spacer

EBI Dbfetch

ID   FP929041; SV 1; linear; genomic DNA; STD; PRO; 1966750 BP.
XX
AC   FP929041;
XX
PR   Project:PRJNA45917;
XX
DT   25-MAR-2010 (Rel. 104, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 2)
XX
DE   Eubacterium cylindroides T2-87 draft genome.
XX
KW   .
XX
OS   Faecalitalea cylindroides T2-87
OC   Bacteria; Firmicutes; Erysipelotrichia; Erysipelotrichales;
OC   Erysipelotrichaceae; Faecalitalea.
XX
RN   [1]
RG   metaHIT consortium -- http://www.metahit.eu/
RA   Pajon A., Turner K., Parkhill J., Duncan S., Flint H.;
RT   "The genome sequence of Eubacterium cylindroides T2-87";
RL   Unpublished.
XX
RN   [2]
RA   Pajon A.;
RT   ;
RL   Submitted (23-MAR-2010) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
XX
DR   MD5; d73a52b0e186b15f7d8e07752eb67094.
DR   BioSample; SAMEA3138372.
DR   EnsemblGenomes-Gn; EC1_R_21560.
DR   EnsemblGenomes-Gn; EC1_R_21570.
DR   EnsemblGenomes-Gn; EC1_R_21580.
DR   EnsemblGenomes-Gn; EC1_T_21180.
DR   EnsemblGenomes-Gn; EC1_T_21190.
DR   EnsemblGenomes-Gn; EC1_T_21200.
DR   EnsemblGenomes-Gn; EC1_T_21210.
DR   EnsemblGenomes-Gn; EC1_T_21220.
DR   EnsemblGenomes-Gn; EC1_T_21230.
DR   EnsemblGenomes-Gn; EC1_T_21240.
DR   EnsemblGenomes-Gn; EC1_T_21250.
DR   EnsemblGenomes-Gn; EC1_T_21260.
DR   EnsemblGenomes-Gn; EC1_T_21270.
DR   EnsemblGenomes-Gn; EC1_T_21280.
DR   EnsemblGenomes-Gn; EC1_T_21290.
DR   EnsemblGenomes-Gn; EC1_T_21300.
DR   EnsemblGenomes-Gn; EC1_T_21310.
DR   EnsemblGenomes-Gn; EC1_T_21320.
DR   EnsemblGenomes-Gn; EC1_T_21330.
DR   EnsemblGenomes-Gn; EC1_T_21340.
DR   EnsemblGenomes-Gn; EC1_T_21350.
DR   EnsemblGenomes-Gn; EC1_T_21360.
DR   EnsemblGenomes-Gn; EC1_T_21370.
DR   EnsemblGenomes-Gn; EC1_T_21380.
DR   EnsemblGenomes-Gn; EC1_T_21390.
DR   EnsemblGenomes-Gn; EC1_T_21400.
DR   EnsemblGenomes-Gn; EC1_T_21410.
DR   EnsemblGenomes-Gn; EC1_T_21420.
DR   EnsemblGenomes-Gn; EC1_T_21430.
DR   EnsemblGenomes-Gn; EC1_T_21440.
DR   EnsemblGenomes-Gn; EC1_T_21450.
DR   EnsemblGenomes-Gn; EC1_T_21460.
DR   EnsemblGenomes-Gn; EC1_T_21470.
DR   EnsemblGenomes-Gn; EC1_T_21480.
DR   EnsemblGenomes-Gn; EC1_T_21490.
DR   EnsemblGenomes-Gn; EC1_T_21500.
DR   EnsemblGenomes-Gn; EC1_T_21510.
DR   EnsemblGenomes-Gn; EC1_T_21520.
DR   EnsemblGenomes-Gn; EC1_T_21530.
DR   EnsemblGenomes-Gn; EC1_T_21540.
DR   EnsemblGenomes-Gn; EC1_T_21550.
DR   EnsemblGenomes-Tr; EC1_R_21560.
DR   EnsemblGenomes-Tr; EC1_R_21570.
DR   EnsemblGenomes-Tr; EC1_R_21580.
DR   EnsemblGenomes-Tr; EC1_T_21180.
DR   EnsemblGenomes-Tr; EC1_T_21190.
DR   EnsemblGenomes-Tr; EC1_T_21200.
DR   EnsemblGenomes-Tr; EC1_T_21210.
DR   EnsemblGenomes-Tr; EC1_T_21220.
DR   EnsemblGenomes-Tr; EC1_T_21230.
DR   EnsemblGenomes-Tr; EC1_T_21240.
DR   EnsemblGenomes-Tr; EC1_T_21250.
DR   EnsemblGenomes-Tr; EC1_T_21260.
DR   EnsemblGenomes-Tr; EC1_T_21270.
DR   EnsemblGenomes-Tr; EC1_T_21280.
DR   EnsemblGenomes-Tr; EC1_T_21290.
DR   EnsemblGenomes-Tr; EC1_T_21300.
DR   EnsemblGenomes-Tr; EC1_T_21310.
DR   EnsemblGenomes-Tr; EC1_T_21320.
DR   EnsemblGenomes-Tr; EC1_T_21330.
DR   EnsemblGenomes-Tr; EC1_T_21340.
DR   EnsemblGenomes-Tr; EC1_T_21350.
DR   EnsemblGenomes-Tr; EC1_T_21360.
DR   EnsemblGenomes-Tr; EC1_T_21370.
DR   EnsemblGenomes-Tr; EC1_T_21380.
DR   EnsemblGenomes-Tr; EC1_T_21390.
DR   EnsemblGenomes-Tr; EC1_T_21400.
DR   EnsemblGenomes-Tr; EC1_T_21410.
DR   EnsemblGenomes-Tr; EC1_T_21420.
DR   EnsemblGenomes-Tr; EC1_T_21430.
DR   EnsemblGenomes-Tr; EC1_T_21440.
DR   EnsemblGenomes-Tr; EC1_T_21450.
DR   EnsemblGenomes-Tr; EC1_T_21460.
DR   EnsemblGenomes-Tr; EC1_T_21470.
DR   EnsemblGenomes-Tr; EC1_T_21480.
DR   EnsemblGenomes-Tr; EC1_T_21490.
DR   EnsemblGenomes-Tr; EC1_T_21500.
DR   EnsemblGenomes-Tr; EC1_T_21510.
DR   EnsemblGenomes-Tr; EC1_T_21520.
DR   EnsemblGenomes-Tr; EC1_T_21530.
DR   EnsemblGenomes-Tr; EC1_T_21540.
DR   EnsemblGenomes-Tr; EC1_T_21550.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02004; group-II-D1D4-5.
DR   SILVA-LSU; FP929041.
DR   SILVA-SSU; FP929041.
XX
CC   This is a reference genome for the metaHIT project
CC   DNA source: Rowett Institute of Nutrition and Health, University of
CC   Aberdeen -- http://www.rowett.ac.uk/divisions/ghp/
CC   Sequencing technology: 454
CC   Genome coverage: 19x
CC   Annotation was added using ab initio prediction IMG/ER --
CC   http://img.jgi.doe.gov/submit (Markowitz, Szeto et al. 2007).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1966750
FT                   /organism="Faecalitalea cylindroides T2-87"
FT                   /strain="T2-87"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:717960"
FT   CDS             complement(9..653)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00100"
FT                   /product="Phosphate uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87829"
FT                   /db_xref="GOA:D4JCA7"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCA7"
FT                   /protein_id="CBK87829.1"
FT                   /translation="MVSTKFIKQTKQLELTMTQMGQDCLKGLSFCRHALYDRDKTLIQE
FT                   INELHEDVSANGRECEQICMRILLLQHPVAKDLRKITVATNTVRDMTRIMDQEKEVADL
FT                   VCRIQDTDVEIDGTIHDLFSIAKEMISGAISAYMQKDEDIAHEVIKLDDKADSLYIDTK
FT                   ELYIEKLAAKTGNAETLVDLLLVGKYLERICDHAVNIAKWVLFQKKGVYEE"
FT   CDS             complement(653..1408)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00110"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /EC_number="3.6.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87830"
FT                   /db_xref="GOA:D4JCA8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCA8"
FT                   /protein_id="CBK87830.1"
FT                   /translation="MSTPKLSIKDVNLFYGDFHALHGISMDIDENKITSFIGPSGCGKS
FT                   TLLKSINRMNDLVEGCKITGEFLLDNKNIYKDIEINTLRKRVGMVFQKANPFPMSVYDN
FT                   IAFGPRTHGIKKKSELDVIVRQALEDAALWDEVKDRLNKSALGLSGGQQQRLCIARALA
FT                   VQPEVLLMDEPTSALDPISTSKIEELTLKLKKDYTIVIVTHNMQQAMRISDKTAFFLLG
FT                   DLIEYGDTEMMFSTPKEKKTEDYITGRFG"
FT   CDS             complement(1412..1873)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00120"
FT                   /product="ABC-type phosphate transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87831"
FT                   /db_xref="GOA:D4JCA9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCA9"
FT                   /protein_id="CBK87831.1"
FT                   /translation="MFVISLNMGLSLLAGSLTLAIMVLPTIMRTTQEALVAVPDSYREG
FT                   SYGLGAGKIRTIFRIILPSAVPGIMSGIVLSMGRIVGETAALIYTSGTVGKISTSVFEP
FT                   GSTLAVHMYKLMSEGLYTEQACAVAVVLLVFVIIMNSLSSVLGKKLAKG"
FT   gap             1962..3029
FT                   /estimated_length=1068
FT   CDS             complement(3737..4639)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00140"
FT                   /product="Fe2+ transport system protein B"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87832"
FT                   /db_xref="GOA:D4JCB0"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCB0"
FT                   /protein_id="CBK87832.1"
FT                   /translation="MARVAYVMNDIMDKLGLSGRAFIPMVLGFGCTVPAIMASRTLESK
FT                   KDRERVMLITPFMSCSAKLPVYILFSGMFFGKYAMFAAYSMYIIGILIALLVAWILHKI
FT                   DKEENTNPLLIELPMYKMPSAYTVYIYVWEKVKDFLTKAGTTIFIASIVIWILMHIGTS
FT                   GYTVDVSESLAAMLGNILVPIMAPVGLGFWQICVALVAGISAKEVVVSSTAVLFGVANI
FT                   NSAHGMSSLMTSLSALGFTSLNAFCLMLFCLLYIPCIGSLATIKKESSLRFTIKMIVFE
FT                   LVVAWLVAFVVYQLGSLVL"
FT   CDS             complement(4618..5766)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00150"
FT                   /product="small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87833"
FT                   /db_xref="GOA:D4JCB1"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011619"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCB1"
FT                   /protein_id="CBK87833.1"
FT                   /translation="MSKEITVGFIGNPNCGKTTLFNAYTGANLKVANWPGVTVERMEGA
FT                   IKEHNMTIHVVDLPGTYSLTSYTMEEQVSRQFIVSDQVDVIIDVVDASSLERSLYLTLQ
FT                   LLELDKPMVMALNMMDIVEKRGMEIDLHRLAEILGIPVVPVVARKKKGIQTLIHAAVHQ
FT                   KQAIGPTTAGINHKPLSIHDERVKEHAMVYSKEIEETISKVEKELQKEYGLKDTRWHAI
FT                   KWLENDNEIKEKYSLNVDFDSDGYETEIINEKYDFIQALLHEVLLGKKQKEELTDKIDS
FT                   YIMHPIGGILIFLLIMLAVFGLTFLLGDAIKGYVEIFIDWLIGISTVGLERLHVSAWLI
FT                   DLITEGVIGGVGGIITFYQISSSYSWHWLFWKTVDIWHVSRM"
FT   CDS             complement(5751..5981)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00160"
FT                   /product="Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87834"
FT                   /db_xref="GOA:D4JCB2"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCB2"
FT                   /protein_id="CBK87834.1"
FT                   /translation="MNLSEGNIHGKYCVISMDLAFQTQRRLQALGMTLDTEIEILHKKH
FT                   NGTLAINLRGTRFALGKNISEHIEVVPCQKK"
FT   gap             6004..7407
FT                   /estimated_length=1404
FT   CDS             complement(7559..9016)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00180"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87835"
FT                   /db_xref="GOA:D4JCB3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCB3"
FT                   /protein_id="CBK87835.1"
FT                   /translation="MKRPVNLFRRLSLTQQVFALILLFLAFFAAFFFMFLSKNIDTTLA
FT                   EQMYDLMAARQQPIVNIIQRNAEILDEDFYEFMSSDTIQTNCLIQRNQVLAFGDNNTQE
FT                   HQAVYNFLGSECKDMEKTGVDIKTGTVIIDHIGYYYRIQNAGTLNFYVASFMDETYSTS
FT                   LRDSVIDSTVYVTVLAFSLILLIMIVWVFSIIHPLNQIKSYIEQIKQGKQVELYLNRED
FT                   EIGEVANALVTMKDELTRQEKAKEEMIHNISHDLKTPIATIKSYSESIKDGIYPYGTLE
FT                   GSVDVILDNAQRLEDKVHNLLYLNRVEYLVTSDSEGVVTNMKEVVEEVVLNSAVIRSEI
FT                   RVITEVEEVFFDGLLESWRVAIENIMDNAFRYAKSYIKITVTEDDLKISNDGPKMPEDR
FT                   IESLFRPYEKGEGGRFGLGLSIVSKVAKANKYKVKGYNTEDGVCFRIYRDKPKSRKNDS
FT                   KKKDNRKESHKKGERDEDRNNWHRSNS"
FT   CDS             complement(9021..9680)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00190"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87836"
FT                   /db_xref="GOA:D4JCB4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCB4"
FT                   /protein_id="CBK87836.1"
FT                   /translation="MKRVICVVEDEKDLNNLVAQYLRKEGYEVRSYYTYEEASAHVQDD
FT                   DVHLWILDIMLDDKSGFDLIEEIRLQGPEIPVIFMSARDKEFDRIIGLEKGSDDYITKP
FT                   FSPKEMVLRVNNIIKRAYKDDNNRISIDGYELDEEQRKIYYDNNEIELTTKEFDLLMMF
FT                   IKNKGIAFSRDKILENVWDENYFGSDRVVDDTLRRLRKKLPNLNIHTIYGYGYRLG"
FT   gap             9791..10974
FT                   /estimated_length=1184
FT   CDS             complement(11045..11812)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00220"
FT                   /product="YbbR-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87837"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCB5"
FT                   /protein_id="CBK87837.1"
FT                   /translation="MENPEHKTLVSKIIELFQMIFRKLSKLFDKVVFNKKGSLFISLFL
FT                   AIIISISVNYEDISLSLFHDTTVSVTINDVSVETLADTENYVIEGIPSTVDVTITGSAS
FT                   DVQVYRQQANIRAIADVRRYTEGNVVVDIEISQLPSNLEATIQPATAEATISKKVSKQF
FT                   TVTSELLLGTGQSSSDFESPVLSETTVTIKASQEQIDAIRSVKAIIDATGQTGDFNVEA
FT                   NVMAYDSSGTPLQVDISPATIQVSVKRANSDSD"
FT   CDS             complement(11814..12737)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00230"
FT                   /product="conserved hypothetical protein TIGR00159"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87838"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCB6"
FT                   /protein_id="CBK87838.1"
FT                   /translation="MDISLSDVLTFLRLILDILVVWALIYSAFRLVRNNSRTIQILKGL
FT                   LVIMIVKVLAVWIGLNTLSYLIDLFLNWGIVAILILFQPEIRGMLEKVGKTTAILPNEF
FT                   QISQYTNMINELVDACTDMSNSKTGALITIEQSNSLNDYIQSGIRMDSQVSRELLGTIF
FT                   QYGTPMHDGAVIIQGTQIACAAAYFPPTTKDLPSKYGARHRAAVGISEITDSITIIVSE
FT                   ETGNISVAYRGQLTQYPPEGLKRYLTNRLIQVDEQETPSILQPVIKTAKSFGLSMSKKS
FT                   DGIVRIDERIKPIEVVDLLEKKQGGK"
FT   gap             13002..13404
FT                   /estimated_length=403
FT   CDS             complement(14517..15200)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00260"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87839"
FT                   /db_xref="GOA:D4JCB7"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCB7"
FT                   /protein_id="CBK87839.1"
FT                   /translation="MIRVAFLEYEKETKDIIFELSKVFNELDWTFRHYRKASDLAKVMK
FT                   KQEIHLFVFDEMFKTPRLESVFVHDNPNALFIYVCKNALATKDKDQRSRVLYIEKDHIV
FT                   EDIKKYESIILSQCSQVDLYNFSYDGVHVNLAYEDIYYLEKIDKMVYFHTKKGEFHKRV
FT                   NMSELETIFAPYGFLRVHVSYLVNAKHIVAWNKDEVQIITQENIPMSRAQKRKLMAQIK
FT                   PKMPE"
FT   gap             16478..17795
FT                   /estimated_length=1318
FT   CDS             complement(17908..18375)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87840"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCB8"
FT                   /protein_id="CBK87840.1"
FT                   /translation="MENSQKKIRRALDYFSAPQLLMVGFASVILTGAVILMLPISVREG
FT                   ATVSFIDALFTSTSAVCVTGLIAIDTADHFTVFGRAVVAALIQIGGLGVTCVGVSLILA
FT                   AGRKIDFHTRKLIKESWNIDSYQGLVKLVKQVLKLTFAFVSCWRSFEFPCI"
FT   CDS             18784..18843
FT                   /transl_table=11
FT                   /locus_tag="EC1_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87841"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCB9"
FT                   /protein_id="CBK87841.1"
FT                   /translation="MGWIYYIIQMLFDSTNEEH"
FT   gap             19640..19882
FT                   /estimated_length=243
FT   CDS             complement(20055..20951)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00320"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87842"
FT                   /db_xref="GOA:D4JCC0"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009928"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCC0"
FT                   /protein_id="CBK87842.1"
FT                   /translation="MRFDFEIDESLKRERNEKIEKLYTDPLVQQFLKKNDLNHDFFDKH
FT                   FSYFQDWVENVKKCSGCQGIEFCVQTIPGKIKTIYLDDSGFLEERYQSCRRFKKFEDEI
FT                   AHRKNYRLSHLSDNDYMIDLHKIEVSNESQEYLLAYMQLLKSLEQKKGIYLYGQPGVGK
FT                   SYMMAGAANFFAKSKKRVSFIKVPLFIQDIKQSMYDNEYRQDMIGHLRFSEVLVLDDIG
FT                   SEAITPWTRDEILFPILDYRMNHELKTYFTSNYTLEELEQHYCLRDKENGYVASLRLME
FT                   RIKALSTPVSLLGKSRR"
FT   CDS             complement(20941..22089)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00330"
FT                   /product="DnaD and phage-associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87843"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCC1"
FT                   /protein_id="CBK87843.1"
FT                   /translation="MELEQNYMIYKTGDFQEKWNAYISLLYKPLIENDACMLYDLFLSL
FT                   DQTSITLEKLLMLYGSYANRFDASKKKLENYELIKTYYDPISRKNIIEVYPPLNAESFL
FT                   NHDTFSRLFLNQCGSSHFDFVKLHFNDEVGKTNYVDISEKMDLSCLESWTQEKEETYLN
FT                   LKPEEGKLKYDFDFETFLKGADRIFPMRYRTKENLSRIASLASIHGIDAVDMRKYVQRS
FT                   INPNTHVFDFEKLKKQVYANQKIIKPTEDPYKMSPVKFLQNKQQGAPVANADRKVIEKL
FT                   IKNYSFSNEVMNVLIEYCLNQTQQKFSKAYVEKVAASWIRLQVDSKEKALEVCRQENQV
FT                   KKPAPKLPDWYQNTEQSVPDDDLVQQALSLQRQLGKEKNDEI"
FT   CDS             complement(22080..22454)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00340"
FT                   /product="Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87844"
FT                   /db_xref="GOA:D4JCC2"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCC2"
FT                   /protein_id="CBK87844.1"
FT                   /translation="MFQDKMIKKEVENILHPLIFQEMNAWIENQKDGLVFIEMPLLFEI
FT                   GAQDHFDSIWCVVTKRNIALERLTKYRHIDTQEAMKRITKQMSEEKKASLSDVVIYNNG
FT                   TLKELKQTIAQMVEREKSWS"
FT   gap             22526..22890
FT                   /estimated_length=365
FT   CDS             complement(22981..23811)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00370"
FT                   /product="formamidopyrimidine-DNA glycosylase (fpg)"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87845"
FT                   /db_xref="GOA:D4JCC3"
FT                   /db_xref="InterPro:IPR000191"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCC3"
FT                   /protein_id="CBK87845.1"
FT                   /translation="MPEAPEVQTVLSTLEHQIKGAKILDVKVYYPKLIQNLDVTEFVSS
FT                   LKNQRFCDFFRIGKYLGFVMDDLDLIVHLRMEGKFYILKELPSDLKHIHCVTYLDDGRL
FT                   LCYHDTRKFGRMALYPKAVDVRRLDCFKNVGYDCLDENLDGMTFYKIIHPLKRNIKSAL
FT                   LDQSIIAGVGNIYADEILFSCKLDPRSRCQKISKKDCENIIYHTKRIIRGAMKAGGTTI
FT                   RSYTSSLGVTGLFQLELKVHSKKDEPCPVCKNKIKKIVVSQRGTYLCSNCQKRK"
FT   CDS             complement(23811..25874)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00380"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87846"
FT                   /db_xref="GOA:D4JCC4"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCC4"
FT                   /protein_id="CBK87846.1"
FT                   /translation="MPKQIIDLKGIMGDSSDNIPGVAGIGEKGATKLLVQYGSLENVYE
FT                   NIDQIKGKQKEKLLNDKENAFMSKELATIYTSMDFPFTIQDCKFDGYDEKVNDFYQKYE
FT                   MRSLISKTTMTSKSYQIKTICSFKGYDSKDLLLMPVNSKEAYLNQKLYGFMFFNNEEVL
FT                   YLKVEDALEDSYFKNMLKHETSLRTWDAKEMMHLLQRYGFYVPSFKEDLHLAAFLLHSQ
FT                   ATDTDSLISSLGIELPETIHDLLKKAKTVEACHIDRLLPVTCAWTWQLSIRQDNIFDEL
FT                   KKDNLLDLYENIEKPLVRILFEMENQGIHIDENVLDEIGAKTDTILESLTQQIHEMAHM
FT                   VFNINSPKQLAGVLYDELNLKGGGKKRSTSAEVLEKLKGSHPIIDVLLDYRKYSKIKST
FT                   YIEGLKKHIQQDSKIHTCFNQAMTQTGRLSSSDPNLQNISVRDEQGREIRKAFVAQKGY
FT                   KLLSADYSQIELRMLAHMANETHMIEAFKEGADIHNRTASHIFHVSQEDVTPDMRRVAK
FT                   TVNFGIVYGQTEFGLSQQLKISRKEAGEFMETYFASYPNIHQFMNQLIDFCKENGYVET
FT                   MFHRRRMIPEINDKNFMTREFGKRAAMNAPIQGSAADLIKIAMIRVDQAMKEKNVKSKM
FT                   LLQIHDELIFLVPDDELEVMQALVKEAMEQAMELKVPLKASINFGQSWYEAK"
FT   CDS             complement(25874..26386)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00390"
FT                   /product="5'-3' exonuclease (including N-terminal domain of
FT                   PolI)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87847"
FT                   /db_xref="GOA:D4JCC5"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCC5"
FT                   /protein_id="CBK87847.1"
FT                   /translation="MSKLLLLDGNSMLFRAYYATLYTHRMSTSNGIPTNAVFGFIMMLN
FT                   KAIDIIKPDSILVAWDAGKPTFRHKQFAAYKGTRKPLDEDLIVQFPIVREFLDATGIKR
FT                   FEIEGYEADDIIGSMAKTNSKGMTTILTSDRDLLQLIDDTTHVLLMKKGLSDMDLMDVE
FT                   NFKDKYI"
FT   gap             26461..26563
FT                   /estimated_length=103
