKTRIGAQLSAIILGVLIFIDDYFNCLTVGSVMRPVTDKHQVSRAKLAYL
FT                   IDATAAPVCIIAPISSWAAAVTGFVKDEDGFSIFIKAIPYNYYALFTIIAMVTLVVLQV
FT                   DFGPMAKHEANAQKGDLFTTGDRPYAEAKQDVIKGKGKVIDLVFPILVLIISCIIGMIY
FT                   TGGFFDGTGFVDAFAGSDASIGLMLGSFFALIITICFYSIRRVLSFTDCCNSIPEGFKA
FT                   MVPAILILTFAWTLKTMTESLGAKEFVAGLVGGVSGPLLGLFPAIIFLVGAFLAFATGT
FT                   SWGTFGILIPIVVNIFSGTNHTMMIISISACMAGAVCGDHCSPISDTTIMASAGAQCNH
FT                   MNHVSTQLPYAVLVAGISCLTYIIAGFVRNPVVPFIIGVLILIGTFVGIKYIIKYITRT
FT                   DKANEQAE"
FT   CDS             complement(744281..745189)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07570"
FT                   /product="dihydroorotate dehydrogenase (subfamily 1) family
FT                   protein"
FT                   /EC_number="1.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92823"
FT                   /db_xref="GOA:D4JLY8"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLY8"
FT                   /protein_id="CBK92823.1"
FT                   /translation="MSNMSVNVAGVEWKNPVTVASGTFGSGAEYSEFVDLNRLGAVTTK
FT                   GVANKPWEGNPTPRVAEVYGGMLNAVGLQNPGIELFCKRDIPFLKQFDTRIVVNVCGHS
FT                   LDEYLDVVKRLADEPIDMMEINISCPNVKEGGIAFGTDPKGVETITSEIKKYAKQPVIM
FT                   KLSPNVTSIADIARAAEAGGADAVSLINTITGMKIDINRRSFVLANKTGGMSGPAVHPV
FT                   AVRMVYETAHAVNIPIIGMGGITNAADAIEMILAGATAVSVGTANFVNPKTTEQIVDGI
FT                   AEYMDRYGVKDISELVGAVDR"
FT   CDS             complement(745189..746025)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07580"
FT                   /product="2-polyprenylphenol hydroxylase and related
FT                   flavodoxin oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92824"
FT                   /db_xref="GOA:D4JLY9"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR023455"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLY9"
FT                   /protein_id="CBK92824.1"
FT                   /translation="MAEKFEEIAVVVDQSSLGNGIYDLTLKTDKIAKAAKAGQFVSVYS
FT                   NDKSKLLPRPISLCGINRDDDTIRLVYRVTGEGTGTEEFSKLVRGDKVRLLGPLGNGFT
FT                   VQPGKKAFLIGGGIGVPPMLQLAKDINAGIVQTSGEEKNPAQAGAVCDMNIVMGYRDEN
FT                   TFLLDEFKEQAASFVATEDGSVGTKGNVIDAIKENALEADVIYACGPMPMLRALKAYAA
FT                   EHDMDCFISMEERMACGIGACLACVCKTKDKDAHSNVNNKRICKEGPVFDAKEVEL"
FT   CDS             complement(746078..747010)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07590"
FT                   /product="orotidine 5'-phosphate decarboxylase, subfamily
FT                   2"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92825"
FT                   /db_xref="GOA:D4JLZ0"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLZ0"
FT                   /protein_id="CBK92825.1"
FT                   /translation="MINKLVDKIKKTNAPIVVGLDPMLSYVPEHITKKAFDELGETPAG
FT                   AAEAIWQYNKAIVDATYDLIPAVKPQIAMYEQFGVEGLKAFQKTVDYCHEKDLVVIGDV
FT                   KRGDIGSTSAAYATGHLGKVQIGSKSYSTFDEDFATVNPYLGTDGIKPFVDVCKEEKKG
FT                   IFILVKTSNPSSGEFQDRMIDGRPLYEWVGEKVAEWGADCMGDSYSYVGAVVGATYPEQ
FT                   GKILRKVMPKSFILVPGYGAQGGKGADLVHFFNEDGLGAIVNSSRGIICAYKQDKYKDM
FT                   GITAENFADASRKAVEDMIEDISGALANR"
FT   repeat_region   748949..751141
FT                   /rpt_family="CRISPR"
FT   CDS             complement(751617..751799)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07620"
FT                   /product="Uncharacterized protein predicted to be involved
FT                   in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92826"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLZ1"
FT                   /protein_id="CBK92826.1"
FT                   /translation="MDTDIRKKLLSEWQNKKKEIITHPYLNEKVEWGMVPFVQAMLLAR
FT                   YLRGDLDEYPVFLWK"
FT   CDS             complement(751799..752647)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07630"
FT                   /product="CRISPR-associated protein, Cas1 family"
FT                   /function="CRISPR-associated protein, Cas1 family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92827"
FT                   /db_xref="GOA:D4JLZ2"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLZ2"
FT                   /protein_id="CBK92827.1"
FT                   /translation="MKKLLNTLYVTSENSYLGLDGENVVVYDDKNEIGRLPLHNLEAII
FT                   SFGYRGTSPALMGACADRNISLCYLTPQGKFLARVSGKVKGNVVLRKQQFQSSSEDIKC
FT                   LEIAKNCILGKVYNSRWVLERAIRDHSMQIDVDKVKKASIKLKEFLDYIQNSQSMNQLR
FT                   GYEGEAASIYFGVFDELILQQKKDFFFQGRNRRPPLDNVNAMLSFTYTLLTTQITSALE
FT                   VVGLDPYVGYMHTERPGRVSLSLDLIEELRAVMADRFVLSLINKKIVNGKSFTKKKTVL
FT                   Y"
FT   CDS             complement(752644..753306)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07640"
FT                   /product="CRISPR-associated exonuclease, Cas4 family"
FT                   /function="CRISPR-associated exonuclease, Cas4 family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92828"
FT                   /db_xref="GOA:D4JLZ3"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLZ3"
FT                   /protein_id="CBK92828.1"
FT                   /translation="MEYSQDDYLMISGIQHFKFCRRQWALIHVEQQWAENEHTVIGELM
FT                   HKKAHDPYLTEKRKDILVVRDLPVSSRSMGVSGECDIVEFHKCEDGVKLYGHRGTYSLY
FT                   PIEYKKGKPKESNEDELQLIAQAMCLEEMFSTKITEGAIFYGETRRRKPIVFTDELRDE
FT                   VKKIFGEMHDYYDRNYTPKVKTSKRCVSCSLKDICMPKIDKSGSVKSYINKMLGETL"
FT   CDS             complement(753306..754217)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07650"
FT                   /product="CRISPR-associated protein, Csd2 family"
FT                   /function="CRISPR-associated protein, Csd2 family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92829"
FT                   /db_xref="InterPro:IPR006482"
FT                   /db_xref="InterPro:IPR013418"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLZ4"
FT                   /protein_id="CBK92829.1"
FT                   /translation="MGEVIKNRYEFVVLFDVENGNPNGDPDAGNMPRIDPESGLGIVTD
FT                   VCLKRKIRNYIETVKEDEDGYKIYIKENVPLNRSDREACKSLGINDDEDKKVTEALKKL
FT                   KKSDKDADIKLRDYMCRNFYDIRAFGAVMTTFVKASLNCGQVRGPVQLGFARSIDPVIS
FT                   QEVTITRVAITTEKDAENKSNEMGRKSIVPYGLYRVEGYISANLARKVTGFSEEDLELL
FT                   WDAVINMFENDHSAARGKMAVRELIVFKHSKELGDCPAYKLFDAVKVQKNDDIQYPRKY
FT                   QDYTVTINDDEIPDTVEVKRMI"
FT   CDS             complement(754218..755954)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07660"
FT                   /product="CRISPR-associated protein, Csd1 family"
FT                   /function="CRISPR-associated protein, Csd1 family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92830"
FT                   /db_xref="InterPro:IPR010144"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLZ5"
FT                   /protein_id="CBK92830.1"
FT                   /translation="MILQALVKEYENLAENNLVPKRGWCQAKVSYAIDLNPNGKIKEIY
FT                   PLKTEQTSGKKKVFLPVAKSVPEMVTRSSGVAANFLCDNVKYMLGIDQNGTNARVQECF
FT                   QAAKEKHLALLKNVDEPMANAICNFFNLWDPETAYDNACVREKSDELNEGGNVIFCMGN
FT                   DFAQDNDTIKKIWDNYVVHQTENTNDGICLATGEKTEIARIHRGIKGVPGAQTSGAALV
FT                   SFNAPAFESYGKEQSYNAPVGKNAEFAYTTALNYLLSNRDKIFQLGDSMVVYWAENGME
FT                   EYQKTFSFVMNPHVDNEEQLQRIFDSLKKSRYVDVDNVKMDFEQSFYILCLAPNAARLS
FT                   VRFFYQNTFGDILKNIKEHYKRLDIVKPLWVEKKYLSVYELLRETVNPNSKDKTPIPNM
FT                   SAMVLQSILSGNRYPASLYTDTVIRIRSEQGNVTWGRASIIKAYLIKNYSWKEGENYMG
FT                   LEETCNDTAYVLGRLFSVLESIQKEANQGINATIKDRYFNSACATPASVFPILFKLENS
FT                   HIKKLEREKGSGSKIFYEKIIGNLMEKLVLFPRSLSLEEQGKFMLGYYHQTQKKYEKKE
FT                   NK"
FT   CDS             complement(755951..756619)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07670"
FT                   /product="CRISPR-associated protein, Csd5d family"
FT                   /function="CRISPR-associated protein, Csd5d family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92831"
FT                   /db_xref="InterPro:IPR010155"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLZ6"
FT                   /protein_id="CBK92831.1"
FT                   /translation="MGVGVRVKVWGDYALFSRPEMKVERCSYDVMTPSAARGILEAIYW
FT                   HPGLSWVIDKIYVKNPIRFTSVRRNEIKSKASANNILQVYNGADKPLYISTKDDIVQRA
FT                   SLILKDVSYVIEAHFEMTEKANNTDNPGKFKDIMMRRLKRGECHHMPYFGCREFPANFC
FT                   LCEEKDIHTFYDNIPEKDLGFMLYDMDYSDCERGNISPMFFRAVMKRGVIDLRDCEVIR
FT                   "
FT   CDS             complement(756620..757060)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92832"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLZ7"
FT                   /protein_id="CBK92832.1"
FT                   /translation="MAVKNNNNLFYTCSLIEYIGRQIKRKRYEVVDLLTKERIKRIYKY
FT                   ADILHCEPIEKVADEFITECSMNNGNYDNIHDCKYRIPDYWDIGEVYERLIEDCFSDDE
FT                   ILHGIWKVYHSWISDKISNYNTDFYYQPRDYIAACYEEGDVL"
FT   CDS             complement(757050..757511)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92833"
FT                   /db_xref="InterPro:IPR025051"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLZ8"
FT                   /protein_id="CBK92833.1"
FT                   /translation="MILYHGSKEIVEFPEIRTARYNKDFYFGFYCTQMPEQAVRWATRY
FT                   GTRGYLNKYEYTENSKLKYLVFEKMTEEWLDFIVDCRRGIAHSYDIVEGPMADDTIYNY
FT                   IQNYIDGKISRAAFWELAKFNHPTHQISFHTVSALSTLRYVGNEVVYGG"
FT   CDS             complement(757745..759859)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07700"
FT                   /product="CRISPR-associated helicase, Cas3 family"
FT                   /function="CRISPR-associated helicase, Cas3 family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92834"
FT                   /db_xref="GOA:D4JLZ9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JLZ9"
FT                   /protein_id="CBK92834.1"
FT                   /translation="MEYIAHIEEERKQRLIDHLDGTAKLAGKFAESFGKYEWGYCIGML
FT                   HDLGKYSKEFQHKIQFNTNDRVDHSTAGMRLCNEKGGYYSILQYAIAGHHSGLMDYYKL
FT                   EERYRKSICDYQAYRQEVEIPQIKSDPFESCKTQNPHFSMGIFMRMLYSCLVDADFLET
FT                   ESFMKNNHVERTSGEEMASLLARLERHIGSWLENDDLNSINGRRTEILKACLIAGENDR
FT                   GLFHLTVPTGGGKTIASLAFALKHAVRHQMEHIIYVIPYTSIIEQNAQVFREILGQDNV
FT                   LENHCNVDYGDSEELKPMQLASENWDKPVIVTTNVQFFESLFASRSSKCRKIHNIANSV
FT                   VIFDEAQMLPLEYLKPCIAMMENLMDFYRTSIVLCTATQPALDSIFDQHRRYIELCPNI
FT                   NEQFKFFKRVIYENLGIIEFDTLIERLKTEKRALCIVNTKKCAQQLYEQLSGDGVYHLS
FT                   TSMYPKHRKKILAQIKERMSDKSKSCVLISTSLVEAGVDLDFNSVYRQVAGVDSVIQAA
FT                   GRCNREGIEKKENSKVYIFDINGMKTVPGQSLQSSITKGLLQDYHDISNLECITEYFKR
FT                   LYHFRENDLDKKNIIGEFKDWKYNFETVSEKFHLIEENTRIVFIPIEQEAKDLLFEIKN
FT                   QGYGKARMRKASQYCVQIYNQLFDTLYGAGIIKEITSDIENFYELVDEEMYTDDKGLNL
FT                   SVESGMDLYL"
FT   CDS             complement(759880..760869)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07710"
FT                   /product="Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92835"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM00"
FT                   /protein_id="CBK92835.1"
FT                   /translation="MYTADEKRYDTMRYNRCGRSGLKLPVVSLGLWHNFGDFSSYDNMK
FT                   QMCFTAFDHGITHFDLANNYGPEYGSAEKHFGLILKEHLSAYRDELIISSKAGYDMWKG
FT                   PYGNWGSRKYLIASLDQSLKRMGLDYVDIFYHHRMDPETPLEETMGALDQIVKSGKALY
FT                   VGLSNYDGETMKRACEILTDLKCPFIINQNSYNIFNRTIEQNGLKQAARECQKGIISFS
FT                   PLAQGMLTDRYINGIPEDSRIKTDGRFLNQEKLTPHIEQIKKLNDIAAKRGETLAQMAL
FT                   KWVVKDDDVTSVLVGASKPQQILENLKVMEGTGFSEEELRMIDEIVGV"
FT   CDS             complement(760945..761340)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07720"
FT                   /product="L-aspartate 1-decarboxylase"
FT                   /function="L-aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92836"
FT                   /db_xref="GOA:D4JM01"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM01"
FT                   /protein_id="CBK92836.1"
FT                   /translation="MNYTMLKGKIHRAVVKQADLNYVGSITVDTKLLEAAGILEYEMVQ
FT                   IVDVENGNRFETYTIAGEPGSGMICLNGAAARQVAVGDHVILMCYAQMTPEEAKEHHPK
FT                   VVFVDDENKIARVTNYEKHGKLTEDFI"
FT   CDS             complement(761378..762217)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07730"
FT                   /product="pantothenate synthetase"
FT                   /function="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92837"
FT                   /db_xref="GOA:D4JM02"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM02"
FT                   /protein_id="CBK92837.1"
FT                   /translation="MLIYGQIEQVREAVKAWKKEGKSVGFVPTMGYLHEGHKSLIDAAR
FT                   RENDKVVVSIFVNPMQFGPAEDLDSYPRDLNRDAKLCEDAGVDIIFHPEPEEMYADGFC
FT                   SYVDMNGLTTELCGKTRPIHFRGVQTVVLKLFHIVTPDRAYFGQKDAQQLAVIKRMVKD
FT                   LNVDTEIIGCPIIREEDGLAKSSRNTYLSEDERQAALVLSRSLKIGKQLVEDGEKSTKA
FT                   IKDAITAEINKEPLARIDYVDVVDFETITPVDEIKGTTLVAIAVYIGKTRLIDNFIA"
FT   CDS             complement(762288..763115)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07740"
FT                   /product="ketopantoate hydroxymethyltransferase"
FT                   /function="ketopantoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92838"
FT                   /db_xref="GOA:D4JM03"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM03"
FT                   /protein_id="CBK92838.1"
FT                   /translation="MKNTVVTFKQAKEKGEKLTMLTAYDYSTAKLIDEAGINAILVGDS
FT                   LGMVVLGYEDTLSVTMEDMIHHSAAVSRGIKDTLLITDMPFMSYQTSVYDAVVNAGRLV
FT                   KEGHAQAVKLEGGKEVCPQIKAIVDASIPVCAHLGLTPQSVNAFGGFKVQGKGEEAAQK
FT                   LLDEARAVEEAGAFAVVLECVPKALAKKITESISIPTIGIGAGADCDGQVLVYQDMLAM
FT                   YANMKPKFVKQFAQVGKEMNEAFTAYKKAVEEGSFPGEEHTFKMDETIIDKLY"
FT   CDS             complement(763184..764035)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07750"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92839"
FT                   /db_xref="GOA:D4JM04"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM04"
FT                   /protein_id="CBK92839.1"
FT                   /translation="MKIGIIGAGRVGCSIGKYLRTKDIELAGYYDVDSAATKEAAEFTR
FT                   TESFDSLKQLADQSQIIFITTPDSFIIPVWEQLKELSLTNQIICHCSGALSSDSFSGRE
FT                   SMSVSCCSIHPMLPFSNKFSSYEQLNKAFFTVEGQDAAVEAISGLFCSIGNEVCRIDGA
FT                   KKAKYHAAASILSNQVIAVLDMGYSLLEDCGFTRAEAVRATGQLVMRNIENVLEAGCDG
FT                   ALTGPIERNDIETVKKHIACMQNDDSDDVRLYKMLGTKLVNIAEKKNPDKDYTQMMELL
FT                   RG"
FT   CDS             complement(764159..764242)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92840"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM05"
FT                   /protein_id="CBK92840.1"
FT                   /translation="MEDVLSPYDRAYPADTRNLKAHCCIRI"
FT   CDS             complement(764313..766901)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07770"
FT                   /product="diguanylate cyclase (GGDEF)
FT                   domain/uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92841"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM06"
FT                   /protein_id="CBK92841.1"
FT                   /translation="MVITTVLPDDFNANVMAIRASLQTVRFYVDGSLRAEYDTKDTRPF
FT                   GKDSASRYVFCNMSEDDAGKELRIELTSHASNYSGVVNTVYCGDKSDIWTNIFHNSSRE
FT                   TIIAFFIFFAAVVSVMFSIALSIVYKTHFDMEYVGWCMLLGAIWMLGESKLRQMLVPNA
FT                   SVLAAMCFVVILISPIAVSIYIDSIQGGRYTRVYTCIEALAAVNLIVCTSLQLFGVCDY
FT                   IETLPAGQGMLAVCCVVVITTFIIDIIKHRALGYRPEMVAMIVALVLALIEAASVYFVV
FT                   TMSGLFIGIGLIVILFVNIIVTIKRISEIEYKRQKEESDKLRNQTERVSLQMMKTLAAT
FT                   IEAKDDYMRGHSYRVAEYSALIAKQLGWSEHDVENLRNAAYLHDIGKIGVPDTILNKPT
FT                   RLTDEEFAAIKSHTVMGADILKDITLLDHLVDIARNHHERYDGKGYPDGLVGEEIPLSA
FT                   RIVCVADSYDAMRSRRIYRNALPDEEIRRELLDNCSTQFDPQISSMFVDMLDNGMVVID
FT                   EDNPAAQGYRDNAAIESVADKFISEVMKTMSSQEKADSVDYLTGLYMRSRGQQVIAALM
FT                   QDNDGCLAFIDMDNLKKVNDVHGHKAGDRALKLIGNLLAKETENETFAACRLGGDEFLI
FT                   FMPYSDRASVESVIKRIFEGFESAREADCEIKEAALSAGLCMTTKGAMFESDYTKADKA
