
EBI Dbfetch

ID   FP929042; SV 1; linear; genomic DNA; STD; PRO; 3344951 BP.
AC   FP929042;
PR   Project:PRJNA39159;
DT   25-MAR-2010 (Rel. 104, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
DE   Eubacterium rectale DSM 17629 draft genome.
KW   .
OS   Eubacterium rectale DSM 17629
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Eubacteriaceae;
OC   Eubacterium.
RN   [1]
RG   metaHIT consortium --
RA   Pajon A., Turner K., Parkhill J., Duncan S., Flint H.;
RT   "The genome sequence of Eubacterium rectale A1-86 (DSM 17629)";
RL   Unpublished.
RN   [2]
RA   Pajon A.;
RT   ;
RL   Submitted (23-MAR-2010) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
DR   MD5; 88fe34f82f0a3690abd5c46a6071c8bb.
DR   BioSample; SAMEA3138356.
DR   EnsemblGenomes-Gn; EUR_R_33170.
DR   EnsemblGenomes-Gn; EUR_R_33180.
DR   EnsemblGenomes-Gn; EUR_T_32720.
DR   EnsemblGenomes-Gn; EUR_T_32730.
DR   EnsemblGenomes-Gn; EUR_T_32740.
DR   EnsemblGenomes-Gn; EUR_T_32750.
DR   EnsemblGenomes-Gn; EUR_T_32760.
DR   EnsemblGenomes-Gn; EUR_T_32770.
DR   EnsemblGenomes-Gn; EUR_T_32780.
DR   EnsemblGenomes-Gn; EUR_T_32790.
DR   EnsemblGenomes-Gn; EUR_T_32800.
DR   EnsemblGenomes-Gn; EUR_T_32810.
DR   EnsemblGenomes-Gn; EUR_T_32820.
DR   EnsemblGenomes-Gn; EUR_T_32830.
DR   EnsemblGenomes-Gn; EUR_T_32840.
DR   EnsemblGenomes-Gn; EUR_T_32850.
DR   EnsemblGenomes-Gn; EUR_T_32860.
DR   EnsemblGenomes-Gn; EUR_T_32870.
DR   EnsemblGenomes-Gn; EUR_T_32880.
DR   EnsemblGenomes-Gn; EUR_T_32890.
DR   EnsemblGenomes-Gn; EUR_T_32900.
DR   EnsemblGenomes-Gn; EUR_T_32910.
DR   EnsemblGenomes-Gn; EUR_T_32920.
DR   EnsemblGenomes-Gn; EUR_T_32930.
DR   EnsemblGenomes-Gn; EUR_T_32940.
DR   EnsemblGenomes-Gn; EUR_T_32950.
DR   EnsemblGenomes-Gn; EUR_T_32960.
DR   EnsemblGenomes-Gn; EUR_T_32970.
DR   EnsemblGenomes-Gn; EUR_T_32980.
DR   EnsemblGenomes-Gn; EUR_T_32990.
DR   EnsemblGenomes-Gn; EUR_T_33000.
DR   EnsemblGenomes-Gn; EUR_T_33010.
DR   EnsemblGenomes-Gn; EUR_T_33020.
DR   EnsemblGenomes-Gn; EUR_T_33030.
DR   EnsemblGenomes-Gn; EUR_T_33040.
DR   EnsemblGenomes-Gn; EUR_T_33050.
DR   EnsemblGenomes-Gn; EUR_T_33060.
DR   EnsemblGenomes-Gn; EUR_T_33070.
DR   EnsemblGenomes-Gn; EUR_T_33080.
DR   EnsemblGenomes-Gn; EUR_T_33090.
DR   EnsemblGenomes-Gn; EUR_T_33100.
DR   EnsemblGenomes-Gn; EUR_T_33110.
DR   EnsemblGenomes-Gn; EUR_T_33120.
DR   EnsemblGenomes-Gn; EUR_T_33130.
DR   EnsemblGenomes-Gn; EUR_T_33140.
DR   EnsemblGenomes-Gn; EUR_T_33150.
DR   EnsemblGenomes-Gn; EUR_T_33160.
DR   EnsemblGenomes-Tr; EUR_R_33170.
DR   EnsemblGenomes-Tr; EUR_R_33180.
DR   EnsemblGenomes-Tr; EUR_T_32720.
DR   EnsemblGenomes-Tr; EUR_T_32730.
DR   EnsemblGenomes-Tr; EUR_T_32740.
DR   EnsemblGenomes-Tr; EUR_T_32750.
DR   EnsemblGenomes-Tr; EUR_T_32760.
DR   EnsemblGenomes-Tr; EUR_T_32770.
DR   EnsemblGenomes-Tr; EUR_T_32780.
DR   EnsemblGenomes-Tr; EUR_T_32790.
DR   EnsemblGenomes-Tr; EUR_T_32800.
DR   EnsemblGenomes-Tr; EUR_T_32810.
DR   EnsemblGenomes-Tr; EUR_T_32820.
DR   EnsemblGenomes-Tr; EUR_T_32830.
DR   EnsemblGenomes-Tr; EUR_T_32840.
DR   EnsemblGenomes-Tr; EUR_T_32850.
DR   EnsemblGenomes-Tr; EUR_T_32860.
DR   EnsemblGenomes-Tr; EUR_T_32870.
DR   EnsemblGenomes-Tr; EUR_T_32880.
DR   EnsemblGenomes-Tr; EUR_T_32890.
DR   EnsemblGenomes-Tr; EUR_T_32900.
DR   EnsemblGenomes-Tr; EUR_T_32910.
DR   EnsemblGenomes-Tr; EUR_T_32920.
DR   EnsemblGenomes-Tr; EUR_T_32930.
DR   EnsemblGenomes-Tr; EUR_T_32940.
DR   EnsemblGenomes-Tr; EUR_T_32950.
DR   EnsemblGenomes-Tr; EUR_T_32960.
DR   EnsemblGenomes-Tr; EUR_T_32970.
DR   EnsemblGenomes-Tr; EUR_T_32980.
DR   EnsemblGenomes-Tr; EUR_T_32990.
DR   EnsemblGenomes-Tr; EUR_T_33000.
DR   EnsemblGenomes-Tr; EUR_T_33010.
DR   EnsemblGenomes-Tr; EUR_T_33020.
DR   EnsemblGenomes-Tr; EUR_T_33030.
DR   EnsemblGenomes-Tr; EUR_T_33040.
DR   EnsemblGenomes-Tr; EUR_T_33050.
DR   EnsemblGenomes-Tr; EUR_T_33060.
DR   EnsemblGenomes-Tr; EUR_T_33070.
DR   EnsemblGenomes-Tr; EUR_T_33080.
DR   EnsemblGenomes-Tr; EUR_T_33090.
DR   EnsemblGenomes-Tr; EUR_T_33100.
DR   EnsemblGenomes-Tr; EUR_T_33110.
DR   EnsemblGenomes-Tr; EUR_T_33120.
DR   EnsemblGenomes-Tr; EUR_T_33130.
DR   EnsemblGenomes-Tr; EUR_T_33140.
DR   EnsemblGenomes-Tr; EUR_T_33150.
DR   EnsemblGenomes-Tr; EUR_T_33160.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01699; Clostridiales-1.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; FP929042.
DR   SILVA-SSU; FP929042.
DR   StrainInfo; 890265; 0.
CC   This is a reference genome for the metaHIT project
CC   DNA source: Rowett Institute of Nutrition and Health, University of
CC   Aberdeen --
CC   Sequencing technology: 454
CC   Genome coverage: 25x
CC   Annotation was added using ab initio prediction IMG/ER --
CC (Markowitz, Szeto et al. 2007).
FH   Key             Location/Qualifiers
FT   source          1..3344951
FT                   /organism="Eubacterium rectale DSM 17629"
FT                   /strain="DSM 17629"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:657318"
FT   rRNA            53..1573
FT                   /gene="16S"
FT                   /locus_tag="EUR_R_33180"
FT                   /product="16S rRNA"
FT   gap             1594..2577
FT                   /estimated_length=984
FT   rRNA            2732..5615
FT                   /gene="23S"
FT                   /locus_tag="EUR_R_33170"
FT                   /product="23S rRNA"
FT   tRNA            5647..5720
FT                   /locus_tag="EUR_T_32720"
FT   tRNA            5801..5873
FT                   /locus_tag="EUR_T_32730"
FT   tRNA            5899..5971
FT                   /locus_tag="EUR_T_32740"
FT   tRNA            6001..6082
FT                   /locus_tag="EUR_T_32750"
FT   tRNA            6112..6185
FT                   /locus_tag="EUR_T_32760"
FT   tRNA            6205..6277
FT                   /locus_tag="EUR_T_32770"
FT   tRNA            6292..6364
FT                   /locus_tag="EUR_T_32780"
FT   CDS             complement(6729..7286)
FT                   /transl_table=11
FT                   /locus_tag="EUR_00100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89271"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1I1"
FT                   /protein_id="CBK89271.1"
FT   CDS             7622..8665
FT                   /transl_table=11
FT                   /locus_tag="EUR_00110"
FT                   /product="aldose 1-epimerase"
FT                   /function="aldose 1-epimerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89272"
FT                   /db_xref="GOA:D6E1I2"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1I2"
FT                   /protein_id="CBK89272.1"
FT                   DYKFSVK"
FT   CDS             9065..9169
FT                   /transl_table=11
FT                   /locus_tag="EUR_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89273"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1I3"
FT                   /protein_id="CBK89273.1"
FT   CDS             9271..10206
FT                   /transl_table=11
FT                   /locus_tag="EUR_00130"
FT                   /product="Lactate dehydrogenase and related dehydrogenases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89274"
FT                   /db_xref="GOA:D6E1I4"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1I4"
FT                   /protein_id="CBK89274.1"
FT   CDS             10327..12264
FT                   /transl_table=11
FT                   /locus_tag="EUR_00140"
FT                   /product="Phosphoglycerol transferase and related proteins,
FT                   alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89275"
FT                   /db_xref="GOA:D6E1I5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1I5"
FT                   /protein_id="CBK89275.1"
FT                   RSSLLFPYLK"
FT   CDS             12337..14559
FT                   /transl_table=11
FT                   /locus_tag="EUR_00150"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED/haloacid
FT                   dehalogenase superfamily, subfamily IA, variant 1 with
FT                   third motif having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89276"
FT                   /db_xref="GOA:D6E1I6"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1I6"
FT                   /protein_id="CBK89276.1"
FT   CDS             14578..16542
FT                   /transl_table=11
FT                   /locus_tag="EUR_00160"
FT                   /product="Transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89277"
FT                   /db_xref="GOA:D6E1I7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1I7"
FT                   /protein_id="CBK89277.1"
FT   CDS             16749..17012
FT                   /transl_table=11
FT                   /locus_tag="EUR_00170"
FT                   /product="Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89278"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1I8"
FT                   /protein_id="CBK89278.1"
FT   CDS             17043..18743
FT                   /transl_table=11
FT                   /locus_tag="EUR_00180"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /function="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89279"
FT                   /db_xref="GOA:D6E1I9"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1I9"
FT                   /protein_id="CBK89279.1"
FT   CDS             19000..20418
FT                   /transl_table=11
FT                   /locus_tag="EUR_00190"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89280"
FT                   /db_xref="GOA:D6E1J0"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1J0"
FT                   /protein_id="CBK89280.1"
FT                   QIYEYLKDRGITAF"
FT   CDS             20466..21161
FT                   /transl_table=11
FT                   /locus_tag="EUR_00200"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89281"
FT                   /db_xref="GOA:D6E1J1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1J1"
FT                   /protein_id="CBK89281.1"
FT                   WGKGYKFEK"
FT   CDS             22460..23227
FT                   /transl_table=11
FT                   /locus_tag="EUR_00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89282"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1J2"
FT                   /protein_id="CBK89282.1"
FT   CDS             23217..24605
FT                   /transl_table=11
FT                   /locus_tag="EUR_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89283"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1J3"
FT                   /protein_id="CBK89283.1"
FT                   AENI"
FT   CDS             24602..25231
FT                   /transl_table=11
FT                   /locus_tag="EUR_00240"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89284"
FT                   /db_xref="GOA:D6E1J4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1J4"
FT                   /protein_id="CBK89284.1"
FT   CDS             25357..26682
FT                   /transl_table=11
FT                   /locus_tag="EUR_00250"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89285"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1J5"
FT                   /protein_id="CBK89285.1"
FT   CDS             26691..27353
FT                   /transl_table=11
FT                   /locus_tag="EUR_00260"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89286"
FT                   /db_xref="GOA:D6E1J6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1J6"
FT                   /protein_id="CBK89286.1"
FT   CDS             27343..28611
FT                   /transl_table=11
FT                   /locus_tag="EUR_00270"
FT                   /product="Predicted permease."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89287"
FT                   /db_xref="GOA:D6E1J7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1J7"
FT                   /protein_id="CBK89287.1"
FT   CDS             28675..29370
FT                   /transl_table=11
FT                   /locus_tag="EUR_00280"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89288"
FT                   /db_xref="GOA:D6E1J8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1J8"
FT                   /protein_id="CBK89288.1"
FT                   WGRGYRFER"
FT   CDS             30613..31059
FT                   /transl_table=11
FT                   /locus_tag="EUR_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89289"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1J9"
FT                   /protein_id="CBK89289.1"
FT   CDS             complement(31106..32407)
FT                   /transl_table=11
FT                   /locus_tag="EUR_00310"
FT                   /product="Flagellar capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89290"
FT                   /db_xref="GOA:D6E1K0"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1K0"
FT                   /protein_id="CBK89290.1"
FT   CDS             33027..33242
FT                   /transl_table=11
FT                   /locus_tag="EUR_00330"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /function="protein translocase subunit secE/sec61 gamma"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89291"
FT                   /db_xref="GOA:D6E1K1"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1K1"
FT                   /protein_id="CBK89291.1"
FT   CDS             33261..33779
FT                   /transl_table=11
FT                   /locus_tag="EUR_00340"
FT                   /product="transcription antitermination protein nusG"
FT                   /function="transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89292"
FT                   /db_xref="GOA:D6E1K2"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1K2"
FT                   /protein_id="CBK89292.1"
FT                   SFADVKKTN"
FT   CDS             33794..34219
FT                   /transl_table=11
FT                   /locus_tag="EUR_00350"
FT                   /product="LSU ribosomal protein L11P"
FT                   /function="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89293"
FT                   /db_xref="GOA:D6E1K3"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1K3"
FT                   /protein_id="CBK89293.1"
FT   CDS             34349..35044
FT                   /transl_table=11
FT                   /locus_tag="EUR_00360"
FT                   /product="ribosomal protein L1, bacterial/chloroplast"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89294"
FT                   /db_xref="GOA:D6E1K4"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1K4"
FT                   /protein_id="CBK89294.1"
FT                   KLNVVKITQ"
FT   CDS             35935..36309
FT                   /transl_table=11
FT                   /locus_tag="EUR_00380"
FT                   /product="LSU ribosomal protein L12P"
FT                   /function="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89295"
FT                   /db_xref="GOA:D6E1K5"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1K5"
FT                   /protein_id="CBK89295.1"
FT   gap             36332..36903
FT                   /estimated_length=572
FT   CDS             37233..41174
FT                   /transl_table=11
FT                   /locus_tag="EUR_00390"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /function="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89296"
FT                   /db_xref="GOA:D6E1K6"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1K6"
FT                   /protein_id="CBK89296.1"
FT   CDS             41193..45041
FT                   /transl_table=11
FT                   /locus_tag="EUR_00400"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /function="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89297"
FT                   /db_xref="GOA:D6E1K7"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1K7"
FT                   /protein_id="CBK89297.1"
FT   CDS             45229..45648
FT                   /transl_table=11
FT                   /locus_tag="EUR_00410"
FT                   /product="SSU ribosomal protein S12P"
FT                   /function="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89298"
FT                   /db_xref="GOA:D6E1K8"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1K8"
FT                   /protein_id="CBK89298.1"
FT   CDS             48722..49909
FT                   /transl_table=11
FT                   /locus_tag="EUR_00440"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /function="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89299"
FT                   /db_xref="GOA:D6E1K9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1K9"
FT                   /protein_id="CBK89299.1"
FT   CDS             50769..50876
FT                   /transl_table=11
FT                   /locus_tag="EUR_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89300"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1L0"
FT                   /protein_id="CBK89300.1"
FT   CDS             50958..52112
FT                   /transl_table=11
FT                   /locus_tag="EUR_00470"
FT                   /product="Predicted Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89301"
FT                   /db_xref="GOA:D6E1L1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1L1"
FT                   /protein_id="CBK89301.1"
FT   CDS             52130..53389
FT                   /transl_table=11
FT                   /locus_tag="EUR_00480"
FT                   /product="Major Facilitator Superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89302"
FT                   /db_xref="GOA:D6E1L2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR022324"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1L2"
FT                   /protein_id="CBK89302.1"
FT   CDS             53401..53478
FT                   /transl_table=11
FT                   /locus_tag="EUR_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89303"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1L3"
FT                   /protein_id="CBK89303.1"
FT                   /translation="MKNWLLFGYKLKLIEKSINNRREAF"
FT   gap             54016..55038
FT                   /estimated_length=1023
FT   CDS             55380..55904
FT                   /transl_table=11
FT                   /locus_tag="EUR_00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89304"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1L4"
FT                   /protein_id="CBK89304.1"
FT                   YATKVEAKREM"
FT   CDS             56161..56463
FT                   /transl_table=11
FT                   /locus_tag="EUR_00530"
FT                   /product="Stress responsive A/B Barrel Domain."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89305"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1L5"
FT                   /protein_id="CBK89305.1"
FT   CDS             56626..57948
FT                   /transl_table=11
FT                   /locus_tag="EUR_00540"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89306"
FT                   /db_xref="GOA:D6E1L6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1L6"
FT                   /protein_id="CBK89306.1"
FT   CDS             58105..59604
FT                   /transl_table=11
FT                   /locus_tag="EUR_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89307"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1L7"
FT                   /protein_id="CBK89307.1"
FT   CDS             59620..60345
FT                   /transl_table=11
FT                   /locus_tag="EUR_00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89308"
FT                   /db_xref="InterPro:IPR025449"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1L8"
FT                   /protein_id="CBK89308.1"
FT   CDS             63700..64164
FT                   /transl_table=11
FT                   /locus_tag="EUR_00580"
FT                   /product="Carbonic anhydrases/acetyltransferases,
FT                   isoleucine patch superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89309"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1L9"
FT                   /protein_id="CBK89309.1"
FT   CDS             64272..65666
FT                   /transl_table=11
FT                   /locus_tag="EUR_00590"
FT                   /product="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89310"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1M0"
FT                   /protein_id="CBK89310.1"
FT                   PRHENN"
FT   CDS             65697..66440
FT                   /transl_table=11
FT                   /locus_tag="EUR_00600"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89311"
FT                   /db_xref="GOA:D6E1M1"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1M1"
FT                   /protein_id="CBK89311.1"
FT   CDS             66618..66731
FT                   /transl_table=11
FT                   /locus_tag="EUR_00610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89312"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1M2"
FT                   /protein_id="CBK89312.1"
FT   CDS             66749..66964
FT                   /transl_table=11
FT                   /locus_tag="EUR_00620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89313"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1M3"
FT                   /protein_id="CBK89313.1"
FT   CDS             69305..69784
FT                   /transl_table=11
FT                   /locus_tag="EUR_00640"
FT                   /product="ybaK/ebsC protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89314"
FT                   /db_xref="GOA:D6E1M4"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1M4"
FT                   /protein_id="CBK89314.1"
FT   CDS             69928..71016
FT                   /transl_table=11
FT                   /locus_tag="EUR_00650"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /function="tryptophanyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89315"
FT                   /db_xref="GOA:D6E1M5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1M5"
FT                   /protein_id="CBK89315.1"
FT   CDS             71102..72043
FT                   /transl_table=11
FT                   /locus_tag="EUR_00660"
FT                   /product="Mg2+ and Co2+ transporters"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89316"
FT                   /db_xref="GOA:D6E1M6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1M6"
FT                   /protein_id="CBK89316.1"
FT   CDS             complement(72124..73011)
FT                   /transl_table=11
FT                   /locus_tag="EUR_00670"
FT                   /product="Predicted SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89317"
FT                   /db_xref="GOA:D6E1M7"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1M7"
FT                   /protein_id="CBK89317.1"
FT                   VLPCGASGRFESIC"
FT   CDS             73427..73744
FT                   /transl_table=11
FT                   /locus_tag="EUR_00680"
FT                   /product="SSU ribosomal protein S10P"
FT                   /function="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89318"
FT                   /db_xref="GOA:D6E1M8"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1M8"
FT                   /protein_id="CBK89318.1"
FT                   K"
FT   CDS             73923..74606
FT                   /transl_table=11
FT                   /locus_tag="EUR_00690"
FT                   /product="LSU ribosomal protein L3P"
FT                   /function="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89319"
FT                   /db_xref="GOA:D6E1M9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1M9"
FT                   /protein_id="CBK89319.1"
FT                   TKSGK"
FT   CDS             74635..75255
FT                   /transl_table=11
FT                   /locus_tag="EUR_00700"
FT                   /product="LSU ribosomal protein L4P"
FT                   /function="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89320"
FT                   /db_xref="GOA:D6E1N0"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1N0"
FT                   /protein_id="CBK89320.1"
FT   CDS             75255..75554
FT                   /transl_table=11
FT                   /locus_tag="EUR_00710"
FT                   /product="Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89321"
FT                   /db_xref="GOA:D6E1N1"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1N1"
FT                   /protein_id="CBK89321.1"
FT   CDS             75634..76479
FT                   /transl_table=11
FT                   /locus_tag="EUR_00720"
FT                   /product="LSU ribosomal protein L2P"
FT                   /function="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89322"
FT                   /db_xref="GOA:D6E1N2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1N2"
FT                   /protein_id="CBK89322.1"
FT                   "
FT   CDS             76496..76777
FT                   /transl_table=11
FT                   /locus_tag="EUR_00730"
FT                   /product="SSU ribosomal protein S19P"
FT                   /function="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89323"
FT                   /db_xref="GOA:D6E1N3"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1N3"
FT                   /protein_id="CBK89323.1"
FT   CDS             76803..77198
FT                   /transl_table=11
FT                   /locus_tag="EUR_00740"
FT                   /product="LSU ribosomal protein L22P"
FT                   /function="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89324"
FT                   /db_xref="GOA:D6E1N4"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1N4"
FT                   /protein_id="CBK89324.1"
FT   CDS             77208..77864
FT                   /transl_table=11
FT                   /locus_tag="EUR_00750"
FT                   /product="SSU ribosomal protein S3P"
FT                   /function="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89325"
FT                   /db_xref="GOA:D6E1N5"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1N5"
FT                   /protein_id="CBK89325.1"
FT   CDS             77867..78304
FT                   /transl_table=11
FT                   /locus_tag="EUR_00760"
FT                   /product="LSU ribosomal protein L16P"
FT                   /function="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89326"
FT                   /db_xref="GOA:D6E1N6"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1N6"
FT                   /protein_id="CBK89326.1"
FT   CDS             78294..78497
FT                   /transl_table=11
FT                   /locus_tag="EUR_00770"
FT                   /product="LSU ribosomal protein L29P"
FT                   /function="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89327"
FT                   /db_xref="GOA:D6E1N7"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1N7"
FT                   /protein_id="CBK89327.1"
FT   CDS             78804..79172
FT                   /transl_table=11
FT                   /locus_tag="EUR_00790"
FT                   /product="LSU ribosomal protein L14P"
FT                   /function="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89328"
FT                   /db_xref="GOA:D6E1N8"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR023571"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1N8"
FT                   /protein_id="CBK89328.1"
FT                   ELREKQFMKIVSLAPEVL"
FT   CDS             79184..79495
FT                   /transl_table=11
FT                   /locus_tag="EUR_00800"
FT                   /product="LSU ribosomal protein L24P"
FT                   /function="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89329"
FT                   /db_xref="GOA:D6E1N9"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1N9"
FT                   /protein_id="CBK89329.1"
FT   CDS             80073..80258
FT                   /transl_table=11
FT                   /locus_tag="EUR_00820"
FT                   /product="Ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89330"
FT                   /db_xref="GOA:D6E1P0"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1P0"
FT                   /protein_id="CBK89330.1"
FT                   ELAYKGQIPGVKKASW"
FT   CDS             80393..80797
FT                   /transl_table=11
FT                   /locus_tag="EUR_00830"
FT                   /product="Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89331"
FT                   /db_xref="GOA:D6E1P1"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1P1"
FT                   /protein_id="CBK89331.1"
FT   CDS             80969..81508
FT                   /transl_table=11
FT                   /locus_tag="EUR_00840"
FT                   /product="LSU ribosomal protein L6P"
FT                   /function="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89332"
FT                   /db_xref="GOA:D6E1P2"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1P2"
FT                   /protein_id="CBK89332.1"
FT                   YADEVIRRKVGKTGKK"
FT   CDS             81528..81896
FT                   /transl_table=11
FT                   /locus_tag="EUR_00850"
FT                   /product="LSU ribosomal protein L18P"
FT                   /function="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89333"
FT                   /db_xref="GOA:D6E1P3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1P3"
FT                   /protein_id="CBK89333.1"
FT                   AGKVKALAEAAREAGLDF"
FT   CDS             81909..82418
FT                   /transl_table=11
FT                   /locus_tag="EUR_00860"
FT                   /product="SSU ribosomal protein S5P"
FT                   /function="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89334"
FT                   /db_xref="GOA:D6E1P4"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1P4"
FT                   /protein_id="CBK89334.1"
FT                   VEEILG"
FT   CDS             82432..82614
FT                   /transl_table=11
FT                   /locus_tag="EUR_00870"
FT                   /product="LSU ribosomal protein L30P"
FT                   /function="LSU ribosomal protein L30P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89335"
FT                   /db_xref="GOA:D6E1P5"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1P5"
FT                   /protein_id="CBK89335.1"
FT                   GAVRKVAPYVKVEEV"
FT   CDS             82638..83078
FT                   /transl_table=11
FT                   /locus_tag="EUR_00880"
FT                   /product="LSU ribosomal protein L15P"
FT                   /function="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89336"
FT                   /db_xref="GOA:D6E1P6"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1P6"
FT                   /protein_id="CBK89336.1"
FT   CDS             83078..84397
FT                   /transl_table=11
FT                   /locus_tag="EUR_00890"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /function="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89337"
FT                   /db_xref="GOA:D6E1P7"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1P7"
FT                   /protein_id="CBK89337.1"
FT   CDS             84474..85118
FT                   /transl_table=11
FT                   /locus_tag="EUR_00900"
FT                   /product="Adenylate kinase"
FT                   /function="Adenylate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89338"
FT                   /db_xref="GOA:D6E1P8"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1P8"
FT                   /protein_id="CBK89338.1"
FT   CDS             85121..85915
FT                   /transl_table=11
FT                   /locus_tag="EUR_00910"
FT                   /product="methionine aminopeptidase, type I"
FT                   /function="methionine aminopeptidase, type I"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89339"
FT                   /db_xref="GOA:D6E1P9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1P9"
FT                   /protein_id="CBK89339.1"
FT   CDS             85963..86181
FT                   /transl_table=11
FT                   /locus_tag="EUR_00920"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89340"
FT                   /db_xref="GOA:D6E1Q0"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Q0"
FT                   /protein_id="CBK89340.1"
FT   CDS             86724..87092
FT                   /transl_table=11
FT                   /locus_tag="EUR_00940"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89341"
FT                   /db_xref="GOA:D6E1Q1"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Q1"
FT                   /protein_id="CBK89341.1"
FT                   TNARTRKGPKRTVANKKK"
FT   CDS             87217..87612
FT                   /transl_table=11
FT                   /locus_tag="EUR_00950"
FT                   /product="SSU ribosomal protein S11P"
FT                   /function="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89342"
FT                   /db_xref="GOA:D6E1Q2"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Q2"
FT                   /protein_id="CBK89342.1"
FT   CDS             87632..88225
FT                   /transl_table=11
FT                   /locus_tag="EUR_00960"
FT                   /product="SSU ribosomal protein S4P"
FT                   /function="SSU ribosomal protein S4P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89343"
FT                   /db_xref="GOA:D6E1Q3"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Q3"
FT                   /protein_id="CBK89343.1"
FT   CDS             89542..90066
FT                   /transl_table=11
FT                   /locus_tag="EUR_00980"
FT                   /product="LSU ribosomal protein L17P"
FT                   /function="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89344"
FT                   /db_xref="GOA:D6E1Q4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Q4"
FT                   /protein_id="CBK89344.1"
FT                   DGALEVLLELV"
FT   CDS             complement(90321..91514)
FT                   /transl_table=11
FT                   /locus_tag="EUR_00990"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_00990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89345"
FT                   /db_xref="GOA:D6E1Q5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Q5"
FT                   /protein_id="CBK89345.1"
FT   CDS             complement(91572..92555)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01000"
FT                   /product="replicative DNA helicase loader DnaI"
FT                   /function="replicative DNA helicase loader DnaI"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89346"
FT                   /db_xref="GOA:D6E1Q6"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Q6"
FT                   /protein_id="CBK89346.1"
FT   CDS             complement(92593..93834)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01010"
FT                   /product="DnaD and phage-associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89347"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Q7"
FT                   /protein_id="CBK89347.1"
FT                   DYDKLEKLFLNSTV"
FT   CDS             complement(94092..95471)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01020"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /function="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89348"
FT                   /db_xref="GOA:D6E1Q8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Q8"
FT                   /protein_id="CBK89348.1"
FT                   K"
FT   CDS             95774..97273
FT                   /transl_table=11
FT                   /locus_tag="EUR_01030"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89349"
FT                   /db_xref="GOA:D6E1Q9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Q9"
FT                   /protein_id="CBK89349.1"
FT   CDS             97270..98388
FT                   /transl_table=11
FT                   /locus_tag="EUR_01040"
FT                   /product="ADP-glucose pyrophosphorylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89350"
FT                   /db_xref="GOA:D6E1R0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1R0"
FT                   /protein_id="CBK89350.1"
FT   CDS             98412..98675
FT                   /transl_table=11
FT                   /locus_tag="EUR_01050"
FT                   /product="Uncharacterized protein, involved in the
FT                   regulation of septum location"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89351"
FT                   /db_xref="GOA:D6E1R1"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1R1"