FT   CDS             complement(26565..27128)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00400"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87848"
FT                   /db_xref="GOA:D4JCC6"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCC6"
FT                   /protein_id="CBK87848.1"
FT                   /translation="MKPRQMIILLLVMALIDDLISLCFPVNFQFQGYSFVPHFCFITLM
FT                   LLIYERGWLDRVLISGFCGVLTDLFFSGTLPVYFIIYAGLGYLSGIFNKAMEEDSRIRF
FT                   FSLFVLVLLLDLIPFLVNLVFQSMNVSFMTWFMHHELLTLTLHGVLILMMMYILDVLKR
FT                   FALIRQHRKQLDQRKKYVKMKTQK"
FT   CDS             complement(27125..27892)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00410"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87849"
FT                   /db_xref="GOA:D4JCC7"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCC7"
FT                   /protein_id="CBK87849.1"
FT                   /translation="MFGLRQNSLSNVGYSAWTYIKYGLFDYPLTSIANVFNDLSNLWHV
FT                   YDDNQYLNEQLAKQRSYQTLYEDERNKNAELEDLLEMQGSLDNATKISCTVLQRSANSW
FT                   DQTVTISAGSSQGVENNMLVVTSQGAVGLIENTQTATSTVRLLTSEDLINDIAIMISME
FT                   DGSNVEGVLQSYDADRNAYRVSLFDNNAQISTGQMVATSGKGGNYPSGIYLGTVTDVTI
FT                   NDDAIISTVYVQPVSNIQSFNYCMVIGSGVVGE"
FT   CDS             complement(28282..28689)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87850"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCC8"
FT                   /protein_id="CBK87850.1"
FT                   /translation="MSLDQRPREKALRQGLNSLSDLELIALILQSGSKDRSVFDIAQDV
FT                   LIETEGLSQLFNMHVNSLMKIKGIREVKALQLLAGVELCKRVLKTNAYRMQIKNSQDVI
FT                   QWFKVEYGYLTQEILFVFIWIPKQGSYLIVF"
FT   tRNA            28820..28910
FT                   /locus_tag="EC1_T_21180"
FT   tRNA            28927..29001
FT                   /locus_tag="EC1_T_21190"
FT   tRNA            29020..29095
FT                   /locus_tag="EC1_T_21200"
FT   tRNA            29101..29174
FT                   /locus_tag="EC1_T_21210"
FT   CDS             complement(29251..29784)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87851"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCC9"
FT                   /protein_id="CBK87851.1"
FT                   /translation="MNKIIIYSSHYGTTKLYADKMSERTHIKEISYQQVQDLNQYQVII
FT                   YVGALYAGGVLGLSKTMKKIKEPRNVKIMIITVGLADPNDEINEKNIRGNIKKQISQEI
FT                   YDRVQIYHLRGGIDYSKLSFQHKTLMKLMYIAEKKIPEEKRNAETKAIIETYGKQVNYV
FT                   DYQSLERIIESIEK"
FT   CDS             complement(29777..29953)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87852"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCD0"
FT                   /protein_id="CBK87852.1"
FT                   /translation="MYKTEIIEYAPKAVDMAKKIEEKANHMMETGYELVTVSITGSAKA
FT                   ILVFKKCEETLHE"
FT   CDS             complement(29946..30161)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87853"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCD1"
FT                   /protein_id="CBK87853.1"
FT                   /translation="MKELKKLKTALIMILFGNGFYLLHTYFLQTQSSSFSQFSQGILLG
FT                   LSVGSNIVGIILLIISIRKIQEDKNV"
FT   CDS             30291..31697
FT                   /transl_table=11
FT                   /locus_tag="EC1_00470"
FT                   /product="Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87854"
FT                   /db_xref="GOA:D4JCD2"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCD2"
FT                   /protein_id="CBK87854.1"
FT                   /translation="MSGFFGVASKESCVLDLFFGVDYHSHLGTRRGGMAVHGEHGFERA
FT                   IHNIENTPFRTKFDADLDKFNGNLGIGCISDFEAQPLLMQSHLGSFAITTVGRINNLQE
FT                   LKELCFSKGMSHFLEMSTGDINPTELVAALINQKDSIEEGLSYVQDMIEGSMSILLMTP
FT                   QGIYASRDKVGRTPIIIGEKSTGYCATFESSAFLNLGYHHYRDLGPGEIVFLTPTHIEV
FT                   KKKPQEEMKICSFLWVYYGYPTSTYEGVNVECMRNRCGEILSQRDDVDVDSVAGVPDSG
FT                   TAHAVGYANAKGIPFTRPFIKYTPTWPRSFMPTNQSQRNMIAKMKLIPVKELIKDKSLL
FT                   LIDDSIVRGTQLGETTDFLYDSGAKEVHVRPACPPIMFGCKYLNFSRSSSEMDLITRRV
FT                   IHKLEGDNVSEETLKEYANPDSEKYQNMLEEIRKRSGFTSLRYHRLDDMVKSIGLEKCK
FT                   LCTYCFDGEE"
FT   gap             31985..33407
FT                   /estimated_length=1423
FT   CDS             complement(33849..34772)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00500"
FT                   /product="K+-dependent Na+/Ca+ exchanger related-protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87855"
FT                   /db_xref="GOA:D4JCD3"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCD3"
FT                   /protein_id="CBK87855.1"
FT                   /translation="MDLLIAIIFIIVGFLFLVKGADCFVENASSIAGKIGVSSLIIGLT
FT                   IVAFGTSMPELAVSVTAALENANEIAVGNVVGSNIFNLLVVAGLSACIYPLLVNKTIMK
FT                   RDWPLSVVAAVLLTFMLIDRNISRFEGMILLICFGIMLYVQIKQTAKSEEDQKRIDTPY
FT                   SKLIIFLIIGIAGIVIGGQLVVDGATSLARIIGLSETLIGLTIVAIGTSLPELVTSLVA
FT                   ARKNENEIAMGNVIGSNLFNIFCILGISSVLNPITFEPTAFIDSLILVVVSIVFLVICK
FT                   FRPLDKKTGLIMVLTYIVYTVYIILR"
FT   CDS             complement(34796..35620)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87856"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCD4"
FT                   /protein_id="CBK87856.1"
FT                   /translation="MNSEKTKNKLIYFLALGSMCLALVLIMYNFFYKTVEVDVMKNIEL
FT                   VYTGENGSASVTVENNTEDLNQRIQEFMETVEYEVSPNSNLSNGDTIHIIATYDDELSM
FT                   TYHYQPINTEKEFIVQGLNNRFESKDDIPENYLNEILTESENYITEHADEIFHLDPETT
FT                   FQEDVSLNNISQLYCAFLKSTQTSDRIISVYQLDYASKEQAVTINYLVCVPNINDGNRV
FT                   IRQDIYGETAYLSSEELQNLNIESYIHRVFGTQYSIEKIETSTNQDQNTEKQ"
FT   gap             36017..37315
FT                   /estimated_length=1299
FT   gap             39000..40867
FT                   /estimated_length=1868
FT   CDS             42138..42461
FT                   /transl_table=11
FT                   /locus_tag="EC1_00570"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87857"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCD5"
FT                   /protein_id="CBK87857.1"
FT                   /translation="MKLILAILSNDDSPAASNALNKNGFQVTKLATTGGFLRAGNTTLI
FT                   VGCEDEKVQDAINIIGEYSSKRTEIVPSTASYDIGRYASFPVEVQVGGATIFVLNVEQF
FT                   VKL"
FT   gap             42624..43128
FT                   /estimated_length=505
FT   CDS             43265..43402
FT                   /transl_table=11
FT                   /locus_tag="EC1_00590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87858"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCD6"
FT                   /protein_id="CBK87858.1"
FT                   /translation="MYDIDLPYDRSIEAKFAKQLDISIESHALTLYGICHDCHQERRGK
FT                   "
FT   CDS             43405..43944
FT                   /transl_table=11
FT                   /locus_tag="EC1_00600"
FT                   /product="Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87859"
FT                   /db_xref="GOA:D4JCD7"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCD7"
FT                   /protein_id="CBK87859.1"
FT                   /translation="MELKGSRTEQNLQTAFAGESQARNKYTYFANKARQEGMNQIAEIF
FT                   EETARNEQEHARLWFQHLNGGKIGTTAENLKAAAEGENYEWTSMYKEFAEVAREEGFTA
FT                   IAFQMEKVAQIEKEHEERYLKLLSNVENEKVFSGEESDTWICGICGFKYTGVNAPKACP
FT                   VCGYPQAVFRKEAKNY"
FT   CDS             44057..45199
FT                   /transl_table=11
FT                   /locus_tag="EC1_00610"
FT                   /product="tRNA(Ile)-lysidine synthetase, N-terminal
FT                   domain/tRNA(Ile)-lysidine synthetase, C-terminal domain"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87860"
FT                   /db_xref="GOA:D4JCD8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCD8"
FT                   /protein_id="CBK87860.1"
FT                   /translation="MALLDKLYKQGHTIIVAHVNYHKRDTANRDEKIVRDYCQERSIEV
FT                   EVQEPTFDNKSNFQSWARKVRYDFFFELATKNDTDQIYVAHHLDDHLETYLFQKSRNML
FT                   CDHYGLKSENIMKGMKIIRPLLEETKAQLIEYCDQNNIEYGIDESNLGNDYTRNKIRHS
FT                   QIEKMSLLEKLRLNEEIQKENIKLKDKREKAASFLKGWNRSIDTLLKQEDAWFILEYYL
FT                   HLEIGNHYSKKHMKSLIEQLQSNCLLEIDGYYLESYEGMLYFKKIKENKSYTVSYLEYI
FT                   TNDSFSLLKTGKVIESIYVSEKDFPLVIRSVKPGDQIKLRYGTKKVSRFLIDRKIPKIY
FT                   RKEWLVMENSEKKVIFVPGIGCDVEHFSIKPNLFMVQYLT"
FT   CDS             45216..45758
FT                   /transl_table=11
FT                   /locus_tag="EC1_00620"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /function="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87861"
FT                   /db_xref="GOA:D4JCD9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCD9"
FT                   /protein_id="CBK87861.1"
FT                   /translation="MISDDILKVLLNEEQIEKRCVELAEQIESDYEKLHAVPIVVGLLK
FT                   GSVPFMAELIKRFTFDCEIDFMSVSSYDGTESIGDVRIEKDMDISCKGRHILVVEDIVD
FT                   TGRTLREVKQMFMNKGATDVKIVSLLDKPERRVVDIKADYVGYTVPNEFVVGYGLDYNQ
FT                   KYRNLPFIGILKPEIYE"
FT   CDS             45770..47737
FT                   /transl_table=11
FT                   /locus_tag="EC1_00630"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /function="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87862"
FT                   /db_xref="GOA:D4JCE0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCE0"
FT                   /protein_id="CBK87862.1"
FT                   /translation="MKKWLNYLPTIFIITIVMSLIFYSSQGTTEQMNYSRFKDVAEHAE
FT                   FEDSTLTISTTIIQVEGSYKTEGKDAISGFRVIVPNTEANLEWLETTLTEDGGRLTIAD
FT                   PNQNSVWINLLVNLIPFLIIGVFFYLMFSKMGGSGSNKAFEFAKSKARVESNVKVRFKD
FT                   VAGCEEEKEEVKEIIDYLRSPKKFTDMGAHIPKGVLMVGPPGTGKTLLAKAVAGEANVP
FT                   FFSISGSDFVEMFVGTGASRVRDMFKNAQKSAPCIVFIDEIDAVGRQRGAGMGGGNDER
FT                   EQTLNQLLVEMDGMTDNNGIVIIAATNRPDVLDPALLRSGRFDRRVTVNLPDIKGREEI
FT                   LQVHARNKKLASDVSLENLARRTPGFSGADLANVLNEGAILAVRNKETQITMNDLDEAI
FT                   DRVMMGPAKKSKKYTEKDKLLVAYHEAGHAVIGLKLEDADMVQKVTIIPRGEAGGYNLM
FT                   TPREEKYFHRKSEFLAKITGLLGGRTSEELVFGEISAGAVNDIEQLTKIAKNMVRVYGM
FT                   SSLGPIQYADPQGNVFLGRDYTQGGNYSNGVAAEIDKEVRKIIDECHENCRKILEENRD
FT                   LLDLIAKSLVERETLTNEEITNLMNYGQITNPNEPVEVQEPKEVEVKEPVETEVPPKPP
FT                   VGVEKQDLDDALNELTKKKD"
FT   CDS             47771..48655
FT                   /transl_table=11
FT                   /locus_tag="EC1_00640"
FT                   /product="Disulfide bond chaperones of the HSP33 family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87863"
FT                   /db_xref="GOA:D4JCE1"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCE1"
FT                   /protein_id="CBK87863.1"
FT                   /translation="MKDQLCRALVCQDRVRLYIVRTTDMVQEARDRFDLHPCACAALGR
FT                   TLSVGSIMGSMLKSDEEMLTITINGHGPIGSIIVDAYHDGTVRGFCSNPHVEDVFLDKG
FT                   KLNVGAVVGKDGTLTVTKDLNMEENFSGTVELVSGEIGEDFAYYFTLSEQIPTAVSVGV
FT                   LIGKDGNVQSAGAMIIQMLPDANEEDILICEHLLQGLKPMSTLMLDYDDMELKDLVNDM
FT                   FEDAKILDTSDVRYSCPCSKERMANAISTLKDEEIQDMIDKDHGCHITCNFCNERYDFS
FT                   EEDLRKILESRNV"
FT   CDS             48648..49628
FT                   /transl_table=11
FT                   /locus_tag="EC1_00650"
FT                   /product="tRNA-U20-dihydrouridine synthase"
FT                   /function="tRNA-U20-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87864"
FT                   /db_xref="GOA:D4JCE2"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCE2"
FT                   /protein_id="CBK87864.1"
FT                   /translation="MFKIGDVTIDNPIVIAPLAGISNIAFRVIAKEFGAGLVCNEMVSD
FT                   KALYYDSKKTFSMCDVDPNEHPVSFQLFGHDIDTVVYAAKYLDTQTNCDIIDFNMGCPV
FT                   NKVIKAKAGSYLMKDIDYAKELVSHIVENVNKPVTVKMRIGFDKDHINCVEMAKAMEGV
FT                   GVKAVAVHGRTRSQMYEGKADWSYIKQVKEAVSIPVIGNGDVRSVDDFFRMQKETGCDA
FT                   VMIGRGIIGNPFLIQECKDALYNEHHTYDFNDRIEICLKHANGLIKNKGEVIAIKEMRG
FT                   LASWYLKGLPGSHYFKNECSKINTLDDLKNVLNEYKTEYMKRMAE"
FT   CDS             49722..50957
FT                   /transl_table=11
FT                   /locus_tag="EC1_00660"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /function="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87865"
FT                   /db_xref="GOA:D4JCE3"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCE3"
FT                   /protein_id="CBK87865.1"
FT                   /translation="MKILVVGKGGREHALAKAAHASKLCDQLYCAPGNPGMAKIATCLN
FT                   VSDSDIEGLVKAAKENEIDLTIVGPEATLSLGIVDAFEKEGLKIFGPTKAATQVESSKD
FT                   FAKQIMAKYDIPTAAYQTFDNYEEAWKYVESKGAPIVIKEDGLKAGKGVTVAMDLDQAN
FT                   EALKIAFDIENNQVVIEEYLEGFEFSLICLVHNELVVPLEVAQDHKCVFDGDKGPNTGG
FT                   MGSYSPVKKITPEIIQEALDTILCPMAKAMVKENVPFTGFLYGGLMMTKNGIKTIEFNA
FT                   RFGDPEAEVILPRLESDFVQAILDVMDNKPVKLKWSNKVSHGVVLASEGYPAGSTSGAI
FT                   IEGVDDVDGFVYHMGTKEVDGNLVTAGGRVLMVVTLEPTLEEAFEHTYNEIKKIHCDKL
FT                   FFRTDIGRKDMD"
FT   CDS             50960..52630
FT                   /transl_table=11
FT                   /locus_tag="EC1_00670"
FT                   /product="Formate-tetrahydrofolate ligase"
FT                   /function="Formate-tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87866"
FT                   /db_xref="GOA:D4JCE4"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCE4"
FT                   /protein_id="CBK87866.1"
FT                   /translation="MAKTDLEIAQECVMEPIEEVAKKVGIQPDMLENYGKYKAKLSFDF
FT                   LRQIENNEPGKLILVTAINPTKAGEGKSTTTVGLGDALNRLGKKTMMALREPSLGPVFG
FT                   LKGGATGGGYAQVVPMEDINLHFTGDMHAITTANNLVSAILDNHLHQGNELNIDPEKIT
FT                   FKRCLDMNDRTLRNINIGQGPKANGVERNDGFNITVASEIMAALCLADDLMDLKKRFGQ
FT                   MLVAYTYDDKPVYVHDLGIEGALAMVMKDAILPNVVQTLEHNPVLIHGGPFANIAHGCN
FT                   SVIATKACLRLADYTVTEAGFGADLGAEKFLDIKCRLAKLNPSAVVIVATIRALKQHGG
FT                   IELENLKEENVEAMLAGCENLAKHIDTIKQFGLPYIVAINEFATDTPSEIEALENWCKE
FT                   NGHPMSLSQVWAKGGEGAIDLAQKVVSLCDQENNFAPLYPLEDSIEEKIETIAKKVYGA
FT                   DGVDFTDEAKEQIKKFNELGWDKLPICMAKTQMSLSDDGKLMGRPTGFRITVRELRPSL
FT                   GAGFIVALTGKVLTMPGLPKHPSALDMDIDQDGKIKGLF"
FT   gap             52696..52903
FT                   /estimated_length=208
FT   CDS             53034..54194
FT                   /transl_table=11
FT                   /locus_tag="EC1_00680"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87867"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCE5"
FT                   /protein_id="CBK87867.1"
FT                   /translation="MKFFDIDKKIWTYIIGIAILVVCILNLDKVEQTIGVIWNAVKVLV
FT                   FGGMIAYVLNLVMNRIEKLLEKSKNKFVLKIKRVISLLASLCCVALIIYFVLAIVIPTL
FT                   GQAGQVLIDVLPQYFNDTIKFLSNLFENNPHIVEMINGLEINWKEMIDQTLSFLGNGLG
FT                   NVLGSTFNMVNIVVNSVFNTILSIIFAIYVLLDKERFIRLYHRLGDLYLGKDRKDKLTS
FT                   ALKIINQSFGSFIGGQCIEATILGTLCATGMYLLNMPYPLMIGVLVGLINIIPMIGAYI
FT                   GGAIGMFMVFTVDPMMSLGFLVYLCILQQFESNVIYPRVVGSSVGLPGIYVMMTVVVFG
FT                   SLAGIPGMFLGIPTVASIYKLAKIHIQNKEKELETKKLESKTSVKN"
FT   CDS             54246..55097
FT                   /transl_table=11
FT                   /locus_tag="EC1_00690"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87868"
FT                   /db_xref="GOA:D4JCE6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCE6"
FT                   /protein_id="CBK87868.1"
FT                   /translation="MIKCLAFDLDGTLLMDDKTMDPRTVESIKQAMAKGIQIVIASGRD
FT                   KNGCRFVYEPLGLEEGNNYLALVNGQIIYDFKNKEYDLDDVLMPEDGIKIQQICKKFDV
FT                   EGIFCCGYDFYSYLSTMNRLKKKIKEVVAGKPMDYGLKSGGKYRNFINLPYEEVRLTQD
FT                   INKVIMVHSEKFFKQNLDALKEALSDYDVLMVGPAWMEIMPKGVSKASALEKIAAKNGY
FT                   TMNEVMAFGDAENDIQMLKRAGVGVAMGNAMDEVKEIADIITDTNLNNGIGKIIDKMVL
FT                   GK"
FT   CDS             55154..55462
FT                   /transl_table=11
FT                   /locus_tag="EC1_00700"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87869"
FT                   /db_xref="GOA:D4JCE7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCE7"
FT                   /protein_id="CBK87869.1"
FT                   /translation="MKIVNTQEFNELMNEKAVLVDFFATWCGPCKMLSPVLEGVAEKMK
FT                   DKVTIVKVDVDRSPDLAAKFGVMSVPTMIMFKNGRQVDAFSGYMPEANLMANIERNL"
FT   CDS             55533..56027
FT                   /transl_table=11
FT                   /locus_tag="EC1_00710"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87870"
FT                   /db_xref="GOA:D4JCE8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCE8"
FT                   /protein_id="CBK87870.1"
FT                   /translation="MNSIYDRCSIRKFKQESLKKSEIDKILRAAFCAPSARNAQPWFFI
FT                   VTEDKEKLKELSEFSPYAKLLADAALGIVVCADTDCNPSLDYCQQDCAAATQNMLIEAK
FT                   ELNIGSCWLGGYPNEDRVQTLKMYFKLPQNIVPLWMVAFGYPDQKQETKDKFKESKIRY
FT                   E"
FT   CDS             56020..56523
FT                   /transl_table=11
FT                   /locus_tag="EC1_00720"
FT                   /product="Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87871"
FT                   /db_xref="GOA:D4JCE9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCE9"
FT                   /protein_id="CBK87871.1"
FT                   /translation="MNSQLEIIVCQNQEMLKEVADCANEIWHEYFPFLLSKDQIDYMVD
FT                   KFQSFKAMDEQTRHDHYKYYQVHKDGEMIGYIGLKFEPDRLFLSKLYLKKEARGKHYAS
FT                   DMLEYIFEIAKRQCYQSVYLTCNKHNSNSLAVYEKKGFKKIDEDVTDIGNGYVMDDYIY
FT                   EYTL"
FT   gap             56556..57668
FT                   /estimated_length=1113
FT   CDS             complement(57670..58443)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00730"
FT                   /product="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87872"
FT                   /db_xref="GOA:D4JCF0"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCF0"
FT                   /protein_id="CBK87872.1"
FT                   /translation="MITDERYAKIVEITNSRGFISTRELAQKLNVTETTIRRDCDELSK
FT                   KNLIIRVHGGAKSIQYRNILSDRNEKNMKDHMLFSSKEKNAVARRAASIVEDGSCIFLD
FT                   GGTSIVAMLKYLEGKKIKIVTHSKLIVSNFQDYNAELFCIGGKLIPEFAMCTGPLTLSG
FT                   LERFNFDYAFIGCAGIDLKRKLVYTVEMDTMAIKQKAMSLAKKSYLLADSSKFNVTGFC
FT                   SFISTDDFEAIFSDNQINADAKDIPDNFILIDTNI"
FT   CDS             58641..59657
FT                   /transl_table=11
FT                   /locus_tag="EC1_00740"
FT                   /product="glycerol 2-dehydrogenase (NAD+)"
FT                   /function="glycerol 2-dehydrogenase (NAD+)"
FT                   /EC_number="1.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87873"
FT                   /db_xref="GOA:D4JCF1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCF1"