FT                   LYYVKQNCKGSYFFYEQLLADNKENTNLSADLRNVAKLLKESGSYTGALDLNYREFARI
FT                   YEFVNNVGDRHKHNCYLVMVTMNTLPEQLADIEEIEKALDCMEQSIRSKIRKVDVCTRY
FT                   SSMQYLIILFEPQENQIPNVMERIFMHYYKLCDREDFKPQYEYIKMAEAK"
FT   CDS             complement(767210..767752)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92842"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM07"
FT                   /protein_id="CBK92842.1"
FT                   /translation="MSKNTNNNQTVDEKKGKRTGLTILGYVLVIVALLTVLPVVLPPIF
FT                   GYHTYLSGTDHTGNISKYGSVVYLKTIDEASYKDGNIVAIESADSSARRVDSYYVDSND
FT                   SSAKEIALRDGNGVSYKVVKGQVIAKTPFIGYLSQLCFSAVGIIVTVVIFAAGVAIMMY
FT                   VNKISKEINTMVEQQTA"
FT   CDS             complement(767787..769160)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07790"
FT                   /product="conserved hypothetical protein TIGR02919"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92843"
FT                   /db_xref="GOA:D4JM08"
FT                   /db_xref="InterPro:IPR014268"
FT                   /db_xref="InterPro:IPR015397"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM08"
FT                   /protein_id="CBK92843.1"
FT                   /translation="MDRAVEVTHTADGITLLFDTFSGESKNLLESFKNAGAAFHAAVIE
FT                   DDGFLPDDVMSVYGFFLGDYRKADSLPGKPLYFNQIQIPDYWRIEGDNSSAKVMDRTRE
FT                   RARIFFTEPTHRRQVKIVDWLDDAGQVRLSEHYNRYGAIFCHTVFNKKGQKALRKFFDV
FT                   TGREMIVENFVTGDILVRWQDKDWIFRSKTDFIAFFIRCSGLEDTAVYFNSLSYPFFAS
FT                   QALAPNGFRDALFWHEPVGDEIPGNMQIILHDQGTRAKRVFVSRRESYDRLIALGAPSD
FT                   KVKQLGYIYSFVRENKHRPHILVCTNSENVGHLTELASLMPQMHFHVAAITEMSSKLMS
FT                   AGQYDNVSLYPNVKMSVLDSLFEKCDFYLDINHEGEIVDAVHRAFLNNMLIVGYEETMH
FT                   NAYYTADTNTFKESEYANMAEALNLTLAMPHLIDEALAMQKKAAVAADATDYMEILHL"
FT   CDS             complement(769139..770629)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07800"
FT                   /product="conserved hypothetical protein TIGR02918"
FT                   /EC_number="2.4.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92844"
FT                   /db_xref="GOA:D4JM09"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR014267"
FT                   /db_xref="InterPro:IPR015397"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM09"
FT                   /protein_id="CBK92844.1"
FT                   /translation="MVYNFNLGIGWASSGVEYAQSYRANLLRRAHIPARFVFTDMFPTE
FT                   NIEHMTRNIGFLDEEVIWLYTFFTDVRTSPVTFTLKELEAAMAEEDYTFSREGKTCRYQ
FT                   FKESGRFYTCYMVDDTSDLVHRVEIVSNGCLIRKDFYTYCRTFSEYYAPLDGKAHLYGR
FT                   TFFNEDGSVCYEEVIEDDSTFYRIGAQVLYTKADLVGYMVKRLNLTADDVVIIDRTTGI
FT                   GQAILENCGPARVGIVVHADHFSEGGTDDDYILWNNYYEYSFSQTEHIDFYITATDAQN
FT                   ELMRQQFKKYCGKEPQVVTIPVGSLDELKYPDEPRKRHSLITASRLATEKHCDWLVEAV
FT                   VKAKESVPDISLDIYGKGGDEAKLKGLIGRLGCADYVHLMGQQKLDDVYKHYDAYVAAS
FT                   QSEGFGLTLMEAIGSGLPIVGFDVRYGNQTFIDDGQNGYKIPITDEMDQKEKIKLLSER
FT                   IVRMFTEDDMDAFSGHSYEKAKEYLTKEVVHRWIELLK"
FT   CDS             complement(772995..773531)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92845"
FT                   /db_xref="GOA:D4JM10"
FT                   /db_xref="InterPro:IPR022259"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM10"
FT                   /protein_id="CBK92845.1"
FT                   /translation="MYGDTWQVRWKEFLSDSYVYGSKIEFNEDGSVSYKNRLMPPGTVI
FT                   HTWYSMTNFQGNRIEPSLPLIDGERAYSIAVNIDYHNSESEALMLRIIFFDRYDVQAQS
FT                   IIVRDKKAVFKPSIRTYSYRIELINGGNADFTFKSLVIKEVSEEEFDAEQERIERLKED
FT                   SNKSKKKRRKNKKSK"
FT   CDS             complement(775128..776789)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07840"
FT                   /product="Domain of unknown function (DUF1975)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92846"
FT                   /db_xref="GOA:D4JM11"
FT                   /db_xref="InterPro:IPR015397"
FT                   /db_xref="InterPro:IPR022372"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM11"
FT                   /protein_id="CBK92846.1"
FT                   /translation="MLYFIPAWYKQNMWCENEQQWYMRRLKSEFDETIKQITLFHRNVD
FT                   RPYRILVLGYSPNFRHFLHRQGMYRSKYWSCFDAIAQVRRKKVAVLSYHDIKWPKGLEF
FT                   VYSPFSIIALQGDVKYAQVEFGEDGNPISIDMFEDGKICRRNYYDDRGFVSSTVIYENG
FT                   IEQYQDFLMENGIWKIREYKNDGHVVVNQTCPDYDVVPDAKSGKAGEPVEMRFTKAEYD
FT                   SLEAVIEEVFASYVNLTRQNDNFFVAMHPLHIRVAEHVLKGKRIIATFFENRFDFTQTS
FT                   LAADFLEHAENIITDSDYTTKLIMENLGAVNNKPVRLNITDIPPYDTRMDFGISSQLRV
FT                   QNILVPVDGLTEDAFARIIKGLADYLTINDLARVHFFTRDASWGHEDAIKNDTVKLLDS
FT                   MGYDSRLVTGDGEAALGFGGSGADAFAENELGDIEKTVEQRFFVDVCVDERDISKCINE
FT                   QRVILDMRGTMDVFVYVTAISKGVPRISLSADQFLVSGKNGMVIDDFSDIGRSLTYYLD
FT                   SFENWNQALVECYELGQKYTTSVLLKKWRKVLNFSE"
FT   gap             778982..780516
FT                   /estimated_length=1535
FT   CDS             complement(782985..783896)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92847"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM12"
FT                   /protein_id="CBK92847.1"
FT                   /translation="MSVHITKTYNIGGLIGLRQNAVKNAGETLGFKEMSLFKFPDAYDS
FT                   DDELHVRMDGIIASLCPEDIVIFQHPSGESPRYDGFLFEHLRRYHGTKIVAFIQEIASD
FT                   RDDSEYSLSDEITLLNRADMFIFASAALRDYYIANGLKEKPYLIQNIPDYMTDICTNEH
FT                   KNKKLYIMAETSQNEYPLNNLNIEVVQYDEYRAMESILRLSDGAFGLIWDADEQALGLY
FT                   MAAGIPVIVKKGLSCEKYVTDNEIGAAATDFEDVYQIAVSESEDKLSQYYANVKKLQNL
FT                   FINGIYTRKLLLDTLILCRERL"
FT   CDS             complement(783997..785034)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92848"
FT                   /db_xref="InterPro:IPR016503"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM13"
FT                   /protein_id="CBK92848.1"
FT                   /translation="MKTHITTLNNMAGTASLAHRRVLKVAQSIGCHEMGLSFYPLKPDY
FT                   AKEIDKRLDGIIAPLNYGDIVIFQYPSWIGVNYDESFVNKIKSYRDTKLIIFVQDIQKL
FT                   MFDSEQAILDMEIKTLNKADLLILPSKKMHRYLKENGLDEKPVIYQTIWDMPSDICFVD
FT                   HAVTRCFHFAGNYNRFPFLAEYHGKTPIYQYDANKPDRENDDSFCWRGYFEQEKLMHEL
FT                   SKGGFGLVWSDDEYFDRYYSMNQPYKLGTNLAAGIPVIVKRGCVHEKFVERNGLGYAVD
FT                   TLDEADKLVQSITDAEYIKLYHNVKNIQKLILDGAYTRKTLQDAIIEVLENACTPVENR
FT                   YQDHI"
FT   CDS             complement(785047..785202)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92849"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM14"
FT                   /protein_id="CBK92849.1"
FT                   /translation="MDAAYKKYTIAQSVKLNFIEKCSNMKVKHPKDYWLEYERKMLENI
FT                   NETTGL"
FT   CDS             complement(785172..786704)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07920"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92850"
FT                   /db_xref="GOA:D4JM15"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR014267"
FT                   /db_xref="InterPro:IPR015397"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM15"
FT                   /protein_id="CBK92850.1"
FT                   /translation="MRVFDFTLLSGYEFSGVDVAQGFRARLFAKNNVNAKFIFTELPTI
FT                   RDMELYGSQKIKRGQIMSAHLFMTGRLDMSLSVKKEALLENEKENYEYDNIDEDGKVIR
FT                   LYNSGEKSVEILCDEDGFVINESLFKNGKKYLVNYYTDSLSYTELYNWDNDSNDGLNPE
FT                   RRIFWNKQGQMVYEQCIYKDNVEYLFKNGEVIDNVEFLERFVKALNLCENDICIMDRAG
FT                   YLDYIQPLFENKGKSKLIAVLHSDHFYKIYEDESSLYMNYEYYYWFKYSEAIDYFVVGT
FT                   DEHKRSLEAFLKEYDCFVPHIAAIPPGAIPEGKLKSKNNRRRGSIISASRLSPRKGIDI
FT                   LIKSVIKAHEINQTINLDIYGSGDDGYTIYLKNIVKDACADDYIHFKGRCNLEKIYPHY
FT                   ELFASFSLWETFGLSLMEAVGDGLAMVGLDVRYGNRLFIHPDENGYLVDFDIETDFQNK
FT                   DKLCERTAAAIVKIFEDDDRLKKFHENSYMIAEEYKEHVIESKWMQLIKNIP"
FT   CDS             complement(786691..787965)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07930"
FT                   /product="Domain of unknown function (DUF1975)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92851"
FT                   /db_xref="InterPro:IPR015397"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM16"
FT                   /protein_id="CBK92851.1"
FT                   /translation="MIFITDELGKFEKNIIELAENVGFKECKTIEAIDLFCGISERNDV
FT                   LKEKDRYYAFIDIPQYWSVRADGLNGAIYDNKTKKANIYFKNPIEKRMVSRVEWIDRNN
FT                   TVYKVDYYNKYGYMYCSENVSGGNVTVREFYDRNGDIKVLEQTGPKTYTTFGTRISPKS
FT                   YRGFADYLEAYLKYNKIYDENIWLTSDEILNKFAWDYGNFKISYLPQNRLNSDLTVITQ
FT                   TNTAFRILCSEEQQVNWYKENSNYKCDRLYSYLENNKSKFGRKEAFIITESDQLEYIEQ
FT                   LINDFPEITFHIAASTIMSDKLTRLDINNNVELYPCITEQKRKELFERCDIYLDINHYR
FT                   ELYNAVNEAMVNNMIILAFDNTAHSKELYPMGNIFESSNYVKMKETLKNIITSQTIFNE
FT                   YIDRQKKQLKQLAAKVVMGDTDESI"
FT   CDS             complement(787962..790133)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07940"
FT                   /product="Lipopolysaccharide biosynthesis proteins,
FT                   LPS:glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92852"
FT                   /db_xref="GOA:D4JM17"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM17"
FT                   /protein_id="CBK92852.1"
FT                   /translation="MNGKDKISVIIPCYNVQKYIMRCFDSIYSQTYGFENLEVILIDDL
FT                   STDNTWSILESLQRQYPENVISLKIQKKGKCGGARNLGMDICTGKYITFVDADDYVHPD
FT                   MLRVLYDRMTEDDYDVAQCGVSCFKADKPNVLEVNDFEIQRLDLDNVDNRKNLIIGLTG
FT                   FTNVTAWAKLYSTKFIIEHNLRFIEDVYYEDTHFSMLCVLLAKKYCKVQSTLYYYFENT
FT                   EGIIRSEISNAKIRDAKIIMDHIRQAIQSRKAELGNVIEQCYCEIQTFLLWHQYIEPYS
FT                   RIETFMNRELDICKEEFLKSEPDIFNNPYVKAFSDNVILKRMSKLRVTAKKMDNAYFLD
FT                   NAMHICFGIHDKDGNYSVWAGTTMQSIVENTKAPIVFHILHDDTLNEINKNKLSFIADN
FT                   SGNDIEFHHFNSDVFGTFADSMNRFAIGTMFRIMLPDIMPDLKKIIYLDSDLFVNTDIE
FT                   ELWNLNIDNYCLAAAQDCSTIRNWGTPYAVAAGQTSRDRYFNAGVLCMNLDNIRKNGSL
FT                   FQQVIDYLNDNPRTWLPDQDALNAIFSGKTLLIDEKWNYFIDEARKNNEKAEKKIYHYA
FT                   ATLLMLHTNNEIDRAYYFTILRTPWGEQMEDGLLCNSMGRIVDRTGMLEKLLKKVTQNN
FT                   IRLVFYGGENSSIRNAMRLLNRNFDSCEWHEHLKENEIICDDNTVYIVSAEADDGNGLE
FT                   ILANAGLENGENYFITQRFLHYTEGGFAL"
FT   CDS             complement(790232..791482)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07950"
FT                   /product="Bacterial transcriptional activator domain."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92853"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM18"
FT                   /protein_id="CBK92853.1"
FT                   /translation="MTHKIKVQMFGNFRMDYNGAPFVAEKMHKESQFNRMMQALIHYSD
FT                   CGVAKDKLEEIVIGERDIDAPHTALRVIVYKTKQKLAQLGLPGKNLIYLEGGIYYWTPD
FT                   IEIEEDAAEFEKLYNEACALEKQMPQEPESAETVCDERIKEIEDNMLELYVKALYLYKG
FT                   EFLAAYTGETWIAQEARRYHIMFEKIINEAAYILRKRKQFKGLEKLGVYAAKVDPFNEW
FT                   EELIMEAMVETRRYDEAEELYTDVVDYYLRECGIYPSSRLLEILEKYSNQMNHAHEILE
FT                   NIQEGMNEQEETERGGYFCSYPVFRGIYQASIRIMKRTRVPVYLMLCTLEDEEGRQVQS
FT                   ETKMNKYSRQLKKCVGESIRYSDIYTSYGKVQFLIMLIGIKREDCEIVKKRINRQFAKK
FT                   NPRAAEKCHVNSIVCEL"
FT   CDS             complement(791783..792700)
FT                   /transl_table=11
FT                   /locus_tag="ERE_07960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92854"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM19"
FT                   /protein_id="CBK92854.1"
FT                   /translation="MKYCTNCGRQLADDEVCTCRQQAQPQAPNQTQDNNAQVDNAAQQA
FT                   QFNGQPQGSAQGQFNGQPQGSAQGQFNGQPQGQFNGQPQGSAQSQAFDNFTQQVSAAGQ
FT                   QLQNDKNVASIITFYKGLVKKPAQAAADFVKNANMASGFIFIGLFAIVEVVLSVVYLLS
FT                   SVIGSIGGFGFSFYPASFFEGIFSGIVGEAVRVLILAAVILVVLNAVQKDKKVTFAQTL
FT                   SAACLYDAVYLPIILVAAIIDIIPFQFFGNVSGWLHTFAGVVGYVSIFFGVRAIEEDDN
FT                   KLPLVCGLAFLATAIGSTIVNAIF"
FT   CDS             792844..793572
FT                   /transl_table=11
FT                   /locus_tag="ERE_07970"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92855"
FT                   /db_xref="GOA:D4JM20"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM20"
FT                   /protein_id="CBK92855.1"
FT                   /translation="MPQTLNIAVCEDEAAETVLLCDILNHSDIQNTYTVFTDADSFLAS
FT                   YEYGKYDLLLMDIYMKDSMTGIEAVSIIRETDADIPVAFITTSTEHALESYRLSAIGYI
FT                   EKPVSAAELSNILHLAMLKKSDAPSLYVKRNKSMERLALSDIMYIEQRARQIFIHLKEN
FT                   EEISCYEKLSELSDQLPAELFFLPHKSYAVNLSYVTRIDTSLKCFVMADDTNIPIKREL
FT                   SGKAKKALERYYFEHTRGLK"
FT   CDS             793640..795493
FT                   /transl_table=11
FT                   /locus_tag="ERE_07980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92856"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM21"
FT                   /protein_id="CBK92856.1"
FT                   /translation="MKKISAIRNIPYLTIILLTLICILLLSSKNMIMSQASYPEATIVS
FT                   SAYAVVDGSDSDKEEITFPHTFKHLSPRTHVTVTTHIDLNKDDPIYIKTVYSPAKVYLD
FT                   DELIYEFGRTENYPSYMKDPATEGYLIGTDGHSGDTELRIEYLSPVTRSSLTVYSPIYG
FT                   AYKSLFFTLLKLNKWSFFIALLELAAGVLFIFISLMLLCYDKEVCKMIFHFGFFSLMAG
FT                   MWSIGECNYTGVIIKNPTLLYLCAFIGLFSQMIPLLYFCRLAVGFKNDKPIIVIAKLLT
FT                   VLDLVACVLQLSGTVALSQSMYVFHVILPLILCFLTAYIILEAVRSQNSRAKRLMVPVF
FT                   ILALASCAEIINYHLKFVASLSLLYQIGTLLFIIIMGIVMGLNISDMLSIKRENERLIF
FT                   DMNLLEHSLLEQKKYNSLITTNEQLFKKQRHDLRHQLVAIKGLANTENKQLNEYLDSLI
FT                   HSIPSAPASYCENRVVNSILSYYSAICRNENIALETKLIVPETDDAALDNDLCLVFGNL
FT                   IENAIEACRRMDTSDSLNEKSSHFIRLHAHVHYKTLIITMDNSFDGHVSIQNGKYRSSK
FT                   RDDYGIGLSSIRSVAGKYDGDVAFEAADGIFQSSVYLQIYK"
FT   CDS             795636..797279
FT                   /transl_table=11
FT                   /locus_tag="ERE_07990"
FT                   /product="FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_07990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92857"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM22"
FT                   /protein_id="CBK92857.1"
FT                   /translation="MIEHTIYKEFIDKISELSDGIYPIITDLDNDLSYVPDKTADFFGF
FT                   EAGEHTCFFEQLSSCVNDVDLPEYKQEIRYRLNGEKTDDIFYVRMGKHTKEYMMGFYSD
FT                   IFTGDDGHRYHVLVLRNENTLPDIDPYTYLYGQSKFERDINGYIMENRSVAIIEVEIGH
FT                   IDEFNILYGSNFNTAIQRELALKFIYMMDGSTATYYMNNCKFVFVVKEADRALAEAFYQ
FT                   KIADTIKSMYFFKCFKFEFDIYAACLILKDYDGDTSTVISKVEYTLDRAKELHSPDLLF
FT                   FNDMVRFNGSSHIDIMKIIHQSVINGCDGFFVEFQPIVKACNGEIMGAEALVRWKKEPF
FT                   GTVPPGLFIDWLEDTPAMYELGNYIMRTAISAASEFAKIKPGFFINVNASSEQLEKECF
FT                   VEDTLAILKEYDFPPSQLWIEITERCRDLPISMIKKTVTAFREAGIHITMDDYGTGSSS
FT                   SQMMLELPVEGIKIDMFFVKDILEEKKKQALVIGMINFANAADLRICIEGIENDNLESY
FT                   LRQFDVTCFQGYHYSRSICQDELMKLLIKP"
FT   CDS             complement(797289..797822)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08000"
FT                   /product="thiW protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92858"
FT                   /db_xref="InterPro:IPR012652"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM23"
FT                   /protein_id="CBK92858.1"
FT                   /translation="MESKKNTKKRTLSIRKIAMAGVLVAVAVAGSLISFPVAGSKCAPV
FT                   QHMVNICAAVFLEPAWGVGVAFCASIIRNLTGLGSLMAFPGSMVGALCCGLMYRFSKKI
FT                   IPTCIAEALGTGILGGLAAYPLAKYVMLIQPEGMFIYIVPFLISTVAGSIVAAIVMLIL
FT                   KKNGALTVFKENLE"
FT   CDS             complement(797896..799206)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08010"
FT                   /product="hydroxymethylpyrimidine synthase"
FT                   /function="hydroxymethylpyrimidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92859"
FT                   /db_xref="GOA:D4JM24"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM24"
FT                   /protein_id="CBK92859.1"
FT                   /translation="MSNYTTQMDAARKGIVTPEIEKVAKKEKMDVDKLMELVASGKVAI
FT                   PANKHHKSLDAEGVGSMLRTKINVNLGVSRDCKDYDVEMQKVMSAVKLGAEAIMDLSSH
FT                   GNTQPFRQKLTSECPAMIGTVPVYDSVIHYQRDLATLTAQDFVDVVRLHAEDGVDFVTL