FT                   /protein_id="CBK89351.1"
FT   gap             98898..99435
FT                   /estimated_length=538
FT   CDS             99464..99958
FT                   /transl_table=11
FT                   /locus_tag="EUR_01060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89352"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1R2"
FT                   /protein_id="CBK89352.1"
FT                   V"
FT   CDS             100066..100869
FT                   /transl_table=11
FT                   /locus_tag="EUR_01070"
FT                   /product="3-methyladenine DNA glycosylase/8-oxoguanine DNA
FT                   glycosylase"
FT                   /EC_number=""
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89353"
FT                   /db_xref="GOA:D6E1R3"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1R3"
FT                   /protein_id="CBK89353.1"
FT   CDS             100898..101458
FT                   /transl_table=11
FT                   /locus_tag="EUR_01080"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /function="peptidyl-tRNA hydrolase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89354"
FT                   /db_xref="GOA:D6E1R4"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1R4"
FT                   /protein_id="CBK89354.1"
FT   CDS             105205..106425
FT                   /transl_table=11
FT                   /locus_tag="EUR_01100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89355"
FT                   /db_xref="GOA:D6E1R5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1R5"
FT                   /protein_id="CBK89355.1"
FT                   AVDGTEN"
FT   CDS             106409..106915
FT                   /transl_table=11
FT                   /locus_tag="EUR_01110"
FT                   /product="Shikimate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89356"
FT                   /db_xref="GOA:D6E1R6"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1R6"
FT                   /protein_id="CBK89356.1"
FT                   EALEL"
FT   CDS             107103..108395
FT                   /transl_table=11
FT                   /locus_tag="EUR_01120"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89357"
FT                   /db_xref="GOA:D6E1R7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1R7"
FT                   /protein_id="CBK89357.1"
FT   CDS             complement(108554..109684)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01130"
FT                   /product="uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89358"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1R8"
FT                   /protein_id="CBK89358.1"
FT   CDS             110134..111315
FT                   /transl_table=11
FT                   /locus_tag="EUR_01140"
FT                   /product="methionine adenosyltransferase"
FT                   /function="methionine adenosyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89359"
FT                   /db_xref="GOA:D6E1R9"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1R9"
FT                   /protein_id="CBK89359.1"
FT   CDS             111502..112191
FT                   /transl_table=11
FT                   /locus_tag="EUR_01150"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89360"
FT                   /db_xref="GOA:D6E1S0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1S0"
FT                   /protein_id="CBK89360.1"
FT                   VGYRFKL"
FT   CDS             112315..113814
FT                   /transl_table=11
FT                   /locus_tag="EUR_01160"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89361"
FT                   /db_xref="GOA:D6E1S1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1S1"
FT                   /protein_id="CBK89361.1"
FT   CDS             114058..115443
FT                   /transl_table=11
FT                   /locus_tag="EUR_01170"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89362"
FT                   /db_xref="GOA:D6E1S2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1S2"
FT                   /protein_id="CBK89362.1"
FT                   QMV"
FT   CDS             115541..116590
FT                   /transl_table=11
FT                   /locus_tag="EUR_01180"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89363"
FT                   /db_xref="GOA:D6E1S3"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1S3"
FT                   /protein_id="CBK89363.1"
FT                   KMRWAVRAE"
FT   CDS             116911..119163
FT                   /transl_table=11
FT                   /locus_tag="EUR_01190"
FT                   /product="formate acetyltransferase 1"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89364"
FT                   /db_xref="GOA:D6E1S4"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1S4"
FT                   /protein_id="CBK89364.1"
FT   CDS             119421..120170
FT                   /transl_table=11
FT                   /locus_tag="EUR_01200"
FT                   /product="pyruvate formate-lyase 1-activating enzyme"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89365"
FT                   /db_xref="GOA:D6E1S5"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1S5"
FT                   /protein_id="CBK89365.1"
FT   CDS             120351..121076
FT                   /transl_table=11
FT                   /locus_tag="EUR_01210"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /function="ribosomal large subunit pseudouridine synthase
FT                   D"
FT                   /EC_number=""
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89366"
FT                   /db_xref="GOA:D6E1S6"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1S6"
FT                   /protein_id="CBK89366.1"
FT   CDS             122077..122457
FT                   /transl_table=11
FT                   /locus_tag="EUR_01220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89367"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1S7"
FT                   /protein_id="CBK89367.1"
FT   CDS             123194..124477
FT                   /transl_table=11
FT                   /locus_tag="EUR_01240"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89368"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1S8"
FT                   /protein_id="CBK89368.1"
FT   CDS             124572..126080
FT                   /transl_table=11
FT                   /locus_tag="EUR_01250"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89369"
FT                   /db_xref="GOA:D6E1S9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1S9"
FT                   /protein_id="CBK89369.1"
FT   CDS             126099..127748
FT                   /transl_table=11
FT                   /locus_tag="EUR_01260"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89370"
FT                   /db_xref="GOA:D6E1T0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR030158"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1T0"
FT                   /protein_id="CBK89370.1"
FT   CDS             128172..129776
FT                   /transl_table=11
FT                   /locus_tag="EUR_01270"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /function="two component transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89371"
FT                   /db_xref="GOA:D6E1T1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1T1"
FT                   /protein_id="CBK89371.1"
FT                   YGVSPSRYRTEYEKNKV"
FT   CDS             129757..131550
FT                   /transl_table=11
FT                   /locus_tag="EUR_01280"
FT                   /product="Predicted signal transduction protein with a
FT                   C-terminal ATPase domain"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89372"
FT                   /db_xref="GOA:D6E1T2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1T2"
FT                   /protein_id="CBK89372.1"
FT   CDS             131547..132602
FT                   /transl_table=11
FT                   /locus_tag="EUR_01290"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89373"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1T3"
FT                   /protein_id="CBK89373.1"
FT                   ENKKLLYAISQ"
FT   CDS             132617..133657
FT                   /transl_table=11
FT                   /locus_tag="EUR_01300"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /function="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family (TC 3.A.1.2.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89374"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1T4"
FT                   /protein_id="CBK89374.1"
FT                   FVKDEQ"
FT   CDS             complement(133660..134502)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01310"
FT                   /product="transcriptional regulator, AraC family"
FT                   /function="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89375"
FT                   /db_xref="GOA:D6E1T5"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1T5"
FT                   /protein_id="CBK89375.1"
FT   CDS             134691..135992
FT                   /transl_table=11
FT                   /locus_tag="EUR_01320"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89376"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1T6"
FT                   /protein_id="CBK89376.1"
FT   CDS             135989..136864
FT                   /transl_table=11
FT                   /locus_tag="EUR_01330"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89377"
FT                   /db_xref="GOA:D6E1T7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1T7"
FT                   /protein_id="CBK89377.1"
FT                   GVMNKKEEQL"
FT   CDS             136864..137700
FT                   /transl_table=11
FT                   /locus_tag="EUR_01340"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89378"
FT                   /db_xref="GOA:D6E1T8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1T8"
FT                   /protein_id="CBK89378.1"
FT   CDS             137740..140580
FT                   /transl_table=11
FT                   /locus_tag="EUR_01350"
FT                   /product="Alpha-galactosidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89379"
FT                   /db_xref="GOA:D6E1T9"
FT                   /db_xref="InterPro:IPR000111"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1T9"
FT                   /protein_id="CBK89379.1"
FT                   KNARIVVGKDGKVYEQ"
FT   CDS             140570..142045
FT                   /transl_table=11
FT                   /locus_tag="EUR_01360"
FT                   /product="maltooligosyl trehalose synthase"
FT                   /function="maltooligosyl trehalose synthase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89380"
FT                   /db_xref="GOA:D6E1U0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022527"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1U0"
FT                   /protein_id="CBK89380.1"
FT   CDS             complement(142366..144165)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89381"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1U1"
FT                   /protein_id="CBK89381.1"
FT   CDS             144438..144932
FT                   /transl_table=11
FT                   /locus_tag="EUR_01380"
FT                   /product="G:T/U mismatch-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89382"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR026353"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1U2"
FT                   /protein_id="CBK89382.1"
FT                   L"
FT   CDS             144962..146311
FT                   /transl_table=11
FT                   /locus_tag="EUR_01390"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89383"
FT                   /db_xref="GOA:D6E1U3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1U3"
FT                   /protein_id="CBK89383.1"
FT   CDS             complement(146364..147389)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01400"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89384"
FT                   /db_xref="GOA:D6E1U4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1U4"
FT                   /protein_id="CBK89384.1"
FT                   Y"
FT   CDS             147780..149141
FT                   /transl_table=11
FT                   /locus_tag="EUR_01410"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89385"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1U5"
FT                   /protein_id="CBK89385.1"
FT   CDS             149172..150050
FT                   /transl_table=11
FT                   /locus_tag="EUR_01420"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89386"
FT                   /db_xref="GOA:D6E1U6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1U6"
FT                   /protein_id="CBK89386.1"
FT                   VLSFKVSGKEE"
FT   CDS             150063..150884
FT                   /transl_table=11
FT                   /locus_tag="EUR_01430"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89387"
FT                   /db_xref="GOA:D6E1U7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1U7"
FT                   /protein_id="CBK89387.1"
FT   CDS             150912..153305
FT                   /transl_table=11
FT                   /locus_tag="EUR_01440"
FT                   /product="Alpha-glucosidases, family 31 of glycosyl
FT                   hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89388"
FT                   /db_xref="GOA:D6E1U8"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1U8"
FT                   /protein_id="CBK89388.1"
FT   CDS             153511..155757
FT                   /transl_table=11
FT                   /locus_tag="EUR_01450"
FT                   /product="Alpha-glucosidases, family 31 of glycosyl
FT                   hydrolases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89389"
FT                   /db_xref="GOA:D6E1U9"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR030458"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1U9"
FT                   /protein_id="CBK89389.1"
FT   CDS             complement(155776..156531)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01460"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89390"
FT                   /db_xref="GOA:D6E1V0"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1V0"
FT                   /protein_id="CBK89390.1"
FT   CDS             complement(156588..157916)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01470"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89391"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1V1"
FT                   /protein_id="CBK89391.1"
FT   CDS             complement(158339..159736)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01480"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89392"
FT                   /db_xref="GOA:D6E1V2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1V2"
FT                   /protein_id="CBK89392.1"
FT                   PDGSDVL"
FT   CDS             160092..160532
FT                   /transl_table=11
FT                   /locus_tag="EUR_01490"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89393"
FT                   /db_xref="GOA:D6E1V3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1V3"
FT                   /protein_id="CBK89393.1"
FT   CDS             160529..161305
FT                   /transl_table=11
FT                   /locus_tag="EUR_01500"
FT                   /product="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89394"
FT                   /db_xref="GOA:D6E1V4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1V4"
FT                   /protein_id="CBK89394.1"
FT   CDS             161836..163548
FT                   /transl_table=11
FT                   /locus_tag="EUR_01510"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89395"
FT                   /db_xref="GOA:D6E1V5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1V5"
FT                   /protein_id="CBK89395.1"
FT   CDS             163570..165246
FT                   /transl_table=11
FT                   /locus_tag="EUR_01520"
FT                   /product="FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89396"
FT                   /db_xref="GOA:D6E1V6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1V6"
FT                   /protein_id="CBK89396.1"
FT   CDS             165361..166041
FT                   /transl_table=11
FT                   /locus_tag="EUR_01530"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89397"
FT                   /db_xref="GOA:D6E1V7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1V7"
FT                   /protein_id="CBK89397.1"
FT                   KSVN"
FT   CDS             166237..166638
FT                   /transl_table=11
FT                   /locus_tag="EUR_01540"
FT                   /product="hemerythrin-like metal-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89398"
FT                   /db_xref="GOA:D6E1V8"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1V8"
FT                   /protein_id="CBK89398.1"
FT   CDS             167013..168419
FT                   /transl_table=11
FT                   /locus_tag="EUR_01550"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89399"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1V9"
FT                   /protein_id="CBK89399.1"
FT                   YSDSGIDRRK"
FT   CDS             complement(168488..168796)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01560"
FT                   /product="Branched-chain amino acid transport protein
FT                   (AzlD)."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89400"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1W0"
FT                   /protein_id="CBK89400.1"
FT   CDS             complement(168841..169542)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01570"
FT                   /product="Predicted branched-chain amino acid permease
FT                   (azaleucine resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89401"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1W1"
FT                   /protein_id="CBK89401.1"
FT                   LFPVADDTDKE"
FT   gap             169925..170785
FT                   /estimated_length=861
FT   CDS             171863..172363
FT                   /transl_table=11
FT                   /locus_tag="EUR_01590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89402"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1W2"
FT                   /protein_id="CBK89402.1"
FT                   PRK"
FT   CDS             172372..173043
FT                   /transl_table=11
FT                   /locus_tag="EUR_01600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89403"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1W3"
FT                   /protein_id="CBK89403.1"
FT                   G"
FT   gap             173215..174155
FT                   /estimated_length=941
FT   CDS             174352..174657
FT                   /transl_table=11
FT                   /locus_tag="EUR_01610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89404"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1W4"
FT                   /protein_id="CBK89404.1"
FT   CDS             174672..175070
FT                   /transl_table=11
FT                   /locus_tag="EUR_01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89405"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1W5"
FT                   /protein_id="CBK89405.1"
FT   CDS             175115..175399
FT                   /transl_table=11
FT                   /locus_tag="EUR_01630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89406"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1W6"
FT                   /protein_id="CBK89406.1"
FT   CDS             175510..175770
FT                   /transl_table=11
FT                   /locus_tag="EUR_01640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89407"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1W7"
FT                   /protein_id="CBK89407.1"
FT   CDS             176133..176450
FT                   /transl_table=11
FT                   /locus_tag="EUR_01650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89408"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1W8"
FT                   /protein_id="CBK89408.1"
FT                   I"
FT   CDS             176813..177958
FT                   /transl_table=11
FT                   /locus_tag="EUR_01670"
FT                   /product="glycerate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89409"
FT                   /db_xref="GOA:D6E1W9"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1W9"
FT                   /protein_id="CBK89409.1"
FT   CDS             178053..179492
FT                   /transl_table=11
FT                   /locus_tag="EUR_01680"
FT                   /product="prolyl-tRNA synthetase, family I"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89410"
FT                   /db_xref="GOA:D6E1X0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1X0"
FT                   /protein_id="CBK89410.1"
FT   CDS             179508..180848
FT                   /transl_table=11
FT                   /locus_tag="EUR_01690"
FT                   /product="uncharacterized domain HDIG"
FT                   /EC_number="3.1.3.-"
FT                   /EC_number=""
FT                   /EC_number="3.1.4.-"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89411"
FT                   /db_xref="GOA:D6E1X1"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1X1"
FT                   /protein_id="CBK89411.1"
FT   CDS             181975..183309
FT                   /transl_table=11
FT                   /locus_tag="EUR_01710"
FT                   /product="PEGA domain."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89412"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1X2"
FT                   /protein_id="CBK89412.1"
FT   CDS             183463..183735
FT                   /transl_table=11
FT                   /locus_tag="EUR_01720"
FT                   /product="Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89413"
FT                   /db_xref="GOA:D6E1X3"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1X3"
FT                   /protein_id="CBK89413.1"
FT   CDS             183865..184104
FT                   /transl_table=11
FT                   /locus_tag="EUR_01730"
FT                   /product="Ribosome-associated heat shock protein implicated
FT                   in the recycling of the 50S subunit (S4 paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89414"
FT                   /db_xref="GOA:D6E1X4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1X4"
FT                   /protein_id="CBK89414.1"
FT   CDS             184213..184497
FT                   /transl_table=11
FT                   /locus_tag="EUR_01740"
FT                   /product="sporulation protein YabP"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89415"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1X5"
FT                   /protein_id="CBK89415.1"
FT   CDS             184515..184808
FT                   /transl_table=11
FT                   /locus_tag="EUR_01750"
FT                   /product="Septum formation initiator."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89416"
FT                   /db_xref="GOA:D6E1X6"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1X6"
FT                   /protein_id="CBK89416.1"
FT   CDS             184893..186734
FT                   /transl_table=11
FT                   /locus_tag="EUR_01760"
FT                   /product="Stage II sporulation protein E (SpoIIE)."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89417"
FT                   /db_xref="GOA:D6E1X7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1X7"
FT                   /protein_id="CBK89417.1"
FT   CDS             186734..188278
FT                   /transl_table=11
FT                   /locus_tag="EUR_01770"
FT                   /product="tRNA(Ile)-lysidine synthetase, N-terminal
FT                   domain/tRNA(Ile)-lysidine synthetase, C-terminal domain"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89418"
FT                   /db_xref="GOA:D6E1X8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1X8"
FT                   /protein_id="CBK89418.1"
FT   CDS             188256..188801
FT                   /transl_table=11
FT                   /locus_tag="EUR_01780"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89419"
FT                   /db_xref="GOA:D6E1X9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1X9"
FT                   /protein_id="CBK89419.1"
FT                   DQRFRNLPYIGFVEGEIK"
FT   tRNA            191306..191387
FT                   /locus_tag="EUR_T_32790"
FT   CDS             complement(193614..194627)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01810"
FT                   /product="Transcriptional regulators"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89420"
FT                   /db_xref="GOA:D6E1Y0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Y0"
FT                   /protein_id="CBK89420.1"
FT   CDS             196460..197728
FT                   /transl_table=11
FT                   /locus_tag="EUR_01830"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89421"
FT                   /db_xref="PDB:4UA8"
FT                   /db_xref="PDB:4UAC"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Y1"
FT                   /protein_id="CBK89421.1"
FT   CDS             197831..199210
FT                   /transl_table=11
FT                   /locus_tag="EUR_01840"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89422"
FT                   /db_xref="GOA:D6E1Y2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Y2"
FT                   /protein_id="CBK89422.1"
FT                   M"
FT   CDS             199210..200097
FT                   /transl_table=11
FT                   /locus_tag="EUR_01850"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89423"
FT                   /db_xref="GOA:D6E1Y3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Y3"
FT                   /protein_id="CBK89423.1"
FT                   QRFYVDGLTGAVKG"
FT   CDS             200323..202017
FT                   /transl_table=11
FT                   /locus_tag="EUR_01860"
FT                   /product="Glycosidases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89424"
FT                   /db_xref="GOA:D6E1Y4"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Y4"
FT                   /protein_id="CBK89424.1"
FT   CDS             complement(202106..202837)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01870"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89425"
FT                   /db_xref="GOA:D6E1Y5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Y5"
FT                   /protein_id="CBK89425.1"
FT   CDS             203018..203446
FT                   /transl_table=11
FT                   /locus_tag="EUR_01880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89426"
FT                   /db_xref="InterPro:IPR025748"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Y6"
FT                   /protein_id="CBK89426.1"
FT   CDS             203728..203970
FT                   /transl_table=11
FT                   /locus_tag="EUR_01890"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89427"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Y7"
FT                   /protein_id="CBK89427.1"
FT   CDS             204095..205669
FT                   /transl_table=11
FT                   /locus_tag="EUR_01900"
FT                   /product="LysM domain."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89428"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Y8"
FT                   /protein_id="CBK89428.1"
FT                   RLIIARM"
FT   CDS             205861..207132
FT                   /transl_table=11
FT                   /locus_tag="EUR_01910"
FT                   /product="Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89429"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Y9"
FT                   /protein_id="CBK89429.1"
FT   CDS             207645..208085
FT                   /transl_table=11
FT                   /locus_tag="EUR_01920"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89430"
FT                   /db_xref="GOA:D6E1Z0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Z0"
FT                   /protein_id="CBK89430.1"
FT   CDS             208748..209623
FT                   /transl_table=11
FT                   /locus_tag="EUR_01940"
FT                   /product="methionine aminopeptidase, type I"
FT                   /function="methionine aminopeptidase, type I"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89431"
FT                   /db_xref="GOA:D6E1Z1"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Z1"
FT                   /protein_id="CBK89431.1"
FT                   TEDGHEVLSW"
FT   CDS             complement(210086..211414)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89432"
FT                   /db_xref="InterPro:IPR025466"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Z2"
FT                   /protein_id="CBK89432.1"
FT   CDS             complement(211540..211635)
FT                   /transl_table=11
FT                   /locus_tag="EUR_01960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89433"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Z3"
FT                   /protein_id="CBK89433.1"
FT                   /translation="MRDEYDFSNAKRNPYAKKLKNKLQLILMKIQ"
FT   CDS             211839..214631
FT                   /transl_table=11
FT                   /locus_tag="EUR_01970"
FT                   /product="small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89434"
FT                   /db_xref="GOA:D6E1Z4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Z4"
FT                   /protein_id="CBK89434.1"
FT                   "
FT   CDS             214752..215945
FT                   /transl_table=11
FT                   /locus_tag="EUR_01980"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_01980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89435"
FT                   /db_xref="GOA:D6E1Z5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Z5"
FT                   /protein_id="CBK89435.1"
FT   CDS             221326..221466
FT                   /transl_table=11
FT                   /locus_tag="EUR_02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89436"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Z6"
FT                   /protein_id="CBK89436.1"
FT                   E"
FT   CDS             221469..222245
FT                   /transl_table=11
FT                   /locus_tag="EUR_02010"
FT                   /product="Serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89437"
FT                   /db_xref="GOA:D6E1Z7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Z7"
FT                   /protein_id="CBK89437.1"
FT   CDS             222255..223196
FT                   /transl_table=11
FT                   /locus_tag="EUR_02020"
FT                   /product="Protein kinase domain."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89438"
FT                   /db_xref="GOA:D6E1Z8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Z8"
FT                   /protein_id="CBK89438.1"
FT   CDS             223941..224360
FT                   /transl_table=11
FT                   /locus_tag="EUR_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89439"
FT                   /db_xref="UniProtKB/TrEMBL:D6E1Z9"
FT                   /protein_id="CBK89439.1"
FT   CDS             224378..225391
FT                   /transl_table=11
FT                   /locus_tag="EUR_02050"
FT                   /product="FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89440"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D6E200"
FT                   /protein_id="CBK89440.1"
FT   CDS             225427..225855
FT                   /transl_table=11
FT                   /locus_tag="EUR_02060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89441"
FT                   /db_xref="UniProtKB/TrEMBL:D6E201"
FT                   /protein_id="CBK89441.1"
FT   CDS             225855..226166
FT                   /transl_table=11
FT                   /locus_tag="EUR_02070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89442"
FT                   /db_xref="UniProtKB/TrEMBL:D6E202"
FT                   /protein_id="CBK89442.1"
FT   CDS             226185..227906
FT                   /transl_table=11
FT                   /locus_tag="EUR_02080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89443"
FT                   /db_xref="UniProtKB/TrEMBL:D6E203"
FT                   /protein_id="CBK89443.1"
FT   CDS             227958..228854
FT                   /transl_table=11
FT                   /locus_tag="EUR_02090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89444"
FT                   /db_xref="UniProtKB/TrEMBL:D6E204"
FT                   /protein_id="CBK89444.1"
FT                   MIVFPGSKKEESSQAAD"
FT   gap             228922..229374
FT                   /estimated_length=453
FT   CDS             229475..229891
FT                   /transl_table=11
FT                   /locus_tag="EUR_02100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89445"
FT                   /db_xref="UniProtKB/TrEMBL:D6E205"
FT                   /protein_id="CBK89445.1"
FT   CDS             230029..230928
FT                   /transl_table=11
FT                   /locus_tag="EUR_02110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89446"
FT                   /db_xref="UniProtKB/TrEMBL:D6E206"
FT                   /protein_id="CBK89446.1"
FT                   QMIVFPGSKKEESSQAAD"
FT   CDS             230936..231481
FT                   /transl_table=11
FT                   /locus_tag="EUR_02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89447"
FT                   /db_xref="UniProtKB/TrEMBL:D6E207"
FT                   /protein_id="CBK89447.1"
FT                   RLRREAAEEEARRKREVS"
FT   CDS             231514..231834
FT                   /transl_table=11
FT                   /locus_tag="EUR_02130"
FT                   /product="Virulence factor EsxB."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89448"
FT                   /db_xref="UniProtKB/TrEMBL:D6E208"
FT                   /protein_id="CBK89448.1"
FT                   DM"
FT   CDS             231834..232475
FT                   /transl_table=11
FT                   /locus_tag="EUR_02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89449"
FT                   /db_xref="UniProtKB/TrEMBL:D6E209"
FT                   /protein_id="CBK89449.1"
FT   CDS             232468..232815
FT                   /transl_table=11
FT                   /locus_tag="EUR_02150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89450"
FT                   /db_xref="UniProtKB/TrEMBL:D6E210"
FT                   /protein_id="CBK89450.1"
FT                   EWVIGQIGGNE"
FT   CDS             232821..234554
FT                   /transl_table=11
FT                   /locus_tag="EUR_02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89451"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="UniProtKB/TrEMBL:D6E211"
FT                   /protein_id="CBK89451.1"
FT                   K"
FT   CDS             234558..234941
FT                   /transl_table=11
FT                   /locus_tag="EUR_02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89452"
FT                   /db_xref="InterPro:IPR017020"
FT                   /db_xref="UniProtKB/TrEMBL:D6E212"
FT                   /protein_id="CBK89452.1"
FT   gap             235322..235686
FT                   /estimated_length=365
FT   CDS             235804..236397
FT                   /transl_table=11
FT                   /locus_tag="EUR_02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89453"
FT                   /db_xref="UniProtKB/TrEMBL:D6E213"
FT                   /protein_id="CBK89453.1"
FT   CDS             236413..237012
FT                   /transl_table=11
FT                   /locus_tag="EUR_02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89454"
FT                   /db_xref="UniProtKB/TrEMBL:D6E214"
FT                   /protein_id="CBK89454.1"
FT   CDS             237103..237348
FT                   /transl_table=11
FT                   /locus_tag="EUR_02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89455"
FT                   /db_xref="InterPro:IPR028954"
FT                   /db_xref="UniProtKB/TrEMBL:D6E215"
FT                   /protein_id="CBK89455.1"
FT   CDS             237775..238023
FT                   /transl_table=11