FT                   /protein_id="CBK87873.1"
FT                   /translation="MGKKALILISQGGYKRIGKIVEDSFKETSCEILFDYFNGECSKNE
FT                   INRLVQLANDNNCDMVIGIGGGKIFDTAKAVAHYVKSPVVICPTIASTDAPCSALSVIY
FT                   SDEGVFEEYFFLPKNPDVVLVDTQVIADSPVRLTVAGIGDALATYFEARACVQSQATTC
FT                   AGGTATNAAYALAKLCFETLMEEGVKAKVALEAKALTPAVEKIIEANTLLSGIGFESCG
FT                   LAGAHAIHNGFTVLEECHSMYHGEKVAFGTIVQLVLENVPAEELEEIIEFCIEVGLPVT
FT                   LKQLGIEEVTKEKIMAVAKAACDPSDTLHNMPFEVTPESTYAAIMAADAYGRYYLGE"
FT   CDS             59743..61080
FT                   /transl_table=11
FT                   /locus_tag="EC1_00750"
FT                   /product="Recombination protein MgsA"
FT                   /function="Recombination protein MgsA"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87874"
FT                   /db_xref="GOA:D4JCF2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCF2"
FT                   /protein_id="CBK87874.1"
FT                   /translation="MEQDSLFQIKEDIRPLADRMRPETLEEYVGQHQLVEKGKLLWQMI
FT                   ENDQVTSMIFWGPPGVGKTTLARIIAHQTESYFVDFSAVTSGIKEIKEVMKQADQRKVL
FT                   GQKTILFVDEIHRFNKAQQDAFLPYVEKGSIILIGATTENPSFEINSALLSRCRVFVLN
FT                   ALEQKDLEDLIFRAISSSKGLGNLRIDISQEDIEAIAAFSGGDARFCLNTLEMVVYNSP
FT                   SDVNGIHVSKEILKQCLQKRSLLYDKKGEEHYNIISALHKSMRNSDVQASIYWLARMLE
FT                   AGEDPLYVARRIVRFSSEDIGMADSRALEICVAAYQACHYLGMPECNVHLTHAVTYCAL
FT                   APKSNSLEVAYLSAKEDAIKTLQEPVPLQIRNAPTKLMKELNYGKDYEYSHDYKYHMTD
FT                   MVCMPDGLIDRQYYKPSDQGSEVKVKNRMDYINAIKAQLRKSRRKK"
FT   CDS             61077..61529
FT                   /transl_table=11
FT                   /locus_tag="EC1_00760"
FT                   /product="conserved hypothetical nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87875"
FT                   /db_xref="GOA:D4JCF3"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCF3"
FT                   /protein_id="CBK87875.1"
FT                   /translation="MKIAIHSLKDTQEFAQKMANLCKDKQIVITLDGDLGAGKTTWTKS
FT                   FGKALGVKDVINSPTFTILKSYTMENGKPLHHIDAYRLEGVSQDLGFEECFDEGISVVE
FT                   WADFIKEQLPKDHISISIEEGIDEERMITMVSTGPLSSSILEGYHD"
FT   CDS             61522..62121
FT                   /transl_table=11
FT                   /locus_tag="EC1_00770"
FT                   /product="Inactive homolog of metal-dependent proteases,
FT                   putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87876"
FT                   /db_xref="GOA:D4JCF4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCF4"
FT                   /protein_id="CBK87876.1"
FT                   /translation="MISLCMDSAYKNLILGVYKDKELLAGVSIEAFKKQSETIFVELNR
FT                   ILEEAKLDYADIDRVVITDGPGSYTGIRIAMTIAKVLCTTMHKELYCISTMQLYAGKEP
FT                   MANVILDARSKRAYVAHCENGKIIGQTTILNVEELDDFLNSCPGTLFGDGYLIGKETKQ
FT                   PDYLKNFIELEDMYRKVDNIHALVPQYLKESDAYKV"
FT   CDS             62118..62549
FT                   /transl_table=11
FT                   /locus_tag="EC1_00780"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87877"
FT                   /db_xref="GOA:D4JCF5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCF5"
FT                   /protein_id="CBK87877.1"
FT                   /translation="MIEIMRKEDLAQIVDLEKKCFNDAWNLEQVENELEVNPFSNGYML
FT                   KGNDKVVAYAFMWETFEMAQIARIGVDPDQRKKHYGQKMMEELFEKARSGGCEYMSLEV
FT                   RESNTAAIKLYEKLGFVTVNVSKGYYSDNENAIVMTRAL"
FT   CDS             62561..63562
FT                   /transl_table=11
FT                   /locus_tag="EC1_00790"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /function="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87878"
FT                   /db_xref="GOA:D4JCF6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCF6"
FT                   /protein_id="CBK87878.1"
FT                   /translation="MIILGIESSCDETAVAIVKDKKEVLSSIVASQIDVHKEFGGVVPE
FT                   VASRIHVENISYCIEQALAQANVTMDMVDAIAVTKGPGLIGCLHVGVQAAKTLAFAYHK
FT                   PLVPVHHLAAHIYANELVVDMKYPVLALVVSGGNTELVYMKNETSFEILGQTQDDAIGE
FT                   AYDKVARVLGLGYPGGPKIDKLAREGKNVYTLAKPKTQGKYDFSFSGLKSSVLQFVKRM
FT                   ERTNQTFDMADLACSFQECALDEIFSRIKVCLDDHPDIRHFVVGGGVSANSRLRERIEE
FT                   LKEQYPNITFTVPPMYCCTDNASMIAVAGTIAYESGRRAGADLTADAGWEIQ"
FT   CDS             63562..64110
FT                   /transl_table=11
FT                   /locus_tag="EC1_00800"
FT                   /product="Sortase and related acyltransferases"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87879"
FT                   /db_xref="GOA:D4JCF7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCF7"
FT                   /protein_id="CBK87879.1"
FT                   /translation="MNRIRLFDSMDVESIYDIYAYYVKNSTAIFDLAPMDKEVFKNKML
FT                   DTSEEYPFYVAEHDGELIGYAYVHKAFTKEAYRFCVELSIYFKKGNHYGMADALVKKVE
FT                   EACIQKGYKWIIACITDTNTTSINFHLKHGYVKTGSLQNCGYKWNQWHGVNWLCKDLMS
FT                   MNIESYYKASSAIVDGDVK"
FT   gap             64131..64253
FT                   /estimated_length=123
FT   CDS             64692..65003
FT                   /transl_table=11
FT                   /locus_tag="EC1_00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87880"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCF8"
FT                   /protein_id="CBK87880.1"
FT                   /translation="MRTIIKGSEGDKMENILNYVRLRQDISFQMSPFNVIDALILSDLA
FT                   YVDWNNIVKDEKVDLQRACRQYFKMHTPEEIQRKYVFSNNVPNLAKEVSRSNRLKTSP"
FT   CDS             65026..65145
FT                   /transl_table=11
FT                   /locus_tag="EC1_00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87881"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCF9"
FT                   /protein_id="CBK87881.1"
FT                   /translation="MKKRTFSFLLLHLYCQMKLYLFLIVEQMEVLQVGKKICR"
FT   CDS             65136..65858
FT                   /transl_table=11
FT                   /locus_tag="EC1_00840"
FT                   /product="Protein of unknown function (DUF2974)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87882"
FT                   /db_xref="InterPro:IPR024499"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCG0"
FT                   /protein_id="CBK87882.1"
FT                   /translation="MQMTYMSHLPCQKMAAEYAEEIIDGIEEKSFWFGFVHKKVYPKIY
FT                   LAGHSKGGNLAMYAALFGKGIQEHITSVFAFDAPGFRLDVWNSIKDRSILEKITNYKPK
FT                   DSIIGCLLEHQETAKIVDATDFGLTQHDAFSWSIGPKDFNYVQSLTKQSEEALAYIDKI
FT                   LMSKEDVDKKTYIDLIFSVIDKFDVKQLSDFNDIGIRKGISGILELRQLSGEEIKFLFE
FT                   VISFLRSQTSSLLKQAKK"
FT   CDS             65874..66713
FT                   /transl_table=11
FT                   /locus_tag="EC1_00850"
FT                   /product="3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases"
FT                   /EC_number="1.1.1.31"
FT                   /EC_number="1.1.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87883"
FT                   /db_xref="GOA:D4JCG1"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCG1"
FT                   /protein_id="CBK87883.1"
FT                   /translation="MKIGWIGAGIMGSPMIMHLIDRQYEVHVYARHAEKIKPVLDKGAI
FT                   LEKEIKNLVQECDVICTMVGFPSDVKEVYEEIFKWVDAGKVCIDFTTSSPKLAEELNAL
FT                   GIQKQVDILDAPVTGGDVGAKKGTLTVLVGGKEEVYEEMKPIFESFGKDIYYCGKAGNG
FT                   QYVKIANQIMIANNLQGICEAYQYLSDMSVDENMIISCLKNGAAGSRQLDLNGQKMFDG
FT                   DYAPGFYVKHFIKDLKIATSESKVPLTGVKTVINEYLDLVDRGYSEKGTQCLIEYFK"
FT   gap             67179..68940
FT                   /estimated_length=1762
FT   CDS             68944..69012
FT                   /transl_table=11
FT                   /locus_tag="EC1_00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87884"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCG2"
FT                   /protein_id="CBK87884.1"
FT                   /translation="MIENAKSSMVFYNKLLKTEEML"
FT   CDS             69009..69473
FT                   /transl_table=11
FT                   /locus_tag="EC1_00870"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87885"
FT                   /db_xref="GOA:D4JCG3"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCG3"
FT                   /protein_id="CBK87885.1"
FT                   /translation="MIKLVRVDHRLLHGQVIFSWTKQMSVNYIIVADDKVPNDPISVMA
FT                   LNIAKPVDCELSIIPFSQLKELVEEKQNKNIMILVKGPEEALRLIEELPEVTEINYGGV
FT                   AKKSDSKQYGKAIFLNPQELKATQEIIAKGKKVYIQMVPTSQIESADFSK"
FT   CDS             69508..70248
FT                   /transl_table=11
FT                   /locus_tag="EC1_00880"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87886"
FT                   /db_xref="GOA:D4JCG4"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCG4"
FT                   /protein_id="CBK87886.1"
FT                   /translation="MLIKAILLGLVGVVGVIDSRLIGRQNIGRPLILSTLAGLVLGDLT
FT                   KGITLGASLELISMGFVSIGAAGPPTMQFGSIIATAFAILSGASTEEALTIAIPVAVAG
FT                   EFLSIIMRMVIAQFSHVADHAIEEGKYGRAIHIHLWWSFIFNALVYFIPIFLTIYYGAD
FT                   VVAELVEAIPDVITNGLTVAGNLLSALGFAMLLSTMLSKKMFPYFLLGFLVVAYSGLDL
FT                   IAVTLYSGILAFILDRVIYAKKEA"
FT   CDS             70253..70810
FT                   /transl_table=11
FT                   /locus_tag="EC1_00890"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87887"
FT                   /db_xref="GOA:D4JCG5"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCG5"
FT                   /protein_id="CBK87887.1"
FT                   /translation="MEQNQNSIITKKDLRRVFLNSLTIMCSWNYERQMHMGFMYGMAPI
FT                   LNKLYKNDEEKKKEAYKRHMEFFNCTPQMTSFIMGLAASMEEQNASSKEGEFQPESISM
FT                   IKTSLMGPFAGIGDSFFQGTLRIITFGIGLSFAQQGSILGPILAVVLFAIPSLLAAYYG
FT                   TFLGYRSGNKYLAKLYQEGLMD"
FT   CDS             70814..71077
FT                   /transl_table=11
FT                   /locus_tag="EC1_00900"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87888"
FT                   /db_xref="GOA:D4JCG6"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCG6"
FT                   /protein_id="CBK87888.1"
FT                   /translation="MHFASIVGLAVIGGMVASMVPITTPLQFNTGGTELVLQDMIDQIF
FT                   PQLLPLVFTLGIYWLIQKKINTNVLLLGIIVFGLVMSAIGIL"
FT   CDS             complement(71121..71873)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00910"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87889"
FT                   /db_xref="GOA:D4JCG7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCG7"
FT                   /protein_id="CBK87889.1"
FT                   /translation="MNIESNKPLYLQVEADIRNSILQKKYRSGQKLPTENELSEQYNVS
FT                   KITIRKAMSNLAKDGLVQKVQGKGTFISYKKDKVLLNRSRGFQDSLNDYGHSSKHKILN
FT                   ISLLTANDDIASKLKIAKGTSMFFLERLIWEDVSPIAIDRIYLPEKDFPDFMKHIAEDK
FT                   SFYQILQENYGITPAKSVLEINGIIATKELSELLQCNMGDPLFYIEKIGYQKNEQPIHY
FT                   SITTVRCDRVSYHVSTDNITVMDEKIIK"
FT   gap             72088..72625
FT                   /estimated_length=538
FT   CDS             73321..74001
FT                   /transl_table=11
FT                   /locus_tag="EC1_00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87890"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCG8"
FT                   /protein_id="CBK87890.1"
FT                   /translation="MKHNNIIIMSALALVISLTGCGNTNKLSEYDMTGISFIEYTDIDT
FT                   VCEDKELITAGSNLLSDQEDNLLLSYVVDSAIELSAELGDYDHLVFTNPKWIENFGDSG
FT                   KLKPIEYSSLSKSMQEFLDSQMPILTNDGSVLPEGTGLYEYEGGGLLAFPVNVTLGAAK
FT                   PIEAKNPLVMLIDNPAEILKADSCLLPLTSSGNVLFLDSDNLQQAFENSELKDYGDIQK
FT                   FNEK"
FT   CDS             73991..74356
FT                   /transl_table=11
FT                   /locus_tag="EC1_00930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87891"
FT                   /db_xref="InterPro:IPR024215"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCG9"
FT                   /protein_id="CBK87891.1"
FT                   /translation="MKNNILQLHNQSERTVEKIDCPFSMPMSRKERPPMTKPREKTREE
FT                   LQAEIEGGKKKIRQFENREKMLRQKIFKEERRTRSHRLIVRGAVFESIVPEARGMTNEE
FT                   SATFLRLALTRQTVFYI"
FT   CDS             complement(74520..75230)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87892"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCH0"
FT                   /protein_id="CBK87892.1"
FT                   /translation="MIEECRDKQRQAEQERDYALSHQKKVEIPVEKPVLYQKCGNCKQT
FT                   AYLKAKERYDTQREKLAGRYKAKTAIYEALMFLLIWYSVSTTLFQMIRSKIFISDCVVF
FT                   FDTIATFIQNIAGLTILAGKNVAQVSNGISNPVVAGIIYWMIRILISGGCLVGVGILLA
FT                   FIEIKIAGLYKKYCWDMITIMVILVSMAIAIYFGDWIKAVLPINLLFLLLFVQLVYVGI
FT                   RWYVKGWRETRGYY"
FT   CDS             complement(75208..76479)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00950"
FT                   /product="plasmid mobilization system relaxase"
FT                   /function="plasmid mobilization system relaxase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87893"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCH1"
FT                   /protein_id="CBK87893.1"
FT                   /translation="MCVDWSIHDKNDGNPHVHLLVTMRPFNPDHSWGNKEVKDWDFVRD
FT                   TDGNIVVDEFHPDWWQDKKNPDRHGIRIPVLDENGVQKVGARNRKQWKRVLTDATGWNN
FT                   PKNCELWRSEWARMCNRHLSIDNQIDHRSYERQGKLKVPTIHEGADARKIEEKYLTGQI
FT                   RKGSWKVEENQMIKKQNALLQKVIATFGKVSGALSMWRECLNDIRRKQRSNSHDGSNDY
FT                   TDRGATEYHGRDASGDTGKGREADVLSGAGRTIAAIRERIIRDASNLAGYRRTADASGR
FT                   KGRPDTATYRRESAMAGISTEIKQREPAIAETEQRIADIEQQIEKARDIDDRIRKLKER
FT                   RSTGRIATADGADAGRTRPERPDYRGTESAARRIADLEREVKQREQSREHSSLKERLEE
FT                   NKRIIAEREKENAHRPSHDRGMSR"
FT   CDS             complement(76501..76929)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00960"
FT                   /product="MobA/MobL family."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87894"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCH2"
FT                   /protein_id="CBK87894.1"
FT                   /translation="MAIFHFTVKIVGRSKGKSVISASAYLNGDVMKNEETGRISYYTSK
FT                   KEVVYTSLMMCENAPPEWLHVPEENIKRFQQSIRYKRADDKDAALEKFKITFQKQRLWN
FT                   EVLKIEKNADAQLGRSFEFSLPKEWSRQEQIDYTTEYI"
FT   CDS             complement(76905..77210)
FT                   /transl_table=11
FT                   /locus_tag="EC1_00970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_00970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87895"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCH3"
FT                   /protein_id="CBK87895.1"
FT                   /translation="MAEGVGFPFPSLPLNEGRTYGQPEVVLISLPQVATGLRLRLPGSF
FT                   RRRGFQPDLLMPQGALLRRGRSDSFTPAKPEEDAVGNQCRIRQKGGIVSWRYFTLQ"
FT   gap             77679..78007
FT                   /estimated_length=329
FT   CDS             78402..79031
FT                   /transl_table=11
FT                   /locus_tag="EC1_01000"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87896"
FT                   /db_xref="GOA:D4JCH4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCH4"
FT                   /protein_id="CBK87896.1"
FT                   /translation="MKDKELRKLIGSRAKQRRLELNLTQPYVAEKMGVTASTILRYENG
FT                   SIDNTKKMVLEGLSEALHVSIEWLKGETDEYETDITDKKELQIRDAMGDILKQLPLDLS
FT                   KKEDAFSKDLLLLMLKQYNLFLESFQFACKNYKGNTNEADIAKAMGFESNDEYNEIMFL
FT                   REITHTVNAFNDMADIVRLYSKKPEMAEQRLENLLSEVLYEDSDSV"
FT   CDS             79192..80487
FT                   /transl_table=11
FT                   /locus_tag="EC1_01010"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87897"
FT                   /db_xref="GOA:D4JCH5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCH5"
FT                   /protein_id="CBK87897.1"
FT                   /translation="MAKGSVRKKGKKWYYRFYVEDASGNLVQKEYAGTESKSETEKLLR
FT                   QAMDDYESKKFIAKSENITVGELLDIWAEEELKTGTLSNGTVQNYLGAITNIKKHPISE
FT                   RKLKNVTSEHLQAFFDLLSFGGTYPDGSERKGYSKDYIRSFSAVLQQSFRFAVSPKQYI
FT                   TFNPMQYIKLKYQTDEVDLFSDDDMDGDIQPIPREDYERLIEFLQDYNPPAILPIQIAY
FT                   YAGLRIGEACGLAWQDVNLEEQCLTIRRSIRYDGSRHKNIIGPTKRKKVRIVDFGDTLA
FT                   EILRNARKEQLKNRMQYGELYHKNYYREVKDKNRVYYEFYHLDGTENVPEDYKEISFVC
FT                   LRPDGSLELPSTLGIVCRKIAQKLDGFEGFHFHQLRHTYTSNLLANGAAPKDVQELLGH
FT                   SDVSTTMNVYAHSTRKAKRESAKLLDKVAGND"
FT   gap             80514..80757
FT                   /estimated_length=244
FT   CDS             complement(81208..82110)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01020"
FT                   /product="Zn-dependent dipeptidase, microsomal dipeptidase
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87898"
FT                   /db_xref="GOA:D4JCH6"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCH6"
FT                   /protein_id="CBK87898.1"
FT                   /translation="MRFANLHDDIGNDIYDHKDQKDRLDTFHYPRFKQGNMCFSAIVCC
FT                   FDGGQDWNTMCDTIRYVENAILHSKHFSFDDTKDIQVFMAVEGMCGIDKDPEERIDWLY
FT                   MHHVRLASLCWNDDNALACGAKKGNKPLTDLGKRVIKEMNQVNMAIDTSHCCEWNFYDI
FT                   ARISTKPIIASHSNVKGLYNHYRNLSDPQLQVIQSKNGLIGGIPVRWFVDKKENNATLE
FT                   DFIQVLIYIKEKIGTNHIALGFDFMDYIPGMEDSNVIGMKDITQIQNIATALQEHGFAQ
FT                   QEIEDICFNNAYNFMKNYI"
FT   CDS             complement(82113..83147)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01030"
FT                   /product="Oligoendopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87899"
FT                   /db_xref="GOA:D4JCH7"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCH7"
FT                   /protein_id="CBK87899.1"
FT                   /translation="MLIESRMDKETLDAMMSSIQSYLPKFRNYLRTKANLLGYKNGLPW
FT                   YEIYATLGECDFNFSIEECEELILKHFKDVSGNLYNMTKQAFDEKWIDYPTRPGKQPGA
FT                   FCENLGWIKQSRLITNYNNTLSDIITVAHELGHAFHGMMIENQPVLNRDYCMPLAETAS
FT                   TFNENIMYNALQKDMNDHDKLLVIDSQLSALCQNILDIYARFQFETLVFEHVEEGFLTA
FT                   DQLCELMKEALLRSFGDGLDPEWLHPYRWITKVHYYIPDIAYYNFPYTFGALFSRGLYA
FT                   LYTKQGKDFIPKYEKLLAATTTNTCEDVAKIADIDLRQETFWNESLQSIVDQMDEFLQL
FT                   AKGE"
FT   CDS             complement(83141..83875)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01040"
FT                   /product="Oligoendopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87900"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCH8"
FT                   /protein_id="CBK87900.1"
FT                   /translation="MKDYLWNLDALYTGYDDPNFIKDFDLMKNLYEEIPTLLQNMESFD
FT                   NKDVIIEGLKTLEIIKDYTYRLKMYAQLRLAVDSNEADNTKWANTTLNLASSLKTYENA
FT                   LLDKILEAPCLKEMIETDAFVHQYKFILLEQLNKKDHKLDSKQEEILSMVYPTSLKAFS
FT                   DMYYALTGNATALYDGKELPLTQVKNMCHDNSSEVRKKAFLAEQEAYKSIATPLSFAIS
FT                   SIKQQQLKEARLRGYKDPLEKC"
FT   CDS             84024..85508
FT                   /transl_table=11