FT                   HCGITRKTIDQIKKHKRKMNIVSRGGSLVFAWMCMTGEENPFYEHYDEILEICEEHDVT
FT                   ISLGDACRPGCLADATDVCQIEELVRLGELTKRAWDHNVQVMVEGPGHVPLDQVAANMK
FT                   VQQSICMGAPFYVLGPLVTDIAPGYDHITAAIGGAVAAMNGAAFLCYVTPAEHLALPNV
FT                   EDTKQGIIASKIAAHAADIAKGIPGARDIDDKMADARRVLDWDAQFACALDPETAKAIR
FT                   DDRLPEDDHSEACSMCGKFCAVRSMNKALAGEYIDIL"
FT   CDS             complement(799251..800042)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08020"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92860"
FT                   /db_xref="GOA:D4JM25"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM25"
FT                   /protein_id="CBK92860.1"
FT                   /translation="MHTALTIAGSDSSGGAGVQADLKTMLANGVFGESVITALTAQNTM
FT                   GVDAVMNVPADFIEAQMKAVFTDIFPDAVKIGMTSSVDTIEAIAAGLVKYKAKNIVLDP
FT                   VMVATSGSRLLEENAANTLMEKLFPLADIITPNIPELEVISGRQIESTDDIIEASKAVY
FT                   DKYGCPVLSKGGHFTDTACVCDYLWDGKQIITFETKRVDNPNSHGTGCTLSSAIASGLA
FT                   KGQPLEQAVDNGKRYVTACLKAMLDLGHGSGPMNHGALILK"
FT   CDS             complement(800145..800795)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08030"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /function="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92861"
FT                   /db_xref="GOA:D4JM26"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM26"
FT                   /protein_id="CBK92861.1"
FT                   /translation="MNKTDLKLYAITDRQWLHGARLSEHVKLAIEGGATMIQIRDKDIL
FT                   STDSDAGLKDEYNEALEIKRICHEHKVPLIINDNVQFAIDIDADGVHLGQDDMNPAEAR
FT                   KLLGTDKIIGVTAKTVEQAKKAEADGADYLGSGAVFGSTTKLNAKPMTKELLREITEAV
FT                   DIPVVAIGGINADNAVTLKGTGIAGIAVVGAIFASADIRAAARELAEICDKIL"
FT   gap             802457..803584
FT                   /estimated_length=1128
FT   CDS             complement(803793..804554)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08050"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.3.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92862"
FT                   /db_xref="GOA:D4JM27"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR011770"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM27"
FT                   /protein_id="CBK92862.1"
FT                   /translation="MTKVIMNGCNGKMGQTITEICKADADIEIVAGIDLYDGIDNDYPV
FT                   FSSIDKCDVDADVVIDFSNAKAVDGVLDYCVDKQVPVVLCTTGLSDEQLAKVEECYKKV
FT                   AVLKSANMSLGINTLMALLKKAAQVFAPAGFDMEIVEKHHNLKLDAPSGTALALADSIN
FT                   EAMDNEYHYVYDRSQRREKRDSKEIGISAVRGGSIVGEHEVLFCGQDEVIEFKHTAYSK
FT                   AVFAKGAVEAAKFLKGKGAGHYDMADVIAAK"
FT   CDS             complement(804579..805469)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08060"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92863"
FT                   /db_xref="GOA:D4JM28"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM28"
FT                   /protein_id="CBK92863.1"
FT                   /translation="MAIFKGAGVAIVTPMYDNEEVNYDKLEELINMQIDNGTDAIIIAG
FT                   TTGESPCLSMEEHAKVIKAAVEFTKHRVPVVAGTGSNCTKTAMQLSKEAEEFGADGLLV
FT                   VTPYYNKATQAGLVSHYSQIADSTKCPIIVYNVPGRTGCNVLPETMAELFKTKENIVGL
FT                   KEATGNLAQASKTMYLTDGKLDMYSGEDGLVVPLMSIGAIGVISVWSNVAPAKVHNMCD
FT                   SFFKGDLQTALELQREALPLVDALFSEVNPIPVKKAMNLMGMNVGPLRSPMCEMGEDNA
FT                   RKLAEVMKAYGLKLA"
FT   CDS             complement(805865..806344)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08070"
FT                   /product="ATP:corrinoid adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92864"
FT                   /db_xref="GOA:D4JM29"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM29"
FT                   /protein_id="CBK92864.1"
FT                   /translation="MENGAVQIYYGEGHGKTNVAIGSAICAACDGKQAVVIQFLKGKKE
FT                   PEFLKKLEPEVKFFNFSRAGILFEQLDEESKQEEIMNIKNGFNYAKKVISTGADMVVVL
FT                   DEMLGLLDLHLISKEELSDMLASRPDDVTVIMTGRVLDDGIREMADEIYNIASEK"
FT   gap             806494..807551
FT                   /estimated_length=1058
FT   CDS             complement(807597..808217)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08080"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92865"
FT                   /db_xref="GOA:D4JM30"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM30"
FT                   /protein_id="CBK92865.1"
FT                   /translation="MADKMFENNQVSIIGEIVSDFQFSHEVYGEGFYMMEVSVRRLSDC
FT                   MDYIPVMVSERLINVEGDYIGKSVYIGGQFRSFNRHEEKKNRLVLSVFARELEVLDSDY
FT                   DEDAANQIFLDGYICKEAIYRKTPLGREIADLLVAVNRSYGKSDYIPCICWGRNARFAS
FT                   TFEVGTHVQIWGRIQSRDYVKKLSETQVEQRTAYEVSVSKIEA"
FT   CDS             808428..810260
FT                   /transl_table=11
FT                   /locus_tag="ERE_08090"
FT                   /product="GTP-binding protein TypA/BipA"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92866"
FT                   /db_xref="GOA:D4JM31"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM31"
FT                   /protein_id="CBK92866.1"
FT                   /translation="MKTTRDDIRNIAIIAHVDHGKTTLVDELLKQSGVFRDNQEVQDRV
FT                   MDSNDIERERGITILSKNTAIQYKDIKINIIDTPGHADFGGEVERVLKMVNGVILVVDA
FT                   FEGVMPQTKFVVMKALALKLPIIVCVNKIDRPEARPNEVIDEVLELFMDLDASEEQLDC
FT                   PFVFASARDGYAMKDLNDERKDMTPLFETIVNYIPAPTGDPDANTQILISTIDYNEYVG
FT                   RIGIGKVDNGKIKVNQEAVVVNHHDPDKLEKVRISKLYEFDGLNKVDVAEANIGSIVAI
FT                   SGIADIHIGDTICSPEAPEAIPFQKISEPTISMNFIVNNSPLAGQEGKFVTSRHIRDRL
FT                   LRELNTDVSLRVEDTDSPDSFKVSGRGELHLSVLIENMRREGYEFAVSKAEVLYKYDEN
FT                   GKKLEPMELAYIDVPDEFTGAVISKLQQRKGELRNMGSIAGGYTRLEFHIPARGLIGYR
FT                   GEFMTDTKGNGILNTMFDGYEPYKGEIAYRATGSLIAFESGEAVTYGLFSAQERGTLFI
FT                   GPGAKVYSGMVIGQCSKAEDIELNVCKKKHLTNTRSSSADEALTLVPPKVLSLEQAIDF
FT                   IDTDELLEVTPESLRIRKKILDPTLRKRAGFKKN"
FT   gap             810329..811846
FT                   /estimated_length=1518
FT   CDS             complement(811907..813121)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08100"
FT                   /product="LL-diaminopimelate aminotransferase apoenzyme"
FT                   /function="LL-diaminopimelate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.83"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92867"
FT                   /db_xref="GOA:D4JM32"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM32"
FT                   /protein_id="CBK92867.1"
FT                   /translation="MFQINDNFQKLPGSYLFSTIAKKVAAYQEANPDKEIIRLGIGDVT
FT                   QPLAPAIIDALHKAVDEMGNAATFHGYAPDLGYEFLRKAISDNDYKARGCDISADEIFV
FT                   SDGAKSDSANIQELFSANSRIAVTDPVYPVYVDSNVMAGRTGTYDAQKETWSNVIYMPS
FT                   TADNGFVPELPKEVPDMIYLCLPNNPTGTTLKKEQLQVWVDYANKNGSVIIFDAAYEAY
FT                   ISEADVPHSIYECNGAKTCAIELRSFSKNAGFTGVRLGFTVVPKELKCGDVSLHAMWAR
FT                   RHGTKFNGAPYIVQRAGEAVYSDAGKAQLKDQVAYYMNNAKTIKTGLAEAGFTVYGGVN
FT                   APYIWLKTPDQMTSWEFFDYLLENANVVGTPGSGFGPSGEGYFRLTAFGNYENTVKALE
FT                   RIKAL"
FT   CDS             complement(813843..815174)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08120"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92868"
FT                   /db_xref="GOA:D4JM33"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM33"
FT                   /protein_id="CBK92868.1"
FT                   /translation="MAKYSKNDIIRIVDEEDIEFIRLQFTDIFGTLKNVAITASQLEKA
FT                   LDNKCMFDGSSIEGFVRIEESDMYLHPDLDTFMIFPWRPQQGKVARIICDVYMADGTPF
FT                   EGDPRYILKKQVEKAKQMGYIFNVGPECEFFLFHLDENGQPTTISHERAGYFDLGPNDL
FT                   GENARRDMVLTLEDMDFEIEASHHEVAPAQHEIDFKYEEALHTADNIMTFKLAIKTIAK
FT                   RHGLFASFMPKPKHGVSGSGMHINMSLSKDGVNIFDNEEDKLGLSEEAYYFIGGIMKHM
FT                   KGMTVITNPIVNSYKRFVPGYEAPIYITWSATNRSPLIRIPAARGDGRRVELRNPDPSA
FT                   NPYLVLALCLAAGIDGIKNKIQPDTELRENVFELTEQDKKRLGIESLPADLHEAVECLK
FT                   SDDFIREILGEHIYNKYIEAKEAEWNDYRAAVTQWEIDEYLYKF"
FT   CDS             complement(815176..815961)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08130"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase, eukaryotic type"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92869"
FT                   /db_xref="GOA:D4JM34"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011858"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM34"
FT                   /protein_id="CBK92869.1"
FT                   /translation="MEFRPCIDIHNGKVKQIVGGSLKDRGDFASENFVSEQDSRFYADM
FT                   YRKSGIKGGHIILLNSVDSEYYEDTKEQAVMALEAYPQGLQVGGGITADNAMEFIDAGA
FT                   AAVIVTSYVFKDGRINYANLNRLKDTVGSDRLVLDLSCRKKDGQYYIVTDRWQNFTDEA
FT                   VTTELLDKLSSYCCEFLVHAVDVEGRVNGIEKELVTMLGSWGRIPVTYAGGVSSFDDLK
FT                   CIRQLGQNHLNVTIGSALDLFGGEMEYDKVIAFCNNKEI"
FT   CDS             816245..817702
FT                   /transl_table=11
FT                   /locus_tag="ERE_08140"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92870"
FT                   /db_xref="GOA:D4JM35"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM35"
FT                   /protein_id="CBK92870.1"
FT                   /translation="MGTIIGEGITFDDVLLVPQYSEVTPNMIELQTHLTKKIVLNIPMM
FT                   SAAMDTVTESKMAIAMARQGGIGIIHKNMSIEAQADEVDKVKRSENGVITDPFYLSPDH
FT                   TLQDADNLMAKFKISGVPITKDGKLVGIITNRDLKFETDFTKKISESMTSENLITAPEG
FT                   ITLDEAKKILAKARKEKLPIVDKDYNLKGLITIKDIEKQIKYPLSAKDDQGRLLCGAGV
FT                   GITGNMMERVDALVKSHVDVIVVDSAHGHSKNILEAVKKIKAAYPDLQIIAGNIATGAA
FT                   AKALIEAGADAVKVGIGPGSICTTRVVAGIGVPQITAIMDCYKVAKEYGVPVIADGGIK
FT                   YSGDMTKALAAGANVCMMGSMFAGCDEAPGTFELYQGRKYKVYRGMGSIAAMENGSKDR
FT                   YFQEGAKKLVPEGVEGRVAYKGTLEDTVFQLVGGIRSGMGYCGCKTIEDLKENGQFVKI
FT                   TAASLKESHPHDIHITKEAPNYSTDDK"
FT   CDS             complement(819100..819498)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92871"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM36"
FT                   /protein_id="CBK92871.1"
FT                   /translation="MKNVVLGIIGCLIVLYTAMLGLSVYNMTVRENQMEKSLSLALSGA
FT                   MNRYYEPNMYIVDKKPVSSYDVEKAVIEDINERLTAGGSAIATVYVCDMEKGIISAGIE
FT                   EEFKLPTGVTKKISCKKTIVADQPMEDN"
FT   CDS             complement(819603..821336)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92872"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM37"
FT                   /protein_id="CBK92872.1"
FT                   /translation="MKEFLKKLIVGVLLIICIGLNFEKSNIIADEWSEPVKFYNSYGNS
FT                   AVFKPTNIYEGDIYFCSAGNTSTSGTKYRTIGYKMSVKNSSGNVIQTIYYQMGGSYMTL
FT                   KCQAKSSGKEYMMYKIPLRYVRNRMNQESLNALSSGSCTIILDACMVLRVNGKNKGGMN
FT                   DNGPSWGKVYTTYAGISKAANWTDSALSALYSYYGKTVRGLFHTIDVRKSTGISSVSGG
FT                   GTYCYGTYVTISASSSAGYDFTNWNNDSSMSSSSYGFYVNSGGTYTAYAKAGTIAVTFW
FT                   RNTSASDSEKTSKSYTYGGINQAFPAVGWQMAGYHMSGWGNNLYDTTAVYPLLCGVANS
FT                   WIESNRPSKNIYAVWQENEYTIEYDTGVSATVKYSDTVTLPSQHMCIGWILGEEYPDIK
FT                   YTPGESIQVADLCRILGIEYTDKAVIRMYALWEHEPTIEADDMFFSIKQARNGGITERL
FT                   IGSLISATDVEDGDIAFGDNEINYLKVKNFDDRKIESARDKDIIEIVLEAKDSYGNITQ
FT                   KTISITFTDTKVKERTKAFGKIRFISEKYYGKNKAGGLMENSRWLNDPEFNSLLREALA
FT                   I"
FT   CDS             complement(821339..821500)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92873"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM38"
FT                   /protein_id="CBK92873.1"
FT                   /translation="MTDVFIRQKNEIPNYNEALAESYGFYNFTGLYTKGEYDEYGYLIC
FT                   YMWGVGIF"
FT   CDS             complement(821469..822221)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92874"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM39"
FT                   /protein_id="CBK92874.1"
FT                   /translation="MKNEKQYRLLFIIPAVIIAIILIICIAVAVSSKSGEKGKKKDSRS
FT                   VSVTENTQDIVAESETLELVKKDALKETNVVEKDNKQNNSTQSDTNDNSAPAADNSDNA
FT                   NTASDKSSDKSSEDKTAADKKTSTGSKNTSTDSNNTQQPAGDDSKPAASNQTVAPEPAQ
FT                   SEPAQPEAPKKEYVAPGWIFYGSKAGNGMSGEQKAYIDSLVKQWTDGSISDSYLAEQIA
FT                   HKMKEEWGLSLNSVGISGDDRCIYPSKK"
FT   CDS             complement(822223..822687)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92875"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM40"
FT                   /protein_id="CBK92875.1"
FT                   /translation="MKEIMQTYGAMIVAVVVGIALLSGFGALKNKMSVAFAPQDILSSD
FT                   SANDGYDSMKNIPVPGIELKEKMRQNAVSYSVYDLLDVTAHEDNLDKLEVYALYDSGRN
FT                   DCTGSISADGSSLSFPDYGVYDMHVRITCKNGTRDHVRISIPINRKVADI"
FT   CDS             complement(822706..822852)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92876"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM41"
FT                   /protein_id="CBK92876.1"
FT                   /translation="MKEVFRQYGGVLIAAAATSAFLVLMGNIVLAQGGMLAQLINIWGN
FT                   SAI"
FT   CDS             complement(822895..822993)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92877"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM42"
FT                   /protein_id="CBK92877.1"
FT                   /translation="MELLIEELGGSVIMLLLGSGVIGVLVYVSTLL"
FT   CDS             complement(823036..823368)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92878"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM43"
FT                   /protein_id="CBK92878.1"
FT                   /translation="MFMVVTSSGVLSGFMTVVEAQNLHAQIINELEDSDYDSSVAQTCF
FT                   ENASKAGDTLELKLYMTDNSIRTVTDASQITSSDEIEKARVELKFTYAVAFFGIEQEHV
FT                   LSGYAL"
FT   CDS             complement(823421..824806)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92879"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM44"
FT                   /protein_id="CBK92879.1"
FT                   /translation="MTYILIFFLTYVLHLLLKLNWVCTAVVLVFLLVMQHFHRIKGQRF
FT                   QEARKRFLDVSLYIDTLLYSFLKEQKIIRAFEDVKSTLADGHMKETVSRAIDHMMLTFD
FT                   ETEVFVDAMRIIEDEYKCNRIVNAHEFMAHAEYYGGDIKESARILLKDKSAWERRILRN
FT                   IEDRQRMFHQIILSVVTSVIISGIILYLPVLSMDISSNIIVQILSAALIVFDDLIILWG
FT                   QKFLEVDYLGIDLLPEDDKHAKKLEEYKAYNPAKELRASILMAVIPALASAFLLYTDRQ
FT                   WPAVAAMGAALICLNQHRIGHRLMKKNLIADVKSAFPKWLMDLALLIQSENVQVAIQKS
FT                   REHIPVILKEEVNTLVERLDVEPESSDPYHRFLDCLNLPEINAAMGMLYAVSIGNSGNC
FT                   GSQIDELITKNLEMLDVADTARLKDKTAGMYLLFLAPVITASFKMIVDMAIFLISFLSY
FT                   KVV"
FT   CDS             complement(824809..825897)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08250"
FT                   /product="Flp pilus assembly protein, ATPase CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92880"
FT                   /db_xref="GOA:D4JM45"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM45"
FT                   /protein_id="CBK92880.1"
FT                   /translation="MELGKEYFGPLWSFVASNEITDIDYNGKEIWLTNIFNERFRANQQ
FT                   FVTQYMTPAFVEQFTQRIANVVSRQFNKRNPELEAETSELRVTILHESVAKSGRSISIR
FT                   KTPPLIRLTAESAIAEKFCSEELLAVLINCVKTKMNITFCGMPGIGKTECVKFFSQFIP
FT                   ANERVITIEDTLEIRYAETNPGKDCIEMKVSEDVFGYSEAIKSCLRMNPKWIMLSEARS
FT                   KEVKYLLQSWSTGVRGMTTLHTDDVRNIPDRILNMLESRVDAERMENDIYQALDVGILI
FT                   RKRRNEDGVVYRYIDQVCFFYRENYTNHVFMLVSDGQIVTHDIPKVILRRFKREGVNEP
FT                   FGESFVNEIRMNEAMMSEEREA"
FT   CDS             complement(825908..826081)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92881"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM46"
FT                   /protein_id="CBK92881.1"
FT                   /translation="MKEIFQEYGGILITVVAILSIILVVTAVIGSDATGIVGKTFSDLI
FT                   TNFSNHANMSVK"
FT   CDS             complement(826480..827763)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08270"
FT                   /product="transcriptional regulator"
FT                   /function="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92882"
FT                   /db_xref="GOA:D4JM47"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024551"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM47"