FT                   /locus_tag="EUR_02220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89456"
FT                   /db_xref="InterPro:IPR028954"
FT                   /db_xref="UniProtKB/TrEMBL:D6E216"
FT                   /protein_id="CBK89456.1"
FT   CDS             238126..238386
FT                   /transl_table=11
FT                   /locus_tag="EUR_02230"
FT                   /product="YukD."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89457"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:D6E217"
FT                   /protein_id="CBK89457.1"
FT   CDS             238389..242555
FT                   /transl_table=11
FT                   /locus_tag="EUR_02240"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE and related
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89458"
FT                   /db_xref="GOA:D6E218"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR023839"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E218"
FT                   /protein_id="CBK89458.1"
FT   tRNA            243186..243260
FT                   /locus_tag="EUR_T_32800"
FT   CDS             243533..243844
FT                   /transl_table=11
FT                   /locus_tag="EUR_02250"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89459"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="UniProtKB/TrEMBL:D6E219"
FT                   /protein_id="CBK89459.1"
FT   CDS             243869..244246
FT                   /transl_table=11
FT                   /locus_tag="EUR_02260"
FT                   /product="Heavy-metal-associated domain."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89460"
FT                   /db_xref="GOA:D6E220"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="UniProtKB/TrEMBL:D6E220"
FT                   /protein_id="CBK89460.1"
FT   CDS             244302..246950
FT                   /transl_table=11
FT                   /locus_tag="EUR_02270"
FT                   /product="copper-(or silver)-translocating P-type ATPase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89461"
FT                   /db_xref="GOA:D6E221"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:D6E221"
FT                   /protein_id="CBK89461.1"
FT                   EAEDYKVTSIQ"
FT   CDS             246972..248144
FT                   /transl_table=11
FT                   /locus_tag="EUR_02280"
FT                   /product="Endoglucanase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89462"
FT                   /db_xref="GOA:D6E222"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6E222"
FT                   /protein_id="CBK89462.1"
FT   CDS             complement(248691..249278)
FT                   /transl_table=11
FT                   /locus_tag="EUR_02300"
FT                   /product="hypothetical protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89463"
FT                   /db_xref="GOA:D6E223"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E223"
FT                   /protein_id="CBK89463.1"
FT   CDS             249559..251133
FT                   /transl_table=11
FT                   /locus_tag="EUR_02310"
FT                   /product="GMP synthase (glutamine-hydrolyzing), C-terminal
FT                   domain or B subunit/GMP synthase (glutamine-hydrolyzing),
FT                   N-terminal domain or A subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89464"
FT                   /db_xref="GOA:D6E224"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6E224"
FT                   /protein_id="CBK89464.1"
FT                   PGTIEFE"
FT   CDS             251340..251792
FT                   /transl_table=11
FT                   /locus_tag="EUR_02320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89465"
FT                   /db_xref="UniProtKB/TrEMBL:D6E225"
FT                   /protein_id="CBK89465.1"
FT   CDS             251782..252183
FT                   /transl_table=11
FT                   /locus_tag="EUR_02330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89466"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E226"
FT                   /protein_id="CBK89466.1"
FT   CDS             252185..252862
FT                   /transl_table=11
FT                   /locus_tag="EUR_02340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89467"
FT                   /db_xref="UniProtKB/TrEMBL:D6E227"
FT                   /protein_id="CBK89467.1"
FT                   IIV"
FT   CDS             252945..253742
FT                   /transl_table=11
FT                   /locus_tag="EUR_02350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89468"
FT                   /db_xref="UniProtKB/TrEMBL:D6E228"
FT                   /protein_id="CBK89468.1"
FT   CDS             256644..257078
FT                   /transl_table=11
FT                   /locus_tag="EUR_02370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89469"
FT                   /db_xref="GOA:D6E229"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D6E229"
FT                   /protein_id="CBK89469.1"
FT   CDS             complement(258134..258376)
FT                   /transl_table=11
FT                   /locus_tag="EUR_02390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89470"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:D6E230"
FT                   /protein_id="CBK89470.1"
FT   CDS             complement(258519..259040)
FT                   /transl_table=11
FT                   /locus_tag="EUR_02400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89471"
FT                   /db_xref="UniProtKB/TrEMBL:D6E231"
FT                   /protein_id="CBK89471.1"
FT                   NEIPLYFLGL"
FT   CDS             complement(259044..259277)
FT                   /transl_table=11
FT                   /locus_tag="EUR_02410"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89472"
FT                   /db_xref="GOA:D6E232"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6E232"
FT                   /protein_id="CBK89472.1"
FT   CDS             259599..260147
FT                   /transl_table=11
FT                   /locus_tag="EUR_02420"
FT                   /product="Putative RNA methylase family UPF0020."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6E233"
FT                   /protein_id="CBK89473.1"
FT   CDS             260253..261086
FT                   /transl_table=11
FT                   /locus_tag="EUR_02430"
FT                   /product="DNA adenine methylase (dam)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89474"
FT                   /db_xref="GOA:D6E234"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6E234"
FT                   /protein_id="CBK89474.1"
FT   CDS             261099..261716
FT                   /transl_table=11
FT                   /locus_tag="EUR_02440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89475"
FT                   /db_xref="UniProtKB/TrEMBL:D6E235"
FT                   /protein_id="CBK89475.1"
FT   CDS             261738..262550
FT                   /transl_table=11
FT                   /locus_tag="EUR_02450"
FT                   /product="DNA modification methylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89476"
FT                   /db_xref="GOA:D6E236"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6E236"
FT                   /protein_id="CBK89476.1"
FT   CDS             262534..263379
FT                   /transl_table=11
FT                   /locus_tag="EUR_02460"
FT                   /product="Restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89477"
FT                   /db_xref="GOA:D6E237"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D6E237"
FT                   /protein_id="CBK89477.1"
FT                   "
FT   CDS             263383..264240
FT                   /transl_table=11
FT                   /locus_tag="EUR_02470"
FT                   /product="DpnII restriction endonuclease."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89478"
FT                   /db_xref="GOA:D6E238"
FT                   /db_xref="InterPro:IPR007637"
FT                   /db_xref="InterPro:IPR021191"
FT                   /db_xref="UniProtKB/TrEMBL:D6E238"
FT                   /protein_id="CBK89478.1"
FT                   ELFL"
FT   CDS             264257..264859
FT                   /transl_table=11
FT                   /locus_tag="EUR_02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89479"
FT                   /db_xref="GOA:D6E239"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="UniProtKB/TrEMBL:D6E239"
FT                   /protein_id="CBK89479.1"
FT   CDS             265068..266303
FT                   /transl_table=11
FT                   /locus_tag="EUR_02490"
FT                   /product="AIPR protein."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89480"
FT                   /db_xref="InterPro:IPR018891"
FT                   /db_xref="UniProtKB/TrEMBL:D6E240"
FT                   /protein_id="CBK89480.1"
FT                   LIYRITNEMKNR"
FT   CDS             267096..267638
FT                   /transl_table=11
FT                   /locus_tag="EUR_02510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89481"
FT                   /db_xref="UniProtKB/TrEMBL:D6E241"
FT                   /protein_id="CBK89481.1"
FT                   SWEDPDYPFDWTEGEFC"
FT   CDS             267654..267971
FT                   /transl_table=11
FT                   /locus_tag="EUR_02520"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89482"
FT                   /db_xref="GOA:D6E242"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6E242"
FT                   /protein_id="CBK89482.1"
FT                   A"
FT   CDS             267962..268330
FT                   /transl_table=11
FT                   /locus_tag="EUR_02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89483"
FT                   /db_xref="UniProtKB/TrEMBL:D6E243"
FT                   /protein_id="CBK89483.1"
FT                   NDLTGANFAHVDGNGENH"
FT   CDS             complement(268369..268554)
FT                   /transl_table=11
FT                   /locus_tag="EUR_02540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89484"
FT                   /db_xref="UniProtKB/TrEMBL:D6E244"
FT                   /protein_id="CBK89484.1"
FT                   FLHILLLCPDYTYHSK"
FT   gap             268899..269928
FT                   /estimated_length=1030
FT   CDS             270196..270666
FT                   /transl_table=11
FT                   /locus_tag="EUR_02550"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89485"
FT                   /db_xref="GOA:D6E245"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6E245"
FT                   /protein_id="CBK89485.1"
FT   CDS             270663..271280
FT                   /transl_table=11
FT                   /locus_tag="EUR_02560"
FT                   /product="Fructose-2,6-bisphosphatase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89486"
FT                   /db_xref="GOA:D6E246"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D6E246"
FT                   /protein_id="CBK89486.1"
FT   CDS             271309..274035
FT                   /transl_table=11
FT                   /locus_tag="EUR_02570"
FT                   /product="Uncharacterized conserved protein
FT                   (DUF2075)./Protein of unknown function (DUF2726)./Viral
FT                   (Superfamily 1) RNA helicase."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89487"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E247"
FT                   /protein_id="CBK89487.1"
FT   CDS             274065..274772
FT                   /transl_table=11
FT                   /locus_tag="EUR_02580"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89488"
FT                   /db_xref="GOA:D6E248"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D6E248"
FT                   /protein_id="CBK89488.1"
FT                   VDTLEYFFMEVDK"
FT   CDS             274796..276166
FT                   /transl_table=11
FT                   /locus_tag="EUR_02590"
FT                   /product="Predicted transcriptional regulator containing an
FT                   HTH domain and an uncharacterized domain shared with the
FT                   mammalian protein Schlafen"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89489"
FT                   /db_xref="GOA:D6E249"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D6E249"
FT                   /protein_id="CBK89489.1"
FT   CDS             276630..277109
FT                   /transl_table=11
FT                   /locus_tag="EUR_02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89490"
FT                   /db_xref="UniProtKB/TrEMBL:D6E250"
FT                   /protein_id="CBK89490.1"
FT   CDS             277132..277257
FT                   /transl_table=11
FT                   /locus_tag="EUR_02620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89491"
FT                   /db_xref="UniProtKB/TrEMBL:D6E251"
FT                   /protein_id="CBK89491.1"
FT   CDS             277674..277997
FT                   /transl_table=11
FT                   /locus_tag="EUR_02640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89492"
FT                   /db_xref="UniProtKB/TrEMBL:D6E252"
FT                   /protein_id="CBK89492.1"
FT                   MNR"
FT   CDS             278021..280990
FT                   /transl_table=11
FT                   /locus_tag="EUR_02650"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89493"
FT                   /db_xref="GOA:D6E253"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E253"
FT                   /protein_id="CBK89493.1"
FT                   "
FT   CDS             281069..282091
FT                   /transl_table=11
FT                   /locus_tag="EUR_02660"
FT                   /product="Virulence protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89494"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:D6E254"
FT                   /protein_id="CBK89494.1"
FT                   "
FT   CDS             282297..283256
FT                   /transl_table=11
FT                   /locus_tag="EUR_02670"
FT                   /product="Transcriptional regulator containing an amidase
FT                   domain and an AraC-type DNA-binding HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89495"
FT                   /db_xref="GOA:D6E255"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D6E255"
FT                   /protein_id="CBK89495.1"
FT   CDS             283397..283990
FT                   /transl_table=11
FT                   /locus_tag="EUR_02680"
FT                   /product="conserved hypothetical integral membrane protein
FT                   TIGR02185"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89496"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:D6E256"
FT                   /protein_id="CBK89496.1"
FT   CDS             283990..284730
FT                   /transl_table=11
FT                   /locus_tag="EUR_02690"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89497"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D6E257"
FT                   /protein_id="CBK89497.1"
FT   CDS             284727..286133
FT                   /transl_table=11
FT                   /locus_tag="EUR_02700"
FT                   /product="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89498"
FT                   /db_xref="GOA:D6E258"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E258"
FT                   /protein_id="CBK89498.1"
FT                   NTICLEELQA"
FT   CDS             289767..290192
FT                   /transl_table=11
FT                   /locus_tag="EUR_02730"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /function="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89499"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6E259"
FT                   /protein_id="CBK89499.1"
FT   CDS             290304..290699
FT                   /transl_table=11
FT                   /locus_tag="EUR_02740"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89500"
FT                   /db_xref="GOA:D6E260"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D6E260"
FT                   /protein_id="CBK89500.1"
FT   CDS             290749..291357
FT                   /transl_table=11
FT                   /locus_tag="EUR_02750"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89501"
FT                   /db_xref="GOA:D6E261"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D6E261"
FT                   /protein_id="CBK89501.1"
FT   CDS             291360..292304
FT                   /transl_table=11
FT                   /locus_tag="EUR_02760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89502"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D6E262"
FT                   /protein_id="CBK89502.1"
FT   CDS             292301..293077
FT                   /transl_table=11
FT                   /locus_tag="EUR_02770"
FT                   /product="Predicted phosphatase homologous to the
FT                   C-terminal domain of histone macroH2A1"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89503"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D6E263"
FT                   /protein_id="CBK89503.1"
FT   CDS             293295..293936
FT                   /transl_table=11
FT                   /locus_tag="EUR_02780"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89504"
FT                   /db_xref="GOA:D6E264"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6E264"
FT                   /protein_id="CBK89504.1"
FT   CDS             293996..294409
FT                   /transl_table=11
FT                   /locus_tag="EUR_02790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89505"
FT                   /db_xref="UniProtKB/TrEMBL:D6E265"
FT                   /protein_id="CBK89505.1"
FT   CDS             294434..294619
FT                   /transl_table=11
FT                   /locus_tag="EUR_02800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89506"
FT                   /db_xref="UniProtKB/TrEMBL:D6E266"
FT                   /protein_id="CBK89506.1"
FT                   VHEIRQIIQQIILFMR"
FT   CDS             complement(294693..295028)
FT                   /transl_table=11
FT                   /locus_tag="EUR_02810"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89507"
FT                   /db_xref="GOA:D6E267"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6E267"
FT                   /protein_id="CBK89507.1"
FT                   ARKLLEK"
FT   CDS             295195..296124
FT                   /transl_table=11
FT                   /locus_tag="EUR_02820"
FT                   /product="RNA ligase."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89508"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="UniProtKB/TrEMBL:D6E268"
FT                   /protein_id="CBK89508.1"
FT   CDS             296297..296785
FT                   /transl_table=11
FT                   /locus_tag="EUR_02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89509"
FT                   /db_xref="UniProtKB/TrEMBL:D6E269"
FT                   /protein_id="CBK89509.1"
FT   CDS             296942..297763
FT                   /transl_table=11
FT                   /locus_tag="EUR_02840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89510"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D6E270"
FT                   /protein_id="CBK89510.1"
FT   CDS             complement(297776..298696)
FT                   /transl_table=11
FT                   /locus_tag="EUR_02850"
FT                   /product="Predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89511"
FT                   /db_xref="GOA:D6E271"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D6E271"
FT                   /protein_id="CBK89511.1"
FT   CDS             complement(298717..299895)
FT                   /transl_table=11
FT                   /locus_tag="EUR_02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89512"
FT                   /db_xref="UniProtKB/TrEMBL:D6E272"
FT                   /protein_id="CBK89512.1"
FT   CDS             complement(299951..301339)
FT                   /transl_table=11
FT                   /locus_tag="EUR_02870"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89513"
FT                   /db_xref="GOA:D6E273"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6E273"
FT                   /protein_id="CBK89513.1"
FT                   HVID"
FT   CDS             301588..301959
FT                   /transl_table=11
FT                   /locus_tag="EUR_02880"
FT                   /product="undecaprenol kinase"
FT                   /function="undecaprenol kinase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89514"
FT                   /db_xref="GOA:D6E274"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="UniProtKB/TrEMBL:D6E274"
FT                   /protein_id="CBK89514.1"
FT   CDS             302024..302476
FT                   /transl_table=11
FT                   /locus_tag="EUR_02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89515"
FT                   /db_xref="UniProtKB/TrEMBL:D6E275"
FT                   /protein_id="CBK89515.1"
FT   CDS             302478..304037
FT                   /transl_table=11
FT                   /locus_tag="EUR_02900"
FT                   /product="Predicted unusual protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89516"
FT                   /db_xref="GOA:D6E276"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D6E276"
FT                   /protein_id="CBK89516.1"
FT                   RR"
FT   CDS             complement(304092..305876)
FT                   /transl_table=11
FT                   /locus_tag="EUR_02910"
FT                   /product="Na/Pi-cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89517"
FT                   /db_xref="GOA:D6E277"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="UniProtKB/TrEMBL:D6E277"
FT                   /protein_id="CBK89517.1"
FT                   KYHLDEDYKKAKSKKSSK"
FT   CDS             306165..307763
FT                   /transl_table=11
FT                   /locus_tag="EUR_02920"
FT                   /product="Sugar (pentulose and hexulose) kinases"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89518"
FT                   /db_xref="GOA:D6E278"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D6E278"
FT                   /protein_id="CBK89518.1"
FT                   AAIEAERAMVKALPL"
FT   CDS             307797..308492
FT                   /transl_table=11
FT                   /locus_tag="EUR_02930"
FT                   /product="L-ribulose 5-phosphate 4-epimerase"
FT                   /function="L-ribulose 5-phosphate 4-epimerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89519"
FT                   /db_xref="GOA:D6E279"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniProtKB/TrEMBL:D6E279"
FT                   /protein_id="CBK89519.1"
FT                   GANAYYGQN"
FT   CDS             309179..310984
FT                   /transl_table=11
FT                   /locus_tag="EUR_02940"
FT                   /product="Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89520"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D6E280"
FT                   /protein_id="CBK89520.1"
FT   CDS             complement(311013..311657)
FT                   /transl_table=11
FT                   /locus_tag="EUR_02950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89521"
FT                   /db_xref="UniProtKB/TrEMBL:D6E281"
FT                   /protein_id="CBK89521.1"
FT   CDS             311814..312359
FT                   /transl_table=11
FT                   /locus_tag="EUR_02960"
FT                   /product="Bacterial SH3 domain."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89522"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:D6E282"
FT                   /protein_id="CBK89522.1"
FT                   GTADGSTTGAADSAAQSQ"
FT   CDS             312384..313217
FT                   /transl_table=11
FT                   /locus_tag="EUR_02970"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89523"
FT                   /db_xref="GOA:D6E283"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D6E283"
FT                   /protein_id="CBK89523.1"
FT   CDS             313259..313600
FT                   /transl_table=11
FT                   /locus_tag="EUR_02980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89524"
FT                   /db_xref="UniProtKB/TrEMBL:D6E284"
FT                   /protein_id="CBK89524.1"
FT                   RYRRYQRFW"
FT   CDS             313619..316147
FT                   /transl_table=11
FT                   /locus_tag="EUR_02990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_02990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89525"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D6E285"
FT                   /protein_id="CBK89525.1"
FT   CDS             316307..316561
FT                   /transl_table=11
FT                   /locus_tag="EUR_03000"
FT                   /product="Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89526"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="UniProtKB/TrEMBL:D6E286"
FT                   /protein_id="CBK89526.1"
FT   CDS             316584..317066
FT                   /transl_table=11
FT                   /locus_tag="EUR_03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89527"
FT                   /db_xref="UniProtKB/TrEMBL:D6E287"
FT                   /protein_id="CBK89527.1"
FT   tRNA            complement(317243..317313)
FT                   /locus_tag="EUR_T_33160"
FT   tRNA            complement(317340..317412)
FT                   /locus_tag="EUR_T_33150"
FT   CDS             317656..318717
FT                   /transl_table=11
FT                   /locus_tag="EUR_03020"
FT                   /product="Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89528"
FT                   /db_xref="GOA:D6E288"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6E288"
FT                   /protein_id="CBK89528.1"
FT                   TTVHELMSELVGA"
FT   CDS             complement(318692..320731)
FT                   /transl_table=11
FT                   /locus_tag="EUR_03030"
FT                   /product="glycogen debranching enzyme, archaeal type,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89529"
FT                   /db_xref="GOA:D6E289"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010401"
FT                   /db_xref="InterPro:IPR024742"
FT                   /db_xref="UniProtKB/TrEMBL:D6E289"
FT                   /protein_id="CBK89529.1"
FT   CDS             320863..321363
FT                   /transl_table=11
FT                   /locus_tag="EUR_03040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89530"
FT                   /db_xref="UniProtKB/TrEMBL:D6E290"
FT                   /protein_id="CBK89530.1"
FT                   REE"
FT   CDS             complement(321364..321783)
FT                   /transl_table=11
FT                   /locus_tag="EUR_03050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89531"
FT                   /db_xref="UniProtKB/TrEMBL:D6E291"
FT                   /protein_id="CBK89531.1"
FT   CDS             321855..322631
FT                   /transl_table=11
FT                   /locus_tag="EUR_03060"
FT                   /product="glutamate racemase"
FT                   /function="glutamate racemase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89532"
FT                   /db_xref="GOA:D6E292"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:D6E292"
FT                   /protein_id="CBK89532.1"
FT   CDS             complement(322904..323542)
FT                   /transl_table=11
FT                   /locus_tag="EUR_03070"
FT                   /product="Predicted EndoIII-related endonuclease"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89533"
FT                   /db_xref="GOA:D6E293"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D6E293"
FT                   /protein_id="CBK89533.1"
FT   CDS             324317..324820
FT                   /transl_table=11
FT                   /locus_tag="EUR_03090"
FT                   /product="Isopentenyldiphosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89534"
FT                   /db_xref="GOA:D6E294"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D6E294"
FT                   /protein_id="CBK89534.1"
FT                   VFEN"
FT   CDS             324888..325064
FT                   /transl_table=11
FT                   /locus_tag="EUR_03100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89535"
FT                   /db_xref="InterPro:IPR025346"
FT                   /db_xref="UniProtKB/TrEMBL:D6E295"
FT                   /protein_id="CBK89535.1"
FT                   IDYKYDETVNQFK"
FT   CDS             325106..325282
FT                   /transl_table=11
FT                   /locus_tag="EUR_03110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89536"
FT                   /db_xref="UniProtKB/TrEMBL:D6E296"
FT                   /protein_id="CBK89536.1"
FT                   RSGDEYRVVRHQM"
FT   CDS             325418..327022
FT                   /transl_table=11
FT                   /locus_tag="EUR_03120"
FT                   /product="CTP synthase"
FT                   /function="CTP synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89537"
FT                   /db_xref="GOA:D6E297"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6E297"
FT                   /protein_id="CBK89537.1"
FT                   PHPLFHGFIEAANKVNR"
FT   CDS             327272..329383
FT                   /transl_table=11
FT                   /locus_tag="EUR_03130"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89538"
FT                   /db_xref="GOA:D6E298"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E298"
FT                   /protein_id="CBK89538.1"
FT                   APDDNTLNN"
FT   CDS             329726..331600
FT                   /transl_table=11
FT                   /locus_tag="EUR_03140"
FT                   /product="excinuclease ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89539"
FT                   /db_xref="GOA:D6E299"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027299"
FT                   /db_xref="UniProtKB/TrEMBL:D6E299"
FT                   /protein_id="CBK89539.1"
FT   CDS             331659..332600
FT                   /transl_table=11
FT                   /locus_tag="EUR_03150"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /function="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.11.-"
FT                   /EC_number="2.7.4.-"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89540"
FT                   /db_xref="GOA:D6E2A0"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2A0"
FT                   /protein_id="CBK89540.1"
FT   CDS             332607..334016
FT                   /transl_table=11
FT                   /locus_tag="EUR_03160"
FT                   /product="Aspartyl aminopeptidase"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89541"
FT                   /db_xref="GOA:D6E2A1"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2A1"
FT                   /protein_id="CBK89541.1"
FT                   FRGYIAFLKEA"
FT   CDS             334033..334992
FT                   /transl_table=11
FT                   /locus_tag="EUR_03170"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /function="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89542"
FT                   /db_xref="GOA:D6E2A2"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2A2"
FT                   /protein_id="CBK89542.1"
FT   CDS             335869..336738
FT                   /transl_table=11
FT                   /locus_tag="EUR_03190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89543"
FT                   /db_xref="GOA:D6E2A3"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2A3"
FT                   /protein_id="CBK89543.1"
FT                   SAIAEELR"
FT   CDS             336739..337623
FT                   /transl_table=11
FT                   /locus_tag="EUR_03200"
FT                   /product="conserved protein of unknown function
FT                   cotranscribed with Bmr (bmrU)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89544"
FT                   /db_xref="GOA:D6E2A4"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2A4"
FT                   /protein_id="CBK89544.1"
FT                   TITNLSKQITIMC"
FT   CDS             337755..338621
FT                   /transl_table=11
FT                   /locus_tag="EUR_03210"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II,
FT                   various bacterial and amitochondriate protist"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89545"
FT                   /db_xref="GOA:D6E2A5"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2A5"
FT                   /protein_id="CBK89545.1"
FT                   GSVGKAE"
FT   CDS             338939..341062
FT                   /transl_table=11
FT                   /locus_tag="EUR_03220"
FT                   /product="Uncharacterized protein related to glutamine
FT                   synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89546"
FT                   /db_xref="GOA:D6E2A6"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022147"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2A6"
FT                   /protein_id="CBK89546.1"
FT                   WPMPSYGDLIFEV"
FT   CDS             341265..343022
FT                   /transl_table=11
FT                   /locus_tag="EUR_03230"
FT                   /product="ammonium transporter"
FT                   /function="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89547"
FT                   /db_xref="GOA:D6E2A7"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2A7"
FT                   /protein_id="CBK89547.1"
FT                   GIEALQDVE"
FT   CDS             complement(343130..345907)
FT                   /transl_table=11
FT                   /locus_tag="EUR_03240"
FT                   /product="Membrane carboxypeptidase/penicillin-binding
FT                   protein"
FT                   /EC_number="3.4.-.-"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89548"
FT                   /db_xref="GOA:D6E2A8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2A8"
FT                   /protein_id="CBK89548.1"
FT   CDS             346073..346780
FT                   /transl_table=11
FT                   /locus_tag="EUR_03250"
FT                   /product="conserved hypothetical protein TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89549"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2A9"
FT                   /protein_id="CBK89549.1"
FT                   FAEYDGEVLLFKN"
FT   tRNA            346902..346976
FT                   /locus_tag="EUR_T_32810"
FT   CDS             347081..347260
FT                   /transl_table=11
FT                   /locus_tag="EUR_03260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89550"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2B0"
FT                   /protein_id="CBK89550.1"
FT                   EAFRFIRSYFNFID"
FT   CDS             347272..347997
FT                   /transl_table=11
FT                   /locus_tag="EUR_03270"
FT                   /product="Acyl-ACP thioesterase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89551"
FT                   /db_xref="GOA:D6E2B1"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2B1"
FT                   /protein_id="CBK89551.1"
FT   CDS             348054..348890
FT                   /transl_table=11
FT                   /locus_tag="EUR_03280"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89552"
FT                   /db_xref="GOA:D6E2B2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2B2"
FT                   /protein_id="CBK89552.1"
FT   CDS             348933..349307
FT                   /transl_table=11
FT                   /locus_tag="EUR_03290"
FT                   /product="endoribonuclease L-PSP"
FT                   /function="endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89553"
FT                   /db_xref="GOA:D6E2B3"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2B3"
FT                   /protein_id="CBK89553.1"
FT   CDS             349484..350719
FT                   /transl_table=11
FT                   /locus_tag="EUR_03300"
FT                   /product="Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89554"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2B4"
FT                   /protein_id="CBK89554.1"
FT                   NYKSIIAVRRIF"
FT   CDS             351314..351934
FT                   /transl_table=11
FT                   /locus_tag="EUR_03310"
FT                   /product="Teichoic acid biosynthesis proteins"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89555"