FT                   /locus_tag="EC1_01050"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87901"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCH9"
FT                   /protein_id="CBK87901.1"
FT                   /translation="MRVLVGQFSSESNEHSRSLMTFEKFLFRFGEEMLDSIYCRDIFED
FT                   EGIELVPSISARGHPHGLVTYDAYQFIHDRLMQAVKENLGTIDGIFLFLHGASKVIGLE
FT                   GGSAEHAFIRDIRKIVGPYMPIALVMDPHGNLSQELVDNVNILRCYRHSPHTDMAETYR
FT                   FVAKSFIDLLKNRQNIHPEYCKVPIIIGGEKSVSLDEPMLSINALCDEAEKTGRIRSAS
FT                   FHIGYLRHDGDKLGCSVVVVPQTAKDQKFARVWAKKIRAFAYERRHEFHYHGNVKEPED
FT                   AIKAVVKYPAGTCFLTDSGDNVGSGADGFNTYVLRQILALDDFNNKFYLVAGIVDKAAY
FT                   KYLYNKQVNDEVEFDLGADLDEMCKKVHIKGKIIAKGLADKAYAKREDIGTAITVKFND
FT                   APVCVVVEYDAIQYVDLDQFECSGLDVKDYDVIVVKEGYISDDYNKYGDYCVMSLTQGP
FT                   TYQKVKVLFLDKSCVHASLMTILNWMKFFLMTRKNG"
FT   CDS             85569..85889
FT                   /transl_table=11
FT                   /locus_tag="EC1_01060"
FT                   /product="Phosphotransferase system cellobiose-specific
FT                   component IIA"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87902"
FT                   /db_xref="GOA:D4JCI0"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCI0"
FT                   /protein_id="CBK87902.1"
FT                   /translation="MEGMELVSFQIIASVGAAKSMYMEAMKAAQEFDFEKAEKLIEDAE
FT                   EMFLKGHEAHASLIQKEAGGEPVNPTMLLMHAEDQLMACETCKQMAEQQIIIFKKFQSL
FT                   EK"
FT   CDS             85905..86228
FT                   /transl_table=11
FT                   /locus_tag="EC1_01070"
FT                   /product="Phosphotransferase system cellobiose-specific
FT                   component IIB"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87903"
FT                   /db_xref="GOA:D4JCI1"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCI1"
FT                   /protein_id="CBK87903.1"
FT                   /translation="MKRIYLFCDNGMSTSMMAQRMQEVADKHNLPFECKAFSYKKISSI
FT                   IEENKLDCILIGPQTKFLYDDINRRYGDKTPVMVIDAADYGMMDAEKVLKKAIVAMKKF
FT                   KNN"
FT   CDS             86301..87263
FT                   /transl_table=11
FT                   /locus_tag="EC1_01080"
FT                   /product="glycosylasparaginase precursor. Threonine
FT                   peptidase. MEROPS family T02"
FT                   /function="glycosylasparaginase precursor. Threonine
FT                   peptidase. MEROPS family T02"
FT                   /EC_number="3.5.1.26"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87904"
FT                   /db_xref="GOA:D4JCI2"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCI2"
FT                   /protein_id="CBK87904.1"
FT                   /translation="MYGIIATWRMALEGISEAADMLKKSADAGDSIETAIRAVEDFEFY
FT                   KSVGYGGLPNEEMEVELDAAFMDGDTLDVGCVGAIKDYANPVSIARMLSKEPVNNFLVG
FT                   AGAEKYAHRHGFERKNMLTERAKIHYHNRVKETTENTELKPYSGHDTVGMVCLDDKGHM
FT                   TAATSTSGLFMKHAGRVGDSPVSGSGFYVDSEVGGASATGLGEDVMKGCVSYEIVRLMK
FT                   EGKTPQEACDIAVNTFDKELKKRRGKAGDMSLIAMNNKGEWGVTTNIEGFSFAVATENE
FT                   EPTVYLVKFDENHKQYFEVASKEWMDNYMATRTAPLVRK"
FT   CDS             87275..88387
FT                   /transl_table=11
FT                   /locus_tag="EC1_01090"
FT                   /product="dipeptidase, putative"
FT                   /EC_number="3.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87905"
FT                   /db_xref="GOA:D4JCI3"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCI3"
FT                   /protein_id="CBK87905.1"
FT                   /translation="METEILKKIDEIEEQMIDAIKSIVRIDSVKSEAQPGMPFGKGVND
FT                   ALEATLKLCEELGFETENVDGRMGIAKYGQGEDYIGIIGHLDVVPVGDGWKHEPFGAEE
FT                   VNGRIFGRGILDNKGPVLSCLFALYVLKELNIKLKHPVWILFGTDEESGFEDLEYYLTK
FT                   KKPPIMGWTPDCKYPVVYAERGRAAIRVYADIKHQKEFNHFVNEYLLTSDDHANKLGLN
FT                   IVDEEFGAMQLRGKSLIDCDEDLGFEFVLSYPASITIEEIMDKVKSKLSENLKAECAKN
FT                   YDPVRFEKTGFLCSSLQKAYEKITGFDGTPVTTTGGTYAKLMPNIVPFGPSFPGQKGIG
FT                   HNPDEWMDRKDLMTNAKIYALSLLYLGSGE"
FT   CDS             88389..89141
FT                   /transl_table=11
FT                   /locus_tag="EC1_01100"
FT                   /product="Uncharacterized protein involved in copper
FT                   resistance"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87906"
FT                   /db_xref="GOA:D4JCI4"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCI4"
FT                   /protein_id="CBK87906.1"
FT                   /translation="MKRIVEVCAGSYQDCIAAYKGKADRVELNSALSVGGLTPSVSSLR
FT                   KVKEETNLKVICMVRPRAAGFCYDEDDEMIIMEDAKLLLDNGADGISFGFLNEDGTIKE
FT                   DKTAQMIELVHSYHKEAVFHRAFDVCPDAYEAIETLIRLGADRILTSGQKAKAFEGKDL
FT                   LKDLQEKYGDKIELLPGSGVNATNAIELMEYTGINQVHSSCKSYLSDPTTANNGVSYAY
FT                   LTDEHEMDYDIVNEDLVTKLVEVVKQGA"
FT   CDS             89218..89967
FT                   /transl_table=11
FT                   /locus_tag="EC1_01110"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87907"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCI5"
FT                   /protein_id="CBK87907.1"
FT                   /translation="MNVEKLLNVVVKAGKMLIESGAEIYRVEETMIRLCQSYPDVQIAD
FT                   SFVTGTGIMLSITVDGKTSTRIGRVRSKSVDLNLIDMINSLSRRVSQDPILVDELEKEI
FT                   DRIERKERYSFWITLLFAGVGAAGFAIFFDGNIADSIAAFLIGILIRCVTTLFEKFRVN
FT                   NFFTNVIASAIAVCCSIASAYLYQGIDYNIVIISSIMLLVPGLAITNAIRDTVAGDYLS
FT                   GLSRGTEAFLTALAIAIGAGFMLSILL"
FT   CDS             89978..90457
FT                   /transl_table=11
FT                   /locus_tag="EC1_01120"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87908"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCI6"
FT                   /protein_id="CBK87908.1"
FT                   /translation="MIEVIIKAGISAFLASIGFGILFNIRGKKLILAGLTGAIGGILYK
FT                   YSLYLGMSELVANFLGALGLAIFGEIFARLCKTPVTTFIVCALIPLVPGGGMYYTMLEV
FT                   IQGNVQEALVKGLETLSIAGVLALGILVVSTGTQFYLRTKRAMETYRFDDNFYNL"
FT   CDS             90837..91727
FT                   /transl_table=11
FT                   /locus_tag="EC1_01130"
FT                   /product="aspartate carbamoyltransferase"
FT                   /function="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87909"
FT                   /db_xref="GOA:D4JCI7"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCI7"
FT                   /protein_id="CBK87909.1"
FT                   /translation="MNKNSLLSMQDLSAEQILSILGDAKSFNSSHKDWQLPKHNALVAN
FT                   LFFEASTRTHFSFESAEYQLGCKVADFNASTSSVTKGESLYDTVKTFEAIGYDAVVIRH
FT                   PKDEYFKELENINIPILNAGDGAGNHPTQCLLDLLTMYDEFKDFKGLNVVIAGDIQHSR
FT                   VAASNKQALEKLGANVFFAGPEEWQREGYPTMDFDEACKWADVVMMLRIQRERGASLAN
FT                   MSDEEYLEKYGLNDRRYQMMKENAIIMHPAPVNRGVEIADHLVEAKKSRIFEQMSNGVL
FT                   VRKAVIKRAFGYEPF"
FT   CDS             91736..93007
FT                   /transl_table=11
FT                   /locus_tag="EC1_01140"
FT                   /product="dihydroorotase"
FT                   /function="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87910"
FT                   /db_xref="GOA:D4JCI8"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCI8"
FT                   /protein_id="CBK87910.1"
FT                   /translation="MLVIKNGNVLVEDTLKKVDILIDEGKIVKIAENIEGDHETIDASG
FT                   LTVLPGLVDVHVHLREPGHAQKETIKTGTKAAAAGGFTTVLCMPNVIPFPDNVEDVKNY
FT                   LELIHDQSVVNTYPYACITKKEAGKEVVDMHALKALGIHWFSDDGVGVANDEIMKEAMT
FT                   KANQEDVMIVAHTEDMSYRKPGACVHESEITKAKGWLGIPSACESAQLIRDLEIVKECK
FT                   NAYHACHISAKESVEALKKAKNDGLNVSGEVTAHHLLLEDKDVQGPNWKMNPPLRSHED
FT                   RMSLIEGLENGSLDIIANDHAPHTAQEKNQPMDKAPFGIVSLETSFALLYTEFVVNQKR
FT                   WSLPQLVNWMSKAPAKRFKLDGIGEIKEGNDADIILVDMNHEYTIDASKFESMGKNTPF
FT                   DGWKVACQIKQTFVKGKEVWKKEA"
FT   CDS             93026..95203
FT                   /transl_table=11
FT                   /locus_tag="EC1_01150"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87911"
FT                   /db_xref="GOA:D4JCI9"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCI9"
FT                   /protein_id="CBK87911.1"
FT                   /translation="MPKRTDIHKILVIGSGPIVIGQAAEFDYAGSQACQSLREEGYEVI
FT                   LINSNPATIMTDTTIADRVYIEPINLDFAKRVIYKERPDAILGSLGGQTGLNLVVELHE
FT                   DGILDEYGVEILGTDLLAINRAEDRELFRELMQQIGEPVPHSRIVHTVEEAVEYCQKLG
FT                   YPVVVRPAYTLGGTGGGFADNEEELRSICEAGLKISPVHQCLIEQSIAGYKEIEYEVIR
FT                   DANDNAIVVCSMENVDPVGIHTGDSIVVAPVQTLTDRENQMLRSASLKIIRALKICGGC
FT                   NVQLALDPKSFRYYVIEVNPRVSRSSALASKATGYPIAKISAKLAVGLTLDEILNPVTQ
FT                   SSYACFEPAIDYVVSKFARFPFDKFPAADRHLGTQMKATGEVMSIGRTFEESFLKGIRS
FT                   LEMKVDHLYKGSIAQMDREELEDKMKKCDDERIFVIAQWLRNGYGSETIQKITGMDPFF
FT                   LYHIQKIIDLEKEMTDHPKDVQILRQLKKNGFSDSYIARNWQMSEYDLYQMRKENGIMP
FT                   VYKMVDTCAGEFTSATPYLYSSYEQENESIVSDRQKIIVLGSGPIRIGQGVEFDYATVH
FT                   CVETLRHAGYEAIIINNNPETVSTDFSISDKLYFEPLTTEDVMHVIELERPLGVIVQFG
FT                   GQTAINLADSLVRHGVKILGTSLEDIDRAEDRHEFEAMLKKLDIPQPQGETATTVEEPL
FT                   SSRRRSAIRFWFDQAMCWADVRWRSCTTTRS"
FT   CDS             95212..96228
FT                   /transl_table=11
FT                   /locus_tag="EC1_01160"
FT                   /product="Carbamoylphosphate synthase large subunit (split
FT                   gene in MJ)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87912"
FT                   /db_xref="GOA:D4JCJ0"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCJ0"
FT                   /protein_id="CBK87912.1"
FT                   /translation="MATAVQEISHDAPILVDKYIVGKELEIDAIADGEDVYIPGVMEHI
FT                   ERAGVHSGDSISVYPTQTISQKTKETIIDYGTRIGKGFHFVGLYNIQFIVDRDENVYVL
FT                   EVNPRSSRTVPFLSKITGVPMSYIATQAILGNSIRKQGLTPGYHPEEKGRVFVKAPVFS
FT                   FAKLRSVDTVLGPEMKSTGEALGSDVNLEKALYKALVASGIQIPMHGNVLMTIANEDKQ
FT                   EALQLAKRFANIGYGIYATKGTADLFEKEGLYVHRASKIEEGEKNNVVDIIRNGRVNFV
FT                   INTMSSKENTRADGFLIRRVSAENNISCMTSLDTANALIKVLESLSFSAISMNEMGK"
FT   CDS             96384..97361
FT                   /transl_table=11
FT                   /locus_tag="EC1_01170"
FT                   /product="Predicted phosphosugar isomerases"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87913"
FT                   /db_xref="GOA:D4JCJ1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR024713"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCJ1"
FT                   /protein_id="CBK87913.1"
FT                   /translation="MRKEHAAQIENAIQALKARGEVNEVYFVACGGSQAVLMAGQYLFD
FT                   RESNVPSHVYTANEFVYDTPKNLCERSLVISCSHSGNTPETIAATKLAREKGAMTIALS
FT                   NLEGSELWEAAEFPVHYDWGKDVSDSDKNKGILYGLLFNLLNVLAPNAKWDICLKELEK
FT                   LTELSEEAKAQYATQAKEWAKSQKRDPIIYTIGSGINYGEVYSTAMCWFMEMQWINSGC
FT                   IHSGEYFHGPFEITDYDVPFMLVKSIGNTRHLDQRVEDFASKFTDKLLVLDQKDLHLEN
FT                   VAPEAKQYVAAILSGVVIRLFVEAIAFERGHSLDVRRYMWQMEY"
FT   CDS             97377..98039
FT                   /transl_table=11
FT                   /locus_tag="EC1_01180"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /EC_number="5.4.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87914"
FT                   /db_xref="GOA:D4JCJ2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCJ2"
FT                   /protein_id="CBK87914.1"
FT                   /translation="MSLDLVIFDVDGLMLDTERIWQEVWRDVARDYALADVGASLFMKV
FT                   VGYSGDTVREILQKELQGHCTPDEFLQTARKEGLERLKTQLKVKPGVYDILSFLKQKKI
FT                   KTAVATSTSRLLTEERLKRVGLYDEFSCICCGDEVRNKKPSPDIYLEVLRKTGINNQRA
FT                   LVFEDSKVGITAAYRANIPCIMVPDLKEPEPEQIKMVKQVLPSLKLAVPIIEKMIAQ"
FT   CDS             98055..98606
FT                   /transl_table=11
FT                   /locus_tag="EC1_01190"
FT                   /product="Phosphotransferase system,
FT                   mannose/fructose-specific component IIA"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87915"
FT                   /db_xref="GOA:D4JCJ3"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCJ3"
FT                   /protein_id="CBK87915.1"
FT                   /translation="MGDAFDILMVTHAELSKGYFSAMKLILDINNEDMETVSFEAGEAL
FT                   DTFSEKLAEIIEKKYKDRKIIILLDLPGGTPANMALPFFRIFKIIKIFVSLDIKKTGTK
FT                   TNTKTYKPLLINILNNSHNKAMHVIIFFRIVFPYKVTGITFLTRGICRSAYKIELIRYA
FT                   ILKRKDIQKHLSMIFLLQDA"
FT   CDS             complement(98574..99278)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01200"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87916"
FT                   /db_xref="GOA:D4JCJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCJ4"
FT                   /protein_id="CBK87916.1"
FT                   /translation="MKLKIEHLQKRFDTKEVLKDVTFTFEPGKIYGLLGRNGAGKTTLF
FT                   NCLNQDISVDGGRFYLEDEMGEHDLRLEDIGYVLSTPQVPEFLTAREFLKFFIEINKES
FT                   LQEEKEIDEYFDIVNLEREDRDRLLKDFSHGMKNKMQMLINIIASPKVLLLDEPLTSLD
FT                   VVVAEEMKNILRDLKHDRILILSTHIMELAFDLCDEIVLLSQGELRAVSSTLDEEELKT
FT                   DILRILQEEDHA"
FT   gap             99356..100445
FT                   /estimated_length=1090
FT   CDS             100500..101267
FT                   /transl_table=11
FT                   /locus_tag="EC1_01210"
FT                   /product="birA, biotin-[acetyl-CoA-carboxylase] ligase
FT                   region"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87917"
FT                   /db_xref="GOA:D4JCJ5"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCJ5"
FT                   /protein_id="CBK87917.1"
FT                   /translation="MQAYIDKLNQEEIQSSLPSFYQIKVIDSTASTNSWLSEHTDLPEG
FT                   TVLIADHQTQGKGRNGRSFYSPSNSGIYLSLLLKPKEDKECVLHYTALSALCMCKAIQS
FT                   VYGFSPSIKWLNDIYFHDKKLGGILCEGKLQQERFDSLIIGIGINVHSFIYPEDIASIA
FT                   CAVEDFVPFKKPRNILITSFLESFYDYYTNHHSFLQAYKDHLAYINQTVRILHPQKEYK
FT                   GTILGVDDSFRLVIKKEDGSIDHLSSGEISIRL"
FT   CDS             complement(101231..101557)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01220"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87918"
FT                   /db_xref="GOA:D4JCJ6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCJ6"
FT                   /protein_id="CBK87918.1"
FT                   /translation="MLREAARELKQKKNLLVFPEGTRSKGDTMNEFKAGALLPAYLSKA
FT                   TIVPVALKKAYTLDISSDHTKQLEIEYGKPIRASEYKKISQEDLAKELHDWIQSRIDIS
FT                   PEDK"
FT   CDS             complement(101602..101925)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87919"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCJ7"
FT                   /protein_id="CBK87919.1"
FT                   /translation="MKTSKIIRALPVLPVAWVSSKIYEKKSQLEAQVRLEKWSRFILKY
FT                   LGYDLSVKGIETIPKEETIFLYPIIKVHWIQLLSWQVVRFIWLLSQKKRMKPCLFLADG
FT                   LEI"
FT   CDS             complement(101912..102238)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01240"
FT                   /product="phosphopantethiene--protein transferase domain"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87920"
FT                   /db_xref="GOA:D4JCJ8"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCJ8"
FT                   /protein_id="CBK87920.1"
FT                   /translation="MWIGCDIVNIDRIKDPYKIARRILSEQEYEQFSNYSSNRQKEFLA
FT                   GRFAAREAIIKALPIPLKLKEIVVEPPKEIQYQGYTIQVSIAHDGGFAMATALVQRKES
FT                   HENI"
FT   CDS             complement(102239..102676)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01250"
FT                   /product="3-hydroxyacyl-[acyl-carrier-protein] dehydratase"
FT                   /function="3-hydroxyacyl-[acyl-carrier-protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87921"
FT                   /db_xref="GOA:D4JCJ9"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCJ9"
FT                   /protein_id="CBK87921.1"
FT                   /translation="MLLSNEDIKKIIPHRYPFLLVDKIESIDEETKTIVGIKCVSANEM
FT                   QFLGHFPQQSVMPGVLIVEAMAQTGAVYLLKEEENRGKIPLFAGINKMRFSSVVVPGDV
FT                   LRMKVQFKRMIGGICIAGCEAYVDDKKVAYGEILCALQDVE"
FT   CDS             complement(102652..103914)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01260"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.179"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87922"
FT                   /db_xref="GOA:D4JCK0"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCK0"
FT                   /protein_id="CBK87922.1"
FT                   /translation="MRRVVITGLGVISPIGNDVNALWNSIEEGVCGIAPITHFDTSDYK
FT                   VKLAAEVKDLDMETYFSKRDLKFNDRFTQFARIASKQAMQDAGFDKEISDADRFGCIIG
FT                   SGIGGIESIELASHTLSERGASRVSPFFIPMALANLAAGQVAIDWGLKGATSCVVTACA
FT                   AGSNAIGEAFHRIRDGYEDVMLAGGSEAAITPLAIAGFQSMRALHTGDDAKRASIPFDK
FT                   QRSGFVMGEGAGILILEELEHAKARNAKIYGEIVGYGSSCDAHHITAPLDDGSGGAKAM
FT                   VQALQDACIKAEDIDYINAHGTSTKLNDKTETMAVKAAFKDHAYKLAISSTKSNTGHLL
FT                   GASGAVEAIISIKSLQEGFIPATINYQESDPDCDLDIVANQGRHQDIHYAMSNSLGFGG
FT                   HNASLVFKKMGGLVCCYQTKI"
FT   CDS             complement(103923..104666)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01270"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87923"
FT                   /db_xref="GOA:D4JCK1"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCK1"
FT                   /protein_id="CBK87923.1"
FT                   /translation="MEQVNKTALITGAAKGIGKAVALAFAKEGYNIVINYNGSKEAALN
FT                   TQQEIEALGVKTLVVQADVSDEDQVKTMVEKSIETFERIDVLVNNSGINKDGLMLRMSY
FT                   EDFHKVIAVNLEGTFNCIKHVSRIMMKQRSGSIINMSSVVGIMGNAGQANYASSKAGVL
FT                   GLTKSAARELALRHIRVNAIAPGFIETDMTAKLAEKDKAKMMEQIPLRQFGQPEDVANV
FT                   CVALASDAFKYVTGQTIHVDGGMIM"
FT   CDS             complement(104654..105589)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01280"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87924"
FT                   /db_xref="GOA:D4JCK2"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCK2"
FT                   /protein_id="CBK87924.1"
FT                   /translation="MTTAFLFAGQGSQIVGMAKDFYDHCPSSKELMDNLHCDYDIKKLC
FT                   FEGPQETLNDTAYAQSSIVAASLMILEGLKSKGIKPDVCAGLSLGEYSALCCAGSMDAQ
FT                   TAINIVRQRGILMSNALPQNTTGMRAVLGLDAGKILEICKEVNEKGLVLEVANYNCPGQ
FT                   IVVTGQIEALEMATPMLLEKGARRVLPLSVSGAFHSSLLTPASNQLEEVLKTSSLSLPS
FT                   IPVYHNVDGKVHEYETIEDLIKILKQQICQSVYFEQTIQNMIKDGVDTFVEIGPGKTLT
FT                   GFVRKIDRKVNVFTINTMEDVERMLQTWNK"
FT   CDS             complement(105586..106650)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01290"
FT                   /product="Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87925"
FT                   /db_xref="GOA:D4JCK3"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCK3"