FT                   /protein_id="CBK92882.1"
FT                   /translation="MKKYTEMTKDELMQEKTALEAEYEKIKNLGLSLDMSRGKPGADQL
FT                   DLSLPMLDVLKSDSDMKSESGLDVRNYACLDGIPEAKALIAGMVGAKPEQAIVYGNSSL
FT                   NIMYDQVSRAFIFGLCGNTPWCKLDKVKFLCPVPGYDRHFAITEEFGVEMINIPMTEDG
FT                   PDMDMVEKYVNNDASVKGIWCVPKYSNPQGVVYSDETVERFAKLKPAADDFRIFWDNAY
FT                   TVHHLYDDKQAEIPNILELCEKEGNPDMVFEFCSTSKVTFPGAGVAGICTSEKNREDIK
FT                   KRLTIQTIGHDKINQLRHARFFKDVDGIKAHMAKHAALIRPKFELVENILTDEIASRGI
FT                   GTWVKPLGGYFFGFEALSGCAKEIVAKCKEAGVTMTGAGSPFPYKKDPDDSVIRIAPTY
FT                   PSLDELKKAAEVFVVVTRLVSVNKLLEA"
FT   CDS             complement(827847..829175)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08280"
FT                   /product="ATPase related to the helicase subunit of the
FT                   Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92883"
FT                   /db_xref="GOA:D4JM48"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM48"
FT                   /protein_id="CBK92883.1"
FT                   /translation="MDLFDYMREQNKETSGPLASRMRPTTLDEVVGQQHIVGKDKLLYR
FT                   AIKADKLSSIIFYGPPGTGKTTLAKVIAHTTSAEFMQINATSAGKKDMEEVVEQAKNNQ
FT                   GMYQKKTILFIDEIHRFNKGQQDYLLPFVEDGTIILIGATTENPYFEVNGALLSRSVIF
FT                   ELKKLSTDDIKVLLKRALTDTEKGMGAYNAQIDDDALDFLADVSNGDARAALTAIELGV
FT                   LTTDRSDDGIIHITIDVASECIQKRVISYDKKGDNHYDTISAFIKSMRGSDPDAAVYYL
FT                   ARMLYAGEDVKFIARRIMILASEDIGNADPMAMVVAASAAAEVERVGMPEAQIILSQAV
FT                   TYMACAPKSNASYNAISAAMSCVKQTKTPAVPAHLQDAHYGAAEKLGHGVGYKYAHDYP
FT                   NHYVKQQYLPDGLTDRVFYKPTDIGYEAKIKAHMDELHRDCDT"
FT   CDS             complement(829391..830857)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08290"
FT                   /product="xylulokinase"
FT                   /function="xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92884"
FT                   /db_xref="GOA:D4JM49"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM49"
FT                   /protein_id="CBK92884.1"
FT                   /translation="MLYIGVDLGTSAVKLLLMDESGKVLNIVSKEYPISFPKPGWSEQN
FT                   PCDWWEQTVAGLIELTKDFDRSAVAGISFGGQMHGLVVLDENDNVIRPAILWNDGRTQK
FT                   ETDYLNNVIGKEKLSELTGNIAFAGFTAPKILWLKANEPENFARIKKLMLPKDYIAYRM
FT                   TGVFSTDYSDASGMLLLDVKNKCWSKEMLDICDVREEWLPGLYESSEKTGTLKADVACE
FT                   LGFPKDCIVAAGAGDNAAAAIGTGTVGAGKCNLSLGTSGTLFITSDEFRVDSHNALHSF
FT                   DHADGGYHLMGCMLSAASCNNWWMKDILHSDDFVNEQKPLEEDGRLGENHVYFLPYLMG
FT                   ERSPHNDPSARAAFIGMSMDTDRADMLQAVFEGVAYGLRDSLEVAKSLGVAPKSTTICG
FT                   GGAKSVLWRKIVANVMNMQVDTVEVEEGPAYGGAILAAVANGCFENVEAAAAAIVRKKD
FT                   TTMPSPQLVEKYEKGYAKFKQFYPALKGKY"
FT   CDS             complement(830916..832400)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08300"
FT                   /product="L-fucose isomerase and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92885"
FT                   /db_xref="GOA:D4JM50"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM50"
FT                   /protein_id="CBK92885.1"
FT                   /translation="MNNIPKMKIGIVAVSRDCFPESLSVNRRKALVDAYAAKYDAADIY
FT                   ECPVCIVESEIHMVQALEDIKAAGCNALCVYLGNFGPEISETLLAKHFDGPKMFVAAAE
FT                   ETQENLIQGRGDAYCGMLNASYNLALRNIGAYIPEYPVGDADDCADMIHEFLPIARAIY
FT                   GLNNLKIISFGPRPLNFLACNAPIKQLYNVGVEIEENSELDLFEAFNKHAGDERIPDVV
FT                   KDMERELGEGNKKPEILEKLAQYELTLLDWVDEHKGYRKYVAIAGKCWPAFQTQFGFVP
FT                   CYVNSRLTGRGIPVSCEVDIYGVLSEFIGTCVSEDAVTLLDINNSVPKDMYKESIEGRF
FT                   DYKHTDTFMGFHCGNTCSSKVCNPQMKYQMIMARSLPIEVTNGTLEGDIVPGDITFYRL
FT                   QSTADCKIRAYVAQGEVLPVATRSFGSIGVFAIKEMGRFYRHVLIEKNYPHHGAVAFGH
FT                   YGKALFEVFKYIGVPVEDINYNQPASLPYKTENPFC"
FT   CDS             832599..833657
FT                   /transl_table=11
FT                   /locus_tag="ERE_08310"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92886"
FT                   /db_xref="GOA:D4JM51"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM51"
FT                   /protein_id="CBK92886.1"
FT                   /translation="MSITAKELAKQLNLSEAAISMALNNKPGVSTLTRKRVLEAAASAG
FT                   YDFSRISNTNEAPASNGTLYFVIYRKNGAVVPNSPVYTHTEHGVLVQDVPFFSQLSEGI
FT                   DLGCRHCHYYLNISYIYENDDIEALLSEWKRLGAKGILLLGTEMEEHDIKPFTRCGLPV
FT                   VLIDNYFEALNLDCVTINNLQGAYLATDYLIKQTHAQPGYLHSAYSITGFEERADGFYK
FT                   AIRKNGMSTSRSVVHHLSPSVDGAYCDMKAVIKSGDELVRCYFADNDLIAAGAMRALSE
FT                   EGYRIPEDISVIGFDDMPMCTYITPPLSTVHVPKQYMGEIAVKRLAEIINSTSASHVKI
FT                   EISTEIIKRKSC"
FT   CDS             complement(833673..836273)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08320"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92887"
FT                   /db_xref="GOA:D4JM52"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM52"
FT                   /protein_id="CBK92887.1"
FT                   /translation="MNIQKFTQKSIEAVNDCEKLAYDYGNQEIEQEHLLVALLSQEDGL
FT                   IPKLIDKMEINVEHFTENAKRHLAARTKVSGSSAQVYVGNDLNKVLIHAEDEAKAMGDE
FT                   YVSVEHLFLCLLKYPNKAMKELIKEYGLTRDRFLTALSTVRGNQKVTSDNPEATYDTLE
FT                   KYGYDMVERARQQKLDPVIGRDDEIRNVVRILSRKTKNNPVLIGEPGVGKTAVVEGLAQ
FT                   RIVKGDVPEGLKDKKLFALDMGSLIAGAKYRGEFEERLKAVLEEVKASDGQIILFIDEL
FT                   HTIVGAGKTDGAMDAGQLLKPMLARGELHCVGATTLDEYREYIEKDAALERRFQPVMVD
FT                   EPTVEDTISILRGLKDRYEVFHGVKITDSALVTAAVLSNRYITDRFLPDKAIDLVDEAC
FT                   AMIKTELDSMPAELDEQNRKIMQLEIEETALKKETDHLSQDRLAALQKELAELRDDFNA
FT                   KKAQWQNEKGAVDKVSKLREKIESTKNEIKTAQQNYDLEKAAELQYGVLPNLQKELESE
FT                   EALLKDRDLSLVRENVGDEEIALIISRWTGIPVAKLTESERNKTLHLDEELHKRVIGQD
FT                   DGVTKVTEAIIRSKAGIKDPTKPIGSFMFLGPTGVGKTELAKALAASLFDDENNMVRLD
FT                   MSEYMEKYSVSRLIGAPPGYVGYDEGGQLTEAVRRKPYSVVLFDEVEKAHPDVFNVLLQ
FT                   VLDDGRITDSQGRTVDFKNTIIIMTSNLGSQELLEGIEADGSISTECENRVMDELKGHF
FT                   RPEFLNRLDEIIMFKPLTKDNIGHIITLLMADLNKRLVDKEITVELTDTAKQFITDNGY
FT                   DPVYGARPLKRYLQKHVETLAAKLILADGVRAGDTILIDVKDGKLSASAVQKNA"
FT   CDS             complement(836505..837167)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08330"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92888"
FT                   /db_xref="GOA:D4JM53"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM53"
FT                   /protein_id="CBK92888.1"
FT                   /translation="MDDTQIEMLPMLGEFSSIASQYEHIMFYYESGIQQIVAKLQILNN
FT                   EFKNNHERNPIENIKSRVKSLDSIIDKMKRKGIPLTTNAMKREIKDIAGVRVICPFISD
FT                   VYQVANMLVNQADVEIVTIKDYIKKPKENGYRSLHMIVLVDVYFSDHKDKVPIEIQFRT
FT                   IAMNFWASTEHQLRYKKSRIFTEEMQQELKKCADIMADADDKMQNLANVSGIVQPIE"
FT   CDS             complement(838242..838694)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08360"
FT                   /product="Phosphatidylserine decarboxylase."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92889"
FT                   /db_xref="GOA:D4JM54"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM54"
FT                   /protein_id="CBK92889.1"
FT                   /translation="MAKKSFVDWLYTTAPGRVTLKVLLHTGALKLGEIVARSPLSKPFI
FT                   SRYIKNNNIDMSDFKGQKYNSFQDFFSRKRDDIEVDRQAEHLISPCDGYLSAYRIKSNN
FT                   SFHIKGSWYKVTDLVTDKKIAKEICWRRLRDTASLCQRLSSLLLYR"
FT   CDS             complement(838694..839395)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08370"
FT                   /product="Phosphatidylserine synthase"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92890"
FT                   /db_xref="GOA:D4JM55"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM55"
FT                   /protein_id="CBK92890.1"
FT                   /translation="MNNMNINSAIADTLDIGNTDTEKKTGLIGFYNYTVVLTYIGMWIG
FT                   FLGVMLAIKDRYVGSLICLMLAGVCDMFDGTIASTKKDRTRDERTFGIQIDSLSDIICF
FT                   GVLPAVWVFCVTPKISIAFTAIFVFILCGLIRLAYFNVDEANRQAATAERRQYYLGLPI
FT                   TSSALAIPAVYLIGEFTAIHTQTIAALALLIIGICYVLPVKLKKPSLFGEVLLVGIGAV
FT                   EFCILIAEVLI"
FT   CDS             complement(839610..840104)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08380"
FT                   /product="Transcriptional regulators, similar to M. xanthus
FT                   CarD"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92891"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM56"
FT                   /protein_id="CBK92891.1"
FT                   /translation="MFEIGDYVLNATNGICKISEIVELDMSGDKQLKSYFLLRPVEEEN
FT                   DRVYIPVDNADKRIRKVITQDEALAVLDRVPEIEALAVNNEKERETRYKEAVRSCEPDS
FT                   VISLLKCLHIRNEQRAQAGKKSTAVDERYGKMAEHNLNAELAFVLEKDRQEIKDIIHDM
FT                   L"
FT   CDS             complement(840232..841227)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92892"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM57"
FT                   /protein_id="CBK92892.1"
FT                   /translation="MEFYDEKIKALAIEIYELDAEVYKKLGSSLGRVFGGEKDICIRNI
FT                   MEDLHSRQNSSRIRSELALISNMARTIPDHDTRHDIMVKYNNIVEEIAELPTGFADGDI
FT                   LDPKIADLNTVNLKDRFKTGDHLIICIGRSCGCGGNEIGFALADKLRMNFYDVSVMNEV
FT                   FRQKDGEEAAQATATFQKKERMGIKKRIKAFRKYHGLSSEDVLFFDTSKFLVEKAKQED
FT                   FIVMGRFADAILTNNHIPHISIFITAPEKRRVQRFLEINKNVTPNQAKKWIESEDKRHL
FT                   KTYKFYTGRKWSKASNYDICINSASYGIKGSIELIIRMLQLDDRVKQLIE"
FT   CDS             complement(841240..842589)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08400"
FT                   /product="transporter, UIT6 family (TC 9.B.53)"
FT                   /function="transporter, UIT6 family (TC 9.B.53)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92893"
FT                   /db_xref="GOA:D4JM58"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM58"
FT                   /protein_id="CBK92893.1"
FT                   /translation="MSNTLLMLCIPFAGLLLCIAVMPLVKPEWWEKHQAHAVILWSLLF
FT                   AIPFALFYGAPKAVETVLECLIGDYLTFIVLLFGLFCVAGNIKLEGSLVGNPKVNVIML
FT                   AVGTFFSSCIGTTGASMLFVRPIIQMNSWRKNKRHIMVFFIFLVSNIGGCLTPIGDPPL
FT                   LMGFSRGVSFFWSMRLFPVLVLNMILLLTIFYHLDKKAYQKDITKGLMPEVKENEPLIR
FT                   IKGAHNFLYIVMIVIAVILSGVLPKLSAFQNAAGEVIGIPIFREVTLTVPAIIEIAIIL
FT                   LAALLSFKTTPKEVRVQNHFTWGAIQEVAVLFIGIFITMQPALMVLKSAGSGLGITKPF
FT                   EMFWATGALSSFLDNTPTYLVFLTTAGAMHFTTGVATTLGVVPVKMLMAISCGAVFMGA
FT                   NTYIGNAPNFMVKSLSDENGINMPSFFGYMWWSLRYLIPVFIIDMIIFFL"
FT   CDS             complement(842738..843517)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08410"
FT                   /product="Predicted hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92894"
FT                   /db_xref="GOA:D4JM59"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM59"
FT                   /protein_id="CBK92894.1"
FT                   /translation="MKLPLTYDNYIFDLYGTLVDIHTDESDTAIWEKLAMFYGYYGALY
FT                   EAKELKERYETLVKSSEAELKKKIENMDIEKQNEAKDAQFAISYAHEASPEIHIEDVFE
FT                   KLYEEKNVNPTKELSVHTGQFFRVMSTEYIKLYPGTKEMLKELKKAGKNVYLLSNAQRI
FT                   FTAYEMRRLDIFDLFDDVFISSDYNTKKPDIRFYKELINKHDIDVSKSLFIGNDSTTDI
FT                   KGAKECRMDAFYVKSNISPKDDMAHDADYIIDNFTNW"
FT   CDS             complement(844222..844896)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08420"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92895"
FT                   /db_xref="GOA:D4JM60"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM60"
FT                   /protein_id="CBK92895.1"
FT                   /translation="MKSDKISRLVTENINLIYLVMKRFRNRGVDREDLFQIGAVGLTKA
FT                   AQRFDESKGFAFSTYAVPLIIGEIQRFLRDDGMVHISRKILDDARKIAIIREKYRMNEN
FT                   SEISLEKMENISGMSKQDIIIAMEADKNASSIENESVLDYLDNKMSAEASDKPSETDKV
FT                   INHIAMQQAFNSLDDSERRLIMLRYMQDKTQKQVAEVLGRNQVAISRMEKNTLAKLRRA
FT                   MM"
FT   CDS             complement(844893..845372)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08430"
FT                   /product="anti-sigma F factor"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92896"
FT                   /db_xref="GOA:D4JM61"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010194"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM61"
FT                   /protein_id="CBK92896.1"
FT                   /translation="MNAAKTNHISLSFDAISENEAFARMTAAMFMAQLNPTLDDVEDVK
FT                   TAVSEAVTNAIIHGYEMGDDNISSGQADHQAAEEKSCPQVHMNCSYIGRELYIEISDSG
FT                   VGIQDVAKAMEPLYTSKPQLDRSGMGFSFMEAFMDALTVTSEPGHGTTVKMKKVL"
FT   CDS             complement(845416..845724)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08440"
FT                   /product="Anti-anti-sigma regulatory factor (antagonist of
FT                   anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92897"
FT                   /db_xref="GOA:D4JM62"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM62"
FT                   /protein_id="CBK92897.1"
FT                   /translation="MIENYIKEADRVTYLMPKEVDHHCAGQIIAELDALIEGCGVRKIV
FT                   FDMKQTEFMDSSGIGVIIGRTKKLKYFNDSSVSVCNMSDRVDKLLKCAGIYTIIHKL"
FT   CDS             complement(845826..847193)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92898"
FT                   /db_xref="GOA:D4JM63"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM63"
FT                   /protein_id="CBK92898.1"
FT                   /translation="MICYKCGQDAGWNDKCPVCGADLSLFKRAIRISNSYYNDGLQKAQ
FT                   VRNLSGAIISLRQSLKFYKYNIQARNLLGLIYYEMGEMVDALSEWVISANYQPDDNLAK
FT                   KYIDQIHNNRNQLETINQTIKKYNQALTYCKQDSKDLAVIQLRKVLSLNPKLVKGHQLL
FT                   ALLYLEEGHLDKAKKALRDAGKIDTDNTTTLRYLKEVNRRLKEKGTERKKKNDDLISYQ
FT                   SGNETIIMPKRFRESSMWANILYIIIGLVVGVAVTCFLVVPGIKSQAKTDAKKQLLSAN
FT                   DTISTNGQTISGLNDQIDKLKKELEDEKKKNDGVSDQISTYEALLNAYVYYTTNDVIKA
FT                   GEALENINTSYLSDSAKQTYDTLNGSIADSYKEALYSQAYSSYSSGDYQSAIPIFQKLV
FT                   GMDEAYRDGSAAYYLAQSFRKSGDLASAKPYYQYVVDNYAGTEKARTSKNYLAQEQ"
FT   CDS             complement(847190..847345)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92899"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM64"
FT                   /protein_id="CBK92899.1"
FT                   /translation="MINFDEEIKNYEPSLEIEEAESAIYSHDLTDVTDIIAQLLREQDK
FT                   RQGELR"
FT   CDS             complement(847471..848859)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08470"
FT                   /product="Predicted polymerase, most proteins contain PALM
FT                   domain, HD hydrolase domain and Zn-ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92900"
FT                   /db_xref="GOA:D4JM65"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM65"
FT                   /protein_id="CBK92900.1"
FT                   /translation="MDDTGIKREPVIRISNDRMEAFIMLPTVEEEYHYTVDEVLEAVNR
FT                   NGVIYGINCETISDMVEKRLMGREVLFAKGKPAVDGADGYFDFYFDSDLNHRPTVKSDG
FT                   SVDYWSVHSVEVVKKGQTIANYCEPVAGEDGIDVLGRVITAKKGKGLPPLVGRGFDKSV
FT                   DGLTYTAAIDGKIERHKNRIIILPILEINGDVDVGTGNIDFVGDVVIHGSVKTGARIRA
FT                   AKSITIDGVCEGCVLEAGNDLILRNGMIGMGKARIIVKGNLFAKFMEYTDVEVDGFVEA
FT                   DSAINCNVVSNDKVIFNGGHASIVGGKVYGCAGIEVQNLGNDAFIKTEVHVGVHKKIKI
FT                   KIAELEKLVDQKQMLLNNINAGIKQIEQMMGSAADGMNLEEKKLALVRAKIEKTAELTE
FT                   DKEELERLKGIVERSTGATVQVLEHVYPNVEVCINNSKLVTKEEFDKIEFKEKDKAVVM
FT                   LSMK"
FT   CDS             complement(849113..850609)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08480"
FT                   /product="Beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92901"
FT                   /db_xref="GOA:D4JM66"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM66"
FT                   /protein_id="CBK92901.1"
FT                   /translation="MNVNPITRLDYPDPDVIRVEDTYYMVSTTMHFMPGCEILQSFDLV
FT                   HWEHVTYVYETLDHTDAQQLKSGQNIYGQGMWAASLRYHEGRFYICFVANDTRKTYLYT
FT                   SEKIDGPWKKQLIEGFYHDASLLFDEDGRNYIVYGNDEIWITELNEDLTAPKKDGLHRL
FT                   LVSDHKNPELGYEGSHIQKINGYYYIFLVHSLRDRWMRTEACFYSDSLEGEFTGGDVLC