FT                   /db_xref="GOA:D6E2B5"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2B5"
FT                   /protein_id="CBK89555.1"
FT   CDS             352111..353196
FT                   /transl_table=11
FT                   /locus_tag="EUR_03320"
FT                   /product="transcriptional regulator, CdaR family"
FT                   /function="transcriptional regulator, CdaR family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89556"
FT                   /db_xref="GOA:D6E2B6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2B6"
FT                   /protein_id="CBK89556.1"
FT   CDS             353207..353890
FT                   /transl_table=11
FT                   /locus_tag="EUR_03330"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /function="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89557"
FT                   /db_xref="GOA:D6E2B7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2B7"
FT                   /protein_id="CBK89557.1"
FT                   DSDED"
FT   CDS             353880..354788
FT                   /transl_table=11
FT                   /locus_tag="EUR_03340"
FT                   /product="cell division protein FtsX"
FT                   /function="cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89558"
FT                   /db_xref="GOA:D6E2B8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2B8"
FT                   /protein_id="CBK89558.1"
FT   CDS             354869..356197
FT                   /transl_table=11
FT                   /locus_tag="EUR_03350"
FT                   /product="C-terminal peptidase (prc)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89559"
FT                   /db_xref="GOA:D6E2B9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2B9"
FT                   /protein_id="CBK89559.1"
FT   CDS             356181..356672
FT                   /transl_table=11
FT                   /locus_tag="EUR_03360"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89560"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR016747"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2C0"
FT                   /protein_id="CBK89560.1"
FT                   "
FT   CDS             356984..357226
FT                   /transl_table=11
FT                   /locus_tag="EUR_03370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89561"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2C1"
FT                   /protein_id="CBK89561.1"
FT   CDS             357270..358262
FT                   /transl_table=11
FT                   /locus_tag="EUR_03380"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /function="bacterial peptide chain release factor 2
FT                   (bRF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89562"
FT                   /db_xref="GOA:D6E2C2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2C2"
FT                   /protein_id="CBK89562.1"
FT   CDS             359040..360341
FT                   /transl_table=11
FT                   /locus_tag="EUR_03400"
FT                   /product="Putative virion core protein (lumpy skin disease
FT                   virus)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89563"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2C3"
FT                   /protein_id="CBK89563.1"
FT   CDS             360439..360882
FT                   /transl_table=11
FT                   /locus_tag="EUR_03410"
FT                   /product="ACT domain-containing protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89564"
FT                   /db_xref="GOA:D6E2C4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008310"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2C4"
FT                   /protein_id="CBK89564.1"
FT   CDS             360890..362080
FT                   /transl_table=11
FT                   /locus_tag="EUR_03420"
FT                   /product="homoserine dehydrogenase"
FT                   /function="homoserine dehydrogenase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89565"
FT                   /db_xref="GOA:D6E2C5"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2C5"
FT                   /protein_id="CBK89565.1"
FT   CDS             362092..362892
FT                   /transl_table=11
FT                   /locus_tag="EUR_03430"
FT                   /product="fagellar hook-basal body proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89566"
FT                   /db_xref="GOA:D6E2C6"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2C6"
FT                   /protein_id="CBK89566.1"
FT   CDS             362906..363724
FT                   /transl_table=11
FT                   /locus_tag="EUR_03440"
FT                   /product="fagellar hook-basal body proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89567"
FT                   /db_xref="GOA:D6E2C7"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2C7"
FT                   /protein_id="CBK89567.1"
FT   CDS             363731..364075
FT                   /transl_table=11
FT                   /locus_tag="EUR_03450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89568"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2C8"
FT                   /protein_id="CBK89568.1"
FT                   EQMKRNYNIS"
FT   CDS             366455..367051
FT                   /transl_table=11
FT                   /locus_tag="EUR_03470"
FT                   /product="Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89569"
FT                   /db_xref="GOA:D6E2C9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2C9"
FT                   /protein_id="CBK89569.1"
FT   CDS             367213..367353
FT                   /transl_table=11
FT                   /locus_tag="EUR_03480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89570"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2D0"
FT                   /protein_id="CBK89570.1"
FT                   S"
FT   CDS             367331..368401
FT                   /transl_table=11
FT                   /locus_tag="EUR_03490"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89571"
FT                   /db_xref="GOA:D6E2D1"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2D1"
FT                   /protein_id="CBK89571.1"
FT                   SAYLFDRFINMMGGNQ"
FT   CDS             368401..371607
FT                   /transl_table=11
FT                   /locus_tag="EUR_03500"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89572"
FT                   /db_xref="GOA:D6E2D2"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2D2"
FT                   /protein_id="CBK89572.1"
FT   CDS             371815..372999
FT                   /transl_table=11
FT                   /locus_tag="EUR_03510"
FT                   /product="acetyl-CoA acetyltransferases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89573"
FT                   /db_xref="GOA:D6E2D3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2D3"
FT                   /protein_id="CBK89573.1"
FT   CDS             373157..374029
FT                   /transl_table=11
FT                   /locus_tag="EUR_03520"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /function="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89574"
FT                   /db_xref="GOA:D6E2D4"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2D4"
FT                   /protein_id="CBK89574.1"
FT                   RTKTPVDAM"
FT   CDS             374071..375240
FT                   /transl_table=11
FT                   /locus_tag="EUR_03530"
FT                   /product="Acyl-CoA dehydrogenases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89575"
FT                   /db_xref="GOA:D6E2D5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2D5"
FT                   /protein_id="CBK89575.1"
FT   CDS             375298..376080
FT                   /transl_table=11
FT                   /locus_tag="EUR_03540"
FT                   /product="Electron transfer flavoprotein, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89576"
FT                   /db_xref="GOA:D6E2D6"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2D6"
FT                   /protein_id="CBK89576.1"
FT   CDS             376097..377143
FT                   /transl_table=11
FT                   /locus_tag="EUR_03550"
FT                   /product="Electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89577"
FT                   /db_xref="GOA:D6E2D7"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2D7"
FT                   /protein_id="CBK89577.1"
FT                   LKEANADA"
FT   CDS             377425..377556
FT                   /transl_table=11
FT                   /locus_tag="EUR_03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89578"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2D8"
FT                   /protein_id="CBK89578.1"
FT   CDS             377625..379439
FT                   /transl_table=11
FT                   /locus_tag="EUR_03570"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /function="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89579"
FT                   /db_xref="GOA:D6E2D9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2D9"
FT                   /protein_id="CBK89579.1"
FT   CDS             379761..380579
FT                   /transl_table=11
FT                   /locus_tag="EUR_03580"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89580"
FT                   /db_xref="GOA:D6E2E0"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2E0"
FT                   /protein_id="CBK89580.1"
FT   CDS             380717..381682
FT                   /transl_table=11
FT                   /locus_tag="EUR_03590"
FT                   /product="L-aminopeptidase/D-esterase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89581"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2E1"
FT                   /protein_id="CBK89581.1"
FT   CDS             381718..382911
FT                   /transl_table=11
FT                   /locus_tag="EUR_03600"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase,
FT                   prokaryotic"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89582"
FT                   /db_xref="GOA:D6E2E2"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2E2"
FT                   /protein_id="CBK89582.1"
FT   CDS             complement(383360..384094)
FT                   /transl_table=11
FT                   /locus_tag="EUR_03610"
FT                   /product="Protein of unknown function (DUF975)."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89583"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2E3"
FT                   /protein_id="CBK89583.1"
FT   CDS             384232..384660
FT                   /transl_table=11
FT                   /locus_tag="EUR_03620"
FT                   /product="Protein of unknown function (DUF2752)."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89584"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2E4"
FT                   /protein_id="CBK89584.1"
FT   CDS             complement(384631..385059)
FT                   /transl_table=11
FT                   /locus_tag="EUR_03630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89585"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2E5"
FT                   /protein_id="CBK89585.1"
FT   CDS             385146..387506
FT                   /transl_table=11
FT                   /locus_tag="EUR_03640"
FT                   /product="Transcriptional accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89586"
FT                   /db_xref="GOA:D6E2E6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023097"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2E6"
FT                   /protein_id="CBK89586.1"
FT   CDS             387806..388414
FT                   /transl_table=11
FT                   /locus_tag="EUR_03650"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89587"
FT                   /db_xref="GOA:D6E2E7"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2E7"
FT                   /protein_id="CBK89587.1"
FT   CDS             388534..389031
FT                   /transl_table=11
FT                   /locus_tag="EUR_03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89588"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2E8"
FT                   /protein_id="CBK89588.1"
FT                   IK"
FT   CDS             389089..389538
FT                   /transl_table=11
FT                   /locus_tag="EUR_03670"
FT                   /product="conserved hypothetical nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89589"
FT                   /db_xref="GOA:D6E2E9"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2E9"
FT                   /protein_id="CBK89589.1"
FT   CDS             389538..390251
FT                   /transl_table=11
FT                   /locus_tag="EUR_03680"
FT                   /product="Inactive homolog of metal-dependent proteases,
FT                   putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89590"
FT                   /db_xref="GOA:D6E2F0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2F0"
FT                   /protein_id="CBK89590.1"
FT                   QAERERQEKERDFRI"
FT   CDS             390248..390697
FT                   /transl_table=11
FT                   /locus_tag="EUR_03690"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89591"
FT                   /db_xref="GOA:D6E2F1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2F1"
FT                   /protein_id="CBK89591.1"
FT   CDS             390691..391602
FT                   /transl_table=11
FT                   /locus_tag="EUR_03700"
FT                   /product="RNAse Z"
FT                   /function="RNAse Z"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89592"
FT                   /db_xref="GOA:D6E2F2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2F2"
FT                   /protein_id="CBK89592.1"
FT   CDS             391614..392195
FT                   /transl_table=11
FT                   /locus_tag="EUR_03710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89593"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2F3"
FT                   /protein_id="CBK89593.1"
FT   CDS             392225..393262
FT                   /transl_table=11
FT                   /locus_tag="EUR_03720"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /function="O-sialoglycoprotein endopeptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89594"
FT                   /db_xref="GOA:D6E2F4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2F4"
FT                   /protein_id="CBK89594.1"
FT                   LKLGE"
FT   CDS             393339..394058
FT                   /transl_table=11
FT                   /locus_tag="EUR_03730"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89595"
FT                   /db_xref="GOA:D6E2F5"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2F5"
FT                   /protein_id="CBK89595.1"
FT                   PEDMGIAELFLKKRRKM"
FT   tRNA            394162..394247
FT                   /locus_tag="EUR_T_32820"
FT   CDS             394447..394830
FT                   /transl_table=11
FT                   /locus_tag="EUR_03740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89596"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2F6"
FT                   /protein_id="CBK89596.1"
FT   CDS             394823..395185
FT                   /transl_table=11
FT                   /locus_tag="EUR_03750"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89597"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2F7"
FT                   /protein_id="CBK89597.1"
FT                   VAKRPITELTNPPRAI"
FT   CDS             395459..397099
FT                   /transl_table=11
FT                   /locus_tag="EUR_03760"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89598"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2F8"
FT                   /protein_id="CBK89598.1"
FT   CDS             398612..399322
FT                   /transl_table=11
FT                   /locus_tag="EUR_03780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89599"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2F9"
FT                   /protein_id="CBK89599.1"
FT                   RWYVKGWRETRGYY"
FT   CDS             400266..401198
FT                   /transl_table=11
FT                   /locus_tag="EUR_03800"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89600"
FT                   /db_xref="GOA:D6E2G0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008358"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2G0"
FT                   /protein_id="CBK89600.1"
FT   CDS             401262..402173
FT                   /transl_table=11
FT                   /locus_tag="EUR_03810"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89601"
FT                   /db_xref="GOA:D6E2G1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2G1"
FT                   /protein_id="CBK89601.1"
FT   CDS             402175..402867
FT                   /transl_table=11
FT                   /locus_tag="EUR_03820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89602"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2G2"
FT                   /protein_id="CBK89602.1"
FT                   KRKVPELY"
FT   CDS             complement(403035..403274)
FT                   /transl_table=11
FT                   /locus_tag="EUR_03830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89603"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2G3"
FT                   /protein_id="CBK89603.1"
FT   CDS             403694..404218
FT                   /transl_table=11
FT                   /locus_tag="EUR_03840"
FT                   /product="NADPH-dependent FMN reductase."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89604"
FT                   /db_xref="GOA:D6E2G4"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2G4"
FT                   /protein_id="CBK89604.1"
FT                   MNELEGIGKNL"
FT   CDS             404382..405725
FT                   /transl_table=11
FT                   /locus_tag="EUR_03850"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89605"
FT                   /db_xref="GOA:D6E2G5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2G5"
FT                   /protein_id="CBK89605.1"
FT   CDS             405815..406333
FT                   /transl_table=11
FT                   /locus_tag="EUR_03860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89606"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2G6"
FT                   /protein_id="CBK89606.1"
FT                   LFHNSIIMV"
FT   gap             406526..408203
FT                   /estimated_length=1678
FT   CDS             complement(408298..409473)
FT                   /transl_table=11
FT                   /locus_tag="EUR_03870"
FT                   /product="Putative transposase."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89607"
FT                   /db_xref="GOA:D6E2G7"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2G7"
FT                   /protein_id="CBK89607.1"
FT   CDS             complement(409470..410318)
FT                   /transl_table=11
FT                   /locus_tag="EUR_03880"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89608"
FT                   /db_xref="GOA:D6E2G8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2G8"
FT                   /protein_id="CBK89608.1"
FT                   S"
FT   gap             410660..411344
FT                   /estimated_length=685
FT   CDS             411836..412216
FT                   /transl_table=11
FT                   /locus_tag="EUR_03890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89609"
FT                   /db_xref="InterPro:IPR020378"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2G9"
FT                   /protein_id="CBK89609.1"
FT   CDS             412329..413060
FT                   /transl_table=11
FT                   /locus_tag="EUR_03900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89610"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2H0"
FT                   /protein_id="CBK89610.1"
FT   CDS             413088..413393
FT                   /transl_table=11
FT                   /locus_tag="EUR_03910"
FT                   /product="Predicted phosphatase homologous to the
FT                   C-terminal domain of histone macroH2A1"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89611"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2H1"
FT                   /protein_id="CBK89611.1"
FT   CDS             413445..413585
FT                   /transl_table=11
FT                   /locus_tag="EUR_03920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89612"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2H2"
FT                   /protein_id="CBK89612.1"
FT                   C"
FT   CDS             414281..414730
FT                   /transl_table=11
FT                   /locus_tag="EUR_03940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89613"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2H3"
FT                   /protein_id="CBK89613.1"
FT   CDS             complement(414836..415537)
FT                   /transl_table=11
FT                   /locus_tag="EUR_03950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89614"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2H4"
FT                   /protein_id="CBK89614.1"
FT                   YNELMDFLVEM"
FT   CDS             416052..416165
FT                   /transl_table=11
FT                   /locus_tag="EUR_03960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89615"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2H5"
FT                   /protein_id="CBK89615.1"
FT   CDS             416184..416549
FT                   /transl_table=11
FT                   /locus_tag="EUR_03970"
FT                   /product="HIRAN domain."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89616"
FT                   /db_xref="GOA:D6E2H6"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2H6"
FT                   /protein_id="CBK89616.1"
FT                   MIEEDKVNDEDQLGFKI"
FT   CDS             416582..417178
FT                   /transl_table=11
FT                   /locus_tag="EUR_03980"
FT                   /product="Methyltransferase domain."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89617"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2H7"
FT                   /protein_id="CBK89617.1"
FT   CDS             417148..419643
FT                   /transl_table=11
FT                   /locus_tag="EUR_03990"
FT                   /product="DNA or RNA helicases of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_03990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89618"
FT                   /db_xref="GOA:D6E2H8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2H8"
FT                   /protein_id="CBK89618.1"
FT   CDS             419680..421065
FT                   /transl_table=11
FT                   /locus_tag="EUR_04000"
FT                   /product="Topoisomerase DNA binding C4 zinc finger."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89619"
FT                   /db_xref="GOA:D6E2H9"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2H9"
FT                   /protein_id="CBK89619.1"
FT                   RKK"
FT   CDS             421692..422231
FT                   /transl_table=11
FT                   /locus_tag="EUR_04010"
FT                   /product="Predicted phosphatase homologous to the
FT                   C-terminal domain of histone macroH2A1"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89620"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2I0"
FT                   /protein_id="CBK89620.1"
FT                   AAEKSYMEDESDDFDF"
FT   CDS             422452..422580
FT                   /transl_table=11
FT                   /locus_tag="EUR_04020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89621"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2I1"
FT                   /protein_id="CBK89621.1"
FT   CDS             422910..423503
FT                   /transl_table=11
FT                   /locus_tag="EUR_04040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89622"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2I2"
FT                   /protein_id="CBK89622.1"
FT   CDS             423500..424369
FT                   /transl_table=11
FT                   /locus_tag="EUR_04050"
FT                   /product="Domain of unknown function (DUF1814)."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89623"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2I3"
FT                   /protein_id="CBK89623.1"
FT                   FLLKNFNI"
FT   CDS             424694..426478
FT                   /transl_table=11
FT                   /locus_tag="EUR_04060"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89624"
FT                   /db_xref="GOA:D6E2I4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2I4"
FT                   /protein_id="CBK89624.1"
FT                   EASAGELRKNVSNFVIEE"
FT   CDS             426879..427286
FT                   /transl_table=11
FT                   /locus_tag="EUR_04080"
FT                   /product="N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89625"
FT                   /db_xref="GOA:D6E2I5"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2I5"
FT                   /protein_id="CBK89625.1"
FT   CDS             427619..427780
FT                   /transl_table=11
FT                   /locus_tag="EUR_04090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89626"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2I6"
FT                   /protein_id="CBK89626.1"
FT                   GEQTERYG"
FT   CDS             427781..427828
FT                   /transl_table=11
FT                   /locus_tag="EUR_04100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89627"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2I7"
FT                   /protein_id="CBK89627.1"
FT                   /translation="MYEKNMQIMEEEENE"
FT   CDS             427821..428504
FT                   /transl_table=11
FT                   /locus_tag="EUR_04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89628"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2I8"
FT                   /protein_id="CBK89628.1"
FT                   DDKAR"
FT   CDS             complement(428620..429081)
FT                   /transl_table=11
FT                   /locus_tag="EUR_04120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89629"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2I9"
FT                   /protein_id="CBK89629.1"
FT   CDS             429496..430227
FT                   /transl_table=11
FT                   /locus_tag="EUR_04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89630"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2J0"
FT                   /protein_id="CBK89630.1"
FT   gap             430649..431593
FT                   /estimated_length=945
FT   CDS             431605..432096
FT                   /transl_table=11
FT                   /locus_tag="EUR_04150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89631"
FT                   /db_xref="GOA:D6E2J1"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2J1"
FT                   /protein_id="CBK89631.1"
FT                   "
FT   CDS             432214..432597
FT                   /transl_table=11
FT                   /locus_tag="EUR_04160"
FT                   /product="Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89632"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2J2"
FT                   /protein_id="CBK89632.1"
FT   CDS             432605..432808
FT                   /transl_table=11
FT                   /locus_tag="EUR_04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89633"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2J3"
FT                   /protein_id="CBK89633.1"
FT   CDS             432852..433862
FT                   /transl_table=11
FT                   /locus_tag="EUR_04180"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89634"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2J4"
FT                   /protein_id="CBK89634.1"
FT   CDS             433931..434260
FT                   /transl_table=11
FT                   /locus_tag="EUR_04190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89635"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2J5"
FT                   /protein_id="CBK89635.1"
FT                   DDEDW"
FT   CDS             434397..434807
FT                   /transl_table=11
FT                   /locus_tag="EUR_04200"
FT                   /product="N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89636"
FT                   /db_xref="GOA:D6E2J6"
FT                   /db_xref="InterPro:IPR000181"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2J6"
FT                   /protein_id="CBK89636.1"
FT   CDS             complement(434995..435993)
FT                   /transl_table=11
FT                   /locus_tag="EUR_04210"
FT                   /product="Domain of unknown function (DUF1814)."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89637"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2J7"
FT                   /protein_id="CBK89637.1"
FT   CDS             complement(435990..436604)
FT                   /transl_table=11
FT                   /locus_tag="EUR_04220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89638"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2J8"
FT                   /protein_id="CBK89638.1"
FT   CDS             436902..437138
FT                   /transl_table=11
FT                   /locus_tag="EUR_04230"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89639"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2J9"
FT                   /protein_id="CBK89639.1"
FT   CDS             437216..438946
FT                   /transl_table=11
FT                   /locus_tag="EUR_04240"
FT                   /product="Protein of unknown function (DUF1703)./Predicted
FT                   AAA-ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89640"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2K0"
FT                   /protein_id="CBK89640.1"
FT                   "
FT   CDS             438939..439562
FT                   /transl_table=11
FT                   /locus_tag="EUR_04250"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89641"
FT                   /db_xref="GOA:D6E2K1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2K1"
FT                   /protein_id="CBK89641.1"
FT   CDS             439566..440039
FT                   /transl_table=11
FT                   /locus_tag="EUR_04260"
FT                   /product="Flavodoxins"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89642"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2K2"
FT                   /protein_id="CBK89642.1"
FT   CDS             complement(441353..441970)
FT                   /transl_table=11
FT                   /locus_tag="EUR_04280"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89643"
FT                   /db_xref="GOA:D6E2K3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2K3"
FT                   /protein_id="CBK89643.1"
FT   CDS             442384..442644
FT                   /transl_table=11
FT                   /locus_tag="EUR_04290"
FT                   /product="Global regulator protein family."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89644"
FT                   /db_xref="GOA:D6E2K4"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2K4"
FT                   /protein_id="CBK89644.1"
FT   CDS             442825..444255
FT                   /transl_table=11
FT                   /locus_tag="EUR_04300"
FT                   /product="Flagellin and related hook-associated proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89645"
FT                   /db_xref="GOA:D6E2K5"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2K5"
FT                   /protein_id="CBK89645.1"
FT                   SMLAQANQSNQGVLSLLQ"
FT   gap             444512..445019
FT                   /estimated_length=508
FT   CDS             445218..445319
FT                   /transl_table=11
FT                   /locus_tag="EUR_04310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89646"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2K6"
FT                   /protein_id="CBK89646.1"
FT   CDS             445500..446165
FT                   /transl_table=11
FT                   /locus_tag="EUR_04320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89647"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2K7"
FT                   /protein_id="CBK89647.1"
FT   CDS             446182..446352
FT                   /transl_table=11
FT                   /locus_tag="EUR_04330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89648"
FT                   /db_xref="GOA:D6E2K8"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2K8"
FT                   /protein_id="CBK89648.1"
FT                   GTDFRGTESLF"
FT   CDS             446309..447373
FT                   /transl_table=11
FT                   /locus_tag="EUR_04340"
FT                   /product="Predicted transcriptional regulator containing an
FT                   HTH domain and an uncharacterized domain shared with the
FT                   mammalian protein Schlafen"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89649"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2K9"
FT                   /protein_id="CBK89649.1"
FT                   CYWEVLAEVNQLQN"
FT   CDS             447570..447743
FT                   /transl_table=11
FT                   /locus_tag="EUR_04350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89650"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2L0"
FT                   /protein_id="CBK89650.1"
FT                   AKNDGKTEARTK"
FT   CDS             447982..448425
FT                   /transl_table=11
FT                   /locus_tag="EUR_04360"
FT                   /product="heat shock protein Hsp20"
FT                   /function="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89651"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2L1"
FT                   /protein_id="CBK89651.1"
FT   CDS             448737..449021
FT                   /transl_table=11
FT                   /locus_tag="EUR_04370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89652"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2L2"
FT                   /protein_id="CBK89652.1"
FT   CDS             449072..450541
FT                   /transl_table=11
FT                   /locus_tag="EUR_04380"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89653"
FT                   /db_xref="GOA:D6E2L3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2L3"
FT                   /protein_id="CBK89653.1"
FT   CDS             453622..454374
FT                   /transl_table=11
FT                   /locus_tag="EUR_04410"
FT                   /product="Predicted membrane protein, hemolysin III
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89654"
FT                   /db_xref="GOA:D6E2L4"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2L4"
FT                   /protein_id="CBK89654.1"
FT   CDS             454514..455155
FT                   /transl_table=11
FT                   /locus_tag="EUR_04420"
FT                   /product="Acetyltransferase (isoleucine patch superfamily)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89655"
FT                   /db_xref="GOA:D6E2L5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2L5"
FT                   /protein_id="CBK89655.1"
FT   CDS             455243..455752
FT                   /transl_table=11
FT                   /locus_tag="EUR_04430"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89656"
FT                   /db_xref="GOA:D6E2L6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2L6"
FT                   /protein_id="CBK89656.1"
FT                   YRMIRE"
FT   CDS             455763..456047
FT                   /transl_table=11
FT                   /locus_tag="EUR_04440"
FT                   /product="DNA-binding protein, stimulates sugar
FT                   fermentation"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89657"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2L7"
FT                   /protein_id="CBK89657.1"
FT   CDS             456047..456136
FT                   /transl_table=11
FT                   /locus_tag="EUR_04450"
FT                   /product="DNA-binding protein, stimulates sugar
FT                   fermentation"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89658"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2L8"