FT                   /protein_id="CBK87925.1"
FT                   /translation="MLRPIKLKDKILEVPIIQGGMGIGVSLSNLASSVRKEGGMGVISA
FT                   AMPGFNEPDFETNSLEANIRALKKEIQKANEVKRGLLGVNIMVASRNYESYVKASVEAG
FT                   ADAIISGAGLPLDLPKYAEDKIMLAPIVSSAKACRLLCRVWDKHHNTTPDFVIIEGQKA
FT                   GGHLGFKKKDLEEGTYQTLEQILKEVLEELVPFEKKYNKQIPVFVAGGIFTHEDIQNYI
FT                   DQGASGVQMATRFIATNECDAHENFKQMILKAKKEDIVYVKSPAGFPGRAIKNEFVKRT
FT                   ETESNQSVSNCLACMLPCTPSSTPYCITRALIRAVKGDMENGLFFCGTSAEKIHEIIDV
FT                   HTLMDQLKGEVKEQ"
FT   CDS             complement(106650..107588)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01300"
FT                   /product="Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /EC_number="1.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87926"
FT                   /db_xref="GOA:D4JCK4"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCK4"
FT                   /protein_id="CBK87926.1"
FT                   /translation="MINQMLNIKYPIFQGAMANIATPEFAAAVSESGALGIIGTGAMNA
FT                   KQVQESIQKIRSLTDKPFGINVMLMNPETDAIMEVIAQNHVPIVTTGAGNPGKYMEMLK
FT                   ASGTKVFPVVASVALAIRMERAGADGIIAEGTEAGGHVNEQTTMALLPQVVDAVNIPVI
FT                   AAGGIADGRGFNAALSLGACGVQLGTCLLASEECPIHENYKNAVLKAKDTDTVVTGRTL
FT                   NTPVRILKNSMSRQYLKLEKAGAEPEEMEKLTLGGLRRAVFEGDMKTGSVMMGQVAGLC
FT                   KEIRPLSEIFEDMMNDSKKQLEELKKKIEEC"
FT   CDS             complement(107569..108561)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01310"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.180"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87927"
FT                   /db_xref="GOA:D4JCK5"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCK5"
FT                   /protein_id="CBK87927.1"
FT                   /translation="MENVKIIGCGYAYGSNYVTNDMLKSVVDTSDEWIQSRTGIKQRTV
FT                   SKNENTSDLAIRAAKKAIEENHIDKHEISLIIVATCTPDNVTPSCACLVQEALGLNEDP
FT                   VMAFDINAACSGFIYALQCASRMLDKGIALVIGAETLSKILDWKDRNTCVLFGDGAGAV
FT                   LIKRCNDGSNMTFYARSKGDKDKALYCAGRSLQPELKNITQEKPYLSMNGREVFRFAIR
FT                   SMPDAIEHVLKEESIDSIDLMIPHQANIRILEYVSKKMKFPMDKMFINLDQFGNTSAAS
FT                   VPLALGQAWQQNKIKENMNLVLVGFGAGFTWAACKIHIEGGKHDDQSDA"
FT   CDS             complement(108543..109478)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01320"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /function="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87928"
FT                   /db_xref="GOA:D4JCK6"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCK6"
FT                   /protein_id="CBK87928.1"
FT                   /translation="MNLKEAQQKINEIKIQQMQIDEKDLDMWNDYQRQIETIQKETIMT
FT                   PWDHVELARRPDRPKAQDYIDLLFDEFVELHGDRKSLDDPAMLCGLGLFHGMPVTILAQ
FT                   SKGKTVEENLKQHFGMPQPEGYRKALRLAKQAEKFNRPIITFVDTPGAYPGKEAEEKGQ
FT                   AQAIADCLYTFSSLKTPVICFVLSEGGSGGALALSVADKIFMLEYAVYSILSPEGFASI
FT                   LWKDGSRAKEACDVMKLTSKDLLEKKVIDEIVPEPFGGAASNLQSVVDKMDLMLKETLN
FT                   ELTKMKTTTLVEKRYEKFRHLGEGSWKMSR"
FT   CDS             complement(109475..110347)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01330"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87929"
FT                   /db_xref="GOA:D4JCK7"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCK7"
FT                   /protein_id="CBK87929.1"
FT                   /translation="MDNLFKERKNRLDVFRKWRKKPIPKAKEIPDHVFMSCSHCHTSVA
FT                   MMDLVSNHYVCPKCHHPFKISARERIRQLIDEGTFKETDAKMISVDPDDFPGYKDKLER
FT                   LQKQTGMKEAVITGTGKIKGLPCVIGVMDSNFFMGSMSAAVGEKITRAIELATKKKQPL
FT                   ILCCTSGGARMQEGILSLVQMAKTSAAMKKHSDAGLLSIIVLTHPTTGGVSASFAMLGD
FT                   IILSEPYALVGFAGKRVIEDTIHEKLPDNFQTAEFVLEKGFIDRIVPREKMKEELGRLL
FT                   SFHCKRSIS"
FT   CDS             complement(110331..111698)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01340"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87930"
FT                   /db_xref="GOA:D4JCK8"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCK8"
FT                   /protein_id="CBK87930.1"
FT                   /translation="MIRRLLIANRGEIAVRIIRACKELGIETVVVYSTADKESLAVQLA
FT                   DQAVCIGPAPAKDSYLNMGLIVQTACSTGCDAVHPGYGFLSENAKFARLVQECDMTFVG
FT                   PNPKLIQMMGDKTQARKLMKEAGVPVVEGCEDALKSVEDAKNMAESIGYPVIIKARLGG
FT                   GGRGMRIVYKAEDLENAYTEARQEAKVCFENDEVYMERYVENPKHIEVQILGDHYGHVV
FT                   HLFERDCSFQRKNQKIIEEAPCTALTRDNREKLLSQAVNAARSIGYDSAGTMEFLMDKQ
FT                   GNFYFMEMNTRIQVEHPVTEAITGVDLIKWQIKIASGQHLTLKQEDIQCHGHAMECRIN
FT                   AEDVAHDFAPSPGPVTFMHVPGGHGVRVDTAVYNGSIISPYYDSMILKLIVSAGNRLEC
FT                   IKKMRASLEETIVSGVKTNIEFNYLTLYQKEFIEGSHDIGYAPILLKRLKENGQFI"
FT   CDS             complement(111695..112120)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01350"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87931"
FT                   /db_xref="GOA:D4JCK9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCK9"
FT                   /protein_id="CBK87931.1"
FT                   /translation="METKQVKEIIEIFEASNLSHMELEEGNLKIRLEKPTGPAQSIPVS
FT                   QIVHTQVEPKPIEDENKIEITSPLVGTFYRAKSPKDKPYVSVGDIVHKGDVVCMVEAMK
FT                   TMNEIQSDQEGIVKEICVEDSSMVEYGQVLIVLGELE"
FT   CDS             complement(112181..112408)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01360"
FT                   /product="Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87932"
FT                   /db_xref="GOA:D4JCL0"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCL0"
FT                   /protein_id="CBK87932.1"
FT                   /translation="MFEDIKKVLIDAINVDEEEIKPEAKLNDDLGIDSLAAVELALELE
FT                   NEFDIRIEDEELAKLETVQDVIDIIEAKKK"
FT   tRNA            complement(113185..113273)
FT                   /locus_tag="EC1_T_21550"
FT   CDS             113406..114656
FT                   /transl_table=11
FT                   /locus_tag="EC1_01380"
FT                   /product="Cystathionine beta-lyase family protein involved
FT                   in aluminum resistance"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87933"
FT                   /db_xref="GOA:D4JCL1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR009651"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCL1"
FT                   /protein_id="CBK87933.1"
FT                   /translation="MILEQIDKELLAMAEESDSVLKDIYQNIDDICLHNSNRVLSAFIE
FT                   NQVSYSDFADINGYGNYDEGRDKIEKIFASVLGCEDALVRPQIMSGTNAIYLTLSALLK
FT                   HGDTMISISGAPYDSLQEMIGIIGESTQSLKTYGVKYEQIDLVNDDFDDDKIIERLKQG
FT                   NVKLIEIQRSRGYSHRLSLTIAKLERIIKKIKEVDPEVIIMVDNCYGELVEKLEPGHIG
FT                   ADVVVGSLMKNLGGGIASTGGYVAGNADLIHMVAERLTAPGIGKDLGANFNLNNSFFKG
FT                   IFMAPSAVKSALKTAVFTAYMLEKLGYKNVSPAYNEERTNIIQTLELGTKENLVNFTQG
FT                   IQATSPIDSFVRVLPAPMPGYPFDEVMAAGSFTQGSTIELSADAPVVEPYTLYMQGGLS
FT                   LEYGKLSILLALTNMNK"
FT   CDS             complement(114678..115424)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01390"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87934"
FT                   /db_xref="GOA:D4JCL2"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCL2"
FT                   /protein_id="CBK87934.1"
FT                   /translation="MNKVVLITGGAQGIGKAIALELAKNHYDIVINYLTSHEAAAKLKE
FT                   EIINTYSVRCLTICADVSNVNQVNQMVSEIEEKLGGVDILVNNAAIDLSNLFHLKTSEE
FT                   FKRTLDVNVVGAFNCAKRVYRHMLEKEYGRIINISSTNGINTYYPMCIDYDASKAALIS
FT                   LTHNLAFEFAPYVNVNCIAPGFIGTENELDGYDEEFLKEEVEKIMVNRYGDPKEVAYLV
FT                   KFLISDEDDFINNTVIRIDGGQKGSC"
FT   CDS             complement(115446..116003)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01400"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /function="translation elongation factor P (EF-P)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87935"
FT                   /db_xref="GOA:D4JCL3"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCL3"
FT                   /protein_id="CBK87935.1"
FT                   /translation="MAISAGDFRTGLTLIVDGDPWQVLDFQHVKPGKGAAILKTKMKNL
FT                   KTGNTQERNFNASTKFEQANISKKAAQYSYQADSTYYFMDMETYDTYELTEDQVGFNKY
FT                   FIVEGAEVQLMFFEGLLLSVSVPEKVELTITETDAAIKGAPSNQTKDAVTETGLSLRVP
FT                   QFIEPGEKIVVFSTDGKYAGRA"
FT   CDS             complement(116078..117307)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01410"
FT                   /product="nicotinamide mononucleotide transporter PnuC"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87936"
FT                   /db_xref="GOA:D4JCL4"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCL4"
FT                   /protein_id="CBK87936.1"
FT                   /translation="MVKFFQKNIEPNKKLRIAEIVILVLLILGSIISYGVGFTKINSDV
FT                   GTISFVQSMEMTRDFEMEDYDGEENAMCDVTYRAGDKELVVTYTYEEYENLDAKTITGY
FT                   EFETSDGTKLYFDHQDVSQAQAQQEYQEIMANQTMPIFNFANASLILVLSLLIMMLFSR
FT                   QFTTYEKSWFMSIMVLATIFSVLFPEESANGVNGIIIMLLYLLDTFLNILCELLISKQS
FT                   RYNFLVSVLVEIVEIAMCVVLMYRFATMATTLFFWLPIDIISFINWSRHKDENEDELTV
FT                   VRRLKGWQEVLVIIGIILWTFVIGYLISGLDIATDFYNNEMLETAIIYIDACASAVGIA
FT                   NGLFIFFRFREQWIAWYICAALEAVINIISGQYVLLILKLGYFTNTTYGYIKWSKYIKS
FT                   HKEEERLSIF"
FT   CDS             complement(117922..118377)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87937"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCL5"
FT                   /protein_id="CBK87937.1"
FT                   /translation="MLPLCEALDISVNELLSGEKLSIINYQEKAEDNMLSLLKENEANR
FT                   KRLFQTIVSIVTTIIASVSLIMMASFLNLNTIIRIFLISIALIIIILSIISIILTDSKT
FT                   GYYECPSCHHQFMPTIHEYVKGYHTFTKRYLRCPKCKKTNLCRRKLK"
FT   CDS             complement(118807..120051)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01450"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87938"
FT                   /db_xref="GOA:D4JCL6"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCL6"
FT                   /protein_id="CBK87938.1"
FT                   /translation="MKQQIYNTALYLRLSRDDELQGESSSITTQRSMLRLYAKEHHLNV
FT                   IDEYIDDGWSGTNFDRPSFQRMIEDIEAGKINCVVTKDLSRLGRNYIMTGQYTELYFPS
FT                   HNVRYIAIDDGVDSEKGESEIAPFKNIINEWVARDTSRKVKSAFKTKFAEGAYYGAYAP
FT                   LGYKKHPDIKGKLLVDEETKWIVEKIFSLAYQGYGSAKITKILREEKVPTASWLNFTRY
FT                   GTFAHIFEGKPESKRYEWTIAHVKAILKSEVYIGNSVHNRQSTVSFKSKKKVRKPESEW
FT                   FRVENTHEPIIDKEVFYRVQEQIKSRRRQTKEKATPIFAGLVKCADCGWSMRFATNKAN
FT                   KTPYSYYSCSFYGQFGKGYCSMHYIRYDVLYQAVLERLQYWAKAVQQDEEKVLNKIQKV
FT                   GNAERIREKKKKAVP"
FT   CDS             complement(121157..122371)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01470"
FT                   /product="Putative phage replication protein RstA"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87939"
FT                   /db_xref="GOA:D4JCL7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003491"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCL7"
FT                   /protein_id="CBK87939.1"
FT                   /translation="MNDKNFIEELRQKREEYGVTQRKLAVACGISRTYFNQIENGTVVP
FT                   SAELKQTIEKQIERFNPQEPLFLLIDYFRVRFPTTDALKIIREVLQLKADYMLYEDFGK
FT                   YGYESKYVLGDINIMCSMQEHLGVLLELKGRGCRQMESYLLAQERSWYDFMLDCLTAGG
FT                   KMKRLDLAINDKAGILDIPKLKEKYKAGECISYFRMQKDYSGTEKCGSDLPKNTGETLY
FT                   LGSTSSELYMCAYQKNYEQYVKNGIEVEDTEIKNRFEIRMKNERAYYAVVDLLTYRDAE
FT                   RTAFSIINHYVRFVDREDDKPKSQWKTNDDWAWFIGENREPIRLTTKPEPYTLQKALHW
FT                   LQRQVAPTIKMVQALDRENHTTILKDMIEQAELKDKHKHLLQLEKSTIEERIDTAVPQE
FT                   NDGIF"
FT   CDS             complement(122691..123158)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01480"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /function="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.-"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87940"
FT                   /db_xref="GOA:D4JCL8"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCL8"
FT                   /protein_id="CBK87940.1"
FT                   /translation="MNTFEGNLVAENIKIGIVVARFNEFITSKLLAGALDNLKRENVGE
FT                   KDIEVAWVPGAFEIPLIASKMAKSKKYDAIICLGAVIRGSTSHYDYVCSEVSKGIAQIS
FT                   LNTETPVMFGVLTTDTIEQAIERAGSKAGNKGSECAQGAIEMVNLIRALEV"
FT   CDS             complement(123159..124364)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01490"
FT                   /product="GTP cyclohydrolase II/3,4-dihydroxy-2-butanone
FT                   4-phosphate synthase"
FT                   /EC_number="4.1.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87941"
FT                   /db_xref="GOA:D4JCL9"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCL9"
FT                   /protein_id="CBK87941.1"
FT                   /translation="MKYQKIKEALQALQEGKLVLVMDDKERENEGDLICSAQFATTENV
FT                   NFMATYAKGLICMPMSESLANRLMLSPMVEDNTDNHETAFTVSIDYKDTTTGISAEERG
FT                   LTARMCVTENVNPFDFRRPGHMFPLIAKNGGALERNGHTEATVDLLRLAGLKECGLCCE
FT                   IMNENGKMMRTPDLIQFSQTHHIPTLTIKELQEYRKVYDLLVECVSVVEMPTKYGNFKA
FT                   HCYINKLNGEHHVALVMGDLNNGNDVLCRVHSECLTGDAFGSLRCDCGQQLDKAMKMIA
FT                   ENGSGVLLYMRQEGRGIGLVNKLKAYHLQDNGMDTLDANLALGFQGDLREYYIGAQILR
FT                   DLGIKSLHLLTNNPDKVYQLEDYGMKISSRVPIEIEANPYDSFYLKTKKDRMGHILNME
FT                   EK"
FT   CDS             complement(124384..125019)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01500"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87942"
FT                   /db_xref="GOA:D4JCM0"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCM0"
FT                   /protein_id="CBK87942.1"
FT                   /translation="MFTGIIEEIGKVERIQKDTCNCKLSIKASKILEDIHLGDSIAVNG
FT                   ICLTVTCFTRQSFTVDVMNETWNRTALSLLRHGSLVNLERAMPMNGRLGGHIVTGHIDG
FT                   TGRISSVRRDKNAVWYQINTQREILNLIVEKGSIAIDGISLTVAKVSKADFSVSVIPHT
FT                   LEQTILKNKQVGDMVNLENDILGKYVQKLIDNSNETELSKELLCRYGF"
FT   gap             126046..127402
FT                   /estimated_length=1357
FT   gap             128346..129946
FT                   /estimated_length=1601
FT   CDS             129950..130426
FT                   /transl_table=11
FT                   /locus_tag="EC1_01530"
FT                   /product="Predicted choloylglycine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87943"
FT                   /db_xref="GOA:D4JCM1"
FT                   /db_xref="InterPro:IPR003199"
FT                   /db_xref="InterPro:IPR005079"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCM1"
FT                   /protein_id="CBK87943.1"
FT                   /translation="MEDGINEHGLAIGLTFVYPKIRGAGFNAGMLVRYLLEKCKNTKEA
FT                   IKHLKMLPIASQQVLIIADSYGDIASVECNNEKMHIVHPSKGNDFVLATNNFYSDELKQ
FT                   YNNLSIDDWKSNERYQVAYSALQQNKNQFSLNLAKNILCGKYGFMCQYDRKKRC"
FT   gap             131185..132260
FT                   /estimated_length=1076
FT   CDS             complement(132725..133039)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01560"
FT                   /product="Predicted pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87944"
FT                   /db_xref="InterPro:IPR011394"
FT                   /db_xref="InterPro:IPR025984"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCM2"
FT                   /protein_id="CBK87944.1"
FT                   /translation="MQKAIQEIIEFNKERDWDQFHSPENLAKSICIEAGELLECFQWNS
FT                   SYDKEAVCEELADVVNYCIVMADRLEVDLEEIVLKKLEKNRQKYPVEKAKGNSKKYNEL
FT                   "
FT   CDS             complement(133178..133576)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01570"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87945"
FT                   /db_xref="GOA:D4JCM3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCM3"
FT                   /protein_id="CBK87945.1"
FT                   /translation="MERKTIEVVAAVIRDNDKIFATQRGYGEFKGGWEFPGGKIEKNEV
FT                   PQQALIREIKEELDTEIEVNDLIDIVEYDYPTFHLKMHCFWASVKKGNLVLKEHEAAKW
FT                   LTKETLYSVDWLPADLGLIETIEKLLTR"
FT   CDS             complement(134126..134302)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87946"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCM4"
FT                   /protein_id="CBK87946.1"
FT                   /translation="MMEQTKINIINLLTNEFATGTGKRHMKNAFLFKQMEMIIVFLNHL
FT                   PNYWKMKRLKNSR"
FT   rRNA            134513..136043
FT                   /gene="16S"
FT                   /locus_tag="EC1_R_21570"
FT                   /product="16S rRNA"
FT   rRNA            136285..139175
FT                   /gene="23S"
FT                   /locus_tag="EC1_R_21560"
FT                   /product="23S rRNA"
FT   misc_RNA        138561..138668
FT                   /locus_tag="EC1_21620"
FT                   /product="Pseudoknot of the domain G(G12) of 23S ribosomal
FT                   RNA"
FT   rRNA            139235..139346
FT                   /gene="5S"
FT                   /locus_tag="EC1_R_21580"
FT                   /product="5S rRNA"
FT   tRNA            140060..140133
FT                   /locus_tag="EC1_T_21220"
FT   tRNA            140140..140227
FT                   /locus_tag="EC1_T_21230"
FT   CDS             complement(141278..142159)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01620"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87947"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCM5"
FT                   /protein_id="CBK87947.1"
FT                   /translation="MLDTLKELQKQKKIRFCISVFMVTLSAFVQVYIMQVFMEPSNLLS
FT                   GGFTGISLLINKILALVGINFPVSVGIILLNAPAAILCYKYVSKRFTFLSCLQFGLVSL
FT                   FLEIFTFEPFIDDQTLNVLFGGLLWGFSISLALRTGGSTGGTDFIAQFVSNKIHKGIWD
FT                   YVFAFNCCMLVIFGAIFGWVHAGYSIVFQFLSTKAISSLYQRYNQVTIEFITSDPDSVI
FT                   DAFMAVVRHGMSVFEGYGGYSQRKIYSCKAVVSSYEVHDAIENVRKVDPKVIVNTYHTA
FT                   NFYGNFYQKPIE"
FT   gap             142201..142502
FT                   /estimated_length=302
FT   CDS             complement(142577..146122)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01630"
FT                   /product="pyruvate:ferredoxin (flavodoxin) oxidoreductase,
FT                   homodimeric"
FT                   /EC_number="1.2.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87948"
FT                   /db_xref="GOA:D4JCM6"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCM6"
FT                   /protein_id="CBK87948.1"
FT                   /translation="MPRAKQSMDGNTAAAHVAYAYTEVAAIYPITPSSPMADSVDQWAA
FT                   AGQKNIFGNQVVVSELQSEAGAAGAVHGSLAAGALTTTFTASQGLLLMIPNMYKIAAEQ
FT                   LPCVFDVSARTVATHALNIFGDHSDVYACRQTGFAMLCETNPQEVMDLSPVAHLAALEG
FT                   KVPFINFFDGFRTSHEIQKIEKWDYEDLKEMCPMDAVEEFRNHALNPEHPTMRGSHENG