FT                   DDRGYCGQGVAQGGIVDTPDGKWYAMLFQDSGAVGRIPILLPVTWKDHFPVFGQNGHVP
FT                   EEIEVHSTRPGYIYQPLVGSDDFCNGLLPRWQFNHDPDPRYYHLDALQGTYTITTREVC
FT                   TELTQAVNTLTQRMSYPSCAAEVTVDASALKEGDVAGLCALQGCYAAVGITKHHGKYEV
FT                   LMLDKKEDGILDMTEGTVVESHQMDFRLEADFCNMKDEARCYYRVNKGDWLPIGTVHKL
FT                   YFKLDHFTGCRFGLFCYAAEKTGGSACFRDFKYYDVDEIS"
FT   CDS             complement(850744..853392)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08490"
FT                   /product="valyl-tRNA synthetase"
FT                   /function="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92902"
FT                   /db_xref="GOA:D4JM67"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM67"
FT                   /protein_id="CBK92902.1"
FT                   /translation="MSKELNKTYDPKDIEDRLYKKWEDNGYFHAEVDRSKKPFTIVMPP
FT                   PNITGQLHMGHALDNTMQDILIRYKRMQGYNALWQPGTDHASIATEVKVIQALKEQGIN
FT                   KADLTREEFLEKCWDWRKEYGGRIVKQLRKLGSSADWQRERFTMDEGCSHAVQEVFTKL
FT                   YKKGWIYKGSRIVNWCPVCKTSISDAEVEHEEQDGFFWHINYPVVGEEGRFVEIATTRP
FT                   ETLFGDTAVAVNPDDERYQDIIGKTLKLPCTDREIPVIADSYVDKEFGTGCVKITPAHD
FT                   PNDFEVGKRHSLEEIVVINDDATMNEKAGKYAGMDRYECRKALVEDLKEQGLLVKVVPH
FT                   SHNVGVHDRCHTTVEPMIKQQWFVKMDEMIKPAVEGVKNGEIKLLPSRMDKTYFNWTDN
FT                   IRDWCISRQLWWGHRIPAWYCDDCGEMVVSIEKPGKCPKCGKEHWTQDPDTLDTWFSSA
FT                   LWPFSTLGWPEKTEDLDYFYPNDVLVTGYDIIFFWVIRMIFSGYEQMGKAPFHTVLFHG
FT                   LVRDSQGRKMSKSLGNGIDPLEVIDKYGADALRLTLITGNAPGNDMRFYWERVEASRNF
FT                   ANKVWNASRFIMMNLEGVELREPKLDELHAADKWILSRVNTLAKDATENMDKFELGIAV
FT                   QKVYDFIWDEFCDWYIEIAKVRTYKKDENPESANAALWTLKTVLVNALKLLHPYMPFIT
FT                   EEIFCTLQSDEETIMLSKWPEYKEEWNFPAEEAAIEHCKDLVKGIRNVRTQMDVPPSRK
FT                   AKLFITSDDEAVRKVFEDNKEVYVNLAFTSEIAVQQGKAGIGDDAVSVVIPDAVAYLPL
FT                   EDLVDFEKEKERLNKEKDKLTKELARSRGMLSNEKFLNNAKPEKVQEEKDKLAKYEQMM
FT                   AQVEERLAQFK"
FT   CDS             complement(854186..854446)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08500"
FT                   /product="toxin-antitoxin system, toxin component, Txe/YoeB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92903"
FT                   /db_xref="GOA:D4JM68"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM68"
FT                   /protein_id="CBK92903.1"
FT                   /translation="MRLLWEDRAWSDYLYWQTQDKKTLKRINGLIKDIQRSTFEGIGKP
FT                   EPLKENLSGMWSRRIDDTNRIVYYEKDEIIYIVSCKGHYDD"
FT   CDS             complement(854446..854712)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08510"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92904"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM69"
FT                   /protein_id="CBK92904.1"
FT                   /translation="MSQSVNVNFKLDADVKKSMEQVCSELGLSMSAAFTVFAKKVGREK
FT                   RIPFEVSVDPFYSDSNIRYLENIVRDIKDGKAHFAEHDLIEED"
FT   CDS             complement(854787..855149)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08520"
FT                   /product="Uncharacterized protein with conserved CXXC
FT                   pairs"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92905"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM70"
FT                   /protein_id="CBK92905.1"
FT                   /translation="MEERNLTCIGCPLGCALKVTIDGENVTVTGNTCKRGADYGAKEVT
FT                   HPMRIVTSTVCVKNGTIPMVSVKTAQDIPKEKIMDVMECINQITVEAPVHIGDVLLSDV
FT                   AATGVDIVATKNVEYK"
FT   CDS             complement(855154..856485)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08530"
FT                   /product="Thioredoxin reductase"
FT                   /EC_number="1.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92906"
FT                   /db_xref="GOA:D4JM71"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM71"
FT                   /protein_id="CBK92906.1"
FT                   /translation="MEFYDIVIVGGGPAGLAAAASAKKNGIDKILILERDCELGGILNQ
FT                   CIHNGFGLHTFKEELTGPEYAGRFIKEVKELGIEYRLNTMVMDISTGDEFENGADDRHD
FT                   VKIKDEANDKIVTAMNRTDGLFHIAAKTVILAMGCRERARGALNIPGYRPAGIFSAGTA
FT                   QRLVNIEGYMPGRKVVILGSGDIGLIMARRMTLEGAKVQVVAELMPYSGGLKRNIVQCL
FT                   DDFGIPLKLSHTVVDIKGRERVEGITLAQVDEHNKPIEGTEEFYECDTLLLSCGLIPEN
FT                   EISKTAGVELNPVTSGPVVNESLETNVPGVFACGNVLHVHDLVDYVSEEATAAGRHAAE
FT                   YVKNGGDKSCDGKEISITATGGVRYTVPSTINTAQMDDTVTVRFRVGAVYKNCYIAVYL
FT                   DDKQLQHRKRPVMAPGEMEQVVLKKKELIETDNPRTITIKIEEA"
FT   CDS             complement(856559..857995)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08540"
FT                   /product="Predicted dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92907"
FT                   /db_xref="GOA:D4JM72"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM72"
FT                   /protein_id="CBK92907.1"
FT                   /translation="MYDVVIIGAGVSGSACARELSKYNLSICVVEKEEDVCCGTSKANS
FT                   AIVHSGIDCKTGTLMAQMNIRGNEMMDELSKQLDFEFRRNGSLIVCFSDDDMPRLKELY
FT                   NQGIANGVPGLEILDSKKAHEMEQNLSDEVVAAIYCPTGGIVCPFGMNIAFAENAAANG
FT                   VEFLFNTEVKEIQKEQAGYILITQNGEIHARCVVNAAGVYADVFHNMVSENKIHITPRR
FT                   GEYELLDRAAGGIVDKTIFQLPGKYGKGVLVTPTVHGNILIGPTADDHEDKDGTNTTRA
FT                   GLEHVVTSGTRSVPSLPMRQVITSFAGNRAHEDGHEFIIEELSDAPYFIDCAGIESPGL
FT                   SSAPAIGERVAAIVEGLFNPSKNADFIETRKGILNPKKISEDEYKKLIKEKPEYGNIIC
FT                   RCEMITEGEIMDAVNRPLGAKSLDGVKRRTRAGMGRCQAGFCSPRTMEIIAREKGISQL
FT                   DITKSGGKSKIVVGMSKNRG"
FT   CDS             complement(858077..859573)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08550"
FT                   /product="glycerol kinase"
FT                   /function="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92908"
FT                   /db_xref="GOA:D4JM73"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM73"
FT                   /protein_id="CBK92908.1"
FT                   /translation="MAKYIMALDAGTTSNRCILFNEKGEMCSVAQKEFTQFFPKPGWVE
FT                   HDAEEIWATQLEVAKEAMANIQATAADICAIGITNQRETTIVWDKNTGEPVYHAIVWQC
FT                   RRTAEYADSLKEKGLTETFRKKTGLVIDAYFSATKLKWLLDNVPGARERAERGELLFGT
FT                   VETWLIWKLTQGQVHVTDYSNASRTMMFNINTLKWDDEILKELDIPKSMLPKPMPSSCV
FT                   YGEVNPVFFGGPIPIAGAAGDQQAALFGQTCFRAGEAKNTYGTGCFLLMNTGEMPVSSK
FT                   NGLVTTIAWGIDGKVVYALEGSIFVAGASIQWLRDEMKFIDSSTDSEYMARKVKDTNGC
FT                   YVVPAFTGLGAPYWDQYARGTIVGLTRGVNKYHVIRATLESMAFQVNDVLEAMKADSGI
FT                   NLTSLKVDGGASANNLLMQMQADISNAPVNRPVCVETTAMGAAYLAGLAVGYWESMDDI
FT                   KRNWSIDRVFEPEIAADLREKKLKMWKKAVACAFNWAKDE"
FT   CDS             complement(859624..863391)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08560"
FT                   /product="Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92909"
FT                   /db_xref="GOA:D4JM74"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM74"
FT                   /protein_id="CBK92909.1"
FT                   /translation="MISRYSVKKPFTVLVGVLLVIVLGVVSLGRMTTDLLPDMSFQYAL
FT                   IVTTDMGASPQEVESDVTAPLEAAMATTSNIKNVSSMSYNSYSLVTCEYEQNANMDSVV
FT                   IEMQQKIDQVKAGWKDGVGTPTIMKINPDMLPIMMTAVDMDGKSKSEITDFVENTLKPA
FT                   IESTEGVASVTATGELTEQIQVTMNQAKIDALNEKINNAVSKKFDDAKSQMDDASAKIE
FT                   SGQNAITSASDQMSAGVDTLKEQKAKLAEQKTQLESTLSSLNEQKSQLETIQSALSDFM
FT                   NSDTYTKTIPSLKEGANAPGEAGIALKAQLEQVDKQIATQFSGLSALGITVNTADDLPA
FT                   AASAIAQTLIQVNTGIEQCQSGLDQIAQGETALLDAYDNLNSQAAISSISIGQQSAQLA
FT                   TAAASLDSSKKELEKSKDDALDKSNLNAVLTIDSLSQLLVAQNFDMPAGYVNDSNGTQY
FT                   IVQVGDEIKSIDDLTNLVLMDMKLDGIAPIHVGDVADVEMTDNSDETYAIVNGNPGIML
FT                   SMEKQTGYSTGDVTDRLLDKLNSLEKENDGLHTTVLMNQGVYIDMVVKSVMQNMIVGAI
FT                   LAIFVLLLFLKDIKPTLVIAASIPLSVIVAVVLMYFTDITLNIISMSGLVLGIGMLVDN
FT                   SIVVIENIYRLRGEGYSVKKAAVEGANQVAGAIFASTLTTVSVYAPIIFTDGITRQLFV
FT                   DLALTVAFTLMASLVVALTFVPAIASGMLKKTKDIKHPWFDRFKDWYGNVLGTCLRFKP
FT                   VVFIAAVVLLVGSGALCMSRGMTFMDMDMESNQISLTIEAKDDEKLDFKQLTELSDKVM
FT                   DKISDIKGIDTIGATAGGSSTMNLMSSGSDSVSMYILLDEKSDVSSDKVIDEIEKRTKN
FT                   LDCKVTASSQAMDSSEFFGSGLSVRIKGNDIDKLQKLAGDVADILKDTKGVTDIDDGLG
FT                   DTINELKITVDKEKAAKYGYTVAQVYQLVSGEISSQKSATTITTDIKDYEVYLQSAEQS
FT                   DVTVDDIKNLTFTYKDNDGSEKEIPLSDICTISQEQTLSTIHRDAQTRYITVSGAVDEN
FT                   HNVTLLSDKIKSKIDKLSIPDGYSIDMEGEDETINESMSQLVLMLVLAVIFIYLIMVAQ
FT                   FQSLLSPFIIMFCIPLAFTGGFIALFITGNELGIISMLGFIMLAGLIVNNGIVLIDYIN
FT                   QARREGMSKHEAIIDAGRTRLRPILMTAMTTILAMFTSAIGIGDGSDMIKPMAIAIIGG
FT                   LVYGTILTLIVIPCIYDAFNREKSMVEEEL"
FT   CDS             complement(863635..863781)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92910"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM75"
FT                   /protein_id="CBK92910.1"
FT                   /translation="MTDTGFLVAFFIVIFLVIIFALVAVIGAVTSAVAGINDDEDETEE
FT                   EGI"
FT   CDS             complement(863919..864770)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08580"
FT                   /product="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92911"
FT                   /db_xref="GOA:D4JM76"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM76"
FT                   /protein_id="CBK92911.1"
FT                   /translation="MSEYRAYMQNTKLHNGTKRKKRRHRFLFGVLLSALLITGALYGRE
FT                   YDISQLKNIEVMETLSSAVSQFGDRKLPVYSVQTTEKKIALSFDCAWGAEDFDSMMETL
FT                   DKHNVKATFFMTGGFVSDNPECVKTLVEKGHEPGNHSEHHYDMATITAGEMKTEIMDVH
FT                   KKVKELTGKDMKVFRPPYGSYNNELIDTVYGCDYYPIQWDVDSLDWKNYGVQNIIDTVC
FT                   NHKSLDCGSIILCHLGAKYTSQALDEMLTKLQDMGYEIVPVSKLIMTEGYHMDANGMQI
FT                   KD"
FT   CDS             complement(864819..865514)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08590"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92912"
FT                   /db_xref="GOA:D4JM77"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM77"
FT                   /protein_id="CBK92912.1"
FT                   /translation="MTIGVIGAMQMEVDDLKAQMTDTQTEVYSGVEFVEGKIGDQYVVA
FT                   AKCGIGKVFAAICAEAMILKYDVDMIVNIGVAGTLTKDLNVLDVAVATNVLQHDMDTSP
FT                   IGDPKGLLSGINMILLPADTKMVELMCSCLADRNIHYKKGNIATGDQFIATKEQKDYIS
FT                   NTFDAIAAEMEGGSIGHVCYVNNVPFAILRSISDGDGGETDYQTFAEKAAHQSIEVVLE
FT                   FIGRAEELK"
FT   CDS             complement(865533..865991)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08600"
FT                   /product="LuxS protein involved in autoinducer AI2
FT                   synthesis"
FT                   /EC_number="4.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92913"
FT                   /db_xref="GOA:D4JM78"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM78"
FT                   /protein_id="CBK92913.1"
FT                   /translation="MERIKSFTINHNILKPGFYISRKDGEIVTYDLRTRKPNAGDYMSN
FT                   SAMHSVEHMFATCVRNSEIADDVVYFGPMGCQTGFYLVVRDVEPGKVFEITKEVLKQIL
FT                   EYDGPVFGASAIECGHYENLSLDEAKKECRAYLNVLESQTNMEFTYPQ"
FT   CDS             complement(866006..867811)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08610"
FT                   /product="oligopeptidase F. Metallo peptidase. MEROPS
FT                   family M03B"
FT                   /function="oligopeptidase F. Metallo peptidase. MEROPS
FT                   family M03B"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92914"
FT                   /db_xref="GOA:D4JM79"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM79"
FT                   /protein_id="CBK92914.1"
FT                   /translation="MSEKRLQKRDEISDEYKWKLEDMYETDELWEAECEKASQLAEKLS
FT                   GFKGHLADSAATLLDFFKKQDELSYYLERIVVYANERSHQDTAVSKYQAYVSKAETLTV
FT                   QASGALAFASPEILQIDDKRLESFYSESNELMHYKRAIDEIMRQKAHTLSAAEENILAQ
FT                   CGEMAAAPENIFSMFNNADIKFPYITDVEGNKIRITHGNFIDFLSSKDRSLRKQVFRGV
FT                   YDSYKKWSNTVSMMYISKLKNDTFYARVRKYDSARAMYLSGGDIPESVYDNLIETVHAH
FT                   LPALHRYMALRKKLLGVEHLHMYDLFAPIVDNVQTTYTYDEAKKLVAKALEPMGDEYVS
FT                   TLKAGMESGWIDVYENENKRSGAYSWGAYGTHPYVLLNYADNLDSVFTLAHEMGHAMHT
FT                   YYSNEHQSITYAGYLIFVAEVASTCNESLLMHYMLEHCEDENERKYLMTHFLDGFRTTL
FT                   FRQAQFAEFEHIAHRKMQKGEPVTKDVLNELWHELNVQYYGPDMRVDDEISYEWMRIPH
FT                   FYTPYYVYQYSTGYSAAVAFSKKILEEGKPAVDKYIGNFLCGGCSKNPIELLKSAGVDM
FT                   STPKPVDDALNVFEDYLKQFETATK"
FT   CDS             complement(867917..868849)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08620"
FT                   /product="Carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92915"
FT                   /db_xref="GOA:D4JM80"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM80"
FT                   /protein_id="CBK92915.1"
FT                   /translation="MKKKKIVIALGHDALGTTLPEQHEATKHTAKAVADFIRDDYEVVI
FT                   THSNGPQVGMIHTAMSEFCRIYPEYTATPTAVCSAMSQGYIGYDLQNAIRTELLGRGIY
FT                   KTVSTILTQVVVDPYDEAFYHPTKIIGRVMTEAEAEEEEKKGNHVTQVEGGYRRVVAAP
FT                   KPVDIVEKDAIRALVDADQVVIACGGGGIPVLAQDNKLQGASAVIEKDLAAGKLADTLD
FT                   ADRLVILTSVDKVCLNYGKEDEKPLDTMTVDEAKKYLAAGEFDEGTMAPKIEAAIDFIG
FT                   DSAIRSVLITKLNKEGKTVSGGMGTLITK"
FT   CDS             complement(869260..870870)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08630"
FT                   /product="Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92916"
FT                   /db_xref="GOA:D4JM81"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM81"
FT                   /protein_id="CBK92916.1"
FT                   /translation="MDNNYGNMNDTNNTNNTNSTNNNTNNVNFTMSGNPYNPDESQKAA
FT                   QTNNTSAESYSQSYNPYSQASAAGQPNTNQSYANQSYANQPYSNQSYNSGTNNNAYGGA
FT                   SAGSTDNSYSRMNMNGQAYQQAAKPKKQRAPRKPGAFGPFAAKTVAAALIFGLVGGGVF
FT                   TGVSYIGTRAISNSSTASAKLTTTTSGGTKQTSSGNAKDLTDVSSVVDEVMPSIVAITN
FT                   TGTVTYNSFFGKQSQQSQSCGSGIIVSEDDDYLYIATNNHVVADSEELTVQFDDDSVVK
FT                   AEIRGTDPDDDLAVVRVKKADLGKDTYSNIKIATIGDSESVAVGSPAIAIGNALGYGQS
FT                   VTTGIVSALNRTVTTQDSQTGETVTNNKLIQTDAAINPGNSGGALLNENGEVIGINSVK
FT                   YSSTEVEGIGYAIPMSVAKPIIESLIQDGKYTNENQAYLGIKGGDVSSEMVAYGFPQGV
FT                   YVSSVSAGSGAANAGLQEGDIITAVDSTKISSMTELQSALKSYKAGDKVTLTVARQSGR
FT                   QYEESKVEVTLSSAKDIQQ"
FT   CDS             complement(871112..872320)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08640"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92917"
FT                   /db_xref="GOA:D4JM82"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM82"
FT                   /protein_id="CBK92917.1"
FT                   /translation="MKPEIKEKITATNQKYLKKFLTEEVPAKLESQLEHMDWSYLDMIH
FT                   NKEQQRGTFSPLAAMELSEIEANKDKYLATGLDAVKNGKVGAILLAGGQGTRLGFDKAK
FT                   GMFNIGKTKELYIFEQLVANLMKVTNQTGTWVPLYVMTSEINDSMTREFFEEHDYFGYN
FT                   KDYVKFFVQEMVPAVDFDGNVLMKSEDSLAMSPNGNGGWFKSLINASLDKDLKDKGVEW
FT                   LNVFAVDNVLQQIADPVFVGATIESGCVSGSKVVRKCDPYERVGAMCLENGKPSIVEYY
FT                   ELTPEMAEAKNENGSLQYGFGVILNYLFRVDKLMTIAEKSLPLHVVEKKVPYIDENGTE
FT                   HKPETPNAYKFETLILDMVYMMDNSLPFEVDREKEFAPVKNATGTDSVETARALLEKNG
FT                   IEI"
FT   CDS             complement(872356..873573)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08650"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator common domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92918"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM83"
FT                   /protein_id="CBK92918.1"
FT                   /translation="MAKKRRRKKRRNGRKKIILFVFEILLLLIVLLVVWAYNKTLGQVK
FT                   YEDALTNSEAGINEDIDDDALANMHGYLNVALFGLDNRSNGSYDEGHSDCIMIASLNYD
FT                   TKEVQIVSVYRDTYLPIGNGKFAKANAAYANGGAKRAVAMLNSNLDLNITKYVCVDWKA
FT                   LVDAIDDIGGLDLEITKAEMKEINYLIPEVDYTTGYNTPYLEGDGMQHLDGTQATCYAR
FT                   IRSTSGDDFLRASRQRIVLQAMLDKAKQSDLGSLTEMCKDIMSQISTNFTAAEILQYAS
FT                   YVTKFQMKETTGFPFELTTMNLSTTGDTVIPIDLAQNVSELHQFLFNETDYQPTDTVQT