FT                   /protein_id="CBK89658.1"
FT                   /translation="MEVKGCTLEIDGVGYFPDAPTERGKGRRC"
FT   CDS             456233..456823
FT                   /transl_table=11
FT                   /locus_tag="EUR_04460"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89659"
FT                   /db_xref="GOA:D6E2L9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2L9"
FT                   /protein_id="CBK89659.1"
FT   CDS             456854..457456
FT                   /transl_table=11
FT                   /locus_tag="EUR_04470"
FT                   /product="Peptidase E"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89660"
FT                   /db_xref="GOA:D6E2M0"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2M0"
FT                   /protein_id="CBK89660.1"
FT   CDS             457422..458309
FT                   /transl_table=11
FT                   /locus_tag="EUR_04480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89661"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2M1"
FT                   /protein_id="CBK89661.1"
FT                   PYADGCKRIAASLF"
FT   CDS             458545..459321
FT                   /transl_table=11
FT                   /locus_tag="EUR_04490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89662"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2M2"
FT                   /protein_id="CBK89662.1"
FT   gap             459331..461089
FT                   /estimated_length=1759
FT   CDS             461336..461575
FT                   /transl_table=11
FT                   /locus_tag="EUR_04500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89663"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2M3"
FT                   /protein_id="CBK89663.1"
FT   CDS             461825..462514
FT                   /transl_table=11
FT                   /locus_tag="EUR_04510"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89664"
FT                   /db_xref="GOA:D6E2M4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2M4"
FT                   /protein_id="CBK89664.1"
FT                   WTGGEKK"
FT   CDS             462511..463542
FT                   /transl_table=11
FT                   /locus_tag="EUR_04520"
FT                   /product="His Kinase A (phosphoacceptor) domain./Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89665"
FT                   /db_xref="GOA:D6E2M5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2M5"
FT                   /protein_id="CBK89665.1"
FT                   PVR"
FT   CDS             463694..464359
FT                   /transl_table=11
FT                   /locus_tag="EUR_04530"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89666"
FT                   /db_xref="GOA:D6E2M6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2M6"
FT                   /protein_id="CBK89666.1"
FT   CDS             464374..466701
FT                   /transl_table=11
FT                   /locus_tag="EUR_04540"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89667"
FT                   /db_xref="GOA:D6E2M7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2M7"
FT                   /protein_id="CBK89667.1"
FT   CDS             complement(466897..467604)
FT                   /transl_table=11
FT                   /locus_tag="EUR_04550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89668"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2M8"
FT                   /protein_id="CBK89668.1"
FT                   RCYLKVWLEKRPY"
FT   CDS             complement(467582..469303)
FT                   /transl_table=11
FT                   /locus_tag="EUR_04560"
FT                   /product="plasmid mobilization system relaxase"
FT                   /function="plasmid mobilization system relaxase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89669"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2M9"
FT                   /protein_id="CBK89669.1"
FT   CDS             complement(469273..469632)
FT                   /transl_table=11
FT                   /locus_tag="EUR_04570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89670"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2N0"
FT                   /protein_id="CBK89670.1"
FT                   KGGIQTWRFFITQSK"
FT   CDS             complement(469632..469946)
FT                   /transl_table=11
FT                   /locus_tag="EUR_04580"
FT                   /product="relaxasome subunit MobC"
FT                   /function="relaxasome subunit MobC"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89671"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2N1"
FT                   /protein_id="CBK89671.1"
FT                   "
FT   CDS             complement(470087..470317)
FT                   /transl_table=11
FT                   /locus_tag="EUR_04590"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89672"
FT                   /db_xref="GOA:D6E2N2"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2N2"
FT                   /protein_id="CBK89672.1"
FT   CDS             470489..471118
FT                   /transl_table=11
FT                   /locus_tag="EUR_04600"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89673"
FT                   /db_xref="GOA:D6E2N3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2N3"
FT                   /protein_id="CBK89673.1"
FT   CDS             471205..472500
FT                   /transl_table=11
FT                   /locus_tag="EUR_04610"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89674"
FT                   /db_xref="GOA:D6E2N4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2N4"
FT                   /protein_id="CBK89674.1"
FT   CDS             472731..473810
FT                   /transl_table=11
FT                   /locus_tag="EUR_04620"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89675"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2N5"
FT                   /protein_id="CBK89675.1"
FT   CDS             473803..474519
FT                   /transl_table=11
FT                   /locus_tag="EUR_04630"
FT                   /product="Predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89676"
FT                   /db_xref="GOA:D6E2N6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2N6"
FT                   /protein_id="CBK89676.1"
FT                   MFINNRQMLLDRLLTD"
FT   CDS             474809..475651
FT                   /transl_table=11
FT                   /locus_tag="EUR_04640"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89677"
FT                   /db_xref="GOA:D6E2N7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2N7"
FT                   /protein_id="CBK89677.1"
FT   CDS             475648..476829
FT                   /transl_table=11
FT                   /locus_tag="EUR_04650"
FT                   /product="Putative transposase."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89678"
FT                   /db_xref="GOA:D6E2N8"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2N8"
FT                   /protein_id="CBK89678.1"
FT   CDS             476881..476973
FT                   /transl_table=11
FT                   /locus_tag="EUR_04660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89679"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2N9"
FT                   /protein_id="CBK89679.1"
FT                   /translation="MPEIDFLNKKTFTKTSGMINLRKRATIESP"
FT   CDS             477239..477805
FT                   /transl_table=11
FT                   /locus_tag="EUR_04670"
FT                   /product="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89680"
FT                   /db_xref="GOA:D6E2P0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2P0"
FT                   /protein_id="CBK89680.1"
FT   gap             478750..479425
FT                   /estimated_length=676
FT   CDS             479920..481611
FT                   /transl_table=11
FT                   /locus_tag="EUR_04690"
FT                   /product="Protein of unknown function (DUF1703)./Predicted
FT                   AAA-ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89681"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2P1"
FT                   /protein_id="CBK89681.1"
FT   CDS             482126..482221
FT                   /transl_table=11
FT                   /locus_tag="EUR_04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89682"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2P2"
FT                   /protein_id="CBK89682.1"
FT                   /translation="MFGQFVEKRESMQTNNKMAVAPRWQPASGRP"
FT   gap             483873..484610
FT                   /estimated_length=738
FT   CDS             484627..484722
FT                   /transl_table=11
FT                   /locus_tag="EUR_04730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89683"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2P3"
FT                   /protein_id="CBK89683.1"
FT                   /translation="MFALEGKHKKWKNVDKECYIVICLSIGYTIA"
FT   CDS             484747..486072
FT                   /transl_table=11
FT                   /locus_tag="EUR_04740"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89684"
FT                   /db_xref="GOA:D6E2P4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2P4"
FT                   /protein_id="CBK89684.1"
FT   CDS             486207..486401
FT                   /transl_table=11
FT                   /locus_tag="EUR_04750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89685"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2P5"
FT                   /protein_id="CBK89685.1"
FT   CDS             486385..486996
FT                   /transl_table=11
FT                   /locus_tag="EUR_04760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89686"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2P6"
FT                   /protein_id="CBK89686.1"
FT   CDS             complement(487115..487693)
FT                   /transl_table=11
FT                   /locus_tag="EUR_04770"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89687"
FT                   /db_xref="GOA:D6E2P7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2P7"
FT                   /protein_id="CBK89687.1"
FT   gap             487862..489178
FT                   /estimated_length=1317
FT   CDS             489482..489751
FT                   /transl_table=11
FT                   /locus_tag="EUR_04780"
FT                   /product="Global regulator protein family."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89688"
FT                   /db_xref="GOA:D6E2P8"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2P8"
FT                   /protein_id="CBK89688.1"
FT   CDS             489922..491436
FT                   /transl_table=11
FT                   /locus_tag="EUR_04790"
FT                   /product="Flagellin and related hook-associated proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89689"
FT                   /db_xref="GOA:D6E2P9"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2P9"
FT                   /protein_id="CBK89689.1"
FT   gap             491693..492172
FT                   /estimated_length=480
FT   CDS             complement(492851..493027)
FT                   /transl_table=11
FT                   /locus_tag="EUR_04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89690"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Q0"
FT                   /protein_id="CBK89690.1"
FT                   TQQKEPFRAMSLS"
FT   CDS             493026..493193
FT                   /transl_table=11
FT                   /locus_tag="EUR_04820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89691"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Q1"
FT                   /protein_id="CBK89691.1"
FT                   MHNTKGGMPT"
FT   CDS             494269..495720
FT                   /transl_table=11
FT                   /locus_tag="EUR_04840"
FT                   /product="arginine decarboxylase"
FT                   /function="arginine decarboxylase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89692"
FT                   /db_xref="GOA:D6E2Q2"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Q2"
FT                   /protein_id="CBK89692.1"
FT   CDS             495736..496593
FT                   /transl_table=11
FT                   /locus_tag="EUR_04850"
FT                   /product="spermidine synthase"
FT                   /function="spermidine synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89693"
FT                   /db_xref="GOA:D6E2Q3"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Q3"
FT                   /protein_id="CBK89693.1"
FT                   EETK"
FT   CDS             496645..497940
FT                   /transl_table=11
FT                   /locus_tag="EUR_04860"
FT                   /product="Saccharopine dehydrogenase and related proteins"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89694"
FT                   /db_xref="GOA:D6E2Q4"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Q4"
FT                   /protein_id="CBK89694.1"
FT   CDS             497954..499105
FT                   /transl_table=11
FT                   /locus_tag="EUR_04870"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /function="carboxynorspermidine decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89695"
FT                   /db_xref="GOA:D6E2Q5"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Q5"
FT                   /protein_id="CBK89695.1"
FT   CDS             499077..500207
FT                   /transl_table=11
FT                   /locus_tag="EUR_04880"
FT                   /product="agmatine deiminase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89696"
FT                   /db_xref="GOA:D6E2Q6"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Q6"
FT                   /protein_id="CBK89696.1"
FT   CDS             500274..501164
FT                   /transl_table=11
FT                   /locus_tag="EUR_04890"
FT                   /product="N-carbamoylputrescine amidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89697"
FT                   /db_xref="GOA:D6E2Q7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Q7"
FT                   /protein_id="CBK89697.1"
FT                   WGLFRDRRPEMYGEN"
FT   CDS             complement(501201..501332)
FT                   /transl_table=11
FT                   /locus_tag="EUR_04900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89698"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Q8"
FT                   /protein_id="CBK89698.1"
FT   CDS             complement(501334..502920)
FT                   /transl_table=11
FT                   /locus_tag="EUR_04910"
FT                   /product="hydroxylamine reductase"
FT                   /EC_number="1.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89699"
FT                   /db_xref="GOA:D6E2Q9"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Q9"
FT                   /protein_id="CBK89699.1"
FT                   PEEDIKVLLKQ"
FT   CDS             504491..504898
FT                   /transl_table=11
FT                   /locus_tag="EUR_04930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89700"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2R0"
FT                   /protein_id="CBK89700.1"
FT   CDS             505476..505571
FT                   /transl_table=11
FT                   /locus_tag="EUR_04950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89701"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2R1"
FT                   /protein_id="CBK89701.1"
FT                   /translation="MDAGTCGKNGAAVDNLTFYPEKYIDKNVQIQ"
FT   gap             505890..507206
FT                   /estimated_length=1317
FT   CDS             507702..508016
FT                   /transl_table=11
FT                   /locus_tag="EUR_04980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_04980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89702"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2R2"
FT                   /protein_id="CBK89702.1"
FT                   "
FT   gap             508876..510997
FT                   /estimated_length=2122
FT   CDS             511194..511595
FT                   /transl_table=11
FT                   /locus_tag="EUR_05010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89703"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2R3"
FT                   /protein_id="CBK89703.1"
FT   CDS             511608..512126
FT                   /transl_table=11
FT                   /locus_tag="EUR_05020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89704"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2R4"
FT                   /protein_id="CBK89704.1"
FT                   EIHNSKCLL"
FT   CDS             512752..513096
FT                   /transl_table=11
FT                   /locus_tag="EUR_05030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89705"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2R5"
FT                   /protein_id="CBK89705.1"
FT                   YDAKTGVLIQ"
FT   CDS             513161..513631
FT                   /transl_table=11
FT                   /locus_tag="EUR_05040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89706"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2R6"
FT                   /protein_id="CBK89706.1"
FT   CDS             514059..514418
FT                   /transl_table=11
FT                   /locus_tag="EUR_05060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89707"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2R7"
FT                   /protein_id="CBK89707.1"
FT                   FGEIDKKSERHFDCK"
FT   gap             514702..515692
FT                   /estimated_length=991
FT   CDS             515733..516152
FT                   /transl_table=11
FT                   /locus_tag="EUR_05080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89708"
FT                   /db_xref="InterPro:IPR025331"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2R8"
FT                   /protein_id="CBK89708.1"
FT   CDS             516153..516374
FT                   /transl_table=11
FT                   /locus_tag="EUR_05090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89709"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2R9"
FT                   /protein_id="CBK89709.1"
FT   CDS             517033..517329
FT                   /transl_table=11
FT                   /locus_tag="EUR_05100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89710"
FT                   /db_xref="InterPro:IPR025850"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2S0"
FT                   /protein_id="CBK89710.1"
FT   CDS             517340..517678
FT                   /transl_table=11
FT                   /locus_tag="EUR_05110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89711"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2S1"
FT                   /protein_id="CBK89711.1"
FT                   WESEKYKF"
FT   CDS             517926..519446
FT                   /transl_table=11
FT                   /locus_tag="EUR_05120"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89712"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2S2"
FT                   /protein_id="CBK89712.1"
FT   CDS             519614..521068
FT                   /transl_table=11
FT                   /locus_tag="EUR_05130"
FT                   /product="Lyzozyme M1 (1,4-beta-N-acetylmuramidase)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89713"
FT                   /db_xref="GOA:D6E2S3"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2S3"
FT                   /protein_id="CBK89713.1"
FT   CDS             521572..522999
FT                   /transl_table=11
FT                   /locus_tag="EUR_05150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89714"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2S4"
FT                   /protein_id="CBK89714.1"
FT                   GGNYQAAPITRSFQIVK"
FT   CDS             523239..523604
FT                   /transl_table=11
FT                   /locus_tag="EUR_05160"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89715"
FT                   /db_xref="GOA:D6E2S5"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2S5"
FT                   /protein_id="CBK89715.1"
FT                   QEAAEIRRMIDAAAGKE"
FT   CDS             523608..525329
FT                   /transl_table=11
FT                   /locus_tag="EUR_05170"
FT                   /product="Antirepressor regulating drug resistance,
FT                   predicted signal transduction N-terminal membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89716"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2S6"
FT                   /protein_id="CBK89716.1"
FT   CDS             525515..527233
FT                   /transl_table=11
FT                   /locus_tag="EUR_05180"
FT                   /product="Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89717"
FT                   /db_xref="GOA:D6E2S7"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2S7"
FT                   /protein_id="CBK89717.1"
FT   CDS             527367..528800
FT                   /transl_table=11
FT                   /locus_tag="EUR_05190"
FT                   /product="Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin
FT                   synthases and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89718"
FT                   /db_xref="GOA:D6E2S8"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2S8"
FT                   /protein_id="CBK89718.1"
FT   CDS             529491..530522
FT                   /transl_table=11
FT                   /locus_tag="EUR_05210"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89719"
FT                   /db_xref="GOA:D6E2S9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2S9"
FT                   /protein_id="CBK89719.1"
FT                   IKN"
FT   CDS             530600..531658
FT                   /transl_table=11
FT                   /locus_tag="EUR_05220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89720"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2T0"
FT                   /protein_id="CBK89720.1"
FT                   MSVKAPVKEETV"
FT   CDS             531751..532368
FT                   /transl_table=11
FT                   /locus_tag="EUR_05230"
FT                   /product="MAF protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89721"
FT                   /db_xref="GOA:D6E2T1"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2T1"
FT                   /protein_id="CBK89721.1"
FT   CDS             complement(532365..532910)
FT                   /transl_table=11
FT                   /locus_tag="EUR_05240"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89722"
FT                   /db_xref="GOA:D6E2T2"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2T2"
FT                   /protein_id="CBK89722.1"
FT                   IKMIIAMLIGPAIKKRLR"
FT   CDS             533243..534574
FT                   /transl_table=11
FT                   /locus_tag="EUR_05250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89723"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2T3"
FT                   /protein_id="CBK89723.1"
FT   CDS             534731..536323
FT                   /transl_table=11
FT                   /locus_tag="EUR_05260"
FT                   /product="Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89724"
FT                   /db_xref="GOA:D6E2T4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2T4"
FT                   /protein_id="CBK89724.1"
FT                   KGRSVNMEPANSR"
FT   CDS             complement(536624..537853)
FT                   /transl_table=11
FT                   /locus_tag="EUR_05280"
FT                   /product="peptidase T"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89725"
FT                   /db_xref="GOA:D6E2T5"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2T5"
FT                   /protein_id="CBK89725.1"
FT                   VKHVLMLADA"
FT   tRNA            538068..538140
FT                   /locus_tag="EUR_T_32830"
FT   CDS             538328..538795
FT                   /transl_table=11
FT                   /locus_tag="EUR_05290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89726"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2T6"
FT                   /protein_id="CBK89726.1"
FT   CDS             complement(538787..539428)
FT                   /transl_table=11
FT                   /locus_tag="EUR_05300"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /function="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89727"
FT                   /db_xref="GOA:D6E2T7"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2T7"
FT                   /protein_id="CBK89727.1"
FT   CDS             539666..541063
FT                   /transl_table=11
FT                   /locus_tag="EUR_05310"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89728"
FT                   /db_xref="GOA:D6E2T8"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2T8"
FT                   /protein_id="CBK89728.1"
FT                   FSGRHKY"
FT   CDS             541101..541952
FT                   /transl_table=11
FT                   /locus_tag="EUR_05320"
FT                   /product="Predicted esterase of the alpha-beta hydrolase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89729"
FT                   /db_xref="GOA:D6E2T9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2T9"
FT                   /protein_id="CBK89729.1"
FT                   KQ"
FT   CDS             541952..542557
FT                   /transl_table=11
FT                   /locus_tag="EUR_05330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89730"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2U0"
FT                   /protein_id="CBK89730.1"
FT   CDS             542548..543480
FT                   /transl_table=11
FT                   /locus_tag="EUR_05340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89731"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2U1"
FT                   /protein_id="CBK89731.1"
FT   CDS             543502..544974
FT                   /transl_table=11
FT                   /locus_tag="EUR_05350"
FT                   /product="Arginine/lysine/ornithine decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89732"
FT                   /db_xref="GOA:D6E2U2"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2U2"
FT                   /protein_id="CBK89732.1"
FT   CDS             545037..545624
FT                   /transl_table=11
FT                   /locus_tag="EUR_05360"
FT                   /product="Guanylate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89733"
FT                   /db_xref="GOA:D6E2U3"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2U3"
FT                   /protein_id="CBK89733.1"
FT   CDS             545693..546133
FT                   /transl_table=11
FT                   /locus_tag="EUR_05370"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89734"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2U4"
FT                   /protein_id="CBK89734.1"
FT   CDS             546184..547173
FT                   /transl_table=11
FT                   /locus_tag="EUR_05380"
FT                   /product="hypothetical protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89735"
FT                   /db_xref="GOA:D6E2U5"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2U5"
FT                   /protein_id="CBK89735.1"
FT   CDS             547178..548398
FT                   /transl_table=11
FT                   /locus_tag="EUR_05390"
FT                   /product="Uncharacterized homolog of PSP1"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89736"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2U6"
FT                   /protein_id="CBK89736.1"
FT                   NGSTDTQ"
FT   CDS             548376..549134
FT                   /transl_table=11
FT                   /locus_tag="EUR_05400"
FT                   /product="Predicted O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2U7"
FT                   /protein_id="CBK89737.1"
FT   CDS             549147..549983
FT                   /transl_table=11
FT                   /locus_tag="EUR_05410"
FT                   /product="conserved hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89738"
FT                   /db_xref="GOA:D6E2U8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2U8"
FT                   /protein_id="CBK89738.1"
FT   CDS             551399..552049
FT                   /transl_table=11
FT                   /locus_tag="EUR_05430"
FT                   /product="K+ transport systems, NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89739"
FT                   /db_xref="GOA:D6E2U9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2U9"
FT                   /protein_id="CBK89739.1"
FT   CDS             552113..552847
FT                   /transl_table=11
FT                   /locus_tag="EUR_05440"
FT                   /product="NAD-dependent protein deacetylases, SIR2 family"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89740"
FT                   /db_xref="GOA:D6E2V0"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2V0"
FT                   /protein_id="CBK89740.1"
FT   CDS             552905..553093
FT                   /transl_table=11
FT                   /locus_tag="EUR_05450"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89741"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2V1"
FT                   /protein_id="CBK89741.1"
FT                   PRKLVEKNDRGLTKKQA"
FT   CDS             553258..553548
FT                   /transl_table=11
FT                   /locus_tag="EUR_05460"
FT                   /product="SSU ribosomal protein S6P"
FT                   /function="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89742"
FT                   /db_xref="GOA:D6E2V2"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2V2"
FT                   /protein_id="CBK89742.1"
FT   CDS             553573..554016
FT                   /transl_table=11
FT                   /locus_tag="EUR_05470"
FT                   /product="single-strand binding protein"
FT                   /function="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89743"
FT                   /db_xref="GOA:D6E2V3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2V3"
FT                   /protein_id="CBK89743.1"
FT   CDS             554056..554313
FT                   /transl_table=11
FT                   /locus_tag="EUR_05480"
FT                   /product="SSU ribosomal protein S18P"
FT                   /function="SSU ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89744"
FT                   /db_xref="GOA:D6E2V4"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2V4"
FT                   /protein_id="CBK89744.1"
FT   CDS             554468..554911
FT                   /transl_table=11
FT                   /locus_tag="EUR_05490"
FT                   /product="Membrane protein implicated in regulation of
FT                   membrane protease activity"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89745"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2V5"
FT                   /protein_id="CBK89745.1"
FT   CDS             554918..555853
FT                   /transl_table=11
FT                   /locus_tag="EUR_05500"
FT                   /product="Membrane protease subunits, stomatin/prohibitin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89746"
FT                   /db_xref="GOA:D6E2V6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2V6"
FT                   /protein_id="CBK89746.1"
FT   CDS             556184..558241
FT                   /transl_table=11
FT                   /locus_tag="EUR_05510"
FT                   /product="Predicted signaling protein consisting of a
FT                   modified GGDEF domain and a DHH domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89747"
FT                   /db_xref="GOA:D6E2V7"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2V7"
FT                   /protein_id="CBK89747.1"
FT   CDS             558238..558684
FT                   /transl_table=11
FT                   /locus_tag="EUR_05520"
FT                   /product="LSU ribosomal protein L9P"
FT                   /function="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89748"
FT                   /db_xref="GOA:D6E2V8"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2V8"
FT                   /protein_id="CBK89748.1"
FT   CDS             560244..560705
FT                   /transl_table=11
FT                   /locus_tag="EUR_05540"
FT                   /product="Uncharacterized flagellar protein FlaG"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89749"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2V9"
FT                   /protein_id="CBK89749.1"
FT   CDS             560715..563345
FT                   /transl_table=11
FT                   /locus_tag="EUR_05550"
FT                   /product="Flagellar capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89750"
FT                   /db_xref="GOA:D6E2W0"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2W0"
FT                   /protein_id="CBK89750.1"
FT                   SSYFS"
FT   CDS             563369..563764
FT                   /transl_table=11
FT                   /locus_tag="EUR_05560"
FT                   /product="flagellar biosynthetic protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89751"
FT                   /db_xref="GOA:D6E2W1"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2W1"
FT                   /protein_id="CBK89751.1"
FT   CDS             563919..564395
FT                   /transl_table=11
FT                   /locus_tag="EUR_05570"
FT                   /product="FlgN protein."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89752"
FT                   /db_xref="GOA:D6E2W2"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2W2"
FT                   /protein_id="CBK89752.1"
FT   CDS             complement(564406..565164)
FT                   /transl_table=11
FT                   /locus_tag="EUR_05580"
FT                   /product="Protein of unknown function (DUF2807)."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89753"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="InterPro:IPR025386"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2W3"
FT                   /protein_id="CBK89753.1"
FT   CDS             complement(565258..566265)
FT                   /transl_table=11
FT                   /locus_tag="EUR_05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89754"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2W4"
FT                   /protein_id="CBK89754.1"
FT   CDS             complement(566278..566610)
FT                   /transl_table=11
FT                   /locus_tag="EUR_05600"
FT                   /product="transcriptional regulator, PadR family"
FT                   /function="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89755"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2W5"
FT                   /protein_id="CBK89755.1"
FT                   SKFIRF"
FT   CDS             567226..567813
FT                   /transl_table=11
FT                   /locus_tag="EUR_05610"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89756"
FT                   /db_xref="GOA:D6E2W6"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2W6"
FT                   /protein_id="CBK89756.1"
FT   CDS             567918..568886
FT                   /transl_table=11
FT                   /locus_tag="EUR_05620"
FT                   /product="K+-dependent Na+/Ca+ exchanger related-protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89757"
FT                   /db_xref="GOA:D6E2W7"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2W7"
FT                   /protein_id="CBK89757.1"
FT   CDS             569897..570070
FT                   /transl_table=11
FT                   /locus_tag="EUR_05640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89758"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2W8"
FT                   /protein_id="CBK89758.1"
FT                   NEKNDWISVTVD"
FT   CDS             570092..570286
FT                   /transl_table=11
FT                   /locus_tag="EUR_05650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89759"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2W9"
FT                   /protein_id="CBK89759.1"
FT   CDS             572919..573467
FT                   /transl_table=11
FT                   /locus_tag="EUR_05670"
FT                   /product="Isopentenyldiphosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89760"
FT                   /db_xref="GOA:D6E2X0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2X0"
FT                   /protein_id="CBK89760.1"