FT                   DIFFQHREACNSVYDALPAVVEKYMNKINEKLGTNYGLFNYYGAPDADRVIIAMGSIND
FT                   VAEEVIDYLTAKGEKVGLIKVRLYRPWSSKHLLAVLPETVKKIAVLDRTKEPGALGDPL
FT                   YLDVVTTLREAGLDTIKVCAGRYGLGSKDTPPSSVFAVYTELLKDEPKPRFTIGIVDDV
FT                   TYLSLPEVKPAPITSAPGTVECKFWGLGGDGTVGANKNSTKIIGDHTDKYIQAYFQYDS
FT                   KKTGGITISHLRFGDNPIKSPYYINQADFVACHNPSYVVKGYKMVQDVKPGGVFMINCQ
FT                   WSDEELDKHMPAEAKKYIADNNIQLYTINAIDKAIEIGMGKRTNTILQSAFFKLANIMP
FT                   IDEAVQYMKEAAKKSYSKKGDAVVEMNYKAIDAGVDATHKVEIPASWSNPEPDAAPAPL
FT                   KGRPATVKMVQDIMNPVNIMNGDSLPVSAFKDNADGQWETGAAAYEKRGTAVTVPEWDA
FT                   TKCIQCNQCAFVCSHATIRPFILDEKEAEAAPENIKLADSKHAPGMKYTMSVTPLDCMG
FT                   CGECITVCPTGAIKMVPQESQADQQPVFDYLVANVGKKKTNFADNTVIGSQYNQPLLEF
FT                   SGSCAGCAETSYARLVTQLFGEQMYISNATGCSSIWGGPAATCPYTVNKDSLQGPAWAN
FT                   SLFEDNAEHGYGMHLGQKVLREQAITKLSQMAECENATEEFKAAYDKFMETKEDTRANA
FT                   PAAKALIAELEKAAENGCEDAKEVLTKKQYLAKKSVWIFGGDGWAYDIGFGGLDHVLAS
FT                   GENVNVMVFDTEMYSNTGGQASKASNIGEVCQFAAAGKELKKKSLAEIAMTYGYVYVAQ
FT                   IALGANPAQAVKCIAEAEAYDGPSLIIGYAPCELHGIAKGGMNHCQDEMKKAVKAGYWN
FT                   LFSFNPDKKKAGQNPFTLTSKEGDGSYQEFLNNEARYTRLVKPFPERAEKLFSESEKAA
FT                   KERFEHLQRLVELYK"
FT   CDS             complement(146288..147559)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01640"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /function="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87949"
FT                   /db_xref="GOA:D4JCM7"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCM7"
FT                   /protein_id="CBK87949.1"
FT                   /translation="MIQLDLNHAHLKENVKDYQEQVVSIDKQLVSKTCLGNDFIGWMTW
FT                   ANDYDREEFARIKECAKKIRENSEVFVVCGIGGSYLGARAAIEMINGLYSDKKPEIIYM
FT                   GNTFSSSYIAQVMDYIKDKEVTVNVISKSGTTTETALAFRILKQFMEEKYGDEAKNRII
FT                   ATTDKARGTLKALATKEGYETFVIPDDIGGRFSVITPVGLLPIAVAGIDIDELMKGLHD
FT                   GMGEYGDPDLDKNPAYRYAVARRILQNEGYDVELFVNYEPQMQMVAEWWKQLFGESEGK
FT                   DGKGILPDSVCFSTDLHSLGQFVQEGKKVLFETNLYVDKPMIDVTFPNDEANEDGMNYL
FT                   AGKSVDWANKMAAQGTLMAHEETGGVPNILLTMPDMSAYSFGNMCMFFFKAIAMTTLMN
FT                   DSNPFNQPGVEVYKKNMFKLLGKE"
FT   CDS             147655..148116
FT                   /transl_table=11
FT                   /locus_tag="EC1_01650"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87950"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCM8"
FT                   /protein_id="CBK87950.1"
FT                   /translation="MIPSALYPLVSALLANVVAQVGKTIVYYFKSGKWDLHWVIASGGF
FT                   PSSHSSTVTALSMAVGIQEGFDSTLFAITAIFSFIVMYDACHVRYYSGKNIELVKQLVD
FT                   DLKEASLIEFDEPIYQEQLKSVLGHKFIEVVGGFVVGLIIPLLLTPLIF"
FT   CDS             148135..148386
FT                   /transl_table=11
FT                   /locus_tag="EC1_01660"
FT                   /product="Thioredoxin-like proteins and domains"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87951"
FT                   /db_xref="GOA:D4JCM9"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCM9"
FT                   /protein_id="CBK87951.1"
FT                   /translation="MAEETMEMPDGMAVEACLDKIRPYIQHDGGDIELLGIDEHAYVYV
FT                   AFRGACAGCMMATEDFSSGIKLLLMDEVPGIRDVILVG"
FT   CDS             complement(148483..149394)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01670"
FT                   /product="glycyl-radical enzyme activating protein family"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87952"
FT                   /db_xref="GOA:D4JCN0"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCN0"
FT                   /protein_id="CBK87952.1"
FT                   /translation="MTTSKAYVFDIKRFAVHDGYGIRTTIFFKGCPLRCKWCQNPEGLE
FT                   TKPRVLWFEKNCIHCRLCEKASMPNQMHYDERPYFNKEYSGDFDNLVHICPSSAIRYDS
FT                   TLYTVEELISKIEEDRVFFKRNGGVTFSGGEPFLQKDFLVDILKECKKRGIHTAIESSF
FT                   YANLELVKQVVPYLDLIFADLKVFDETDHKAMTGVSNQKILQNIEYLLTSEHKDKVIIR
FT                   TPLIPGYNATERNLSQISSFISNLYPEIKYELLNYNPLASSKYDLVDMEYEPGKLKPFA
FT                   PDELETFKNIVKEAGIKNIIEV"
FT   gap             150759..152101
FT                   /estimated_length=1343
FT   gap             154607..155480
FT                   /estimated_length=874
FT   gap             156630..158253
FT                   /estimated_length=1624
FT   CDS             complement(159611..159955)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01740"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87953"
FT                   /db_xref="GOA:D4JCN1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCN1"
FT                   /protein_id="CBK87953.1"
FT                   /translation="MRDLYILGFIFFDSKDHRATMSELAAHMNITPAAASQIISGYEKN
FT                   GWVIRTRSEKDRRTVYVEISDKIKEHLKSKWRDNQQFLSDFLDELSPEDLDSLERILNK
FT                   VLDYFEEYYK"
FT   gap             159972..160407
FT                   /estimated_length=436
FT   CDS             complement(160941..163214)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01760"
FT                   /product="valyl-tRNA synthetase"
FT                   /function="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87954"
FT                   /db_xref="GOA:D4JCN2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCN2"
FT                   /protein_id="CBK87954.1"
FT                   /translation="MAKTMDTKYDHLAVEKDIYSKWVEKGYFTAGDLTKKPYCIVIPPP
FT                   NVTGKLHLGHAWDTTLQDILCRYKRLKGYDVLWVSGMDHAGIATQAKVDERLKNEGISR
FT                   YDIGREKFLDRAWEWKEEYASTIRSQWAKLGLSLDYTRERFTLDEGLSKAVRKVFVDLY
FT                   NDGLIYQGERIINWDPEAKTALSNIEVEHKEILGHMYYFKYKVVENGQELVIATTRPET
FT                   MFADQAIFVHPEDERYKEIVGMHAINPANGEELPIMADDYIDMDFGTAVMKCTPAHDPN
FT                   DFALAKKYGLKMPICMNPDGTMNEMCHKYAGMDRFECREALVEDFKKAGVVDHIEEHMH
FT                   QVGHSERTGVIVEPYLSKQWFVKMKPLAEEVLRNQKIEDQKIHFVPSRFEKTFEQWLEN
FT                   IEDWCISRQLWWGHRIPAWTNKETGEMYIGMEDPKDKENWIQDEDVLDTWFSSALWPFS
FT                   TLGWPESTDDLARYFPNDVLVTGYDIIFFWVARMAFQTRYCMKNRPFKDVLIHGLVRDS
FT                   QGRKMSKSLGNGIDPMDVIENHGADALRFFLTTNSTPGLDLRFDEKKMESSWNFINKIW
FT                   NAARYVQMQIGDTKPTLDVDCLSSVDKWILSRMDEVLNHVSMNMEKYEFAMIGNELYSF
FT                   IWNDFCSWYIELSKATLYSEDQAVVQNTKAVLYTVLEAILKMLSPFMPFVTEEIYLDLP
FT                   HDKESMNLETWPGKVNFTYTNEEKDEMALTISAIQAVRETKTEYGMKPSEDLEISLHDE
FT                   QGNL"
FT   gap             164336..164946
FT                   /estimated_length=611
FT   CDS             complement(164973..165692)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01780"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87955"
FT                   /db_xref="GOA:D4JCN3"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCN3"
FT                   /protein_id="CBK87955.1"
FT                   /translation="MKLILKYLKKYKLLFLIDAISVFGFALVELGIPTLISRMIDQGVN
FT                   TKDTSFLWSNWALMSIISIVGVCGTVILGYCSTRISTNVTRDIRNDVFEHAMTFSNAEM
FT                   DKFGVSSMITRTNNDAYQIMLFLNVILRMALMTPVMMIVSIMLIVRISLPLSYIVLLTI
FT                   PFILIGVFAVAKVSEPISENQQNSIDRINKILREHITGIRVIRSFNKEKNEEERFAKEN
FT                   RYYQRESSKLFKLMSCT"
FT   gap             166967..169405
FT                   /estimated_length=2439
FT   CDS             complement(169607..171343)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01810"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87956"
FT                   /db_xref="GOA:D4JCN4"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCN4"
FT                   /protein_id="CBK87956.1"
FT                   /translation="MKLFKHFLQYYKLYKTVFFLDLLCASIISIVDLAFPLILNFCTDN
FT                   LFMQSHSKILSTLGILAIALLALYLLRSVCRYYVSAQGHIMGANMEKDMRKDLFDQYQR
FT                   LSFSYYDRHNTGVMMSRVVSDLFDISEFAHHGPENLFISLVKIFGSFIILYIIYWPLAL
FT                   LLSIVTFIMLVFSYRQNKSMQKVFMDNRRKIGDVNARLQDSLSGIRVVQSFTNEDLEKE
FT                   KFAQSNDAFLASKKSNYYVMGTYHSTNNFFQGLLYITVIIGGGYFIATSDLSPITLATF
FT                   ALYINIFIAPIEVLIEFTEMFQKGLSGFKRFEEVMKEVPDIQDKEGARDLHDVKGDICF
FT                   DHVSFSYNQDENVLNDVNLTIPAGKKVALVGPSGSGKTTLCSLVSRFYDVKGGKITLDG
FT                   VDIREYKVKSLRQCIGLVQQDVYLFTGTIEENIAYGKLNATHEEIVEAAKKANIHDFIM
FT                   SLPEGYDTFVGERGTRLSGGQKQRISIARVFLKDPKILILDEATSALDNESERIIQKSL
FT                   EELSKNRTCITIAHRLSTIRNSNEIVVLDSNGLHERGTHEELMELNGTYARYYQLQFEG
FT                   LH"
FT   gap             172120..173160
FT                   /estimated_length=1041
FT   CDS             complement(173618..174289)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01850"
FT                   /product="FOG: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87957"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCN5"
FT                   /protein_id="CBK87957.1"
FT                   /translation="MDQNFNKVFWDACANGDFAMAASQIKAGADVNYQNGDGRTALMRA
FT                   SKRDRKDVVQLLIDNGADVNLVDNKGKTALMAAAKKGNKTICKALLDAGADVNAKDDRG
FT                   RTALMRAALLGQDRCVEVLLDAGADINAQDEVGRTALMEACIAFKRDTVSMLLERNANV
FT                   NLFDNNGCTALMRAAYGGYPSLVEKLLSYGADKDMEDKQGNVALDYVREHCRAQLEPIL
FT                   R"
FT   gap             175064..176268
FT                   /estimated_length=1205
FT   CDS             complement(177652..177957)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01880"
FT                   /product="Predicted NADH:ubiquinone oxidoreductase, subunit
FT                   RnfB"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87958"
FT                   /db_xref="GOA:D4JCN6"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCN6"
FT                   /protein_id="CBK87958.1"
FT                   /translation="MLYAILMMLVLGAVLGLGLGVADKYLKVETDERVDTVTGMLPGYN
FT                   CGGCGYPGCSGMAEALVSGEMDHIACKPCKDDKKKEIVDYLASTPGPDGNTIKIKG"
FT   CDS             complement(178141..178716)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01890"
FT                   /product="electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87959"
FT                   /db_xref="GOA:D4JCN7"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCN7"
FT                   /protein_id="CBK87959.1"
FT                   /translation="MGELVTLLVTSVLINNVILNQFLGMCPFMGVSKKRSSAIGMGVAV
FT                   MFVIVVAAIVTYGLYYLVLVPLGLEFMDLITFILVIASLVQLTEMFIKKTSPSLYKSLG
FT                   VYLPLITTNCVVLNVCLVNISNHYDFAQMLVYSFGTPLGFALVLYIFSTIRERLDLCDV
FT                   PKPFIGNPIALIVAAIMSMAFSGLAGIV"
FT   CDS             complement(178718..179371)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01900"
FT                   /product="electron transport complex, RnfABCDGE type, E
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87960"
FT                   /db_xref="GOA:D4JCN8"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCN8"
FT                   /protein_id="CBK87960.1"
FT                   /translation="MNRFQNFKNGLLKDNPVFSLYLGICSTLAITTSVNNGLGMGVAVI
FT                   CVLIMSNVIISLVRNITPEEIRIPVYIVIIATLVKIIQMLIEAYAPALNTSLGVFIPLI
FT                   VVNCIILGRAEAFASKHGVLDSALDGLGMGLGYTLAVTSMSLIREVLSTGMINLVNPFD
FT                   ETQVLFNIRILPDDYVISMFSSPVGAFVTFAILAALVSVYKNHADQKVAAKEVK"
FT   CDS             complement(179386..179523)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01910"
FT                   /product="FMN-binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87961"
FT                   /db_xref="GOA:D4JCN9"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCN9"
FT                   /protein_id="CBK87961.1"
FT                   /translation="MILKTKSFVKRSSEEELDTISGATVSSQPVVDAINEASTYVDELK
FT                   "
FT   CDS             complement(179520..179900)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87962"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCP0"
FT                   /protein_id="CBK87962.1"
FT                   /translation="MNKILKLGVFLAVVSAIAGGALAFANEMTAPVIAANNEKTEKAAL
FT                   LQMYPDASESDFEEVEFKSESTTVQKVYKYNDLFIFNMKVSGYEDGTTFLVSINSNDKI
FT                   IDNFLAMSNGDTKGLGSKVLEG"
FT   CDS             complement(179897..181066)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01930"
FT                   /product="Predicted NADH:ubiquinone oxidoreductase, subunit
FT                   RnfD"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87963"
FT                   /db_xref="GOA:D4JCP1"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCP1"
FT                   /protein_id="CBK87963.1"
FT                   /translation="MKFTFHVSPNIKDRFSTQRIMWELTVGLMVIFVISCIYYGNSYGM
FT                   NYAMQAIILLASSLITTLVCEAIFALCTKKKPLDYIKTSFGWVTSIILTMMVPISMTPY
FT                   ALIIATACCIVLGKLLFGGFGNNIFNPAAVGRAIIFASFMGATTDLVTSATPTTVIAST
FT                   YNWLPATSSVLDTFLEQFGGFMGLALGTYPGAIGETFSIAIILVGIYLAFRQVIDWRVP
FT                   VTYLGGIFVLTAIVALLTGIESYHGIPGFIWYPVLHLLTGGVIFGGVFMLTDPVTSPTS
FT                   AGGRVIFALGAAVLTVLIRLKANLPEGCLYSILLMNLFTPMIEYALDGKQLEIKKKVWT
FT                   GFICIAIVGLGVSFYAASSIEPVTKIESEATSMVVDNVPVEHVQEEVSL"
FT   gap             181160..181326
FT                   /estimated_length=167
FT   CDS             182036..183148
FT                   /transl_table=11
FT                   /locus_tag="EC1_01960"
FT                   /product="Membrane-associated lipoprotein involved in
FT                   thiamine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87964"
FT                   /db_xref="GOA:D4JCP2"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCP2"
FT                   /protein_id="CBK87964.1"
FT                   /translation="MKKVSKIKQWLLLSCCFLFLIVCITSYISNRENSSSKTQNITLTD
FT                   VGFDTSIDFQATCSPSEFDQYVTIVRDTFTKYNQLFDQYNSYEGINNVYTLNNEAADSY
FT                   VQVDDDLIECIQQAQKVYSLSSQFDITQGAVLSLWHDAREESIVLNDEGKDGILPDASA
FT                   IQEAMQHTGFDKLEIKNNTIHYLDPELKLDLGGIAKGYTAQKCKEILNENGLVNGFINA
FT                   GGNVVLLSEKSDGWRIGIRNPDQQSSLVRYTTTKDKAIVTSGDYQRYYEISDQRYTHII
FT                   DPQTGYPSNYVQSVTIICNDSTLADGLSTALFNMSYEDGANFISSLQDTYDIGVIWILD
FT                   KEKAITSDIECNDFIIKTTDNIRKDVTLSN"
FT   CDS             complement(183156..183425)
FT                   /transl_table=11
FT                   /locus_tag="EC1_01970"
FT                   /product="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87965"
FT                   /db_xref="GOA:D4JCP3"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCP3"
FT                   /protein_id="CBK87965.1"
FT                   /translation="MSSGDKRVSKGYALRSFCSMHDIDLEEVAAFGDTSNDNDMLKISG
FT                   LGVCLLNGSEDTKAAADIITDKTCDEDGWADYMEKHFISKYIKN"
FT   CDS             183508..184428
FT                   /transl_table=11
FT                   /locus_tag="EC1_01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87966"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCP4"
FT                   /protein_id="CBK87966.1"
FT                   /translation="MKKIISVITSLFLFLGLCGCSKNTSVTLKEDVIFRLEDVMKIQNK
FT                   ESNSIYYYYMAIIENNSDSSYDTSLLSYSLTDDKDENINAIDRYMSTPSSTIASNESTY
FT                   VYGYVGFPNNNQKDIGFYFPKTEDFLSFNAADVREADNTQIQEQGKEKFTLFEDRAMAI
FT                   EVDASKTKADFSNGTTKLSNLQITYINKTDHNIVIPYLEPHGILNGLDLTQYSDKGDFS
FT                   GMSLEDYKKIDFSNDGLAPKTEDYEGTATGYIVYFLEPQKEMTCNIEFTFENVGIDFSD
FT                   KDTNVFTINLISNSFGSTTTFEISY"
FT   CDS             184443..185219
FT                   /transl_table=11
FT                   /locus_tag="EC1_01990"
FT                   /product="glutamate 5-kinase"
FT                   /function="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_01990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87967"
FT                   /db_xref="GOA:D4JCP5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCP5"
FT                   /protein_id="CBK87967.1"
FT                   /translation="MRIVVKVGTSTLAHETGRLNIRHIEKLVKVLSDLKNSGHEIILVS
FT                   SGAIGMGVGKLMLAKRPNDMPTKQAAAAIGQCELMYTYDKLFSEYNHTVAQILLTKEDV
FT                   EQESRRVNFQNTLYRLLELNALPIVNENDTISTSEISVGDNDTLGAIVSCCIKADLLIL
FT                   LSDIEGLYTDDPHQNKDAKLIPIVQNLDEDIMHLGKDKGSMLGTGGMVTKLQAAKIVTD
FT                   HGIDMIICHGSKPENLYDILEGKRIGTYFMGKAVKS"
FT   CDS             185216..186472
FT                   /transl_table=11
FT                   /locus_tag="EC1_02000"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /function="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87968"
FT                   /db_xref="GOA:D4JCP6"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCP6"
FT                   /protein_id="CBK87968.1"
FT                   /translation="MNTQEILIQAKRESNKAPYSTEEKNTALRAMAKALIDHTYDILSK
FT                   NKIDIENAKNKISEVMLDRLYLDASRIQDMAKGILDVSKLPDPTGRILSTHTLENGLIV
FT                   NKISVPMGVIAIIYESRPNVTSDAAALTIKAGSVCILRSGKEAWNSANAIVKALQEGLE
FT                   NVGMSKNRIHLIEDTTRQSSYDLMKANGYVDLLIPRGGKGLIQSVIQNATVPCIETGTG
FT                   ICHIYVDKDANLDKAVKIIENAKTQRPSVCNAEEVCLVHKDIAQDFLPKLKEVLVEQRK
FT                   AQDKIPVELRLDPIAHQIIDGTLATDEDFDTEFLDYILAIKVVDSIEEAIEHIQEHSTH
FT                   HSDAIISENEQAQTKFSSTIDSAAVYINASTRFTDGGVFGLGCEMGISTQKLHARGPMG
FT                   LEELCTYKYIIKGNGQIRE"
FT   CDS             186552..187865
FT                   /transl_table=11
FT                   /locus_tag="EC1_02010"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87969"
FT                   /db_xref="GOA:D4JCP7"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCP7"
FT                   /protein_id="CBK87969.1"
FT                   /translation="MKTKNEKASVFELNGIPSLKEAFPLALQHVVAMIVGCVTPAIIIS
FT                   QVAGLGVHDQVIFVQAALVIAGISTLIQLFPIGRKIGSGLPVIMGVSFAYLPSMQAIAG
FT                   TYDIATILGAQLIGGIAAILVGIFIKKLRKLFPPIVTGTVVFTIGLSLYPTAINYMAGG
FT                   ASSANYGSWQNWLIAFIVLAIVTGLNHFAKGIWKLSSILIGIIAGYIIAACFGMIDFSS
FT                   VTQASMFQVPQFMHFGMKFEFSAILTFVILFTINSIQAIGDFSATTSGGLDRQPTDDEL
FT                   QGGIVAYGITNILGSFFGGLPTATFSQNVGIVATTKVVNRCVLGLAACIILIAGFVPVI
FT                   SALLTTIPQCVLGGATISVFASIAMTGMKLIASQPLDYRNTSIVGLAVALGMGVTQASA
FT                   SLETFPLWVSTVFGKSPVVLATITAIILNLILPKPKDR"
FT   gap             188213..189977
FT                   /estimated_length=1765
FT   gap             190763..191867
FT                   /estimated_length=1105
FT   CDS             192491..192886
FT                   /transl_table=11
FT                   /locus_tag="EC1_02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87970"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCP8"
FT                   /protein_id="CBK87970.1"
FT                   /translation="MYLILACLFALALPLFDYLEYIQFRQAQLTYQYGYLQLAIRPLIL
FT                   PMCSLLLGWFLVHFLGIQKTNRKIFFILVAILIIYIIFISPWCLIPILQLTLPWPAYID
FT                   YLAIIFSQIDFLPAIFVIMGMGLDYTR"
FT   gap             193024..193355
FT                   /estimated_length=332
FT   CDS             complement(193774..194826)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02050"