FT                   VSDKIAKKTGVTSKTSAFDLTQYNDTVGSDGTEGAKKKNKDKQDALKKSQSESETGSEK
FT                   KSSSDD"
FT   CDS             complement(873575..873733)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92919"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM84"
FT                   /protein_id="CBK92919.1"
FT                   /translation="MVSRRKEVECFKCGRPQMRLTNLEFGKYTNMSEKERQDYADAWLY
FT                   IHRKKEK"
FT   CDS             complement(873781..875511)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08670"
FT                   /product="alpha-phosphoglucomutase"
FT                   /function="alpha-phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /EC_number="5.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92920"
FT                   /db_xref="GOA:D4JM85"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM85"
FT                   /protein_id="CBK92920.1"
FT                   /translation="MDFRAEYEKWCTDPYFDEATKAELKAIAGDDKEIEDRFYRTLEFG
FT                   TAGLRGVIGAGTNRMNIYTVRQATQGLANYILSQGEDAVKRGVAIAHDSRNMHDEFTDA
FT                   TALCLAANGIKTYVFPQLAPVPELSYAVRTLGTIAGVVITASHNPREYNGYKVYWEDGA
FT                   QVTPPHDTSIMAEVAKVTSFDQVKTMDKAAAIEAGLYNVISDEVEEGYFGELRKLSIHP
FT                   EIIKAMAKDIKIVYTPLHGTGLRPVQRVLKDMGFENVYIEPSQAVPDGNFPTCPYPNPE
FT                   NPDAWKLALELAKEKDADIVLATDPDADRLGVYCKDTKTGEYVTFTGNMSAMLIGEYIL
FT                   SQKSANGTLPENPAFVESIVSTDMGKAIAAAYGVKHIEVLTGFKYIGEQMLKFEKTGCN
FT                   NYVFGMEESYGCLPGTYARDKDAPAAVCMLCEVAAFYKSQGKTLWDGMIDMYEKYGYYR
FT                   EGISTMTLKGIDGAAQINEIMTKARAAEPKKFGDYQVLAIRDYKNDTRKDMTTGKVEPT
FT                   GLPSSNVLYYELNDNAWCCVRPSGTEPKIKFYFGVKGVSLEDSQAKLDALSAEVLGQFE
FT                   "
FT   CDS             complement(875599..876426)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08680"
FT                   /product="Glycosyltransferases, probably involved in cell
FT                   wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92921"
FT                   /db_xref="GOA:D4JM86"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM86"
FT                   /protein_id="CBK92921.1"
FT                   /translation="MNKVKFSVLLSIYYKEKPEYFRECMESIYSQTVLPDEIVLVEDGR
FT                   LTEELYEAISDYECRPSEINFVTVKLEKNSGLGLALAEGIKHCSNELVARMDTDDICVP
FT                   DRFEIQLNAFSENPGLDIIGGYISEFSDDMHNIISERTVPLGNYVIKQYQRKRDAFNHM
FT                   TVMYKRSAVLAAGNYQDCLLMEDSLLWANMIRNHCRMANIGETLVYARTGDDMLKRRGG
FT                   FDYFLKYKAGRKRILKTGTISAADYFVTVAAQFVVCMMPLWMRSLVFKKILRN"
FT   CDS             complement(876453..877142)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08690"
FT                   /product="Sugar transferases involved in lipopolysaccharide
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92922"
FT                   /db_xref="GOA:D4JM87"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM87"
FT                   /protein_id="CBK92922.1"
FT                   /translation="MSRWRTWGEIPTFMKNDFTLKYYRHLSRKRTSMVFKRIFDVIMSA
FT                   VLLVLLSPVILVLAVWIKVDSRGPVFFRQERITQYGRKFRIFKFRTMVNDADKKGSLVT
FT                   VGGDSRITRVGAVIRKYRLDEIPQLINVLCGDMSFVGTRPEVEKYVMAYTPAMMATLLM
FT                   PAGITSEASIRYKDEDRLLEAADDVDYTYIHKVLPGKMRYNLKYLKRFSLINDIRLCIE
FT                   TVLAVIH"
FT   CDS             complement(877135..878352)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08700"
FT                   /product="Predicted pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92923"
FT                   /db_xref="GOA:D4JM88"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM88"
FT                   /protein_id="CBK92923.1"
FT                   /translation="MEKRQISFSPPDITEAEVSAVADALRSGWITTGPRTKEFEKRIAK
FT                   LCGTDKAVALGSATACLESILRFLGIGAGDEVITSAYTYTASASPAVHVGAALKFIDVA
FT                   PDSFEMDYDALEAAITEKTKVIVPVDIAGVPCDYDRIFDIVERKKALFHPSNDVQRAIG
FT                   RVIVAADSAHAFGASYMRAGERIMCGNVADFTSFSFHAVKNLTTAEGGALTWRTIEGFD
FT                   DEYIYKQFMLLSLHGQTKDALHKNGLGNWEYDIVAPSYKCNMTDIQAAIGLVQLDRYEG
FT                   LLKRRRDIIERYDEAFKPLGLLTVPHFTDRHTSSGHLYLLRIPGIGVDRRNALIVQMAE
FT                   RGIATNVHFKPLPMMTAYKNMGFDIADFPNAYHQYENEITLPLNTKLSDEDVEYIINNL
FT                   LEILHE"
FT   CDS             complement(878432..880378)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08710"
FT                   /product="Predicted nucleoside-diphosphate sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92924"
FT                   /db_xref="GOA:D4JM89"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM89"
FT                   /protein_id="CBK92924.1"
FT                   /translation="MSNRLDMKKDTNNRKDKTKYDGPEKPDAYMGNDKQWVFRALVLAF
FT                   IDMCIIAISFFFALMIRFEFSYSHIPLSFLEGYLHIVPLFMVISLVVFYIFRLYHSIWR
FT                   FASINEFMHIIGAFLVLTVVSVIIHEVYEIKMPYAFWIIGLMLSFALCTACRFAYRFIR
FT                   TGQKMLEQRGSANGDERVMIIGAGNAGRMLIRELIMSSHLHTKACCIIDDNPAKLGRFI
FT                   DGVPIVGNRNDIPEMVEKYDITKIVYAVPSTSGKDRKDILNICKDTGCDVSVVPGIYQM
FT                   VDGRVSVSNLRPVSIEDLLGRDPVVVDNDGIHSFLQGKVVMVTGGGGSIGSELCRQIAR
FT                   EDPKLLIIFDIYENNAYDIQQELKRKYPYVRVETLIGSVRNTNRLHYVFQTYHPEIIYH
FT                   AAAHKHVPLMEESPNEAIKNNVLGTLKLSRIAAEYHVKKFVLISTDKAVNPTNIMGASK
FT                   RLCEMVIQMMNRQTETDFVAVRFGNVLGSNGSVIPLFKKQIEDGGPVTVTDKRIIRYFM
FT                   TIPEAVALVLQAGLYAHGGEIFVLDMGEPVKIDDMARNLIRLSGLEPDVDIQIVYTGLR
FT                   PGEKLYEEMLMSEEGLKETPNKLIHVGEPIEMDDELFEKQLVMLEKACTSEAKDIKQIV
FT                   ASVVKTYHPDLED"
FT   CDS             complement(880529..880948)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08720"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92925"
FT                   /db_xref="GOA:D4JM90"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM90"
FT                   /protein_id="CBK92925.1"
FT                   /translation="MDNIIIRNRKEEFKELVLYTVFGNMTFVISIGAYAIFNVFFGINE
FT                   LIANALAWVFAVLFSYVTNKKWVFKAATPTKTAFLVQMFAFFSGRFITLVIEETIIFIF
FT                   ITLLDYPSMWVKLVAQVVVVVLNYVISKLFVFKNR"
FT   CDS             complement(882586..883701)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92926"
FT                   /db_xref="GOA:D4JM91"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM91"
FT                   /protein_id="CBK92926.1"
FT                   /translation="MKFIKISAFAIVLLLLMQIVSKAFIAIDSSDIENIYGFYAEPENS
FT                   LDMVMIGPSEVYTGYAPALAWEEYGLKSCNLSIGAVPCNMYKSIVTEIVKRQKPKLLVI
FT                   SAAAFSQGNWNLTDEVYLRKWIDNMPMSQNKLDTVKTIPKNINKDDEKVKDNISDTLYF
FT                   PLEKYHGNWKDPEAVYTSFVTRAYMRLSGGGYLKGFYSKTGITGGRDNLANIGQPTKEA
FT                   YVLTDECRAYLKELLSYCNKLGIEHVLLLQPPHETQAADKSGLEQIESITKEYGYDFLD
FT                   LSTDYESSVGIDDSHDFADFEHLNAYGVQKLSSYIGDMAVNQYSIKSDTAKSELSRWKK
FT                   SVKRTKKALKMAREYTDRGEAQVVGEYEAAK"
FT   CDS             complement(883806..884849)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08750"
FT                   /product="Fucose 4-O-acetylase and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92927"
FT                   /db_xref="GOA:D4JM92"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM92"
FT                   /protein_id="CBK92927.1"
FT                   /translation="MQTNTTRDKTIDFIKGILILFVILGHTTLGLTDMYSFDDTMYGIA
FT                   NVIYSFHMPCFIAVSGFLYSEYVGNASQGIFSRICHKAFNILLPYVMISVIYWIIKFAL
FT                   SNLIREPVAVSSLISIPWKPIEFLWYLYALFLLYCVAFMADYVFARLLPHFNYKMELLF
FT                   VLFLIIAYTCYGSFHYVGFNYIAGFQMYFYLGCLIKKWLDKLYNRYAVLSLSVMSVLVE
FT                   VSDIVLRDDMSSNPIFSSLFERLTACIVTVFIFAVSYFLSGYCDFPKWLQTIGRDSMPF
FT                   YAMNVIFVGGIRIILNRAGITNMVLQCVCGFAGSTAICWILYECIIKKIRLIDFIFYPC
FT                   KQLHIRK"
FT   CDS             complement(884851..885303)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08760"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92928"
FT                   /db_xref="GOA:D4JM93"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM93"
FT                   /protein_id="CBK92928.1"
FT                   /translation="MKVFDKLMELPILRIFNPFYKKYKEMLLYLFFGGLSFIVSIATYA
FT                   CFNVGMGINELIANILSWIITVMFAFLTNRVWVFQSPTDSVQAFIKQMFVFYSGRVITL
FT                   VVEEAILLVFITWLGFNSMLIKVIAQVIVIVLNYVISKLVVFKERS"
FT   CDS             complement(885316..886179)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08770"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92929"
FT                   /db_xref="GOA:D4JM94"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR006637"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM94"
FT                   /protein_id="CBK92929.1"
FT                   /translation="MPWVSGGNITGTTGRKLRIEGININLSQDTVHSLTGTIMYRTHVQ
FT                   DIGWTGWKTLGQYSGTSCRAKQVEAIEIKLTGQLATFYNIYYSSHIENYGWLGWASNGQ
FT                   TSGSTGISYRVEALRINLVRKGAPAPGSVANYYKNKPVYTPKPAALDVMSKNAQVRASS
FT                   TRWLIMTDTSACQVGVYSGSYGNWSRVASWSCGPGKPSTPTVKGEFTIYGRGKSFGSRS
FT                   YTCWYYTQFYGNYLFHSVLYNRGSMTHIQDGTLGKQVSHGCVRLDINNAKWLYDNIPNG
FT                   TKVVIY"
FT   CDS             complement(886286..889531)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08780"
FT                   /product="Listeria/Bacterioides repeat"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92930"
FT                   /db_xref="GOA:D4JM95"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR006637"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM95"
FT                   /protein_id="CBK92930.1"
FT                   /translation="MKKVVALLLTLSMLISANTFVFADSAETGNSTESYQQQDNSENQI
FT                   VTYLSVADPSVKKGDAVRIIVGLADGIDQSNARLTVENTDLNQSFEISGEMTEDGNLIF
FT                   ESSDLVSGCYTVKSLETDGYSVDFEAIGINSQFGIDTVVMDLNADAYAEDSDNSNSDNE
FT                   NTGSEVYDAVVINPDETSTQAAGNTISEAIAAAADVQQNNLFRASSAVNVVLDPGHGGN
FT                   DGGAQASYGGKTYLEKTLNLKIAQYCKEELSKYKRVNVYMTRNDDHYVALEDRVNYAKS
FT                   VGASVFVSIHNNSTTSSSVHGATVYYPNSSLNANIGAQGGALANEVLKQLVALGLANDG
FT                   TRIRNSESGDTYTDGSICDYYSVIRNSKKAGFPGIIIEHAYISNQSDATNYLGSETALK
FT                   KLGIADAQGIVNYFGLKQEDYHLIFDASYYLNNNPDVKNNWGNTAEAALQHFIKYGMAE
FT                   GRRGNEIFDVHFYKDNNIDLQNAFGDNWYLYYQHYLENGIREGRQASENFDVISYKTRY
FT                   RDLQSAFGDDYEGYVDHYISYGINEERDASPLRYKVDFVDNGQIVESQNVLCMRGAKAP
FT                   EITKTGYVLSWDKAYNKIASDTTVNAVWAPVTVKLNFDAAGGNITNTSKNITYGGTYGD
FT                   LESPERDGYTFIGWYTAATGGTQITKDTKVEVTADQTVYAHWASNSYTVTFDADGGTVN
FT                   TNSKTVIFGNAYGELPTPTRNGYTFAGWWTAVDSGEQISFNSAVKTASDHVLYAHWVLN
FT                   SVSVSYQTHVANIGWQNGVSNGAMAGTVGRGLQLEAIKINVKSDADIGVIYTTHVKNDG
FT                   WHGNSFNGEQSGTTGQNKHVEALMLKLTGKDADKYDIYYRVHAQNYGWLAWAKNGESAG
FT                   TSGYAYRLEAIQIVVTAKGDMAPTVFYGGYTSNNAKAYISKTSTVPIINTNASVRYQSH
FT                   VSNIGWQSAVENGSLSGTTGRSLGLEAVKIDLNGQPCPGGIKYQSHVSNIGWQNAVADG
FT                   ALAGTTGRALNVEAINMSLTGEMANQYDIYYRVHAQNYGWLGWAKNGQNAGTSGQNLHL
FT                   EALQIVLVKKGQSAPGNNYGGIISKNTMAYIAR"
FT   CDS             complement(889752..891884)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08790"
FT                   /product="Phosphoglycerol transferase and related proteins,
FT                   alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92931"
FT                   /db_xref="GOA:D4JM96"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM96"
FT                   /protein_id="CBK92931.1"
FT                   /translation="MRKIKNELCNNRRLLSVVLAIIDVAFIALLLIGLCMGIFGKHTYN
FT                   FSIEYGEEHSNKNYAQMYYAPSVKKMTEEDSINAYFENKKANFKIKMSLAEINNNLFRV
FT                   DPINTLEVYSIKSITLSDFWGNSIEVSGSKLEKYISSRKDVEYEVHDDGLYITALTQDN
FT                   MFILSQKLNYKVVKLFLNRQLVLFYIGTFCYLLFGILQFVLLCQNNDDKKHSRIFNFLS
FT                   AFITYILTALGGALLYGFWYMQKNFKDVPIGQIIYHLNTPLEGTNTSSFSVIFISIILI
FT                   IIICVLMVTFGLLIFRKKKNKWIYKFWMSLLGCIAIGYSIILCCFHFDIISYLKYTKQD
FT                   STIYEDNYVDGRDVAITFPKEKRNLIYIFLESMEMTYSDQSVGGAMSENYIPELTQISL
FT                   ENENFGIYGKLNGAYTTSGATFTMGGLVAQTSGVPINENLISNDTLNSKWESDNNYVPG
FT                   VWAIGDVLKGEGYNQEFLIGSDKKFAGRSSYFHGHGNYDIFDYYTAIDRGYIDDDYMVW
FT                   WGYEDEKLFEYAKNELNNLASKDEPFNLTMLTVDTHFTDGYVCELCQNQYDEQYSNVIA
FT                   CSSRQVSEFLDWIKQQDFYDNTTVVISGDHLTMDSDYIERQNATDFNRRTYFTIVNGAA
FT                   VNEKPCVEREYTTLDLYPTTLAALGVQIEGNRLGLGTNLYSGEDTLIEKYGLDYINVEL
FT                   LKDSQLYRKKLLYGKN"
FT   CDS             complement(891972..893264)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08800"
FT                   /product="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92932"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM97"
FT                   /protein_id="CBK92932.1"
FT                   /translation="MKVNKLLTIACHKYVSSETSEKNNFVWNMIGSMIFAAASMILSLL
FT                   IIRIVGEDDGGIFAIAITVAQMLAFIEYYETRTFQVTDTKSTFEFGHYKAVKYILFVVS
FT                   VVVSIVYSILTAKSNIYKCIVILLMCIYRFVDAYADLYEGAFQKDGRLDLTGKSQAFRT
FT                   VMSVTVMLVVLIITKNMILAISLSILIAILGLIIFDVMPMKTFRNIAVIWNEKYILGIL
FT                   KNCFPLFIGSFLWSYILSASRIAIDAKMASNYSAYFQTLFMPVSIVNLFATFVMKPALT
FT                   KLADEYASDYKKPFIVSISKISVIIVGFTIICIIGAWILGIPVLQILTGSELIQYKMVL
FT                   ILLMFAGGINALSYFGYYVLTVMRKSGMIIIGYIVSAIVAKLANEYLVARYGIKGGAYG
FT                   FLTSVMVLFLIFYFCIIYTILKKNKKILRKS"
FT   CDS             complement(893251..893607)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08810"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92933"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM98"
FT                   /protein_id="CBK92933.1"
FT                   /translation="MSTSLRVILFVASLCVFFFIMKKIKKAKLKIEYALFWIVSSILLL
FT                   ILSIFPQIAYFFADICGIKSPVNFIFLFSIMVLFVHNFYLTLRISNLDNMINSLTEEIA
FT                   VRNYYKKEEENESK"
FT   CDS             complement(895125..897260)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08840"
FT                   /product="Predicted membrane protein (DUF2142)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92934"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:D4JM99"
FT                   /protein_id="CBK92934.1"
FT                   /translation="MKSFVVGVRNVKKNISKISLWILIFSILSLVTVAMVWSPRKELKI
FT                   RGNADNLLERYDTSDIIEYSGCYINQSGQICINGVDPHIVFKKENIKNVTTIVIKLKDK
FT                   VSGDLDVQLYFDDGNEFNENDSCIKTIFSGDDNVGFELTNKSLKQIRIDVDSDFNFDDI
FT                   EIYSGKSIISIDKENMHYERIIYSICFTVFIISILLFIDKKLNFSDTIICFIGRKYKIA
FT                   LRDLLIFIVSLVIGAIIAYFVSGLKFMYSTWLFCSAIVAIILFILISYRTIKDKPEKLL
FT                   VRLVFVSSITMLFVSPIGHISWDIDSHFKFAISSSSVAHIGLSEPELEVLTNGGNFIQN
FT                   TDTYAQNIEKINTLNKNSDAIIKYIDHNISLTALPSGVVIALLRLFGANFFVIYKFGQI
FT                   PIVLVYSLCCYFAMKRLHSGKMILAVVAMFPTSLFIASNYSYDTWVIGFVMIGMAYFVG
FT                   NCQEEGVVSTKDTVIMVIAFAIAIIPKQIYLAFLIIPFLMKRNKIENKKKYYSICSMAF
FT                   VIMLFDLLLKTIFETSKGGDVRGGAGVNPTEQILYIIHNPVEYTRTLLNFLKDYLSIRN
FT                   MNGFIDHFAYLGIGTTTVAIIVFAFLVFTTLTDKREYDVKAYSKIVYIYDILMFFGTVV
FT                   LIATSLYIAYTEVGSNTIAGCQSRYITPLIYPLFAVLGGSGIRLKFDYRVYNYIVMIIM
FT                   QSVSMWCIYQYILIKML"
FT   CDS             complement(897257..899392)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08850"
FT                   /product="Predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92935"
FT                   /db_xref="GOA:D4JMA0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMA0"
FT                   /protein_id="CBK92935.1"
FT                   /translation="MNTIKQNIKKVARPIYHKVVPEKIRTRRAARLNRSLEYETWITML
FT                   EANENYDEKFEYNPKISILVPVYNVLDRHLIPCIESVLNQVYTNWELCLADDCSSWDSV
FT                   RETLAKYEGNEKIKIVYRTENGHISRCTNSALEIATGEFVAFMDCDDVLRPNALYEVVK
FT                   KLNENPNLDFIYSDEDKIDDDGFNRHMPHFKPDWSPDTLMSHMYTCHFGVYRRSIANEI
FT                   GGLRAGYEGAQDYDFTLRFTEKTNKIAHIDKILYHWRERKESTALDPSAKPYIFEAAKK
FT                   SKEDALERRGLKANLEMVDIMYQYRVNYISQTNPLVSVIIPSKDNYKVLKRCIETLYEI
FT                   TRYKNFEVILVDNGSNDENKKLYQGLADKYNFRYIYEKMNFNFSRMCNIGAKEAKGDYY
FT                   LFLNDDIEIINEEWLERMVGHAELEHVGAVGAKLLYPNSKKIQHIGVINIANGPVHAFI
FT                   GYNDDNIYYFGRNKIDYNWLVVTAACMLVNAAKFNKVNGFNEDMPVAYNDVELCFRLVE