FT   CDS             573527..573733
FT                   /transl_table=11
FT                   /locus_tag="EUR_05680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89761"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2X1"
FT                   /protein_id="CBK89761.1"
FT   CDS             573905..575335
FT                   /transl_table=11
FT                   /locus_tag="EUR_05690"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89762"
FT                   /db_xref="GOA:D6E2X2"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2X2"
FT                   /protein_id="CBK89762.1"
FT                   AGEGAASTLKNSREEAKR"
FT   gap             575365..576233
FT                   /estimated_length=869
FT   CDS             576262..576744
FT                   /transl_table=11
FT                   /locus_tag="EUR_05700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89763"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2X3"
FT                   /protein_id="CBK89763.1"
FT   CDS             576826..577359
FT                   /transl_table=11
FT                   /locus_tag="EUR_05710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89764"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2X4"
FT                   /protein_id="CBK89764.1"
FT                   PHRDVVRWELKQQQ"
FT   CDS             577398..578183
FT                   /transl_table=11
FT                   /locus_tag="EUR_05720"
FT                   /product="uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89765"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2X5"
FT                   /protein_id="CBK89765.1"
FT   CDS             578236..578385
FT                   /transl_table=11
FT                   /locus_tag="EUR_05730"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89766"
FT                   /db_xref="GOA:D6E2X6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2X6"
FT                   /protein_id="CBK89766.1"
FT                   SFLE"
FT   CDS             578411..578605
FT                   /transl_table=11
FT                   /locus_tag="EUR_05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89767"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2X7"
FT                   /protein_id="CBK89767.1"
FT   CDS             578593..579696
FT                   /transl_table=11
FT                   /locus_tag="EUR_05750"
FT                   /product="Putative transposase, YhgA-like."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89768"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2X8"
FT                   /protein_id="CBK89768.1"
FT   CDS             579860..580414
FT                   /transl_table=11
FT                   /locus_tag="EUR_05760"
FT                   /product="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89769"
FT                   /db_xref="GOA:D6E2X9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2X9"
FT                   /protein_id="CBK89769.1"
FT   CDS             581391..581939
FT                   /transl_table=11
FT                   /locus_tag="EUR_05770"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89770"
FT                   /db_xref="GOA:D6E2Y0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Y0"
FT                   /protein_id="CBK89770.1"
FT   CDS             581936..582730
FT                   /transl_table=11
FT                   /locus_tag="EUR_05780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89771"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Y1"
FT                   /protein_id="CBK89771.1"
FT   CDS             582848..583486
FT                   /transl_table=11
FT                   /locus_tag="EUR_05790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89772"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Y2"
FT                   /protein_id="CBK89772.1"
FT   CDS             583889..584149
FT                   /transl_table=11
FT                   /locus_tag="EUR_05800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89773"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Y3"
FT                   /protein_id="CBK89773.1"
FT   CDS             584271..584954
FT                   /transl_table=11
FT                   /locus_tag="EUR_05810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89774"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Y4"
FT                   /protein_id="CBK89774.1"
FT                   ELIGG"
FT   CDS             585102..585473
FT                   /transl_table=11
FT                   /locus_tag="EUR_05820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89775"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Y5"
FT                   /protein_id="CBK89775.1"
FT   CDS             585535..585969
FT                   /transl_table=11
FT                   /locus_tag="EUR_05830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89776"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Y6"
FT                   /protein_id="CBK89776.1"
FT   CDS             586132..587289
FT                   /transl_table=11
FT                   /locus_tag="EUR_05840"
FT                   /product="Uncharacterized flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89777"
FT                   /db_xref="GOA:D6E2Y7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Y7"
FT                   /protein_id="CBK89777.1"
FT   CDS             587569..589209
FT                   /transl_table=11
FT                   /locus_tag="EUR_05850"
FT                   /product="Uncharacterized metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89778"
FT                   /db_xref="GOA:D6E2Y8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Y8"
FT                   /protein_id="CBK89778.1"
FT   CDS             589331..590743
FT                   /transl_table=11
FT                   /locus_tag="EUR_05860"
FT                   /product="pyruvate kinase"
FT                   /function="pyruvate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89779"
FT                   /db_xref="GOA:D6E2Y9"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Y9"
FT                   /protein_id="CBK89779.1"
FT                   TGNTNVIKVETV"
FT   CDS             591283..592710
FT                   /transl_table=11
FT                   /locus_tag="EUR_05870"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89780"
FT                   /db_xref="GOA:D6E2Z0"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Z0"
FT                   /protein_id="CBK89780.1"
FT                   KETRHFFERHRNGEIED"
FT   CDS             592713..593267
FT                   /transl_table=11
FT                   /locus_tag="EUR_05880"
FT                   /product="Fructose-2,6-bisphosphatase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89781"
FT                   /db_xref="GOA:D6E2Z1"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Z1"
FT                   /protein_id="CBK89781.1"
FT   CDS             593487..594959
FT                   /transl_table=11
FT                   /locus_tag="EUR_05890"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89782"
FT                   /db_xref="GOA:D6E2Z2"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Z2"
FT                   /protein_id="CBK89782.1"
FT   CDS             594991..595656
FT                   /transl_table=11
FT                   /locus_tag="EUR_05900"
FT                   /product="probable selenium-dependent hydroxylase accessory
FT                   protein YqeC"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89783"
FT                   /db_xref="InterPro:IPR017587"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Z3"
FT                   /protein_id="CBK89783.1"
FT   CDS             595699..596661
FT                   /transl_table=11
FT                   /locus_tag="EUR_05910"
FT                   /product="selenium-dependent molybdenum hydroxylase system
FT                   protein, YqeB family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89784"
FT                   /db_xref="InterPro:IPR017695"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Z4"
FT                   /protein_id="CBK89784.1"
FT   CDS             597342..597830
FT                   /transl_table=11
FT                   /locus_tag="EUR_05930"
FT                   /product="molybdopterin adenylyltransferase"
FT                   /function="molybdopterin adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89785"
FT                   /db_xref="GOA:D6E2Z5"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Z5"
FT                   /protein_id="CBK89785.1"
FT   CDS             597900..599009
FT                   /transl_table=11
FT                   /locus_tag="EUR_05940"
FT                   /product="Molybdopterin biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89786"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Z6"
FT                   /protein_id="CBK89786.1"
FT   CDS             599011..600084
FT                   /transl_table=11
FT                   /locus_tag="EUR_05950"
FT                   /product="Molybdenum cofactor biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89787"
FT                   /db_xref="GOA:D6E2Z7"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Z7"
FT                   /protein_id="CBK89787.1"
FT                   LKAAEVNAARNMSRIGG"
FT   CDS             600094..601536
FT                   /transl_table=11
FT                   /locus_tag="EUR_05960"
FT                   /product="Xanthine and CO dehydrogenases maturation factor,
FT                   XdhC/CoxF family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89788"
FT                   /db_xref="GOA:D6E2Z8"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015808"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Z8"
FT                   /protein_id="CBK89788.1"
FT   CDS             601633..602547
FT                   /transl_table=11
FT                   /locus_tag="EUR_05970"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89789"
FT                   /db_xref="GOA:D6E2Z9"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:D6E2Z9"
FT                   /protein_id="CBK89789.1"
FT   CDS             602547..603272
FT                   /transl_table=11
FT                   /locus_tag="EUR_05980"
FT                   /product="molybdate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89790"
FT                   /db_xref="GOA:D6E300"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="UniProtKB/TrEMBL:D6E300"
FT                   /protein_id="CBK89790.1"
FT   CDS             603235..604305
FT                   /transl_table=11
FT                   /locus_tag="EUR_05990"
FT                   /product="ABC-type sulfate/molybdate transport systems,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89791"
FT                   /db_xref="GOA:D6E301"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E301"
FT                   /protein_id="CBK89791.1"
FT                   KNINDELYIKNFYLLG"
FT   CDS             604326..605489
FT                   /transl_table=11
FT                   /locus_tag="EUR_06000"
FT                   /product="cysteine desulfurase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89792"
FT                   /db_xref="GOA:D6E302"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010969"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D6E302"
FT                   /protein_id="CBK89792.1"
FT   CDS             605519..606547
FT                   /transl_table=11
FT                   /locus_tag="EUR_06010"
FT                   /product="selenophosphate synthase"
FT                   /function="selenophosphate synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89793"
FT                   /db_xref="GOA:D6E303"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="UniProtKB/TrEMBL:D6E303"
FT                   /protein_id="CBK89793.1"
FT                   VN"
FT   CDS             606645..607262
FT                   /transl_table=11
FT                   /locus_tag="EUR_06020"
FT                   /product="selenium metabolism protein YedF"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89794"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR019870"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D6E304"
FT                   /protein_id="CBK89794.1"
FT   CDS             607284..607538
FT                   /transl_table=11
FT                   /locus_tag="EUR_06030"
FT                   /product="Protein of unknown function (DUF3343)."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89795"
FT                   /db_xref="InterPro:IPR021778"
FT                   /db_xref="UniProtKB/TrEMBL:D6E305"
FT                   /protein_id="CBK89795.1"
FT   CDS             607578..608438
FT                   /transl_table=11
FT                   /locus_tag="EUR_06040"
FT                   /product="Aerobic-type carbon monoxide dehydrogenase,
FT                   middle subunit CoxM/CutM homologs"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89796"
FT                   /db_xref="GOA:D6E306"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D6E306"
FT                   /protein_id="CBK89796.1"
FT                   IKHEH"
FT   CDS             608459..608992
FT                   /transl_table=11
FT                   /locus_tag="EUR_06050"
FT                   /product="Aerobic-type carbon monoxide dehydrogenase, small
FT                   subunit CoxS/CutS homologs"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89797"
FT                   /db_xref="GOA:D6E307"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniProtKB/TrEMBL:D6E307"
FT                   /protein_id="CBK89797.1"
FT                   EDIGKEWKDEHKSN"
FT   CDS             608973..611348
FT                   /transl_table=11
FT                   /locus_tag="EUR_06060"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /function="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89798"
FT                   /db_xref="GOA:D6E308"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="UniProtKB/TrEMBL:D6E308"
FT                   /protein_id="CBK89798.1"
FT   CDS             611345..611983
FT                   /transl_table=11
FT                   /locus_tag="EUR_06070"
FT                   /product="Uncharacterized MobA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89799"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6E309"
FT                   /protein_id="CBK89799.1"
FT   CDS             612902..615322
FT                   /transl_table=11
FT                   /locus_tag="EUR_06090"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89800"
FT                   /db_xref="GOA:D6E310"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D6E310"
FT                   /protein_id="CBK89800.1"
FT   CDS             615754..617061
FT                   /transl_table=11
FT                   /locus_tag="EUR_06110"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89801"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E311"
FT                   /protein_id="CBK89801.1"
FT   CDS             617557..617790
FT                   /transl_table=11
FT                   /locus_tag="EUR_06120"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89802"
FT                   /db_xref="GOA:D6E312"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D6E312"
FT                   /protein_id="CBK89802.1"
FT   CDS             617796..618704
FT                   /transl_table=11
FT                   /locus_tag="EUR_06130"
FT                   /product="putative enoyl-(acyl-carrier-protein) reductase
FT                   II"
FT                   /EC_number="1.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89803"
FT                   /db_xref="GOA:D6E313"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017569"
FT                   /db_xref="UniProtKB/TrEMBL:D6E313"
FT                   /protein_id="CBK89803.1"
FT   CDS             618798..619724
FT                   /transl_table=11
FT                   /locus_tag="EUR_06140"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89804"
FT                   /db_xref="GOA:D6E314"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:D6E314"
FT                   /protein_id="CBK89804.1"
FT   CDS             619711..620451
FT                   /transl_table=11
FT                   /locus_tag="EUR_06150"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89805"
FT                   /db_xref="GOA:D6E315"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D6E315"
FT                   /protein_id="CBK89805.1"
FT   CDS             620448..621680
FT                   /transl_table=11
FT                   /locus_tag="EUR_06160"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase 2"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89806"
FT                   /db_xref="GOA:D6E316"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="UniProtKB/TrEMBL:D6E316"
FT                   /protein_id="CBK89806.1"
FT                   HNASILLKAYK"
FT   CDS             621949..622377
FT                   /transl_table=11
FT                   /locus_tag="EUR_06170"
FT                   /product="beta-hydroxyacyl-[acyl carrier protein]
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89807"
FT                   /db_xref="GOA:D6E317"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D6E317"
FT                   /protein_id="CBK89807.1"
FT   CDS             622395..624161
FT                   /transl_table=11
FT                   /locus_tag="EUR_06180"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /function="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89808"
FT                   /db_xref="GOA:D6E318"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D6E318"
FT                   /protein_id="CBK89808.1"
FT                   LLEERYKRFRKF"
FT   CDS             624180..625148
FT                   /transl_table=11
FT                   /locus_tag="EUR_06190"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89809"
FT                   /db_xref="GOA:D6E319"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D6E319"
FT                   /protein_id="CBK89809.1"
FT   CDS             625161..625655
FT                   /transl_table=11
FT                   /locus_tag="EUR_06200"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89810"
FT                   /db_xref="GOA:D6E320"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6E320"
FT                   /protein_id="CBK89810.1"
FT                   K"
FT   CDS             625765..627123
FT                   /transl_table=11
FT                   /locus_tag="EUR_06210"
FT                   /product="Glutamate dehydrogenase/leucine dehydrogenase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89811"
FT                   /db_xref="GOA:D6E321"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6E321"
FT                   /protein_id="CBK89811.1"
FT   CDS             complement(627222..628229)
FT                   /transl_table=11
FT                   /locus_tag="EUR_06220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89812"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D6E322"
FT                   /protein_id="CBK89812.1"
FT   CDS             complement(628222..628647)
FT                   /transl_table=11
FT                   /locus_tag="EUR_06230"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89813"
FT                   /db_xref="GOA:D6E323"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D6E323"
FT                   /protein_id="CBK89813.1"
FT   CDS             629000..629095
FT                   /transl_table=11
FT                   /locus_tag="EUR_06240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89814"
FT                   /db_xref="UniProtKB/TrEMBL:D6E324"
FT                   /protein_id="CBK89814.1"
FT                   /translation="MQSIDSWVLDSVSDIDTAHIIVITDIYSGVF"
FT   CDS             629264..630424
FT                   /transl_table=11
FT                   /locus_tag="EUR_06250"
FT                   /product="diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase /5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /function="diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase"
FT                   /function="5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89815"
FT                   /db_xref="GOA:D6E325"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D6E325"
FT                   /protein_id="CBK89815.1"
FT   CDS             630541..631260
FT                   /transl_table=11
FT                   /locus_tag="EUR_06260"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89816"
FT                   /db_xref="GOA:D6E326"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:D6E326"
FT                   /protein_id="CBK89816.1"
FT                   KKQPVGITRDFLAKYGF"
FT   CDS             631367..632563
FT                   /transl_table=11
FT                   /locus_tag="EUR_06270"
FT                   /product="GTP cyclohydrolase II/3,4-dihydroxy-2-butanone
FT                   4-phosphate synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89817"
FT                   /db_xref="GOA:D6E327"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D6E327"
FT                   /protein_id="CBK89817.1"
FT   CDS             632686..633150
FT                   /transl_table=11
FT                   /locus_tag="EUR_06280"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89818"
FT                   /db_xref="GOA:D6E328"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="UniProtKB/TrEMBL:D6E328"
FT                   /protein_id="CBK89818.1"
FT   CDS             634564..635337
FT                   /transl_table=11
FT                   /locus_tag="EUR_06300"
FT                   /product="Capsular polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89819"
FT                   /db_xref="GOA:D6E329"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:D6E329"
FT                   /protein_id="CBK89819.1"
FT   CDS             635364..636077
FT                   /transl_table=11
FT                   /locus_tag="EUR_06310"
FT                   /product="capsular exopolysaccharide family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89820"
FT                   /db_xref="GOA:D6E330"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E330"
FT                   /protein_id="CBK89820.1"
FT                   YGNYYGSYYGQSDKA"
FT   CDS             636074..637972
FT                   /transl_table=11
FT                   /locus_tag="EUR_06320"
FT                   /product="Molecular chaperone, HSP90 family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89821"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="UniProtKB/TrEMBL:D6E331"
FT                   /protein_id="CBK89821.1"
FT   CDS             638036..638656
FT                   /transl_table=11
FT                   /locus_tag="EUR_06330"
FT                   /product="signal peptidase I . Serine peptidase. MEROPS
FT                   family S26A"
FT                   /function="signal peptidase I . Serine peptidase. MEROPS
FT                   family S26A"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89822"
FT                   /db_xref="GOA:D6E332"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:D6E332"
FT                   /protein_id="CBK89822.1"
FT   CDS             638698..639846
FT                   /transl_table=11
FT                   /locus_tag="EUR_06340"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89823"
FT                   /db_xref="GOA:D6E333"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="UniProtKB/TrEMBL:D6E333"
FT                   /protein_id="CBK89823.1"
FT   CDS             639915..640688
FT                   /transl_table=11
FT                   /locus_tag="EUR_06350"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89824"
FT                   /db_xref="GOA:D6E334"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D6E334"
FT                   /protein_id="CBK89824.1"
FT   CDS             complement(640675..641943)
FT                   /transl_table=11
FT                   /locus_tag="EUR_06360"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89825"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D6E335"
FT                   /protein_id="CBK89825.1"
FT   CDS             642113..642229
FT                   /transl_table=11
FT                   /locus_tag="EUR_06370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89826"
FT                   /db_xref="UniProtKB/TrEMBL:D6E336"
FT                   /protein_id="CBK89826.1"
FT   CDS             642250..642396
FT                   /transl_table=11
FT                   /locus_tag="EUR_06380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89827"
FT                   /db_xref="UniProtKB/TrEMBL:D6E337"
FT                   /protein_id="CBK89827.1"
FT                   QSV"
FT   CDS             642515..642667
FT                   /transl_table=11
FT                   /locus_tag="EUR_06390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89828"
FT                   /db_xref="UniProtKB/TrEMBL:D6E338"
FT                   /protein_id="CBK89828.1"
FT                   RPMPI"
FT   CDS             642810..642953
FT                   /transl_table=11
FT                   /locus_tag="EUR_06400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89829"
FT                   /db_xref="UniProtKB/TrEMBL:D6E339"
FT                   /protein_id="CBK89829.1"
FT                   AG"
FT   CDS             642969..643121
FT                   /transl_table=11
FT                   /locus_tag="EUR_06410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89830"
FT                   /db_xref="UniProtKB/TrEMBL:D6E340"
FT                   /protein_id="CBK89830.1"
FT                   KNRKK"
FT   CDS             643136..643297
FT                   /transl_table=11
FT                   /locus_tag="EUR_06420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89831"
FT                   /db_xref="UniProtKB/TrEMBL:D6E341"
FT                   /protein_id="CBK89831.1"
FT                   GSKSDKKD"
FT   CDS             643377..645590
FT                   /transl_table=11
FT                   /locus_tag="EUR_06430"
FT                   /product="bacteriocin-processing peptidase. Cysteine
FT                   peptidase. MEROPS family C39"
FT                   /function="bacteriocin-processing peptidase. Cysteine
FT                   peptidase. MEROPS family C39"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89832"
FT                   /db_xref="GOA:D6E342"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E342"
FT                   /protein_id="CBK89832.1"
FT   CDS             645616..647088
FT                   /transl_table=11
FT                   /locus_tag="EUR_06440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89833"
FT                   /db_xref="GOA:D6E343"
FT                   /db_xref="InterPro:IPR003997"
FT                   /db_xref="UniProtKB/TrEMBL:D6E343"
FT                   /protein_id="CBK89833.1"
FT   CDS             647361..647822
FT                   /transl_table=11
FT                   /locus_tag="EUR_06450"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89834"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:D6E344"
FT                   /protein_id="CBK89834.1"
FT   CDS             648019..648255
FT                   /transl_table=11
FT                   /locus_tag="EUR_06460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89835"
FT                   /db_xref="UniProtKB/TrEMBL:D6E345"
FT                   /protein_id="CBK89835.1"
FT   CDS             648322..648522
FT                   /transl_table=11
FT                   /locus_tag="EUR_06470"
FT                   /product="Bacteriocin class II with double-glycine leader
FT                   peptide."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89836"
FT                   /db_xref="GOA:D6E346"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:D6E346"
FT                   /protein_id="CBK89836.1"
FT   CDS             648736..649176
FT                   /transl_table=11
FT                   /locus_tag="EUR_06480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89837"
FT                   /db_xref="UniProtKB/TrEMBL:D6E347"
FT                   /protein_id="CBK89837.1"
FT   CDS             649417..650145
FT                   /transl_table=11
FT                   /locus_tag="EUR_06490"
FT                   /product="CAAX amino terminal protease family."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89838"
FT                   /db_xref="GOA:D6E348"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D6E348"
FT                   /protein_id="CBK89838.1"
FT   gap             650295..651296
FT                   /estimated_length=1002
FT   CDS             651310..651441
FT                   /transl_table=11
FT                   /locus_tag="EUR_06500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89839"
FT                   /db_xref="UniProtKB/TrEMBL:D6E349"
FT                   /protein_id="CBK89839.1"
FT   CDS             651743..652675
FT                   /transl_table=11
FT                   /locus_tag="EUR_06510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89840"
FT                   /db_xref="UniProtKB/TrEMBL:D6E350"
FT                   /protein_id="CBK89840.1"
FT   CDS             652855..653205
FT                   /transl_table=11
FT                   /locus_tag="EUR_06520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89841"
FT                   /db_xref="UniProtKB/TrEMBL:D6E351"
FT                   /protein_id="CBK89841.1"
FT                   AQIEKVAEFLSE"
FT   CDS             653426..654778
FT                   /transl_table=11
FT                   /locus_tag="EUR_06530"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89842"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E352"
FT                   /protein_id="CBK89842.1"
FT   CDS             654801..655280
FT                   /transl_table=11
FT                   /locus_tag="EUR_06540"
FT                   /product="D-alanyl-D-alanine carboxypeptidase."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89843"
FT                   /db_xref="GOA:D6E353"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D6E353"
FT                   /protein_id="CBK89843.1"
FT   CDS             655376..655891
FT                   /transl_table=11
FT                   /locus_tag="EUR_06550"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89844"
FT                   /db_xref="GOA:D6E354"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D6E354"
FT                   /protein_id="CBK89844.1"
FT                   KQLEVEKL"
FT   CDS             655888..656652
FT                   /transl_table=11
FT                   /locus_tag="EUR_06560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89845"
FT                   /db_xref="UniProtKB/TrEMBL:D6E355"
FT                   /protein_id="CBK89845.1"
FT   CDS             657510..658715
FT                   /transl_table=11
FT                   /locus_tag="EUR_06580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89846"
FT                   /db_xref="GOA:D6E356"
FT                   /db_xref="InterPro:IPR008031"
FT                   /db_xref="UniProtKB/TrEMBL:D6E356"
FT                   /protein_id="CBK89846.1"
FT                   KK"
FT   CDS             658847..660205
FT                   /transl_table=11
FT                   /locus_tag="EUR_06590"
FT                   /product="transporter, NhaC family (TC 2.A.35)"
FT                   /function="transporter, NhaC family (TC 2.A.35)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89847"
FT                   /db_xref="GOA:D6E357"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D6E357"
FT                   /protein_id="CBK89847.1"
FT   CDS             complement(660297..660524)
FT                   /transl_table=11
FT                   /locus_tag="EUR_06600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89848"
FT                   /db_xref="InterPro:IPR022453"
FT                   /db_xref="UniProtKB/TrEMBL:D6E358"
FT                   /protein_id="CBK89848.1"
FT   CDS             complement(660529..660846)
FT                   /transl_table=11
FT                   /locus_tag="EUR_06610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89849"
FT                   /db_xref="InterPro:IPR025354"
FT                   /db_xref="UniProtKB/TrEMBL:D6E359"
FT                   /protein_id="CBK89849.1"
FT                   N"
FT   gap             660937..662079
FT                   /estimated_length=1143
FT   CDS             662199..662420
FT                   /transl_table=11
FT                   /locus_tag="EUR_06620"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89850"
FT                   /db_xref="GOA:D6E360"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6E360"
FT                   /protein_id="CBK89850.1"
FT   CDS             662407..663180
FT                   /transl_table=11
FT                   /locus_tag="EUR_06630"
FT                   /product="Protein of unknown function (DUF3169)."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89851"
FT                   /db_xref="InterPro:IPR021509"
FT                   /db_xref="UniProtKB/TrEMBL:D6E361"
FT                   /protein_id="CBK89851.1"
FT   CDS             663214..663570
FT                   /transl_table=11
FT                   /locus_tag="EUR_06640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89852"
FT                   /db_xref="UniProtKB/TrEMBL:D6E362"
FT                   /protein_id="CBK89852.1"
FT                   PYNKKGKRSTIIDM"
FT   CDS             663912..664760
FT                   /transl_table=11
FT                   /locus_tag="EUR_06650"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89853"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E363"
FT                   /protein_id="CBK89853.1"
FT                   I"
FT   CDS             665241..667373
FT                   /transl_table=11
FT                   /locus_tag="EUR_06660"
FT                   /product="Phosphoglycerol transferase and related proteins,
FT                   alkaline phosphatase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89854"
FT                   /db_xref="GOA:D6E364"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D6E364"
FT                   /protein_id="CBK89854.1"
FT                   VEHDSESETDEPTENQ"
FT   CDS             667883..668083
FT                   /transl_table=11
FT                   /locus_tag="EUR_06670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89855"
FT                   /db_xref="UniProtKB/TrEMBL:D6E365"
FT                   /protein_id="CBK89855.1"
FT   CDS             668235..668327
FT                   /transl_table=11
FT                   /locus_tag="EUR_06680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89856"
FT                   /db_xref="UniProtKB/TrEMBL:D6E366"
FT                   /protein_id="CBK89856.1"
FT                   /translation="MFQNPGILENHICLFYVENAIGNEKGEKWR"
FT   CDS             668324..669688
FT                   /transl_table=11
FT                   /locus_tag="EUR_06690"
FT                   /product="Mg2+ transporter (mgtE)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89857"
FT                   /db_xref="GOA:D6E367"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="UniProtKB/TrEMBL:D6E367"
FT                   /protein_id="CBK89857.1"
FT   CDS             669821..670081
FT                   /transl_table=11
FT                   /locus_tag="EUR_06700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89858"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:D6E368"
FT                   /protein_id="CBK89858.1"
FT   CDS             670097..670381
FT                   /transl_table=11
FT                   /locus_tag="EUR_06710"
FT                   /product="Protein of unknown function (DUF2442)."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89859"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:D6E369"
FT                   /protein_id="CBK89859.1"
FT   CDS             670534..671493
FT                   /transl_table=11
FT                   /locus_tag="EUR_06720"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89860"
FT                   /db_xref="GOA:D6E370"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D6E370"
FT                   /protein_id="CBK89860.1"
FT   CDS             671493..672164
FT                   /transl_table=11
FT                   /locus_tag="EUR_06730"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89861"
FT                   /db_xref="GOA:D6E371"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6E371"
FT                   /protein_id="CBK89861.1"
FT                   G"
FT   CDS             672171..673319
FT                   /transl_table=11