FT                   /product="methionine-S-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87971"
FT                   /db_xref="GOA:D4JCP9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCP9"
FT                   /protein_id="CBK87971.1"
FT                   /translation="MKTIYLAGGCFWGVQKYFDLIPGVISTTVGYANGHIKNPVYEDVR
FT                   SQKSGHVEALKVDYDENIILLSQLLDAYFEIIDPFSLNRQGNDIGSSYRTGIYYTDKND
FT                   VRIIQETFRLQQAKSAQKIVVEVCPLDSFYPAEEYHQKYLEKNPDGYCHIPKIKYEQIH
FT                   IQEMSSYDKMCRKELFDPSDAYLRSLRKNTNRILNELNHTDNSLKEKRYELFKELFGRV
FT                   GKNLNIKSNFHCDNGYNIYFKDDVFVNVECVFCDVGRIYIGNNVLIGPQVGIYAVNHPL
FT                   DMELRRQGLEYGDDVIIKDNVWIGGHVTINPGITLEENVIVASGSVVTKSFESNVMIGG
FT                   NPARIIKHLK"
FT   CDS             complement(194861..195508)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87972"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCQ0"
FT                   /protein_id="CBK87972.1"
FT                   /translation="MKKILRLVMVLFVSIGLCACSNADEEPQVREVIDNYFTSIQSGDY
FT                   QTAMSYYTADVEDGFGIKDLDEVVEQELTAAALGEDFDNAAKDWLKYTIQNTFDSYNID
FT                   EVTFDSDTATVIVSGKGLDFEQFNSSEFQDSLTTVTNDYVNEHMNEMQDLYLSQGEEAA
FT                   TNQLISNLSNFVFGEMKTYVDNIESKDYKTRFTLVKEDTDWKISNIEHTMSS"
FT   CDS             complement(195601..195891)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02070"
FT                   /product="Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87973"
FT                   /db_xref="GOA:D4JCQ1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCQ1"
FT                   /protein_id="CBK87973.1"
FT                   /translation="MAKFVNRESLAQVLCDNLNISKKDASYAIELIFNEMSESLASDGY
FT                   VDISGFGKFEIFFRKERMGINPVTKERIMIPATKLPKFRPSQTLKNKCNNR"
FT   CDS             complement(195893..196888)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02080"
FT                   /product="glycerol 3-phosphate dehydrogenase (NAD(P)+)"
FT                   /function="glycerol 3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87974"
FT                   /db_xref="GOA:D4JCQ2"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCQ2"
FT                   /protein_id="CBK87974.1"
FT                   /translation="MKTVVIGSGSWGTALAQVLADNKEEVIIYGIEKSEIDDINLNHEN
FT                   SKYFEGVELNPNLKATDDITVVKDADIVLLAVPTFAIEGICLQIDPYLKNNIIVVNVSK
FT                   GFHPETSERMSEVIRRCISKEHLSSVVSLIGPSHAEEVVIRLLTTIDAVSLKEEDAQVI
FT                   QRTFSNNYLRIYTGDDEIGSELGVAIKNVMAIASGILSGLGYQDNTRAALITRGLQEMI
FT                   RYGVFFGGKQQTFMGLTGIGDLIVTCTSIHSRNFEAGYQIGKENDVTNFLKYNKKTVEG
FT                   VRTAKIVHKVAKENNIDMPICEEVYQILFEGKEPKTCANDLMLRELKKEF"
FT   CDS             complement(197218..198207)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02100"
FT                   /product="ribosome-associated GTPase EngA"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87975"
FT                   /db_xref="GOA:D4JCQ3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCQ3"
FT                   /protein_id="CBK87975.1"
FT                   /translation="MIRGTVAIVGRPNVGKSTIFNRLIGERKSIVDDTPGVTRDRIYGT
FT                   VEWLTQSFHIIDTGGIQIEDQPFSEEINMQVDIAIEEADVIIFITSAKEGVMTDDMAIA
FT                   RKLQKSNKPVVLAVNKADNQELQMAVYEFYSLGLGDPMTISGAHGIGLGDLLDKVIELM
FT                   PKKELKPYEGITSFCVIGRPNVGKSSLVNAILKEDRVIVSNIEGTTRDAIDTPFKVDDK
FT                   EYMIIDTAGIRKRGKIYENIEKYSILRAMNAIERSNVVLFVIDGELGIREQDKHVAGLA
FT                   HEAGKGVIIVYNKWDTVDKDEKTMNAIEKKFALNLYTLIMRQLPLQVH"
FT   gap             198547..199389
FT                   /estimated_length=843
FT   CDS             complement(199595..199999)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87976"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCQ4"
FT                   /protein_id="CBK87976.1"
FT                   /translation="MEELPARKEEVEHAQEEGIIFDLLCNPVKVLGDENGWVNGIECVR
FT                   MELGEPDESGRRRPVEIKDSNFTIDIDCMIMAIGTSPNPLIRHTTEGLEVNRKGCFIVD
FT                   DKNMTSRAGIYAGGECGNGSCNSYSGYGSW"
FT   CDS             complement(200032..200934)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02130"
FT                   /product="NADPH-dependent glutamate synthase beta chain and
FT                   related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87977"
FT                   /db_xref="GOA:D4JCQ5"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCQ5"
FT                   /protein_id="CBK87977.1"
FT                   /translation="MPNMSLEKIAMPVQPADERIKNFEEVATGYTAEMAMEEATRCLHC
FT                   KHKPCVNGCPVNVNIPDFIEKVKDGEFEEAYRIISLTSSLPAVCGRVCPQENQCEKYCV
FT                   RGIKGESVAIGRLERFVADYHRENNDAPLTKPESNHHKVAIVGAGPAGLTCAGDLAKQG
FT                   YEVTIFEALHVAGGVLMYGIPEFRLPKEIVQKEISHLKELGVEIVTNYVVGRSDSIDSL
FT                   IESGYEAIFIGSGAGLPNFMNLEGENLKGVYSANEFLTRINLMKAYKEGSATPVQHPKK
FT                   CVVVGGGNVAMDAEDAQDV"
FT   CDS             complement(200934..201776)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02140"
FT                   /product="sulfide dehydrogenase (flavoprotein) subunit
FT                   SudB"
FT                   /function="sulfide dehydrogenase (flavoprotein) subunit
FT                   SudB"
FT                   /EC_number="1.18.1.2"
FT                   /EC_number="1.97.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87978"
FT                   /db_xref="GOA:D4JCQ6"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCQ6"
FT                   /protein_id="CBK87978.1"
FT                   /translation="MYTILKKEVLNPTVTRMIIDAPFVAKRAKAGQFIILRVNEEGERI
FT                   PLTIADSDSEKGTVSIIFQIVGKTTMLLNTLEEGDSLHDFVGPLGKPSEIDGNEKVCII
FT                   GGGVGCAIAYPTAKAFHEAGSDVTTIVGFRNKDLVILEDEFKECSDAYYLMSDDGSVGQ
FT                   KGVVTLKLEELIQSGEKFDKVIAIGPIIMMKFVCELTKKYNIPTVVSMNPIMIDGTGMC
FT                   GGCRLRVGDEIKFACVDGPDFDGHLVDFDEAMSRNRAYMDFEKHEREETCNLLNKEVA"
FT   CDS             complement(201841..202815)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02150"
FT                   /product="Predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87979"
FT                   /db_xref="GOA:D4JCQ7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCQ7"
FT                   /protein_id="CBK87979.1"
FT                   /translation="MKELNWVSLGCGVIAHQLAQAMQKDGRKLYGVANRTYSKAIDFAK
FT                   EYGIEKVYENIDDVFEDENVDVIYISTPHNTHINFLKKALANKKHVLCEKSITLNIDEL
FT                   EMAKKLAEENGVILAEAMTLYHMPLYKKLYDLTHSGALGELKMIQMNFGSYKEYDMKNR
FT                   FFNPNLAGGALLDIGVYALSFVRWFMSEKPDQILSQVRLAPSKVDEQAGILLMNSKQEM
FT                   ATIALTLHAKQPKRGMIAYDKGYIEIYEYPRACKAVITYTEDNHKEVIECGDTKDALYY
FT                   EITDMEQTILTNENVMHIDFTYDVMDMMSQIRESWGLKYPEEM"
FT   CDS             complement(202812..203540)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02160"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87980"
FT                   /db_xref="GOA:D4JCQ8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCQ8"
FT                   /protein_id="CBK87980.1"
FT                   /translation="MDLKQSARDLAIEYLLQEIKKGNLKAGDKLLNERKLSENLGISRV
FT                   PLREAICTLSTLGILEAHQGDGTYVSDSYSEIFSNIIKKYGIFDRSMVDEVFEARSLFE
FT                   ADAARLAARNHTEDDLVKLEQALKKHENALTDYYEEKLKDKDMMELDTEIHLGIAASSH
FT                   NNFILEIVKSIRYVTLQQDYFSEQYTLDHEHFKRSSIMHREIFNAIKEKNEDLAYKKMQ
FT                   EHINEIRLALDIESIRRDIK"
FT   CDS             complement(203999..204133)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87981"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCQ9"
FT                   /protein_id="CBK87981.1"
FT                   /translation="MFLVGSTYWNMVYGKDIGDVLIDDEGMANMRNIGQNMAGLIKQL"
FT   gap             204138..205206
FT                   /estimated_length=1069
FT   CDS             complement(205550..205831)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCR0"
FT                   /protein_id="CBK87982.1"
FT                   /translation="MPNIITHILFTDDVYEKLDDPKYDFLESRLQLMEVGGNGPDFLFF
FT                   HNLNPTSFMKKTPLRKLGMKFIRTLLMIFMQALLPPYKKKKIQKFVRI"
FT   CDS             complement(205824..207203)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02200"
FT                   /product="Domain of unknown function(DUF2779)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87983"
FT                   /db_xref="InterPro:IPR021301"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCR1"
FT                   /protein_id="CBK87983.1"
FT                   /translation="MEKPFSDYWKEYLNIQNAPCGQVGDTNEDTLNLLKNSDVVCSVRF
FT                   EYRNCRTRIPVLMKMEDGYKAIYPHLSAYPKESEAQLMKINIQIAQSAGVHITSNEIIY
FT                   LNKEYIRKDYLDLNEFLLRSDHLFNRRNKPSKTIDECMEQYDFDLDEWIDTVQTLLDSP
FT                   EFTLDRSKKCTTGRRCSYYDDCFDESKLPDDSILFLTTSSHKLQAYANGIRRISDLEPE
FT                   DIEGFKLQYAQYMASKHGIFYDKAALKIWTSMIQYPISYLDFEWDTFAIPPYENMKAFD
FT                   VLCFQYSLHIEDLNHNLSHHDFFDTADCREKFILSLLETIPKKGSILVYNMEGAEKLRL
FT                   KQLGEQFPKYKEQLDQICDRMIDLSKPFECGLFYDNRMRGHYSLKKVLPVFTDEYSYHQ
FT                   LSIQNGLNAVFTYRTFDSALPEQKQVIRQELSNYCEMDTFAEYVTFHGLEKYLKEDDVN
FT                   A"
FT   CDS             complement(207324..208268)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02210"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87984"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCR2"
FT                   /protein_id="CBK87984.1"
FT                   /translation="MNRSAICIKMLMLLKARGKMNTLELAKELETNPRNIREFKKELVT
FT                   AGYNIQEVKGRYGGYYLDEDCLFPSLKLTKDEIDALNESRGIVDSHPEFVGRDFFHSGL
FT                   DKVLCADKDTKSMMHYYVNQTGLALSLQEYNMVQTVQLAMDRKQSVEISYQTLSQKDVS
FT                   TFLLDPYEIIHYKNAYYVIGFSHKRNEYRTYRFSIQRMKQCKLTDKRFLRDSSFNVASF
FT                   IGKESLIKASFIRFEILVKTEFIRMFKEQYWGLDFKEIKKNDGILCTFMAEDPNKIYQQ
FT                   LFLFQDKAKLVAPLDNKNEYCRMVKDILHMYQE"
FT   CDS             complement(208283..209461)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02220"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87985"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCR3"
FT                   /protein_id="CBK87985.1"
FT                   /translation="MFRVPRQYKDKEVLYRRVILFAVVLLMVVLYFEKILQVLLYILSI
FT                   CMPFLFGGGLAFVFNIIANNLMRAGNILFKIEERKIYRVIANILSIVIVLALFLGFVFL
FT                   LVPQIFASLETIINNLPETLNSFYHWAYRTSSSIPSLHNWIQGLDLNVLDFDNLSNWFN
FT                   DFINWIFSGGANNIFGSVYQVISTTFSIVLSTFVALMFSIIVLFNKSTVVKESKGLLRA
FT                   YMPDDIYEKTLHVLRLIARTFTQYIGGTCTECIILGTLVTVGATLLNIPYATLVGIIVG
FT                   VGALVPMFGALIAAIIGALFVATESVQSAVYFMIMFICIQQVEGNFIYPNVVGRSVGFP
FT                   PMYVIVAVTVGASLGGILGIIISIPVCSCIYQLVKEDVVMRLKVKKHSTTSS"
FT   CDS             209594..211222
FT                   /transl_table=11
FT                   /locus_tag="EC1_02230"
FT                   /product="L-glutamine synthetase"
FT                   /function="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87986"
FT                   /db_xref="GOA:D4JCR4"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022147"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCR4"
FT                   /protein_id="CBK87986.1"
FT                   /translation="MKIVDEYFGCDVFSTSAMQKYLPHAVYKQMIGVIEKGQELPREIA
FT                   DIVANAMKDWAMDKGATHYTHWFQPMTGITAEKHDAFITPTGPNSVISDFRGKELIKGE
FT                   PDASSFPSGGLRATFEARGYTAWDPTSFAFVKDKTLYIPTLFCSYDGSALDKKTPLLRS
FT                   IDALNKAAVRLYNIMGHNIKNITVTVGPEQEYFLIDKEMYKKRLDLMVTGRTLFGTDPV
FT                   KGQELDDHYFGNIEERVKAYMEEVDEELWKLGVYAKTEHKEVAPCQFEIAPVYSPVNLA
FT                   NDQNQITMEILQKVANHHGLVCLLHEKPFAGVNGSGKHNNWSFSTDKGENMLEPGDSPK
FT                   DNIRFLITLVAIIKAVDEYQDLLRVSVATAGNDHRLGGHEAPPAIISIYLGEELTAILE
FT                   AIEKGDEYIDTINKKLELGVSALPPISRDSTDRNRTSPFAFTGNKFEFRMLGSAINISC
FT                   PNTILNTIVAEEMTQFADELECYSEEELNDAIIRLIRKTIKEHKRIIFSGNGYSPEWRK
FT                   EALSRGLLELKNTAETLPHYTNPKT"
FT   gap             211309..212463
FT                   /estimated_length=1155
FT   CDS             complement(213216..214787)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02250"
FT                   /product="Phosphoenolpyruvate synthase/pyruvate phosphate
FT                   dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87987"
FT                   /db_xref="GOA:D4JCR5"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCR5"
FT                   /protein_id="CBK87987.1"
FT                   /translation="MVAEGLLTKEEAILNVDPSQLDALLHPTFDGAALKDAQVITRGLP
FT                   ASPGAATGKVVFNAEDAKRAANAGHRVVLVRLETSPEDIEGMAAAQGVLTVRGGMTSHA
FT                   AVVARGMGTCCVSGCGDIKVNEEEKYFTVNGLKFTENDYISLDGSTGNVYGEEVRTVPA
FT                   KIVGDFETFMSWADEFRKLKVRTNADTPRDAKKAYEFGAEGIGLVRTEHMFFDGDRIKA
FT                   IREMIVSKTVEQREKALAKLLPMQRGDFEKIYEAMHGLPVTIRYLDPPLHEFLPTEEED
FT                   IIALANEMNMGVADLKAVISNLHEFNPMMGHRGCRLAISYPEIAKMQTQAVIEAAINVN
FT                   ERKPHYHIVPEIMIPLVGDKNELAYVKKIVKETADQIIADKGVELTYKVGTMIEIPRAA
FT                   VLADEIAEEAEFFSFGTNDLTQMTYGFSRDDAGSFLQDYYDKKVYEQDPFARLDQKGVG
FT                   KLVKMAATLGRQTRPDIKLGICGEHGGDPSSIEFCHKVGLDYVSCSPFRVPIARLAAAQ
FT                   AAIRNK"
FT   CDS             complement(214802..215842)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02260"
FT                   /product="Phosphoenolpyruvate synthase/pyruvate phosphate
FT                   dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87988"
FT                   /db_xref="GOA:D4JCR6"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCR6"
FT                   /protein_id="CBK87988.1"
FT                   /translation="MAKKYVYNFHEGNGSMRELLGGKGANLAEMMNLGMPVPYGFTVTT
FT                   EACNQYYADDEKISVGIIAEIMNHLRDLEEESGKEFGSPENPLLVSVRSGARASMPGMM
FT                   DTILNLGLNDEVVEGLATLTNNPRFAYDSYRRFIQMFADVVMGLSKAKFETVIDEIKEA
FT                   KHVKLDTELDTDDLKLMVKKFKEFYCEQLHDDFPTDPKEQLILAVEAVFKSWENPRAQY
FT                   YRKMNDIPSSWGTAVNVQMMVFGNMGETSGTGVAFTRNPATGENKLYGEFLMNAQGEDV
FT                   VAGIRTPQTIDHLKDIMPKAYEQFVDITKKLENHYKDMQDMEFTIENEKLFMLQLVMVN
FT                   VLLLLL"
FT   CDS             complement(215943..216407)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02270"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number="1.20.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87989"
FT                   /db_xref="GOA:D4JCR7"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCR7"
FT                   /protein_id="CBK87989.1"
FT                   /translation="MVIIYTSPGCASCRKAKQWLKDNNIEFVEKNIFTSLLNEKEIKYI
FT                   LSRCENGTEDIISVRSKAFQSLKKGIDDLSTKELVELIQKNPSILKRPIMLSKKSLVVG
FT                   YDDDEITMMMPSDLRKVCEETCNDSCPNYEVCGKLRVEEVQPTMNVNLQQ"
FT   CDS             216567..217556
FT                   /transl_table=11
FT                   /locus_tag="EC1_02280"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /function="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87990"
FT                   /db_xref="GOA:D4JCR8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCR8"
FT                   /protein_id="CBK87990.1"
FT                   /translation="MERMLSGIKPTGRLHLGNYIGAISQFVKYQDEYEMYIFIANQHAI
FT                   TVPTDPKALRQNTKDLIALYLAAGLDPEKCTLFLQSDVDAHVKLGWVFTCLTYMGELQR
FT                   MTQYKDKTAKGETGITDGLFTYPCLMAADILLYDADYVPVGQDQKQHVELTRHLAERFN
FT                   NRYSETFVVPQPLETKVGKKIFSLQDPTKKMSKSETDTKGTIDLLDDPAVARKKIMSAV
FT                   TDSVGIIQYDPESQPGLANLLTIQSVLANEPIEDIVKRYEGKGYGELKKEIGQTVFDFL
FT                   TDLQAKYKKIIESNVIDQILEEGAKKASYVANKKIRKVYKKIGFTITK"
FT   gap             217934..219126
FT                   /estimated_length=1193
FT   CDS             complement(219359..220360)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCR9"
FT                   /protein_id="CBK87991.1"
FT                   /translation="MSEELTYEQKLNIVKELSSCYDEKDNIEICDHEKMKYIMDYKLNI
FT                   DLEIIKGIFESDFKKTKIEDDDSEDDIFDTATSILNGFYEKHPFLIPFVGKNYSKAKPQ
FT                   YLYVLESHYLPNSSSFYELHYNKLDTEDKKNKWLKEQWYEKDFKWSNLKQFNVNNAESS
FT                   EKEEIFLHREDIEYMWTESVVKNNIKYNNRFIALFENMLNIKKEEIERAVKSIAFMNYF
FT                   LRPSEDTGVSIKYEYIDSLFSYLNLIRVWEALGKPYIIICSAKVRNSFKGYWEKHNTIL
FT                   DNSENQIPEDNLCLCNHPSNMSWKRKIDGYKNNEEKLKTFIESVENSDSKNT"
FT   gap             221015..221547
FT                   /estimated_length=533
FT   CDS             221557..222012
FT                   /transl_table=11
FT                   /locus_tag="EC1_02320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87992"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCS0"
FT                   /protein_id="CBK87992.1"
FT                   /translation="MNSLEKTIHDKLYTENIFNFINIDISSLNPYKQFMFFKQFAKNKI
FT                   RYRVIRLEALMIFLTLHQEKYGNKKNLNIFFLDSRDDYDLSSIPFEIRNMVNYSYLLSI
FT                   FKNIKIPFPYVFLNPSVYLPRKSYPFFIDIINEINSSKMNKILIIHA"
FT   CDS             complement(222636..222956)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02340"
FT                   /product="Uncharacterized bacitracin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87993"
FT                   /db_xref="GOA:D4JCS1"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCS1"
FT                   /protein_id="CBK87993.1"
FT                   /translation="MDFIFNLIKAFFLGIIQGIAEWLPISSTGHLIIFDTIWPLTPAAF
FT                   FEVFKVVIQFGSILAVLFLYFRKLNPFDPEKSSKKKRETFHLWKLVIIGCIPAAVIGLF
FT                   SR"
FT   CDS             complement(222962..224272)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02350"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87994"
FT                   /db_xref="GOA:D4JCS2"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCS2"
FT                   /protein_id="CBK87994.1"
FT                   /translation="METVLVIGAARSGIAVSKLLQKNGYHVILTDSNEVKEKMDLEALG
FT                   IEVVDNGHPDWLLEKDYPFVVKNPGIPYRVPIVKHFQEAGVPIYTEIEIAYRFAPGFKY
FT                   AAVTGTDGKTTVTTLLYEMLNAKEKALVAGNIGTPLSELALIHQEETFNVALELSNFQL
FT                   LGIDTFQPKISVVTNLAPDHLDYMDSLEEYYQSKMLIYKNCNSQDWFIRNIDDENIVKY
FT                   AQNIPCQVINFSLTQEADLYKDDTFAYLKDEILFKLSDLKIVGDFNCGNAMMAACMAYK
FT                   MGIDLETIQSVIRSFKGVEHRIEYVNTINGVRFYNDSKATNTHAACAALSAFDKNVILL
FT                   CGGKDKHISFDDLKQYDHKIKHCFSFGQTKDHFKSIFTNQTSCQTMKDALDHAIEIIEE
FT                   GDVILLSPACSSFDQFKNYEIRGEIFKDLVEEIAKRG"
FT   CDS             complement(224274..225254)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02360"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /function="Phospho-N-acetylmuramoyl-pentapeptide-transferas
FT                   e"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87995"
FT                   /db_xref="GOA:D4JCS3"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCS3"
FT                   /protein_id="CBK87995.1"
FT                   /translation="MEFSNGFYMIIGFILCLVLMFVIMPPMINYLHKIKFGQTEREEGL
FT                   ESHKKKNGTPTMGGIAFILVPVVVYFLMNLFTPFKLDMNTGIILLAFVGYGLIGFIDDY