FT                   AGYYNVVRNDVILYHHESVSRGNDLKSEKKFKRLMAEQKHLYKLHPYFKNKDPFYSSNL
FT                   TQHAPDFSYNMMKENIGKCVVEECTKEFDICRKVVNAIDNIYVGNKCIIEGWGFYNEKP
FT                   YNGNIQLLLKSDNKSYLITTRKIFRSDLAIHFKRKPGAELSGFICEFDKIDAGKYQIYV
FT                   CCNGKATKTKRHIIINK"
FT   CDS             complement(900942..902027)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08870"
FT                   /product="ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92936"
FT                   /db_xref="GOA:D4JMA1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMA1"
FT                   /protein_id="CBK92936.1"
FT                   /translation="MNMIEVKDVSICFRMANDKLNSLKEFMIQKVKGKLKYEEFWALKD
FT                   VSFNVKKGEVVGIVGHNGAGKSTILKVISGIMKPTEGTVVTHGNIVPMLELGSGFDMDL
FT                   SGRENIYLNGSILGYSKEFLDEKFDEILEFSELGEFIEQPIRNYSSGMLMRLAFSVATI
FT                   VNPEILIVDEILAVGDADFQEKSKNKMLDLMSGGTTVLFVSHMISQIREMCDTVVWLDH
FT                   GKVKMIGGAKEVCDAYQFKKSENDELSKLYFDDGTGFNERATFTQVMPMDGNIFKQVYE
FT                   FPTKCQHVRYDPVEGTTISLSDLKIVAEDANVNIIATNGRQVDDVFYFGKDDPWIDMSF
FT                   SHGVSSVEITGVVREVNEDAM"
FT   CDS             complement(902047..903504)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08880"
FT                   /product="ABC-type polysaccharide/polyol phosphate export
FT                   systems, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92937"
FT                   /db_xref="GOA:D4JMA2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMA2"
FT                   /protein_id="CBK92937.1"
FT                   /translation="MEEKFIKKVFGITLLVYFASICLVYLVSSKQFHYQETQSDTVSQS
FT                   QVVGEFAEGDTIKQTFTVDSQYLEGVTVTPATYGKTAEGMLEAKITDTNGKNIADIDVD
FT                   MSELSDNQPYDIKLPEKIKVDNNESYTLELICKSLDGDSQISFYYGNSIKMAKGEISKS
FT                   YDDSTRVYVNNEGLEGELCLSIDGMNTIWFGNYYWIIMGAIGILLIVYFVVSLNKRKSG
FT                   KQTVVIAFLDSVSHYKFLISQLVKRDFKTKYKRSVLGVCWSFLNPLLMMLVQYVVFSTI
FT                   FSSGVANYPVYLLSGIVMFNFFNECCAMGISAITSNSSLITKVYVPKYIYPLSRAMSSL
FT                   VNLGFSLIPLLIVTFVTGLWPRPAFILLPFPIICMMIFSLGMSYFLSTSMVFFKDTQFI
FT                   WNVLSTVWLYATPIFYTENIITSPILLKAFHCNPMYQFIYFVRSILIDGVSPSPQHYLY
FT                   CILLSVVPFILGFWFFKKNEDKFIFNL"
FT   CDS             complement(903589..904515)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08890"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92938"
FT                   /db_xref="GOA:D4JMA3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMA3"
FT                   /protein_id="CBK92938.1"
FT                   /translation="MHSTDKIAILMATYNGEKYICQQIDSILSQTCTDWELYIHDDGST
FT                   DNTIAVVESYVEKYPDKIHLIDGKSTGGAKYNFFYMFGQVEAPYYMTCDQDDVWLEKKI
FT                   ELTYDKMLAIEDKADVPCLVYTELRVVDSELNTIADTMSEYQSLDCHKRTINQFILQNS
FT                   VTGCTMMVNMALRDKMLHITDIDNTIMHDWWAALVAAQFGKTAFIDEPTILYRQHGDNS
FT                   LGALGINKLSYIVRRVWQKKQIQESMRLGRLQAREFAKTYNLPADSLAVRYAALEGKSR
FT                   LVRQRFYKENDMYKTGTMRRLGQAVWG"
FT   CDS             complement(905419..907548)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08910"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92939"
FT                   /db_xref="GOA:D4JMA4"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMA4"
FT                   /protein_id="CBK92939.1"
FT                   /translation="MNSKKWIIQYLEVLLDIIVMFTSYLIANWYKFGFFRTGLINHTEH
FT                   YLTLFLVELVAYVVVHFVAFADDNLINRKLFPEIYNVLKMYVYVGAITVGCVYFTKTSE
FT                   YFSRGQMGMTFILSTIFTVIVRQLLKRLVTKEYHRSGANEKIMLVTTSDQVERVIKKIK
FT                   TTRNWDFRISNIAILDCDMVGEIVDKIEVVATADNLLQVISTAEIDSVFVHLPDNYPFK
FT                   QREFVTVLNEMGKTVHLNVNEYEAKVGEHYMDFLGKYAVVTWKNKTYRVRHLLIKKLID
FT                   LLFGVAGSILIVPVWIVAFIGKIVTGDHGPVLISLVRVGKNGRRFYYYKFRAMYMDARD
FT                   RYDKWILDGKKGKDPRFTPVGRMLRALRLENLPSAWNVLWGDMSMVGNPAPSLPEFIEY
FT                   SAFHRKSLSVKPGIIGFWQVYSREHRLLTEEEQSEYDQEYILNWTVGLDLRIIFRAVCP
FT                   LCRSVSKRELVMPAQLVDEMRCLSELVKDREPLSYDIQAYPATEDSGKPVYRFIKRLVD
FT                   IVASLLGLIVLSPVFIILAVIIRMSDGGSVFYGHTRVGYKGKKISVYKFRSMKTNAGDL
FT                   EKILTPEQLEQYVKEFKIDNDPRITKIGGFLRKTSLDELPQLINILKGELSIVGPRPIV
FT                   EKETEIYGKDIAKLLSVKPGLTGYWQAYARNNATYESGERQRMEMYYVEHCSLWMDIKI
FT                   LFRTVFSVIREDGAQ"
FT   CDS             complement(907545..908762)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92940"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMA5"
FT                   /protein_id="CBK92940.1"
FT                   /translation="MDKNKSISTQKNNRWDVVYFILYGIVLAKCVYETTMFSQQVLVGT
FT                   FKLFLAAMVLYTGAKILFSGYYSRKEQLAIAVVILIFGIVGLQTGYYELLQPVLLIVGA
FT                   KNVRFDNILKVYTAVVSVMLIVAAIASQTGVIADVIGYSPRNAAAARHSYGIIYPTDFA
FT                   AHIFYLILAVGCLGIWKRVQENEQYRYLAWLRWLIVIAAAVFIYIKAGAFTGTACLIGF
FT                   LVLMCLIYLLERKNLARRVCEIFKYLPIVWASLFLALSYFYSESNAIMVKIDSVLSQRL
FT                   MVSHKVWSEYSIKLFGQFIEEQGWGGVADPTGIDPAKYFFIDDMYLRMLFEYGIIVFAV
FT                   VLILLIFIGHKAIGAKQYVLFAAIVMIGVHSFMEHHLLEMAYDPFLLVLLAGIDTADKE
FT                   KSGRKI"
FT   CDS             complement(908887..910395)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08930"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator common domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92941"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMA6"
FT                   /protein_id="CBK92941.1"
FT                   /translation="MKKKKKATKWIIFARVLLVLQLIASAMIFAMAVKTKMLPAKYIMF
FT                   AAGGLLIMEFLVFALVHLGQNIMKPKASGYFKRGLGTFISILVIICSLYGTSVLSKVMG
FT                   TLNDMTGNKNVMEDKIVVYVMKDDPAETIDDAKDYTFAYTDSYGYEETKETIDDINKKT
FT                   DSTINTKPYASAIEMVDALYSGEVKAMILNTSYVSVITDTEGYEDFETKTKVLYAYTKT
FT                   YEVEKTEKDVQVTKEPFVVYISGSDTRSKKLAKSRSDVNILAFVNPESRQVLLLNTPRD
FT                   YYVETSVSHGTKDKLTHCGLYGIDCSMKTLASVYDLDTINYYAQINFTGFETLIDQIGG
FT                   VTVNSEQAFSSSMDSYKFSKGPNELNGEEALAYARERHNLPDGDNGRGRHQMDLISAVI
FT                   DKMTNSTALLTNYSGILDSLEGMISMDFKSSDISSLINMQLSEGGSWNIKSFAVTGQGT
FT                   KKTTYSMPIQKVYVTIPDESSVEHAKQLIQKVMNGETITDDDLK"
FT   CDS             complement(910500..911150)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08940"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /function="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92942"
FT                   /db_xref="GOA:D4JMA7"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMA7"
FT                   /protein_id="CBK92942.1"
FT                   /translation="MLGCSRNTRKDIEIMGQIKVQKNVGGIEGLCIIEPTVHGDNRGYF
FT                   METYNSKDMQEAGIDRVFVQDNQSCSTKGVLRGLHFQKEYPQAKLVRAVKGSVFDVAVD
FT                   LRSDSKTYGKWFGVELTEENKKQFLIPEGFAHGFLVLSDVAEFCYKVTDFWHLGDESGL
FT                   AWNDPAIGIEWPQLVGEYPGSADGSGYTLEDGTPINLSDKDQKWETLENTFKF"
FT   CDS             complement(911188..912129)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08950"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /function="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92943"
FT                   /db_xref="GOA:D4JMA8"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMA8"
FT                   /protein_id="CBK92943.1"
FT                   /translation="MKVFVTGVAGQLGHDVMNDLAARGYEGIGTDIAPQYSGADDGTAV
FT                   TTMPYVSLDITDRDAVEKTITELKPDVVVHCAAWTAVDLAEDDDKKAKVHAINADGTQN
FT                   IADACKKIDAKMVYISTDYVFDGQGTTPWQPDCKDYAPLNVYGQTKLDGELAVANTLEK
FT                   YFIVRIAWVFGVNGKNFIKTMLNVGKTHDKLTVVSDQIGTPTYTLDLSRLLVDMIETDK
FT                   YGYYHATNEGGYISWYDFTKEIFKQAVELGHTEYSEDRLTVAPVTTAEYGVSKAARPFN
FT                   SRLDKSKLVENGFNPLPTWQDALHRYLQEIEF"
FT   CDS             complement(912340..913359)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08960"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /function="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92944"
FT                   /db_xref="GOA:D4JMA9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMA9"
FT                   /protein_id="CBK92944.1"
FT                   /translation="MTIIVTGGAGFIGSNFVFHMLNKYPDYRIVCLDCLTYAGNLSTLE
FT                   PVMDNPNFRFVKESITDRDAVYKLFEEEHPDMVVNFAAESHVDRSIENPQVFLDTNIIG
FT                   TSVLMDACRKYGIKRYHQVSTDEVYGDLPLDRPDLFFHEDTPIHTSSPYSSSKAAADLL
FT                   VLAYHRTYGLPVTISRCSNNYGPYHFPEKLIPLMIANALNDKPLPVYGTGENVRDWLYV
FT                   EDHCKAIDLIIHNGRVGEVYNVGGHNEKTNLEIVKIICKELNKPESLITFVGDRKGHDM
FT                   RYAIDPTKIHNELGWLPETKFEDGIKKTIKWYLDNREWWETIISGEYQNYYEKMYANR"
FT   CDS             complement(913373..914344)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08970"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /function="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92945"
FT                   /db_xref="GOA:D4JMB0"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMB0"
FT                   /protein_id="CBK92945.1"
FT                   /translation="MNQVSGFYRPKASNAARSFSLKENNMKGIILAGGSGTRLYPLTMV
FT                   TSKQLLPIYDKPMIYYPMSVLMNAGIRDILIISTPQDTPRFKELLGDGHQFGVNLTYEV
FT                   QPSPDGLAQAFVIGEKFIGDDTVAMVLGDNIFAGHGLNKRLKAAVENAKSGKGATVFGY
FT                   YVDDPERFGIVEFDKEGKAISIEEKPEHPKSNYCVTGLYFYDNNVVEYAKNLKPSARGE
FT                   LEITDLNRIYLEKKALNVELLGQGFTWLDTGTHESLVDATNFVKTVETHQHRKIACLEE
FT                   IAYLNGWITKDEVLKTYELVKKNQYGQYLKDVLDGKYREQLY"
FT   CDS             complement(914448..915629)
FT                   /transl_table=11
FT                   /locus_tag="ERE_08980"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92946"
FT                   /db_xref="GOA:D4JMB1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMB1"
FT                   /protein_id="CBK92946.1"
FT                   /translation="MKLPGYYSSGEFAKKAHITKKTVRYYDEHNILKPSYVNENGARFY
FT                   NDDDFARLQQILFLKYLGFSLDDIKEMTLRNTDSNVMSESLHMQLGLVEERIEQMKLMK
FT                   SALQEASEVIDEGRSVDWSHMLELVNINEMEQKLKQQYRDASNISARINLHRDFSMNPV
FT                   SWFSWVFDECSFFEGEKVLEVGCGDASLWTQNIDRIPADMQITLTDISYGMVRDATRNV
FT                   GADDKRFTYEVMDAHRLYKPDASYDCVIADHVLFYCDNLDAVCSEILRVLKPGGVFVCS
FT                   TYSSRHMKEINDLVQQFDDRIELSAERLYEQFGKENGEAILGKYFGEVSWHGYEDELVV
FT                   EKAEPVIEYVLSCHGNQNRYIVDRYKEFAAFVRKKTEGGFHITKDAGVFIARK"
FT   CDS             915801..916916
FT                   /transl_table=11
FT                   /locus_tag="ERE_08990"
FT                   /product="UDP-galactopyranose mutase"
FT                   /function="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_08990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92947"
FT                   /db_xref="GOA:D4JMB2"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMB2"
FT                   /protein_id="CBK92947.1"
FT                   /translation="MKYDYIVVGSGLYGAIFAHEAKAKGKSVLVVDKRPNIAGNVYTEK
FT                   QEGINVHMYGAHIFHTNDKRVWNYITQFAEFNRFTNSPVANYKGELYSMPFNMYTFNKM
FT                   WGVVTPEEAAAKIEEQKKEITGEPKNLEEQAISLVGRDIYEKLVKGYTEKQWGRDCKEL
FT                   PAFIIKRLPVRLTFDNNYFNALYQGIPIGGYTKMVENLLDGIEVRLNTDYLEHKAELDA
FT                   LADKVVYTGPIDAYFGFKLGTLEYRSVRFENETLDIPNFQGNAAVNYTDRETPWTRIIE
FT                   HKWFEFGKDEDGNDLPKTIISREYSSEWKAGDEPYYPVNDEKNGKLYAKYKELADKETG
FT                   VIFGGRLGEYKYYDMDTTIASVLDMCEKELG"
FT   CDS             complement(916993..918195)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09000"
FT                   /product="Diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92948"
FT                   /db_xref="GOA:D4JMB3"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMB3"
FT                   /protein_id="CBK92948.1"
FT                   /translation="MRQTPYYVFDTDEFAKRAAMIRAALDCKGGRRIPLCFSIKANPFL
FT                   LHRLPEGLDHVEVCSPGELEICIALGVKPESIIYSGVMKEKCDIERAVSYGAGILTCES
FT                   IRHAALISEVMLERMPEGAHEAEFAETKTHVILRLTSGNQFGMSLDDIEYIISHPDEFK
FT                   GIAVMGIHYYSGTQKSLRKINKDLEKIKSALSVLKEKYSFEPQLVEYGPGLCVEYFEDD
FT                   WQEREKRSLDEAAEVLREFAVEYPLGIEMGRFLAASCGKYYTQVKDLKSTGDANYAILD
FT                   GGIHHLNYFGQRMAMQVPPISIYRAAGVELTELPDTDYTLCGSLCTVADVLVREVKLKK
FT                   LELGDVLEFGHCGAYSVTEAPALFLSRQLPAIYAYSKEYGYECLREHIPAAEINLAGKK
FT                   L"
FT   CDS             complement(918201..918431)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09010"
FT                   /product="hypothetical protein"
FT                   /EC_number="6.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92949"
FT                   /db_xref="GOA:D4JMB4"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMB4"
FT                   /protein_id="CBK92949.1"
FT                   /translation="MRDTILEILEELRPDVDFEKETKLIDDKILESFDIVSLVSELTDE
FT                   FDITIRPKDLVPENFNSVDAIEKLVKELVEE"
FT   CDS             complement(918433..920079)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09020"
FT                   /product="Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /EC_number="6.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92950"
FT                   /db_xref="GOA:D4JMB5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMB5"
FT                   /protein_id="CBK92950.1"
FT                   /translation="MKNVLEWLEATVEKYPDKPAFSDTECSITFAQVYDIARNTGAYLI
FT                   EQLGVDRTPVAVFAGRKMVTPAYFLGVVYAGRPYAPIDASLPDKRIEKILENLCPRAIV
FT                   ADRESLEHVESIVDELAKSEGFDRPQIFIAEDISRFDQVAGADSNCKISESAGDAVTDS
FT                   ENDTDGGVVAGCAGKKDDSSLEKLATVRRQMSMTDPLYIIYTSGSTGNPKGVMTSHLSL
FT                   MTYINAYCDVMHIEESDVLGNQSPLDYIAAIRDIYLPLKTGCSTAIIPKEYFMEPNALF
FT                   DYMNDKKVSSVGWSVSAFTILTSLGAFEEVGLKSLRKICFSGSVMPCRVLRKWQENLPE
FT                   AHFVNQYGPTEATASCTYYSVDHTVEDDEVLPIGKAYDNYRVFLIDEHGNEPAVGEQGE
FT                   ICVCGPILALGYYNDPERTAAAFTLNPLNKAYPERMYRTGDYGRLNEDGILHFCGRMDR
FT                   QIKHMGHRVELDEVEHAANVVEGVAESCVIYNKAKEVLILFYTGDCDRRSLALALRDEL
FT                   PGFMVPRKIKKLEQLPKLPNGKYDMKKLEEM"
FT   CDS             complement(920185..921159)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09030"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92951"
FT                   /db_xref="GOA:D4JMB6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMB6"
FT                   /protein_id="CBK92951.1"
FT                   /translation="MEKNKISIVVPCFNEKEALPLFYNKITWVLNQMSQASETSGLSYE
FT                   LIIVDDGSMDGTLDVAKELATNDSGVKYISFSRNFGKEAAMYAGLQHAVGEYVAIMDAD
FT                   LQDPPEMLPKMYQVLTKEGYDAVGTRRVTRKGEPAIRSFFARKFYRLMSKISKANMVDG
FT                   ARDYRLMNRKYVDALLSLKEYNRFSKGLFGWVGFKVKWLEFENVNRVAGETKWSFWQLF
FT                   LYSLDGIVAFSNAPLYMASIAGVFSFIVAIAAMLFIIIRRLVFGDPVAGWASTVVIILF
FT                   IGGIQLLSIGILGLYLSKLYLEAKDRPIYLIGESNIEKPTEKN"
FT   CDS             complement(921722..921892)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92952"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMB7"
FT                   /protein_id="CBK92952.1"
FT                   /translation="MPEILIIFILCAGIIVIGIILCIIIKVSHMSDDEQKKDDERQLEF
FT                   IRAYKEHKKGH"
FT   CDS             complement(922060..923427)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09060"
FT                   /product="phosphoglucosamine mutase"
FT                   /function="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92953"
FT                   /db_xref="GOA:D4JMB8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMB8"
FT                   /protein_id="CBK92953.1"
FT                   /translation="MGKYFGTDGFRGEANVNLTAEHAYQIGRFLGWYYGELKKQKQLDE
FT                   PAKIVIGKDTRRSSYMFEYSLVSGLTASGADAYLLHVTTTPSVAYVARTDDFDCGIMIS
FT                   ASHNPYYDNGIKLINSNGEKMDEETILLVEDYIDGKLRLFGQEWKELPYAHKDAIGCTV
FT                   DYVAGRNRYMGYLISLGVYSFKGMKVGLDCANGSSWNMAKSVFEALGAKCYVINNEPNG
FT                   LNINNNAGSTHIEGLQKYVVDNGLDVGFAYDGDADRCLCVDELGNVITGDHILYIYGKY
FT                   MKERGKLDNNTVVTTVMSNFGLYKALDELGIGYAKTAVGDKYVYEYMQQNGCRIGGEQS
FT                   GHIIFSKYASTGDGILTSLKMMEVMMARKQKMSQLCEGLNIYPQVLQNVRVADKAEALA
FT                   NPDVQAAIEQVTAELGDTGRILVRESGTEPVIRVMVEAESEEICQKYVDMVVAKLK"
FT   CDS             complement(923578..924999)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09070"
FT                   /product="Protein of unknown function (DUF1015)."