FT                   /locus_tag="EUR_06740"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89862"
FT                   /db_xref="GOA:D6E372"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:D6E372"
FT                   /protein_id="CBK89862.1"
FT   CDS             673382..674032
FT                   /transl_table=11
FT                   /locus_tag="EUR_06750"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89863"
FT                   /db_xref="GOA:D6E373"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6E373"
FT                   /protein_id="CBK89863.1"
FT   CDS             674115..674759
FT                   /transl_table=11
FT                   /locus_tag="EUR_06760"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89864"
FT                   /db_xref="GOA:D6E374"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6E374"
FT                   /protein_id="CBK89864.1"
FT   CDS             674940..676205
FT                   /transl_table=11
FT                   /locus_tag="EUR_06770"
FT                   /product="anion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89865"
FT                   /db_xref="GOA:D6E375"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D6E375"
FT                   /protein_id="CBK89865.1"
FT   CDS             676278..677177
FT                   /transl_table=11
FT                   /locus_tag="EUR_06780"
FT                   /product="hydro-lyases, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha region"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89866"
FT                   /db_xref="GOA:D6E376"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:D6E376"
FT                   /protein_id="CBK89866.1"
FT                   VFDKDLNYTITTHSGVEL"
FT   CDS             677177..677803
FT                   /transl_table=11
FT                   /locus_tag="EUR_06790"
FT                   /product="hydro-lyases, Fe-S type, tartrate/fumarate
FT                   subfamily, beta region"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89867"
FT                   /db_xref="GOA:D6E377"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="UniProtKB/TrEMBL:D6E377"
FT                   /protein_id="CBK89867.1"
FT   CDS             678063..678674
FT                   /transl_table=11
FT                   /locus_tag="EUR_06800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89868"
FT                   /db_xref="UniProtKB/TrEMBL:D6E378"
FT                   /protein_id="CBK89868.1"
FT   CDS             678939..679706
FT                   /transl_table=11
FT                   /locus_tag="EUR_06810"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89869"
FT                   /db_xref="GOA:D6E379"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E379"
FT                   /protein_id="CBK89869.1"
FT   CDS             679699..681738
FT                   /transl_table=11
FT                   /locus_tag="EUR_06820"
FT                   /product="Predicted permease."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89870"
FT                   /db_xref="GOA:D6E380"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6E380"
FT                   /protein_id="CBK89870.1"
FT   CDS             681820..683094
FT                   /transl_table=11
FT                   /locus_tag="EUR_06830"
FT                   /product="Alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89871"
FT                   /db_xref="GOA:D6E381"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:D6E381"
FT                   /protein_id="CBK89871.1"
FT   CDS             complement(683199..684539)
FT                   /transl_table=11
FT                   /locus_tag="EUR_06840"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89872"
FT                   /db_xref="GOA:D6E382"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR023990"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="UniProtKB/TrEMBL:D6E382"
FT                   /protein_id="CBK89872.1"
FT   CDS             complement(684684..685775)
FT                   /transl_table=11
FT                   /locus_tag="EUR_06850"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89873"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6E383"
FT                   /protein_id="CBK89873.1"
FT   CDS             686006..687247
FT                   /transl_table=11
FT                   /locus_tag="EUR_06860"
FT                   /product="SAM-dependent methyltransferase"
FT                   /function="SAM-dependent methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89874"
FT                   /db_xref="GOA:D6E384"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6E384"
FT                   /protein_id="CBK89874.1"
FT                   YYLKFFIFQVVDEK"
FT   CDS             687446..687634
FT                   /transl_table=11
FT                   /locus_tag="EUR_06870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89875"
FT                   /db_xref="UniProtKB/TrEMBL:D6E385"
FT                   /protein_id="CBK89875.1"
FT                   LNKKYRVSKKKVEGSRV"
FT   CDS             complement(687904..689160)
FT                   /transl_table=11
FT                   /locus_tag="EUR_06880"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89876"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D6E386"
FT                   /protein_id="CBK89876.1"
FT   CDS             complement(689321..689884)
FT                   /transl_table=11
FT                   /locus_tag="EUR_06890"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89877"
FT                   /db_xref="GOA:D6E387"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D6E387"
FT                   /protein_id="CBK89877.1"
FT   CDS             690015..690218
FT                   /transl_table=11
FT                   /locus_tag="EUR_06900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89878"
FT                   /db_xref="UniProtKB/TrEMBL:D6E388"
FT                   /protein_id="CBK89878.1"
FT   CDS             690215..690691
FT                   /transl_table=11
FT                   /locus_tag="EUR_06910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89879"
FT                   /db_xref="UniProtKB/TrEMBL:D6E389"
FT                   /protein_id="CBK89879.1"
FT   CDS             690804..691196
FT                   /transl_table=11
FT                   /locus_tag="EUR_06920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89880"
FT                   /db_xref="UniProtKB/TrEMBL:D6E390"
FT                   /protein_id="CBK89880.1"
FT   gap             692166..694027
FT                   /estimated_length=1862
FT   CDS             694108..695619
FT                   /transl_table=11
FT                   /locus_tag="EUR_06940"
FT                   /product="ABC-type bacteriocin/lantibiotic exporters,
FT                   contain an N-terminal double-glycine peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89881"
FT                   /db_xref="GOA:D6E391"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="UniProtKB/TrEMBL:D6E391"
FT                   /protein_id="CBK89881.1"
FT   CDS             695728..696339
FT                   /transl_table=11
FT                   /locus_tag="EUR_06950"
FT                   /product="ABC-type bacteriocin/lantibiotic exporters,
FT                   contain an N-terminal double-glycine peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89882"
FT                   /db_xref="GOA:D6E392"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E392"
FT                   /protein_id="CBK89882.1"
FT   CDS             696443..696775
FT                   /transl_table=11
FT                   /locus_tag="EUR_06960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89883"
FT                   /db_xref="UniProtKB/TrEMBL:D6E393"
FT                   /protein_id="CBK89883.1"
FT                   GSYDLF"
FT   CDS             696823..697068
FT                   /transl_table=11
FT                   /locus_tag="EUR_06970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89884"
FT                   /db_xref="UniProtKB/TrEMBL:D6E394"
FT                   /protein_id="CBK89884.1"
FT   CDS             697643..697855
FT                   /transl_table=11
FT                   /locus_tag="EUR_06990"
FT                   /product="ABC-type bacteriocin/lantibiotic exporters,
FT                   contain an N-terminal double-glycine peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_06990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89885"
FT                   /db_xref="GOA:D6E395"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="UniProtKB/TrEMBL:D6E395"
FT                   /protein_id="CBK89885.1"
FT   CDS             697933..698052
FT                   /transl_table=11
FT                   /locus_tag="EUR_07000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89886"
FT                   /db_xref="UniProtKB/TrEMBL:D6E396"
FT                   /protein_id="CBK89886.1"
FT   CDS             698826..699287
FT                   /transl_table=11
FT                   /locus_tag="EUR_07020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89887"
FT                   /db_xref="UniProtKB/TrEMBL:D6E397"
FT                   /protein_id="CBK89887.1"
FT   CDS             700067..700885
FT                   /transl_table=11
FT                   /locus_tag="EUR_07030"
FT                   /product="Predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89888"
FT                   /db_xref="GOA:D6E398"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E398"
FT                   /protein_id="CBK89888.1"
FT   CDS             700924..701424
FT                   /transl_table=11
FT                   /locus_tag="EUR_07040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89889"
FT                   /db_xref="GOA:D6E399"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D6E399"
FT                   /protein_id="CBK89889.1"
FT                   III"
FT   CDS             701440..702597
FT                   /transl_table=11
FT                   /locus_tag="EUR_07050"
FT                   /product="Uncharacterized oxidoreductases, Fe-dependent
FT                   alcohol dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89890"
FT                   /db_xref="GOA:D6E3A0"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3A0"
FT                   /protein_id="CBK89890.1"
FT   gap             702706..704216
FT                   /estimated_length=1511
FT   CDS             complement(704408..705241)
FT                   /transl_table=11
FT                   /locus_tag="EUR_07060"
FT                   /product="Protein kinase domain."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89891"
FT                   /db_xref="GOA:D6E3A1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3A1"
FT                   /protein_id="CBK89891.1"
FT   CDS             705640..706101
FT                   /transl_table=11
FT                   /locus_tag="EUR_07080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89892"
FT                   /db_xref="GOA:D6E3A2"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3A2"
FT                   /protein_id="CBK89892.1"
FT   CDS             706195..707121
FT                   /transl_table=11
FT                   /locus_tag="EUR_07090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89893"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3A3"
FT                   /protein_id="CBK89893.1"
FT   CDS             707200..707556
FT                   /transl_table=11
FT                   /locus_tag="EUR_07100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89894"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3A4"
FT                   /protein_id="CBK89894.1"
FT                   VLAVVALVMAKKNN"
FT   CDS             707785..708339
FT                   /transl_table=11
FT                   /locus_tag="EUR_07110"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89895"
FT                   /db_xref="GOA:D6E3A5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3A5"
FT                   /protein_id="CBK89895.1"
FT   CDS             708336..710249
FT                   /transl_table=11
FT                   /locus_tag="EUR_07120"
FT                   /product="Secreted protein containing C-terminal
FT                   beta-propeller domain distantly related to WD-40 repeats"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89896"
FT                   /db_xref="InterPro:IPR019198"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3A6"
FT                   /protein_id="CBK89896.1"
FT                   EE"
FT   CDS             710435..711367
FT                   /transl_table=11
FT                   /locus_tag="EUR_07130"
FT                   /product="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89897"
FT                   /db_xref="GOA:D6E3A7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3A7"
FT                   /protein_id="CBK89897.1"
FT   CDS             711457..712560
FT                   /transl_table=11
FT                   /locus_tag="EUR_07140"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89898"
FT                   /db_xref="GOA:D6E3A8"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3A8"
FT                   /protein_id="CBK89898.1"
FT   CDS             712591..713847
FT                   /transl_table=11
FT                   /locus_tag="EUR_07150"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89899"
FT                   /db_xref="GOA:D6E3A9"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3A9"
FT                   /protein_id="CBK89899.1"
FT   CDS             713962..714456
FT                   /transl_table=11
FT                   /locus_tag="EUR_07160"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89900"
FT                   /db_xref="GOA:D6E3B0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3B0"
FT                   /protein_id="CBK89900.1"
FT                   C"
FT   CDS             714509..715462
FT                   /transl_table=11
FT                   /locus_tag="EUR_07170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89901"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3B1"
FT                   /protein_id="CBK89901.1"
FT   CDS             715502..716092
FT                   /transl_table=11
FT                   /locus_tag="EUR_07180"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89902"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3B2"
FT                   /protein_id="CBK89902.1"
FT   CDS             716124..716345
FT                   /transl_table=11
FT                   /locus_tag="EUR_07190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89903"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3B3"
FT                   /protein_id="CBK89903.1"
FT   CDS             716345..716914
FT                   /transl_table=11
FT                   /locus_tag="EUR_07200"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89904"
FT                   /db_xref="GOA:D6E3B4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3B4"
FT                   /protein_id="CBK89904.1"
FT   CDS             716927..717007
FT                   /transl_table=11
FT                   /locus_tag="EUR_07210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89905"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3B5"
FT                   /protein_id="CBK89905.1"
FT                   /translation="MENDGLSKLIKQNHKEARVHINMKML"
FT   CDS             717171..719255
FT                   /transl_table=11
FT                   /locus_tag="EUR_07220"
FT                   /product="Predicted exporters of the RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89906"
FT                   /db_xref="GOA:D6E3B6"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3B6"
FT                   /protein_id="CBK89906.1"
FT                   "
FT   CDS             719349..721862
FT                   /transl_table=11
FT                   /locus_tag="EUR_07230"
FT                   /product="X-X-X-Leu-X-X-Gly heptad repeats"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89907"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3B7"
FT                   /protein_id="CBK89907.1"
FT   CDS             721900..722481
FT                   /transl_table=11
FT                   /locus_tag="EUR_07240"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89908"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3B8"
FT                   /protein_id="CBK89908.1"
FT   CDS             722618..723736
FT                   /transl_table=11
FT                   /locus_tag="EUR_07250"
FT                   /product="CAAX amino terminal protease family."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89909"
FT                   /db_xref="GOA:D6E3B9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3B9"
FT                   /protein_id="CBK89909.1"
FT   CDS             723805..725670
FT                   /transl_table=11
FT                   /locus_tag="EUR_07260"
FT                   /product="Fe-S oxidoreductase"
FT                   /EC_number="4.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89910"
FT                   /db_xref="GOA:D6E3C0"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023970"
FT                   /db_xref="InterPro:IPR025288"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3C0"
FT                   /protein_id="CBK89910.1"
FT   CDS             725683..726465
FT                   /transl_table=11
FT                   /locus_tag="EUR_07270"
FT                   /product="exonuclease, DNA polymerase III, epsilon subunit
FT                   family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89911"
FT                   /db_xref="GOA:D6E3C1"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3C1"
FT                   /protein_id="CBK89911.1"
FT   CDS             complement(726509..727105)
FT                   /transl_table=11
FT                   /locus_tag="EUR_07280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89912"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3C2"
FT                   /protein_id="CBK89912.1"
FT   CDS             727171..727275
FT                   /transl_table=11
FT                   /locus_tag="EUR_07290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89913"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3C3"
FT                   /protein_id="CBK89913.1"
FT   CDS             727379..728980
FT                   /transl_table=11
FT                   /locus_tag="EUR_07300"
FT                   /product="Uncharacterized vancomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89914"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3C4"
FT                   /protein_id="CBK89914.1"
FT                   GQAQGTQTQQPAGQTQ"
FT   CDS             729076..730077
FT                   /transl_table=11
FT                   /locus_tag="EUR_07310"
FT                   /product="Hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89915"
FT                   /db_xref="GOA:D6E3C5"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3C5"
FT                   /protein_id="CBK89915.1"
FT   CDS             730105..730587
FT                   /transl_table=11
FT                   /locus_tag="EUR_07320"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89916"
FT                   /db_xref="GOA:D6E3C6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3C6"
FT                   /protein_id="CBK89916.1"
FT   CDS             730587..731765
FT                   /transl_table=11
FT                   /locus_tag="EUR_07330"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89917"
FT                   /db_xref="GOA:D6E3C7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3C7"
FT                   /protein_id="CBK89917.1"
FT   CDS             731787..732290
FT                   /transl_table=11
FT                   /locus_tag="EUR_07340"
FT                   /product="Predicted rRNA methylase (SpoU class)"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89918"
FT                   /db_xref="GOA:D6E3C8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3C8"
FT                   /protein_id="CBK89918.1"
FT                   SWDD"
FT   CDS             732380..733237
FT                   /transl_table=11
FT                   /locus_tag="EUR_07350"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89919"
FT                   /db_xref="GOA:D6E3C9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3C9"
FT                   /protein_id="CBK89919.1"
FT                   LKNR"
FT   CDS             733250..734095
FT                   /transl_table=11
FT                   /locus_tag="EUR_07360"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89920"
FT                   /db_xref="GOA:D6E3D0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3D0"
FT                   /protein_id="CBK89920.1"
FT                   "
FT   CDS             734145..734978
FT                   /transl_table=11
FT                   /locus_tag="EUR_07370"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89921"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3D1"
FT                   /protein_id="CBK89921.1"
FT   CDS             735014..735748
FT                   /transl_table=11
FT                   /locus_tag="EUR_07380"
FT                   /product="pseudouridylate synthase I"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89922"
FT                   /db_xref="GOA:D6E3D2"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3D2"
FT                   /protein_id="CBK89922.1"
FT   CDS             735876..737111
FT                   /transl_table=11
FT                   /locus_tag="EUR_07390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89923"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3D3"
FT                   /protein_id="CBK89923.1"
FT                   KPAKELNTPVKK"
FT   CDS             737205..738779
FT                   /transl_table=11
FT                   /locus_tag="EUR_07400"
FT                   /product="Predicted membrane protein involved in D-alanine
FT                   export"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89924"
FT                   /db_xref="GOA:D6E3D4"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3D4"
FT                   /protein_id="CBK89924.1"
FT                   DFVYMQF"
FT   CDS             739039..739467
FT                   /transl_table=11
FT                   /locus_tag="EUR_07410"
FT                   /product="LSU ribosomal protein L13P"
FT                   /function="LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89925"
FT                   /db_xref="GOA:D6E3D5"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR023564"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3D5"
FT                   /protein_id="CBK89925.1"
FT   CDS             740341..741162
FT                   /transl_table=11
FT                   /locus_tag="EUR_07430"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89926"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3D6"
FT                   /protein_id="CBK89926.1"
FT   CDS             742061..742333
FT                   /transl_table=11
FT                   /locus_tag="EUR_07450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89927"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3D7"
FT                   /protein_id="CBK89927.1"
FT   CDS             742363..742548
FT                   /transl_table=11
FT                   /locus_tag="EUR_07460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89928"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3D8"
FT                   /protein_id="CBK89928.1"
FT                   PRKPLFWFYARKFEKC"
FT   CDS             742616..743476
FT                   /transl_table=11
FT                   /locus_tag="EUR_07470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89929"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3D9"
FT                   /protein_id="CBK89929.1"
FT                   LYGGW"
FT   CDS             743527..743838
FT                   /transl_table=11
FT                   /locus_tag="EUR_07480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89930"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3E0"
FT                   /protein_id="CBK89930.1"
FT   CDS             743937..744437
FT                   /transl_table=11
FT                   /locus_tag="EUR_07490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89931"
FT                   /db_xref="InterPro:IPR024234"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3E1"
FT                   /protein_id="CBK89931.1"
FT                   LER"
FT   gap             744734..745547
FT                   /estimated_length=814
FT   CDS             746575..746793
FT                   /transl_table=11
FT                   /locus_tag="EUR_07520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89932"
FT                   /db_xref="InterPro:IPR024272"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3E2"
FT                   /protein_id="CBK89932.1"
FT   CDS             746863..747732
FT                   /transl_table=11
FT                   /locus_tag="EUR_07530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89933"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3E3"
FT                   /protein_id="CBK89933.1"
FT                   AKSVFQAH"
FT   CDS             750567..750947
FT                   /transl_table=11
FT                   /locus_tag="EUR_07560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89934"
FT                   /db_xref="InterPro:IPR024216"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3E4"
FT                   /protein_id="CBK89934.1"
FT   CDS             752705..752962
FT                   /transl_table=11
FT                   /locus_tag="EUR_07580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89935"
FT                   /db_xref="InterPro:IPR025464"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3E5"
FT                   /protein_id="CBK89935.1"
FT   CDS             752952..753710
FT                   /transl_table=11
FT                   /locus_tag="EUR_07590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89936"
FT                   /db_xref="InterPro:IPR025376"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3E6"
FT                   /protein_id="CBK89936.1"
FT   CDS             753897..756005
FT                   /transl_table=11
FT                   /locus_tag="EUR_07600"
FT                   /product="DNA topoisomerase III, bacteria and conjugative
FT                   plasmid"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89937"
FT                   /db_xref="GOA:D6E3E7"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3E7"
FT                   /protein_id="CBK89937.1"
FT                   DQRKGGSR"
FT   CDS             756002..756280
FT                   /transl_table=11
FT                   /locus_tag="EUR_07610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89938"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3E8"
FT                   /protein_id="CBK89938.1"
FT   CDS             756287..759571
FT                   /transl_table=11
FT                   /locus_tag="EUR_07620"
FT                   /product="DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89939"
FT                   /db_xref="GOA:D6E3E9"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR025465"
FT                   /db_xref="InterPro:IPR025923"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3E9"
FT                   /protein_id="CBK89939.1"
FT   CDS             759573..759788
FT                   /transl_table=11
FT                   /locus_tag="EUR_07630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89940"
FT                   /db_xref="InterPro:IPR025468"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3F0"
FT                   /protein_id="CBK89940.1"
FT   CDS             759867..768656
FT                   /transl_table=11
FT                   /locus_tag="EUR_07640"
FT                   /product="DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89941"
FT                   /db_xref="GOA:D6E3F1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3F1"
FT                   /protein_id="CBK89941.1"
FT   CDS             768658..769476
FT                   /transl_table=11
FT                   /locus_tag="EUR_07650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89942"
FT                   /db_xref="InterPro:IPR024380"
FT                   /db_xref="InterPro:IPR024383"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3F2"
FT                   /protein_id="CBK89942.1"
FT   CDS             769479..769817
FT                   /transl_table=11
FT                   /locus_tag="EUR_07660"
FT                   /product="Bacterial mobilisation protein (MobC)."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89943"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3F3"
FT                   /protein_id="CBK89943.1"
FT                   LTQLSKLS"
FT   CDS             769969..770271
FT                   /transl_table=11
FT                   /locus_tag="EUR_07670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89944"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3F4"
FT                   /protein_id="CBK89944.1"
FT   CDS             770268..770567
FT                   /transl_table=11
FT                   /locus_tag="EUR_07680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89945"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3F5"
FT                   /protein_id="CBK89945.1"
FT   CDS             complement(770642..772054)
FT                   /transl_table=11
FT                   /locus_tag="EUR_07690"
FT                   /product="Predicted transcriptional regulator containing an
FT                   HTH domain and an uncharacterized domain shared with the
FT                   mammalian protein Schlafen"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89946"
FT                   /db_xref="GOA:D6E3F6"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3F6"
FT                   /protein_id="CBK89946.1"
FT                   SRNQKYITVRSE"
FT   CDS             772181..773593
FT                   /transl_table=11
FT                   /locus_tag="EUR_07700"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89947"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3F7"
FT                   /protein_id="CBK89947.1"
FT                   QDVEKEKDHGQR"
FT   CDS             complement(773816..774172)
FT                   /transl_table=11
FT                   /locus_tag="EUR_07710"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89948"
FT                   /db_xref="GOA:D6E3F8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3F8"
FT                   /protein_id="CBK89948.1"
FT                   VKELTELSKKFETN"
FT   CDS             774335..774514
FT                   /transl_table=11
FT                   /locus_tag="EUR_07720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89949"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3F9"
FT                   /protein_id="CBK89949.1"
FT                   EKPVDRRRKENKSQ"
FT   CDS             774565..775248
FT                   /transl_table=11
FT                   /locus_tag="EUR_07730"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89950"
FT                   /db_xref="GOA:D6E3G0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3G0"
FT                   /protein_id="CBK89950.1"
FT                   GGVLK"
FT   CDS             775245..776276
FT                   /transl_table=11
FT                   /locus_tag="EUR_07740"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89951"
FT                   /db_xref="GOA:D6E3G1"
FT                   /db_xref="InterPro:IPR002369"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3G1"
FT                   /protein_id="CBK89951.1"
FT                   PRQ"
FT   CDS             776418..777083
FT                   /transl_table=11
FT                   /locus_tag="EUR_07750"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89952"
FT                   /db_xref="GOA:D6E3G2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3G2"
FT                   /protein_id="CBK89952.1"
FT   CDS             777099..779609
FT                   /transl_table=11
FT                   /locus_tag="EUR_07760"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89953"
FT                   /db_xref="GOA:D6E3G3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3G3"
FT                   /protein_id="CBK89953.1"
FT   CDS             780193..780606
FT                   /transl_table=11
FT                   /locus_tag="EUR_07770"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89954"
FT                   /db_xref="GOA:D6E3G4"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3G4"
FT                   /protein_id="CBK89954.1"
FT   CDS             781158..781385
FT                   /transl_table=11
FT                   /locus_tag="EUR_07780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89955"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3G5"
FT                   /protein_id="CBK89955.1"
FT   CDS             782838..784049
FT                   /transl_table=11
FT                   /locus_tag="EUR_07800"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89956"
FT                   /db_xref="GOA:D6E3G6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3G6"
FT                   /protein_id="CBK89956.1"
FT                   AIAE"
FT   CDS             784046..784384
FT                   /transl_table=11
FT                   /locus_tag="EUR_07810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89957"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3G7"
FT                   /protein_id="CBK89957.1"
FT                   LGNVLFFV"
FT   CDS             complement(784381..784515)
FT                   /transl_table=11
FT                   /locus_tag="EUR_07820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89958"
FT                   /db_xref="GOA:D6E3G8"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3G8"
FT                   /protein_id="CBK89958.1"
FT   CDS             785447..785635
FT                   /transl_table=11
FT                   /locus_tag="EUR_07840"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89959"
FT                   /db_xref="GOA:D6E3G9"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3G9"
FT                   /protein_id="CBK89959.1"
FT                   KRVELDAWVKSGRSAIE"
FT   CDS             785673..786443
FT                   /transl_table=11
FT                   /locus_tag="EUR_07850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89960"
FT                   /db_xref="InterPro:IPR024975"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3H0"
FT                   /protein_id="CBK89960.1"
FT   CDS             786454..787626
FT                   /transl_table=11
FT                   /locus_tag="EUR_07860"
FT                   /product="DNA adenine methylase (dam)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89961"
FT                   /db_xref="GOA:D6E3H1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3H1"
FT                   /protein_id="CBK89961.1"
FT   CDS             787630..788442
FT                   /transl_table=11
FT                   /locus_tag="EUR_07870"
FT                   /product="MjaII restriction endonuclease."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89962"
FT                   /db_xref="GOA:D6E3H2"
FT                   /db_xref="InterPro:IPR019045"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3H2"
FT                   /protein_id="CBK89962.1"
FT   CDS             complement(789258..789500)
FT                   /transl_table=11
FT                   /locus_tag="EUR_07890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89963"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3H3"
FT                   /protein_id="CBK89963.1"
FT   gap             789804..791680
FT                   /estimated_length=1877
FT   CDS             791709..791951
FT                   /transl_table=11
FT                   /locus_tag="EUR_07900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89964"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3H4"
FT                   /protein_id="CBK89964.1"
FT   CDS             792077..793330
FT                   /transl_table=11
FT                   /locus_tag="EUR_07910"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89965"
FT                   /db_xref="GOA:D6E3H5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3H5"
FT                   /protein_id="CBK89965.1"
FT                   IIRTTEDIEAYMAEHKKN"
FT   CDS             793537..793845
FT                   /transl_table=11
FT                   /locus_tag="EUR_07920"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89966"
FT                   /db_xref="GOA:D6E3H6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3H6"