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92954"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMB9"
FT                   /protein_id="CBK92954.1"
FT                   /translation="MSNCFNPANILLPNDCIDMEKWSVIACDQFTSQADYWDAVEKHVA
FT                   DAPSTLNVVFPEIYLGTITKQENDCNSSGDGVKNDKETGRKTKYASMTDDERIKYINTT
FT                   METYLTDGTLKQAVADGYVLVERTTESGVRLGIVGLIDLDDYDFDPKKKTLIRATEGTV
FT                   ISRIPPRVKIRENAAIELPHVMLLVDDPIDRQKIDGCQGATQEDAVNIAAVKYGIIEYV
FT                   YAIRDTLRKLYDTELMQGGGHIRGYAVEGEAAKQVTEAFAAKQNSCGGFLFAVGDGNHS
FT                   LATAKTCWENIKKTGKFTEEQLKNHPARHALVEICNLHSEALEFKPIHRLLTNVDVKDI
FT                   LSFFEAEITKQGLASTEGDEIVFEYVESGATAIKNSRINITNRGDRLPVEILQGILDKY
FT                   LETHGNVEIDYIHGDEALHGLVKETKGCGIFLQSIDKSTLFPAINAGGVLPRKTFSIGE
FT                   ANEKRYYMECHKISM"
FT   CDS             complement(925088..926335)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09080"
FT                   /product="Beta-glucosidase-related glycosidases"
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92955"
FT                   /db_xref="GOA:D4JMC0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMC0"
FT                   /protein_id="CBK92955.1"
FT                   /translation="MNFRQNGDKYLIIIEVIALIVVLVFGAVHFVMPGNKENKKITESQ
FT                   QETQNPTQETDGIQQVQADGQQAAPAFTPSDSVKTKLSSMTTEEKVAQLFITRPEEITG
FT                   VSQFTQAGNKTKAAIGTYPLGGFVFRQENFSGEAAVIKMMSSLQSFSQERLGVNLFLAI
FT                   DEEGGERLPLASANGYEAQQAPSQLGDADAAGSSAGKIGSYMATNGLNMNFGPTADIAY
FT                   GDNADNDTYAFGSESATVGDCVAAQVSSYNGAGINSVAKSFPGKGKATTDSATGMLWMT
FT                   DKLEDLEASDFVPYQKAIEAGVPAVMMGNVICQSVTGEETTPCSTSAGAVNYMRTTMGF
FT                   NGLLITDDLSDASLNKVCTQDEAAVAAVKAGMSMLYVSTGFESSYNAVLSAVNSGEIPA
FT                   EKLDDAVGRILTTKGI"
FT   CDS             complement(926338..927408)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09090"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator common domain"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92956"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMC1"
FT                   /protein_id="CBK92956.1"
FT                   /translation="MKKKKNIIITAVMIVLIAIIAIILVKVNSSNVKNKEVKGIKPGTE
FT                   AVKTKADTQTEDDSTTDKSGIEEFALFGVDSRSDQLDKGTRSDSIMVVRVDHDAKKIRM
FT                   VSIFRDCMMNIDGHGYQKVTHAHAFGGPELAVDTLNKNLDLDIKNYVTVNFNTVGEIVD
FT                   EVGGIVQDIDASEAKVINGYIDEVNKVRGTSSSHIDSAGTYTLDGTQAVAYSRIRYTAG
FT                   GDYKRAERQRTVLFKVFESAKQMNTAAKIKMVSDLIGHVNTNYNTDEILSVFKNLADYT
FT                   VEDSTAYPQVFYGGKVDGAWVEVPTTLADMATGVHQFLEGDTGYTPSATVNEYSSALSG
FT                   KVSGPNNDLTNTNFGD"
FT   CDS             complement(927448..928173)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09100"
FT                   /product="capsular exopolysaccharide family"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92957"
FT                   /db_xref="GOA:D4JMC2"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMC2"
FT                   /protein_id="CBK92957.1"
FT                   /translation="METVVINQIKDQSYTMKESLRALKTSISFSGKGVKSILFTSSVPN
FT                   EGKTTVVMDLARSMADSKKSVLIVDTDMRKSVLVGRLRAKVESGGKIYGLSHYLSGQVS
FT                   LDKVVYATNIKGVFILFAGHEVPNPTELLETKEFKELIEFGEKNFDYVLVDTPPTGAAI
FT                   DAAVVGKNVDGAVIVAAQNVTSSRAIINTKRTLEDSGVKILGAVLNKCRFEESKYGHYY
FT                   GNYYGNYYGNYYGRDDDEK"
FT   CDS             complement(928173..928955)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09110"
FT                   /product="Capsular polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92958"
FT                   /db_xref="GOA:D4JMC3"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMC3"
FT                   /protein_id="CBK92958.1"
FT                   /translation="MENNEPIRDQEIEIDLLALFHELVKHWKALVASMVLLAAVFGLYS
FT                   KITFVPEYEASAEMYVLTKSTSITSLADIQVGSSLTNDYEYVITGRTVLSQVIDNLDMD
FT                   ETYEQLSKRVSIENPTDTRVLKIVVTDTDLEASKTVADEIAKVSSQYIADNMEQSQPKI
FT                   IQTAYASKTPVNNNILKNTVIGAVLGLILAAGIVVLGYMLDDTISNADDMETRTGLKVL
FT                   ASLPVDETEYDGAKTKRRKKKKTQSSKSDDSKNKKRAV"
FT   CDS             complement(929184..931256)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09120"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92959"
FT                   /db_xref="GOA:D4JMC4"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMC4"
FT                   /protein_id="CBK92959.1"
FT                   /translation="MKKKSIKLLVVLACVLMALGMAGCGKKAYKTFPEKYKLASVDVGG
FT                   MTADEAKKAIKTAVGKYKISVKLDDASFDMTAEDLGLKYNDKADLQELINAANKDKEPE
FT                   KQVKLFKMDKSDELETALVDSYITAKTQSQSDAAAQSDKDTDANDDEQKKAATDTQTFD
FT                   IRSIVPYRATIAYNADAGQFEGVDGVSGDAPVYDNAAANLTSAVKELKDKVELTSATGY
FT                   VDGEKAADSEQVKNALKEANAYLDVTVTCNFTPATGEAATEAVGKDQIAQWLIVDNDGL
FT                   SVSLDGENMATYCTELAKKHDVSKKKTGQFKTTGGSIINVPVASSGQTVDGNKLYEAIA
FT                   EAINNKKSATVEAVYSEAKEEETGEYVTYGGNYCEVDLTNQMVYVYKNGELVVSSQCVT
FT                   GCISKGHGTPTGVYSIFSRDKDRYLRGDGYKSWVNFFIPFNGGIGFHDASWRSTFGGNI
FT                   YLYSGSHGCINMPYSAAKKLYENVTLDEKVIVYGGVDKVAGKAQSLGGADSYNVTEGDG
FT                   AFNLGVTAEDNAKLTYSSDNNGVVRVDENGNVTIAGVGAATITVKSEATTSYKAGSKTI
FT                   RITVNAKPQPNQTPSVTIGCGNKTVTEGDAPFSLGASASNGAALSYQSSDPSIASVDGA
FT                   GNVTIYRAGSVQITAIAGEMAGWNSASSSITVTVNSKPQPQPVAPTEPSEQPQQN"
FT   CDS             complement(931399..932460)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09130"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92960"
FT                   /db_xref="GOA:D4JMC5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMC5"
FT                   /protein_id="CBK92960.1"
FT                   /translation="METENKKILSIIIPTYNAAKFLDKGLSSFIIDDNSLLNMLDIIVV
FT                   NDGSTDNSVEIAQKYVNKYPDVYRILNKENGGHGSAINEGVKIIKGSYFKVVDADDWVN
FT                   TDVLKETICYLKDNENKHENFADAVLMSYRSYVLQRENTDEYPYDDKYITKNGGPYNAG
FT                   YVDEHLYDFWWGLSLHGVIYNTQFYRNTGLTLSEGVFYEDQEFSIIPMAYAESIYAYDK
FT                   ALYEYRVGDVNQSVSIESSLKRLDHYEKVIMRLIEAGRDAEHFSIGGKQLWFDKTSKFI
FT                   NDYLQLCLIRNTDKKQLRKRMKLFVSQIEKKNTDMYKCVNKNYKVFCMLNKMHMSDKVY
FT                   QNYFIRLLHIVRH"
FT   CDS             complement(932542..933669)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09140"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92961"
FT                   /db_xref="GOA:D4JMC6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMC6"
FT                   /protein_id="CBK92961.1"
FT                   /translation="MSKILSIIIPTYNAEKFLNKGLSSFLVCRDTDAQTAQHNCKMATE
FT                   GRFEEIDIDKAILDKLEVIVVNDGTPDKSVEVAQKFVDWYPDTFVIVNKTNGGHGSAIN
FT                   TGVEHVRGKYLKVVDADDWVDTLALKHLVEYLEHVDSDAVIQSFRYYDISKDEYRPADV
FT                   SVPDFTGEYNLKDIVNMWDDVYDGLSFHGVIYNTWFYKALGYKLTEHVFYEDQEYATVP
FT                   FSYAKTVRFIQEELYVYRVGDVNQSVSAASQVKRLPDLEQVIFNVLEAEKSFAKMPQGG
FT                   KEHFIRKTSGIITSYYQIALIKNTDRQSGRAIVEQFNMRLAQKSALMYEAVQRKYKVFR
FT                   LFNKLHVSNSFYENQFAKLLELAKRVGRADRLYRK"
FT   CDS             complement(933742..934737)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09150"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92962"
FT                   /db_xref="GOA:D4JMC7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMC7"
FT                   /protein_id="CBK92962.1"
FT                   /translation="MEKLLTIVVPAYNVEKYIKNCLDSFIDLSVLRSLEILIVDDGSTD
FT                   STASLAHTYEQKYPYSFKVLSKENGGHGSTINYAIPRATGKYFKVVDGDDWLDKSLLPQ
FT                   FVQLLKHTHSDVISNDFNLVDDKTKKVTKRRKAVSNSYHYNREWGFAEAVMDPLITIHS
FT                   MTIRTDVLQKNDIRVDEHCFYEDQEYILYPIPYCTSITFSPLPLYQYRLGRSGQSVDIK
FT                   MMIKRHDQHLKVLDALFEYNNVHGNLQTYKKQYLERGIAEAVDDEYQIFLAKGNDTRNV
FT                   EQMKKFDEMLREEHPGVYQACNRKSVWMLRKTGFKIFPMAAWVYSRLRGN"
FT   CDS             complement(935070..936488)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09170"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92963"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMC8"
FT                   /protein_id="CBK92963.1"
FT                   /translation="MGKKLLKTFTNNIGFKILAIAFAFILWLVVYNLNDPVKTKTFTTT
FT                   VTVTGRDSVVDKGLWPTIKDSEKTISFSVSGKRSYLNELDDSDFYANVDLANIIVDKDD
FT                   TNKASVKVDIGCTKYRHSITFNGGDHMLPLSVEKYMQKQFEVKVSLDGSLSGAKALGNK
FT                   PQANPKVVKIGGPESIVSTIASANVNIKVDDNTIISDNQITDRGDLTLIDDNGDEIDIS
FT                   KLDVDSQYQSIAVTVDVLSTKEVPIKCTMTGSPAGGKSVLGVELSEESVMLKGNAEALN
FT                   NITSIDVGPIDISGATDDISTSVDLTGYLPDGVFIVNSSKAKLSIDIKIETNATSTMTL
FT                   NSSNITYDGLEEGYTITFVTDKSSVIVSGTKSDIDTLSGTTLKGKIDVTGLGTGTHTVT
FT                   VKPNLDETKYTWGEIKVQIVIGREGDGGGTTGTDGTGTASGSTTGDTGTGGSSSSGSTS
FT                   SGNTGNNGSDSSSH"
FT   CDS             complement(936454..937359)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09180"
FT                   /product="conserved hypothetical protein TIGR00159"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92964"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMC9"
FT                   /protein_id="CBK92964.1"
FT                   /translation="MDNVSGVLIRFKDQFLTFTNVPGIKIGVIDIIEILIISVLFYHIL
FT                   LWIKTTRAWNLFKGLIIILLFVLVAALFQMDTILWLAEKLFNIGLVALVVIFQPELRNA
FT                   LENIGGKTFLGDFFNTGRGEIEKFSDKTIDELVRACFAMGRVKTGALIVMEDEINLGEY
FT                   IRTGIDVDAILTSQLLINIFEKNTPLHDGAVIVRGNRVVSATCYLPLSDSLSLSKDLGT
FT                   RHRAAVGVSEISDSLTIIVSEETGAVSTAYKGHIEHDIDADHLRTQLKLLQNRHREPGK
FT                   FELIKRRFKNGKEASKNLHK"
FT   CDS             complement(937389..938426)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92965"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMD0"
FT                   /protein_id="CBK92965.1"
FT                   /translation="MNKLLEIKDKAVKFCGEYEHFILPVVRFAVAFIAFITIDLNIGYM
FT                   AKISSMLVALLLALVCALLPVNAILWIASIMILLDMYALSIEVFAITFVLFLVLYFVYF
FT                   RFAPKDGMLVILTPICFQLHIPSVMPVAAGLLRRAYSVVAIICGTLLYYFFDGIRQNAS
FT                   ALAEVVDKKGQSTTKLNVTMGQLLDNKEMFIVMAIFVITTLVVYQVRRLKINNSWTVAT
FT                   IAGGLIQLVALVVAYLVLGLPEKIIWLVLSTVVAIFAGVVIQFIFMNLDYARTENVQFE
FT                   DDEYYYYVKAVPKKMIAKEEKVVKHFGNTGSLGKKIPRHNQENISKEAIAKDLEIDENI
FT                   FEDDK"
FT   CDS             complement(938436..938846)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92966"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMD1"
FT                   /protein_id="CBK92966.1"
FT                   /translation="MINEEKVRELFNIALCDSKSDDSRVQKQSASYYGWDYIWKEGLKS
FT                   FFTGTFAFAGLVVMWVAVNAAELLDRINKLDFKAMGVTIGILYIAFMAVYIFVTIVVYT
FT                   ARYKAGRREVRKYANHLKAVGRIYSREEKIKR"
FT   CDS             complement(938865..939269)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92967"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMD2"
FT                   /protein_id="CBK92967.1"
FT                   /translation="MRISNCKGCGRIFNVLSDEQYCPNCQKKMDEKFDIVKRFVEDNPN
FT                   VPVETVAKETDTSMKQINRWIREERLSFSPDSSYGIPCENCGRMIRTGRFCDECKTKLT
FT                   NTLRSALDTPKSQDRQLWQQDDKNRMRYIR"
FT   CDS             complement(940156..941154)
FT                   /transl_table=11
FT                   /locus_tag="ERE_09230"
FT                   /product="rod shape-determining protein MreB"
FT                   /function="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:ERE_09230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK92968"
FT                   /db_xref="GOA:D4JMD3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D4JMD3"
FT                   /protein_id="CBK92968.1"
FT                   /translation="MVGSDIGIDLGTASILVYIKGKGVVLKEPSVVAFDRDTNKIKAIG
FT                   EEARLMLGRTPGNIVAVRPLRQGVISDYTVTEKMIKHFIQKALGKKSFRKPLVSVCVPS
FT                   GVTEVEKKAVEDATFAAGARDVKIIEEPIAAAIGAGIDISKPCGNMIVDIGGGTSDIAV
FT                   ISLGGSVVSTSIKIAGDDFDEAIVRYMRKKHNLLIGERTAEDIKIKIGTCYPLPQPETI
FT                   EVRGRNLVTGLPRTITVSSEETEEALREATLQIVEAVHSVLEKTPPELAADVADRGIVL
FT                   TGGGSLLRGLEELIEEKTGINTMTAEQPMTCVAIGTGKYVEFLAGKRDEEF"
FT   CDS             complement(941270..944122)
FT