FT                   /protein_id="CBK89966.1"
FT   CDS             794057..794614
FT                   /transl_table=11
FT                   /locus_tag="EUR_07930"
FT                   /product="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89967"
FT                   /db_xref="GOA:D6E3H7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3H7"
FT                   /protein_id="CBK89967.1"
FT   CDS             795553..796479
FT                   /transl_table=11
FT                   /locus_tag="EUR_07950"
FT                   /product="ABC-type transport system involved in Fe-S
FT                   cluster assembly, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89968"
FT                   /db_xref="GOA:D6E3H8"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3H8"
FT                   /protein_id="CBK89968.1"
FT   CDS             796786..797817
FT                   /transl_table=11
FT                   /locus_tag="EUR_07960"
FT                   /product="Archaeal ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89969"
FT                   /db_xref="GOA:D6E3H9"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3H9"
FT                   /protein_id="CBK89969.1"
FT                   ENY"
FT   CDS             797857..798768
FT                   /transl_table=11
FT                   /locus_tag="EUR_07970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89970"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3I0"
FT                   /protein_id="CBK89970.1"
FT   CDS             798817..799290
FT                   /transl_table=11
FT                   /locus_tag="EUR_07980"
FT                   /product="Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89971"
FT                   /db_xref="GOA:D6E3I1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3I1"
FT                   /protein_id="CBK89971.1"
FT   CDS             799740..799934
FT                   /transl_table=11
FT                   /locus_tag="EUR_07990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_07990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89972"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3I2"
FT                   /protein_id="CBK89972.1"
FT   CDS             799931..801397
FT                   /transl_table=11
FT                   /locus_tag="EUR_08000"
FT                   /product="anthranilate synthase, component I"
FT                   /function="anthranilate synthase, component I"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89973"
FT                   /db_xref="GOA:D6E3I3"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3I3"
FT                   /protein_id="CBK89973.1"
FT   CDS             801394..801960
FT                   /transl_table=11
FT                   /locus_tag="EUR_08010"
FT                   /product="anthranilate synthase, component II"
FT                   /function="anthranilate synthase, component II"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89974"
FT                   /db_xref="GOA:D6E3I4"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3I4"
FT                   /protein_id="CBK89974.1"
FT   CDS             802081..803097
FT                   /transl_table=11
FT                   /locus_tag="EUR_08020"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /function="anthranilate phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89975"
FT                   /db_xref="GOA:D6E3I5"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3I5"
FT                   /protein_id="CBK89975.1"
FT   CDS             803124..803912
FT                   /transl_table=11
FT                   /locus_tag="EUR_08030"
FT                   /product="Indole-3-glycerol phosphate synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89976"
FT                   /db_xref="GOA:D6E3I6"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3I6"
FT                   /protein_id="CBK89976.1"
FT   CDS             804011..805201
FT                   /transl_table=11
FT                   /locus_tag="EUR_08040"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89977"
FT                   /db_xref="GOA:D6E3I7"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3I7"
FT                   /protein_id="CBK89977.1"
FT   CDS             805194..805961
FT                   /transl_table=11
FT                   /locus_tag="EUR_08050"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /function="tryptophan synthase, alpha chain"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89978"
FT                   /db_xref="GOA:D6E3I8"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3I8"
FT                   /protein_id="CBK89978.1"
FT   CDS             806058..806726
FT                   /transl_table=11
FT                   /locus_tag="EUR_08060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89979"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3I9"
FT                   /protein_id="CBK89979.1"
FT                   "
FT   CDS             806921..807520
FT                   /transl_table=11
FT                   /locus_tag="EUR_08070"
FT                   /product="phosphoserine phosphatase
FT                   /phosphoserine:homoserine phosphotransferase"
FT                   /function="phosphoserine phosphatase"
FT                   /function="phosphoserine:homoserine phosphotransferase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89980"
FT                   /db_xref="GOA:D6E3J0"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR011863"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3J0"
FT                   /protein_id="CBK89980.1"
FT   CDS             807853..808050
FT                   /transl_table=11
FT                   /locus_tag="EUR_08080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89981"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3J1"
FT                   /protein_id="CBK89981.1"
FT   CDS             808238..808456
FT                   /transl_table=11
FT                   /locus_tag="EUR_08090"
FT                   /product="Heavy-metal-associated domain."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89982"
FT                   /db_xref="GOA:D6E3J2"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3J2"
FT                   /protein_id="CBK89982.1"
FT   CDS             808538..810436
FT                   /transl_table=11
FT                   /locus_tag="EUR_08100"
FT                   /product="heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type
FT                   ATPase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89983"
FT                   /db_xref="GOA:D6E3J3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3J3"
FT                   /protein_id="CBK89983.1"
FT   CDS             811054..811422
FT                   /transl_table=11
FT                   /locus_tag="EUR_08110"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /function="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89984"
FT                   /db_xref="GOA:D6E3J4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3J4"
FT                   /protein_id="CBK89984.1"
FT                   ADGHVRTIIAQGREHIEE"
FT   CDS             812300..813514
FT                   /transl_table=11
FT                   /locus_tag="EUR_08130"
FT                   /product="Putative enzyme of poly-gamma-glutamate
FT                   biosynthesis (capsule formation)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89985"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3J5"
FT                   /protein_id="CBK89985.1"
FT                   KLHVN"
FT   CDS             813658..815790
FT                   /transl_table=11
FT                   /locus_tag="EUR_08140"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89986"
FT                   /db_xref="GOA:D6E3J6"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3J6"
FT                   /protein_id="CBK89986.1"
FT                   NTIRVPARTTIILVAE"
FT   CDS             complement(816332..817111)
FT                   /transl_table=11
FT                   /locus_tag="EUR_08150"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89987"
FT                   /db_xref="GOA:D6E3J7"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3J7"
FT                   /protein_id="CBK89987.1"
FT   tRNA            817367..817440
FT                   /locus_tag="EUR_T_32840"
FT   CDS             817651..819540
FT                   /transl_table=11
FT                   /locus_tag="EUR_08160"
FT                   /product="FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89988"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3J8"
FT                   /protein_id="CBK89988.1"
FT   CDS             complement(819910..820422)
FT                   /transl_table=11
FT                   /locus_tag="EUR_08170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89989"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3J9"
FT                   /protein_id="CBK89989.1"
FT                   TYGYCTL"
FT   CDS             821814..822695
FT                   /transl_table=11
FT                   /locus_tag="EUR_08200"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family (TC 3.A.1.7.1)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89990"
FT                   /db_xref="GOA:D6E3K0"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3K0"
FT                   /protein_id="CBK89990.1"
FT                   AVIKKVGLILPQ"
FT   CDS             822820..823722
FT                   /transl_table=11
FT                   /locus_tag="EUR_08210"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter membrane protein 1,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89991"
FT                   /db_xref="GOA:D6E3K1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3K1"
FT                   /protein_id="CBK89991.1"
FT   CDS             823715..824578
FT                   /transl_table=11
FT                   /locus_tag="EUR_08220"
FT                   /product="phosphate ABC transporter membrane protein 2,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter membrane protein 2,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89992"
FT                   /db_xref="GOA:D6E3K2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3K2"
FT                   /protein_id="CBK89992.1"
FT                   KKFQAK"
FT   CDS             824888..825577
FT                   /transl_table=11
FT                   /locus_tag="EUR_08230"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89993"
FT                   /db_xref="GOA:D6E3K3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3K3"
FT                   /protein_id="CBK89993.1"
FT                   GYKIDAE"
FT   CDS             825634..828057
FT                   /transl_table=11
FT                   /locus_tag="EUR_08240"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89994"
FT                   /db_xref="GOA:D6E3K4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3K4"
FT                   /protein_id="CBK89994.1"
FT   CDS             complement(828301..828891)
FT                   /transl_table=11
FT                   /locus_tag="EUR_08250"
FT                   /product="pyridoxal phosphate synthase yaaE subunit"
FT                   /function="pyridoxal phosphate synthase yaaE subunit"
FT                   /EC_number="2.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89995"
FT                   /db_xref="GOA:D6E3K5"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3K5"
FT                   /protein_id="CBK89995.1"
FT   CDS             complement(828893..829777)
FT                   /transl_table=11
FT                   /locus_tag="EUR_08260"
FT                   /product="pyridoxal phosphate synthase yaaD subunit"
FT                   /function="pyridoxal phosphate synthase yaaD subunit"
FT                   /EC_number="4.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89996"
FT                   /db_xref="GOA:D6E3K6"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3K6"
FT                   /protein_id="CBK89996.1"
FT                   ESEIKIIMEERGK"
FT   CDS             829921..830178
FT                   /transl_table=11
FT                   /locus_tag="EUR_08270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89997"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3K7"
FT                   /protein_id="CBK89997.1"
FT   CDS             830212..831609
FT                   /transl_table=11
FT                   /locus_tag="EUR_08280"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89998"
FT                   /db_xref="GOA:D6E3K8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3K8"
FT                   /protein_id="CBK89998.1"
FT                   IIKDTIL"
FT   CDS             831807..832568
FT                   /transl_table=11
FT                   /locus_tag="EUR_08290"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK89999"
FT                   /db_xref="GOA:D6E3K9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3K9"
FT                   /protein_id="CBK89999.1"
FT   CDS             832568..833218
FT                   /transl_table=11
FT                   /locus_tag="EUR_08300"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /function="phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90000"
FT                   /db_xref="GOA:D6E3L0"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3L0"
FT                   /protein_id="CBK90000.1"
FT   CDS             833395..834063
FT                   /transl_table=11
FT                   /locus_tag="EUR_08310"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90001"
FT                   /db_xref="GOA:D6E3L1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3L1"
FT                   /protein_id="CBK90001.1"
FT                   "
FT   CDS             834109..835431
FT                   /transl_table=11
FT                   /locus_tag="EUR_08320"
FT                   /product="Signal transduction histidine kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90002"
FT                   /db_xref="GOA:D6E3L2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3L2"
FT                   /protein_id="CBK90002.1"
FT   CDS             835550..836854
FT                   /transl_table=11
FT                   /locus_tag="EUR_08330"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90003"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3L3"
FT                   /protein_id="CBK90003.1"
FT   CDS             836885..838933
FT                   /transl_table=11
FT                   /locus_tag="EUR_08340"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90004"
FT                   /db_xref="GOA:D6E3L4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3L4"
FT                   /protein_id="CBK90004.1"
FT   CDS             839217..839744
FT                   /transl_table=11
FT                   /locus_tag="EUR_08350"
FT                   /product="SSU ribosomal protein S30P/sigma 54 modulation
FT                   protein"
FT                   /function="SSU ribosomal protein S30P"
FT                   /function="sigma 54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90005"
FT                   /db_xref="GOA:D6E3L5"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3L5"
FT                   /protein_id="CBK90005.1"
FT                   KGHTYGLIEPEC"
FT   CDS             840544..840918
FT                   /transl_table=11
FT                   /locus_tag="EUR_08360"
FT                   /product="Transposase DDE domain."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90006"
FT                   /db_xref="GOA:D6E3L6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3L6"
FT                   /protein_id="CBK90006.1"
FT   CDS             841580..842635
FT                   /transl_table=11
FT                   /locus_tag="EUR_08380"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90007"
FT                   /db_xref="GOA:D6E3L7"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3L7"
FT                   /protein_id="CBK90007.1"
FT                   LIDISLKKYEV"
FT   CDS             842637..844031
FT                   /transl_table=11
FT                   /locus_tag="EUR_08390"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alani
FT                   ne ligase"
FT                   /function="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alan
FT                   ine ligase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90008"
FT                   /db_xref="GOA:D6E3L8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3L8"
FT                   /protein_id="CBK90008.1"
FT                   VEALSE"
FT   CDS             844137..844658
FT                   /transl_table=11
FT                   /locus_tag="EUR_08400"
FT                   /product="Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90009"
FT                   /db_xref="GOA:D6E3L9"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3L9"
FT                   /protein_id="CBK90009.1"
FT                   GVDYPEPETV"
FT   CDS             844658..845662
FT                   /transl_table=11
FT                   /locus_tag="EUR_08410"
FT                   /product="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90010"
FT                   /db_xref="GOA:D6E3M0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3M0"
FT                   /protein_id="CBK90010.1"
FT   CDS             845722..846666
FT                   /transl_table=11
FT                   /locus_tag="EUR_08420"
FT                   /product="glucokinase"
FT                   /function="glucokinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90011"
FT                   /db_xref="GOA:D6E3M1"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3M1"
FT                   /protein_id="CBK90011.1"
FT   CDS             849149..849778
FT                   /transl_table=11
FT                   /locus_tag="EUR_08440"
FT                   /product="Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90012"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3M2"
FT                   /protein_id="CBK90012.1"
FT   CDS             849775..851370
FT                   /transl_table=11
FT                   /locus_tag="EUR_08450"
FT                   /product="Coproporphyrinogen III oxidase and related Fe-S
FT                   oxidoreductases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90013"
FT                   /db_xref="GOA:D6E3M3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023995"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3M3"
FT                   /protein_id="CBK90013.1"
FT                   IDEMIERKQRLFEK"
FT   CDS             851515..852888
FT                   /transl_table=11
FT                   /locus_tag="EUR_08460"
FT                   /product="Predicted ATP-binding protein involved in
FT                   virulence"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90014"
FT                   /db_xref="GOA:D6E3M4"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3M4"
FT                   /protein_id="CBK90014.1"
FT   CDS             852872..853579
FT                   /transl_table=11
FT                   /locus_tag="EUR_08470"
FT                   /product="HNH endonuclease."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90015"
FT                   /db_xref="GOA:D6E3M5"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3M5"
FT                   /protein_id="CBK90015.1"
FT                   YDEEGNVKKNISV"
FT   CDS             853874..855322
FT                   /transl_table=11
FT                   /locus_tag="EUR_08480"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90016"
FT                   /db_xref="GOA:D6E3M6"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3M6"
FT                   /protein_id="CBK90016.1"
FT   CDS             856479..857687
FT                   /transl_table=11
FT                   /locus_tag="EUR_08500"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90017"
FT                   /db_xref="GOA:D6E3M7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3M7"
FT                   /protein_id="CBK90017.1"
FT                   KDE"
FT   CDS             857703..858893
FT                   /transl_table=11
FT                   /locus_tag="EUR_08510"
FT                   /product="Predicted Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90018"
FT                   /db_xref="GOA:D6E3M8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3M8"
FT                   /protein_id="CBK90018.1"
FT   CDS             858908..859789
FT                   /transl_table=11
FT                   /locus_tag="EUR_08520"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90019"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3M9"
FT                   /protein_id="CBK90019.1"
FT                   GLFLHSRWSKAQ"
FT   CDS             859845..860957
FT                   /transl_table=11
FT                   /locus_tag="EUR_08530"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90020"
FT                   /db_xref="GOA:D6E3N0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3N0"
FT                   /protein_id="CBK90020.1"
FT   CDS             860944..861948
FT                   /transl_table=11
FT                   /locus_tag="EUR_08540"
FT                   /product="Fucose 4-O-acetylase and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90021"
FT                   /db_xref="GOA:D6E3N1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3N1"
FT                   /protein_id="CBK90021.1"
FT   CDS             861953..863164
FT                   /transl_table=11
FT                   /locus_tag="EUR_08550"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90022"
FT                   /db_xref="GOA:D6E3N2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3N2"
FT                   /protein_id="CBK90022.1"
FT                   FEKM"
FT   CDS             864215..864871
FT                   /transl_table=11
FT                   /locus_tag="EUR_08570"
FT                   /product="CMP-N-acetylneuraminic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90023"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3N3"
FT                   /protein_id="CBK90023.1"
FT   CDS             864895..866469
FT                   /transl_table=11
FT                   /locus_tag="EUR_08580"
FT                   /product="Isopropylmalate/homocitrate/citramalate
FT                   synthases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90024"
FT                   /db_xref="GOA:D6E3N4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3N4"
FT                   /protein_id="CBK90024.1"
FT                   KQHYVKI"
FT   CDS             866485..867507
FT                   /transl_table=11
FT                   /locus_tag="EUR_08590"
FT                   /product="Sugar kinases, ribokinase family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90025"
FT                   /db_xref="GOA:D6E3N5"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3N5"
FT                   /protein_id="CBK90025.1"
FT                   "
FT   CDS             867606..868667
FT                   /transl_table=11
FT                   /locus_tag="EUR_08600"
FT                   /product="Acyltransferase family."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90026"
FT                   /db_xref="GOA:D6E3N6"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3N6"
FT                   /protein_id="CBK90026.1"
FT                   KSIWGVFRYFKES"
FT   CDS             870883..870987
FT                   /transl_table=11
FT                   /locus_tag="EUR_08630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90027"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3N7"
FT                   /protein_id="CBK90027.1"
FT   CDS             871776..872294
FT                   /transl_table=11
FT                   /locus_tag="EUR_08650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90028"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3N8"
FT                   /protein_id="CBK90028.1"
FT                   IELPIIPID"
FT   CDS             872369..874882
FT                   /transl_table=11
FT                   /locus_tag="EUR_08660"
FT                   /product="Cysteine protease"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90029"
FT                   /db_xref="GOA:D6E3N9"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3N9"
FT                   /protein_id="CBK90029.1"
FT   CDS             875416..876141
FT                   /transl_table=11
FT                   /locus_tag="EUR_08670"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90030"
FT                   /db_xref="GOA:D6E3P0"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3P0"
FT                   /protein_id="CBK90030.1"
FT   CDS             876171..877325
FT                   /transl_table=11
FT                   /locus_tag="EUR_08680"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90031"
FT                   /db_xref="GOA:D6E3P1"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3P1"
FT                   /protein_id="CBK90031.1"
FT   CDS             877319..877798
FT                   /transl_table=11
FT                   /locus_tag="EUR_08690"
FT                   /product="PTS system IIA component, Glc family (TC 4.A.1)"
FT                   /function="PTS system IIA component, Glc family (TC 4.A.1)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90032"
FT                   /db_xref="GOA:D6E3P2"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3P2"
FT                   /protein_id="CBK90032.1"
FT   CDS             877882..879351
FT                   /transl_table=11
FT                   /locus_tag="EUR_08700"
FT                   /product="PTS system N-acetylglucosamine-specific IIB
FT                   component, Glc family (TC 4.A.1.1.2)/PTS system
FT                   N-acetylglucosamine-specific IIC component, Glc family (TC
FT                   4.A.1.1.2)"
FT                   /function="PTS system N-acetylglucosamine-specific IIB
FT                   component, Glc family (TC 4.A.1.1.2)"
FT                   /function="PTS system N-acetylglucosamine-specific IIC
FT                   component, Glc family (TC 4.A.1.1.2)"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90033"
FT                   /db_xref="GOA:D6E3P3"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3P3"
FT                   /protein_id="CBK90033.1"
FT   CDS             879665..880696
FT                   /transl_table=11
FT                   /locus_tag="EUR_08710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90034"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3P4"
FT                   /protein_id="CBK90034.1"
FT                   PPQ"
FT   CDS             880880..882139
FT                   /transl_table=11
FT                   /locus_tag="EUR_08720"
FT                   /product="histidyl-tRNA synthetase"
FT                   /function="histidyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90035"
FT                   /db_xref="GOA:D6E3P5"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3P5"
FT                   /protein_id="CBK90035.1"
FT   CDS             882228..884024
FT                   /transl_table=11
FT                   /locus_tag="EUR_08730"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /function="aspartyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90036"
FT                   /db_xref="GOA:D6E3P6"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3P6"
FT                   /protein_id="CBK90036.1"
FT   CDS             884034..885074
FT                   /transl_table=11
FT                   /locus_tag="EUR_08740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90037"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3P7"
FT                   /protein_id="CBK90037.1"
FT                   GSKYEP"
FT   CDS             complement(885410..886849)
FT                   /transl_table=11
FT                   /locus_tag="EUR_08750"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90038"
FT                   /db_xref="GOA:D6E3P8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3P8"
FT                   /protein_id="CBK90038.1"
FT   CDS             complement(886852..887553)
FT                   /transl_table=11
FT                   /locus_tag="EUR_08760"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90039"
FT                   /db_xref="GOA:D6E3P9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3P9"
FT                   /protein_id="CBK90039.1"
FT                   VWGIGYKFEVK"
FT   CDS             complement(887605..889983)
FT                   /transl_table=11
FT                   /locus_tag="EUR_08770"
FT                   /product="MutS2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90040"
FT                   /db_xref="GOA:D6E3Q0"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3Q0"
FT                   /protein_id="CBK90040.1"
FT   CDS             890535..891803
FT                   /transl_table=11
FT                   /locus_tag="EUR_08780"
FT                   /product="Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90041"
FT                   /db_xref="GOA:D6E3Q1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3Q1"
FT                   /protein_id="CBK90041.1"
FT   CDS             891822..892766
FT                   /transl_table=11
FT                   /locus_tag="EUR_08790"
FT                   /product="uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90042"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3Q2"
FT                   /protein_id="CBK90042.1"
FT   CDS             892852..894333
FT                   /transl_table=11
FT                   /locus_tag="EUR_08800"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /function="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90043"
FT                   /db_xref="GOA:D6E3Q3"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3Q3"
FT                   /protein_id="CBK90043.1"
FT   CDS             894441..896219
FT                   /transl_table=11
FT                   /locus_tag="EUR_08810"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90044"
FT                   /db_xref="GOA:D6E3Q4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3Q4"
FT                   /protein_id="CBK90044.1"
FT                   KSLQRHYGDCLELVEK"
FT   CDS             complement(896281..897564)
FT                   /transl_table=11
FT                   /locus_tag="EUR_08820"
FT                   /product="dihydroorotase"
FT                   /function="dihydroorotase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90045"
FT                   /db_xref="GOA:D6E3Q5"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3Q5"
FT                   /protein_id="CBK90045.1"
FT   CDS             897831..898781
FT                   /transl_table=11
FT                   /locus_tag="EUR_08830"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90046"
FT                   /db_xref="GOA:D6E3Q6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3Q6"
FT                   /protein_id="CBK90046.1"
FT   CDS             898781..899464
FT                   /transl_table=11
FT                   /locus_tag="EUR_08840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90047"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3Q7"
FT                   /protein_id="CBK90047.1"
FT                   YFHTV"
FT   CDS             899442..899822
FT                   /transl_table=11
FT                   /locus_tag="EUR_08850"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90048"
FT                   /db_xref="GOA:D6E3Q8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3Q8"
FT                   /protein_id="CBK90048.1"
FT   CDS             899816..900541
FT                   /transl_table=11
FT                   /locus_tag="EUR_08860"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90049"
FT                   /db_xref="GOA:D6E3Q9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3Q9"
FT                   /protein_id="CBK90049.1"
FT   CDS             900534..901568
FT                   /transl_table=11
FT                   /locus_tag="EUR_08870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90050"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3R0"
FT                   /protein_id="CBK90050.1"
FT                   WPQS"
FT   CDS             901726..902109
FT                   /transl_table=11
FT                   /locus_tag="EUR_08880"
FT                   /product="Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90051"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3R1"
FT                   /protein_id="CBK90051.1"
FT   CDS             902146..903399
FT                   /transl_table=11
FT                   /locus_tag="EUR_08890"
FT                   /product="Uncharacterized protein conserved in bacteria
FT                   C-term(DUF2220)."
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90052"
FT                   /db_xref="InterPro:IPR024534"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3R2"
FT                   /protein_id="CBK90052.1"
FT                   LKEAILESDKTIEQERLL"
FT   CDS             903518..904774
FT                   /transl_table=11
FT                   /locus_tag="EUR_08900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90053"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3R3"
FT                   /protein_id="CBK90053.1"
FT   CDS             905324..906103
FT                   /transl_table=11
FT                   /locus_tag="EUR_08910"
FT                   /product="Predicted divalent heavy-metal cations
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90054"
FT                   /db_xref="GOA:D6E3R4"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3R4"
FT                   /protein_id="CBK90054.1"
FT   CDS             906915..907601
FT                   /transl_table=11
FT                   /locus_tag="EUR_08920"
FT                   /product="ATP synthase F0 subcomplex A subunit"
FT                   /function="ATP synthase F0 subcomplex A subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90055"
FT                   /db_xref="GOA:D6E3R5"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3R5"
FT                   /protein_id="CBK90055.1"
FT                   IKEATE"
FT   CDS             907740..907970
FT                   /transl_table=11
FT                   /locus_tag="EUR_08930"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /function="ATP synthase F0 subcomplex C subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90056"
FT                   /db_xref="GOA:D6E3R6"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3R6"
FT                   /protein_id="CBK90056.1"
FT   CDS             908026..908478
FT                   /transl_table=11
FT                   /locus_tag="EUR_08940"
FT                   /product="ATP synthase F0 subcomplex B subunit"
FT                   /function="ATP synthase F0 subcomplex B subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90057"
FT                   /db_xref="GOA:D6E3R7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3R7"
FT                   /protein_id="CBK90057.1"
FT   CDS             908456..908974
FT                   /transl_table=11
FT                   /locus_tag="EUR_08950"
FT                   /product="ATP synthase, F1 delta subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90058"
FT                   /db_xref="GOA:D6E3R8"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3R8"
FT                   /protein_id="CBK90058.1"
FT                   ELERKLTRR"
FT   CDS             910491..911381
FT                   /transl_table=11
FT                   /locus_tag="EUR_08970"
FT                   /product="ATP synthase, F1 gamma subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90059"
FT                   /db_xref="GOA:D6E3R9"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR023633"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3R9"
FT                   /protein_id="CBK90059.1"
FT                   TEVIAGAKSQKKKRK"
FT   CDS             911390..912781
FT                   /transl_table=11
FT                   /locus_tag="EUR_08980"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /function="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90060"
FT                   /db_xref="GOA:D6E3S0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6E3S0"
FT                   /protein_id="CBK90060.1"
FT                   KTMQQ"
FT   CDS             912805..913218
FT                   /transl_table=11
FT                   /locus_tag="EUR_08990"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /function="ATP synthase F1 subcomplex epsilon subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:EUR_08990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK90061"
FT                   /db_xref="GOA:D6E3S1"