FT                   IIVVKKDNEGLKPAYKFALQSILAVIFFFIYQTSSSTEIWIPIIDVTFDLGYFYFILVF
FT                   IMFTAETNAVNFTDGLDGLCSGQMIIALIPFLCFALIQGVDNVAFLIVLVIASLLGYLK
FT                   FNKHPAKIFMGDTGSLALGGLIAAIAMVLKQEILLVIIGFVFVAEVLSVIIQVTYYKKT
FT                   HKRIFKMAPLHHHFEKCGWSETKVVTRFWLVGVVLAVIGLILGVM"
FT   gap             225291..226140
FT                   /estimated_length=850
FT   CDS             complement(226401..226616)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02380"
FT                   /product="Thiamine pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87996"
FT                   /db_xref="GOA:D4JCS4"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCS4"
FT                   /protein_id="CBK87996.1"
FT                   /translation="MKKALLITPMSKNIIQDDSYDYIGVDSGALLLMEAKIPMRFAVGD
FT                   FDSMTEDEFQRLQGTCQIIRHPVTKK"
FT   CDS             complement(226613..227269)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02390"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /function="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87997"
FT                   /db_xref="GOA:D4JCS5"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCS5"
FT                   /protein_id="CBK87997.1"
FT                   /translation="MERIIAPSVLSLDYSKMTEQIEQLNQSKAKWLHFDVMDGHFVPNI
FT                   TFGPDILKGFRKASPLFMDVHLMISDPEYYAPIFVKAGADMITFHVESFDNDTDKCLAF
FT                   MQKMQDLHVQVGFTLRPATPIEPFEALLEKADMVLVMSVNPGFGGQSFMDDQLDKVRWL
FT                   YKKREEKQLNYRIEIDGGINHETYKKACDAGCDTLVAGSYVFKNDIVSTIEGLLK"
FT   gap             227351..228182
FT                   /estimated_length=832
FT   CDS             complement(229183..229938)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02410"
FT                   /product="Serine/threonine protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87998"
FT                   /db_xref="GOA:D4JCS6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCS6"
FT                   /protein_id="CBK87998.1"
FT                   /translation="MRAFGNTDIGCTRKVNEDDYCILQNENGDWLAAVCDGIGGSAAGE
FT                   VASHLAVSKLREAFLKAPVFKKDSQVNDWIHDTLNKANDAIYLESMRNRKERGMGTTCV
FT                   GMIYANNATYIFNVGDSRLYAYYSDGLIQMSEDHSVIAKLIKEGKIKPEEAKSHAQRNT
FT                   LTNALGVWRVFRIDTNKIDSNYRYILICSDGLHGYVSYEEIQAIIDSSAYNLTDKVNAL
FT                   ISRANQSGGYDNCTVILMENERYQDGSND"
FT   gap             230353..231783
FT                   /estimated_length=1431
FT   CDS             complement(233957..234826)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK87999"
FT                   /db_xref="InterPro:IPR029433"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCS7"
FT                   /protein_id="CBK87999.1"
FT                   /translation="MLKYNKEELVKIAVTGCVDHPRVKGYYVGYDGKGRMPIGTGGIVY
FT                   SHAIGDCCMNIAGDHIEPGISLANPSDKENHALETFACVGNEAKIINGPMKSKTGYVTG
FT                   THGGVDHTMVYMDKEVLEEMDSNETILVKAYGQGLKLLDYPEIHMMNIDPDLLTAMPIL
FT                   EEEGKVSFPVVTSVPSYLMGSGLGSSTLMEGDYDIMTQDERANEIHGLNDLRFGDFVAI
FT                   IDHDCHYGPHYYKGAVSIGVVVHSDSFTSGHGPGLCVVATSKLGNITYRIEEDANLKTY
FT                   MKHIKRSV"
FT   gap             234953..235735
FT                   /estimated_length=783
FT   CDS             complement(236683..236817)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88000"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCS8"
FT                   /protein_id="CBK88000.1"
FT                   /translation="MSTVNSGFIVRGIFNGKINSITTGDFGLKMNIQGLTFSNLSYAS"
FT   CDS             complement(237140..237475)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02490"
FT                   /product="ribosome-binding factor A"
FT                   /function="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88001"
FT                   /db_xref="GOA:D4JCS9"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCS9"
FT                   /protein_id="CBK88001.1"
FT                   /translation="MTVKNERLDMILQREISNILQFDLKNPKLGFVTVTDVQCTRDLSQ
FT                   AKVYVTFLGKQERNDAGMKILKQSKGFIRSTLAKRMTIRKMPDLIFIQDTSLEQGNRIE
FT                   RILKDIQ"
FT   CDS             complement(237478..238122)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02500"
FT                   /product="Translation-initiation factor 2./Elongation
FT                   factor Tu domain 2."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88002"
FT                   /db_xref="GOA:D4JCT0"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCT0"
FT                   /protein_id="CBK88002.1"
FT                   /translation="MSLEDLAKKIDEGDVKEINVLIKADVQGSAEALKASMERLEVDTV
FT                   RVNVIRSTVGTITESDILLASASNAIIYGFNIRPSAAIRKKAEEEGIEIRLHNIIYKAL
FT                   EELESAMKGMLAPVYEEVVIGQAEVRQIYKVSKVGTIAGCKVVDGHIKRDCKVRLIREG
FT                   IVIYDGKLGSLRRFENDVKEVQNGFECGMTIENYNDIKVDDIIEAYEDQEV"
FT   CDS             complement(238077..239318)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02510"
FT                   /product="small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88003"
FT                   /db_xref="GOA:D4JCT1"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCT1"
FT                   /protein_id="CBK88003.1"
FT                   /translation="MPNNNRPRRKPSKKGPNKHKNTNSAPRKVEAVKEITYSDSLTVGQ
FT                   LANLLHKNSSEIIKFLFMMGNMSTINTVLSDDDIELICMEFGVVVHKEVIIDEDDIEEQ
FT                   IGNIEEDDSKMVPRPPVVTIMGHVDHGKTTLLDTIRKTNVTSGEFGGITQHIGAYQVSL
FT                   KGRKVTFLDTPGHEAFTAMRARGAQVTDIVIIVVAADDGVMPQTKEAVDHAKAAGVPIV
FT                   VAVNKIDKPGANPDRIMSEMAELGIMPEEWGGDTIFMNVSAKQGTGVSDLLETVLLVAD
FT                   MAELKANPDQLASGTVIEAKLDKGRGPVATLLVQRGTLHSGDSIVVGTSYGRVRKMTND
FT                   KGMEIKKAEPSCPVEIIGLNDVPRAGDVFMAYDNYKKAQEIASHRLEKQIEKSAMQQAL
FT                   CLWKILPRRLMKVT"
FT   CDS             complement(239683..239871)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02530"
FT                   /product="Predicted nucleic-acid-binding protein implicated
FT                   in transcription termination"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88004"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCT2"
FT                   /protein_id="CBK88004.1"
FT                   /translation="MRKIPMRKCVVTQERFPKKELIRVVRTPESEVVVDLTGKKNGHGA
FT                   YVQKSEETILKAKKIKH"
FT   CDS             complement(239880..241517)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02540"
FT                   /product="transcription termination factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88005"
FT                   /db_xref="GOA:D4JCT3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR028620"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCT3"
FT                   /protein_id="CBK88005.1"
FT                   /translation="MKLKVDTLQKALQGIENDRQLSSEIVEDALREALTKAYRKHIEIP
FT                   DAYVEVVIEDGIIHIYHQRKVVEDVEDDELEISLEDARKVNKNIQLDDFVNEEVDFTTF
FT                   DRAAVVLAKNVMKQKIREAEKAQVYEEYCDKLDEMVLGVVETVEEKFVIVNIGKTLAML
FT                   KKSQQIPTEKYYEGQKLLVVITEVNKETKGAQVLVSRATPVFVRRLFEREVPEIYNGII
FT                   EIKAIARDPGERCKIAVYSHNENIDPIGACIGPRGSRVQTIINELNGEKIDIFEWSDNI
FT                   SELIENALSPSEAVAVIPNENVKDGLIVVVPDSQLSLAIGKRGKNARLAVKLSNRKIDI
FT                   KSESEMQELGIDYMTIAKELQEEYEAKKAKERAYKQQQKIEELKHSEIEIENVDVADFD
FT                   YDDDIDTTTYEEVEGPIHQNTTTLFEKERETELDEMEEAARIAKEKRKEKTAADIKEYT
FT                   SKFENFADASNKSEQVVSKPKKKVEEAHIETKDEQKEEELQKKKAMFEQMKPIYSEEEL
FT                   AEIEEAEYEEENAWDDDVDYEEYDEYYD"
FT   CDS             complement(241529..241993)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02550"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88006"
FT                   /db_xref="GOA:D4JCT4"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCT4"
FT                   /protein_id="CBK88006.1"
FT                   /translation="MNLDILKEWIEPVLNEKDCVLYDIEWLTNQNPPILQISVEKQDGT
FT                   MDLDTCAMCSDVIGTLLDNKDWYTKEYMLEVCSPGAERELKTDQQLRDAIGKYVYVKLI
FT                   DPKQGLDQVLGDLKEVNDDSIIVAYKEKTRNKTIEIDRNNINVIMTAVKL"
FT   CDS             complement(242099..242632)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02560"
FT                   /product="ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88007"
FT                   /db_xref="GOA:D4JCT5"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCT5"
FT                   /protein_id="CBK88007.1"
FT                   /translation="MKVNIVGKNITATPGISEKIQKKLNTLAKYFIIGEDDTANVLVRT
FT                   YPTKQKIEVTIPTKHAILRAEVIDDDLYSAIDKVVDKLEDQIRRQKTRLTRKNKESLAA
FT                   AFIDHEIFNEYNEEEDELVKTKSIVPVEMSLDEAIMKMELLGHDFFIYTDDETEKIAVV
FT                   YRRHNGGYGLIETE"
FT   gap             243345..244268
FT                   /estimated_length=924
FT   CDS             complement(245129..245797)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02600"
FT                   /product="Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88008"
FT                   /db_xref="GOA:D4JCT6"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCT6"
FT                   /protein_id="CBK88008.1"
FT                   /translation="MSDIAKKQKIDSIDYVVKVSKRKGIRMSIAPGGELVVHADPFCSD
FT                   DTIKQFVKQYTDKIKVQSHSGMIRLFGKSFKIKKAQGQTNHITTCEDEIIIQTKPSADA
FT                   ILVFKEFLNRYAKEVFEDIMDMTLLRFKEYSLNKLTLKVRTMKRSWGICHPESNYITLN
FT                   FELVHYPVEFVEYVICHEFVHLLEPNHSKQFYEILSKVMPDYKRRLDLIEEGKEKQYLM
FT                   "
FT   gap             246150..247014
FT                   /estimated_length=865
FT   CDS             complement(247102..248340)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02620"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /function="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88009"
FT                   /db_xref="GOA:D4JCT7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCT7"
FT                   /protein_id="CBK88009.1"
FT                   /translation="MNLFEELEWRGLVDNITSPEVKDAINNEKLTFYIGTDPTADSLHI
FT                   GHYSSLLMAKRLEKHGHHPIMLVGGATGFIGDPKATGERNMLTQETLKANYDALHEQIS
FT                   KLWGFEMVNNLDWTKDISVIDFLRDYGKFFNVNYMINKETVKKRLDTGISYTEFSYMIL
FT                   QSLDFLHLYQEKNCTLQIGGQDQWGNITSGLELIRKKCGADVKCYGLTMPLITKADGTK
FT                   FGKSESGTVWLDASKTSPYELYQFLFNTDDRKVIEYLKKLTFLTREQIEELEVSLQNEP
FT                   HKRLAQKTLASEVVRDLHGQEGLDCALKITEALFKGKIQELTDDQKLDAIRNMEKLHCE
FT                   QGKTLLETLVESGIASSRREAREWIKGNSIMVNGTKITDPDYMMTPDNHCVCVKNYSII
FT                   RRGKKNYYCLELK"
FT   CDS             complement(250213..250947)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02640"
FT                   /product="Leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88010"
FT                   /db_xref="GOA:D4JCT8"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCT8"
FT                   /protein_id="CBK88010.1"
FT                   /translation="MFPYPSGVGLHAGHPEGYTATDIVCRMKRMQGYNVLHPMGFDSFG
FT                   LPAEQYAIQTGNHPDGFTKHNIEVFTKQLKMLGFSYDWTKEVSTCDPDFYKWTQWIFKQ
FT                   LFEDGLAKCVEMPVNWCEELGTVLANDEVVDGKSERGGYPVVRKNMRQWVIDIVKYADR
FT                   LLEGLDEIDWPESTKEMQRNWIGKSIGAHVDFKVAGHEESFTVFTTRCDTLFGATYCVL
FT                   APEHRLIDMITTEDKKDRSRSV"
FT   CDS             complement(251078..252052)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02650"
FT                   /product="phosphotransacetylase"
FT                   /function="phosphotransacetylase"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88011"
FT                   /db_xref="GOA:D4JCT9"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCT9"
FT                   /protein_id="CBK88011.1"
FT                   /translation="MIINELEKKVTGSGTRIVFTEGWDPRVQEAAIKLVENNIVVPILL
FT                   GEPEEIEACAKENGFDVSNIQQMSPKSFDKMEEMATKMVELRRGKLDMETCKKMLQHTN
FT                   YFGTMLVQMGYADGLLGGATYSTADTVRPALQLVKTAPGNALVSSCFLLVKGDQQYIMG
FT                   DCSININPNADELVEITMQTAHTAKQFGIDPKVALLSYSSMGSAKGECVAKMTEASLRL
FT                   KRMPIDFEIDGEMQFDCAVSPEVAALKAPDSKVAGHANTFIFPNLSSGNIGYKIAARLG
FT                   GWEAIGPVLQGLNAPINDLSRGCTAQEIYKMAIVTAAQKFLDI"
FT   CDS             complement(252226..253074)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88012"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCU0"
FT                   /protein_id="CBK88012.1"
FT                   /translation="MEKRSKRRRNSEEIQDLGLDLDEEIIDEEDEAEEDLEVEIEEVEE
FT                   DSIDSDFREMPKVRIDADTGNNGHKHLSSQKGSNQNLKWVLVCILCIVLGVVIYGGYKV
FT                   FFSGNEEDKTSEINNQKDDATVVENQDTEGPSFIGFLDRVVINLNAVDVDYSKYYLAID
FT                   NDQQMQVTVTGDVNLAAEGEYPITVSATDQAGNTTTHNAVVQVISEDTMVAIPLELTPM
FT                   IDGSIPMAPDTKQRVDANVILYYYGEVSQEIKDEIARLGLDVSGYHLDTYWHPNDLNVA
FT                   Y"
FT   gap             253296..254179
FT                   /estimated_length=884
FT   CDS             complement(254971..255237)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88013"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCU1"
FT                   /protein_id="CBK88013.1"
FT                   /translation="MKNDIIKRILSIVFSVVLVGCSLFLMYELIQLNVLPSKFLFIVVA
FT                   IIFLIDTIIVLLLNFYSNKLVSKVILIVVAIVISFGSGFGGYY"
FT   CDS             complement(255284..255523)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCU2"
FT                   /protein_id="CBK88014.1"
FT                   /translation="MRMRFEFIILDCPPVLSVSDCIPVSHVSDGTLFVISSKDTDKNEA
FT                   KTALQQLQRNVANVLGAVLNKVDQANESAYYSYY"
FT   CDS             complement(255540..255965)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02710"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88015"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCU3"
FT                   /protein_id="CBK88015.1"
FT                   /translation="MKKVENKSNKSQQFDEMEVYRHLRTNIEYSSVDKKIQVINITSSQ
FT                   PGEGKTTTSTNLAIVSSGQYGRVLLVDCDMRKPQVHKRFNISNRFGLSNILAGDNVNIS
FT                   DSYFSKFKDKDTDGVLYVLPAGVKVPNPLELLSSRKI"
FT   CDS             complement(255968..256483)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88016"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCU4"
FT                   /protein_id="CBK88016.1"
FT                   /translation="MIDNKLFFTLANSKYLLCEFNVRENIGSTSRVEDRLYELCIRDYV
FT                   PLVAHVERYFHNGIDLDRVHNWIDMGCKIQVNRTSILGLQGKVVQKNALCLLESGIVHI
FT                   VATDTHRTTGSRIPRLSDVYEFIEERFGEDNARILTYENPLHIIEDEDLDDMIKIEKRK
FT                   HLFFRRDR"
FT   gap             256487..257199
FT                   /estimated_length=713
FT   CDS             complement(257767..258423)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88017"
FT                   /db_xref="GOA:D4JCU5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCU5"
FT                   /protein_id="CBK88017.1"
FT                   /translation="MYTIKELYSLEHSLAGDYLSQFEYPWQALAGIKEFIVSLGKTLDS
FT                   SYEEVKENVWIHKSANVFESAYIGAPCIIGPETEVRHGAFIRGSALVGANCVVGNSVEL
FT                   KNVILFDNVQVPHYNYVGDSILGYKSHMGAGSITSNVKSDKKLVVIKSDLEQIETGLKK
FT                   IGAMLGDYVEVGCNSVLNPGTIIGRCSNVYPTSCVRGVIPENSIFKNSGVVIKKD"
FT   gap             258532..260107
FT                   /estimated_length=1576
FT   CDS             complement(260267..261421)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02770"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88018"
FT                   /db_xref="GOA:D4JCU6"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCU6"
FT                   /protein_id="CBK88018.1"
FT                   /translation="MFKNNGKLKLLIIVGTRPEIIRLSAVINKCRQYFDVVLAHTGQNY
FT                   DYNLNGVFFKDLELADPEVYMEAVGKDLGETMGNIIAKSYQLMVDIQPDAVLVLGDTNS
FT                   CLSVIGAKRLHIPIFHMEAGNRCKDECLPEETNRRIVDIISDVNLCYSEHARKYLHEAG
FT                   LPKERVYVTGSPMAEVLHNNLSKIEASDIHERLHLEKGKYILLSAHREENIDTEKNFLS
FT                   LFNAINKMAEKYDMPILYSCHPRSKKRLETSGFKLDPRVIQHEPLGFHDYNCLQMNAYA
FT                   VVSDSGTLPEESSFFTSVGHPFPAICIRTSTERPEALDKGDFILAGIDERSLLQAVDTA
FT                   VELNKNNDLGIPVPDYVDENVSTKVVKIIQSYTGVVNKMVWRKF"
FT   gap             261971..263214
FT                   /estimated_length=1244
FT   CDS             complement(263961..264158)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88019"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCU7"
FT                   /protein_id="CBK88019.1"
FT                   /translation="MRKHILSKYAINFDSNSEKIFDDPTIITMTIEDSDEDEFNMRGTS
FT                   CDSSIYTATVESTDEDESFQ"
FT   CDS             complement(264296..265138)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88020"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCU8"
FT                   /protein_id="CBK88020.1"
FT                   /translation="MVRESIKFKHFKKYCKSLNKVAKNKVVQNLINILLLVWSYLPLFA
FT                   LTDELDFSNASLEHKNKWKLRFSCLNIYFGEYLIQLLTFCISEKKLNLYKITKLSNFPN
FT                   FDMSETKTLDLKKQFFEHMDNLSENELLIEKEALLRQLSDEDERMNLAFNKINMYTTII
FT                   LGGVPILLTILSEKISLFIQNVFLKLLPQSIVFLLLIYFTGNLIIIILQFITIRGIRKS
FT                   KFSELKNSDNKEETLNWQIYYDWQIKKRKVNLFISLLKIFQNWFVISLILFLIWLLIA"
FT   CDS             complement(265131..265724)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88021"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCU9"
FT                   /protein_id="CBK88021.1"
FT                   /translation="MIHKDIISIINGIADSFPGTVLTPPNILRKTENKIYQILTAQKLG
FT                   MKIPMSFLGNVNEKLIEFLTQKSIIKPISVGKINFGKTVEIYQTSLFHGCDENISLTPI
FT                   YLQKYVEKQYEVRLTIIDNIFYPIKIETIDKIDWRKDYQNHTYSIIECPSDIKEKCKKL
FT                   MIEYGLSFGAFDFIVTPKNEWIFLELIQMDNGYG"
FT   gap             265819..266163
FT                   /estimated_length=345
FT   CDS             complement(266275..267327)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02830"
FT                   /product="Predicted nucleoside-diphosphate sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88022"
FT                   /db_xref="GOA:D4JCV0"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR013692"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCV0"
FT                   /protein_id="CBK88022.1"
FT                   /translation="MHRYAIIICSWFLIAAFLMMFINTVLKHFLTTDIGEIRIFSRDEK
FT                   KQDDMRHDLQARYPEYANKVKFYIGDVRNIQSVRDAMPGVDYIFHAAALKQVPSCEFFP
FT                   MEAVRTNIIGTDNVLHAAIENNVKRVVCLSTDKAAYPINAMGISKAMMEHVIFANARVA
FT                   AERGNTVICCTRYGNVMCSRGSVIPLFIDQIKAGNPITITDPNMTRFLMNLDEAVDLVK
FT                   FAFEHANPGDLFIQKADASTIGGLAKAVQSLFGDTGTQIIGTRHGEKLYETLMTREERL
FT                   RAEDMGGYYRVAADSRDLNYDKFMVNGQVHTQADESYTSHNTNRLDVEGTVKKILTTDY
FT                   VQEALKDWVK"
FT   CDS             complement(267306..267833)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02840"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88023"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCV1"
FT                   /protein_id="CBK88023.1"
FT                   /translation="MDAYSYIQRGHVFANAQTGNMLLFGINLSQLKFLDALQYAIPVIA
FT                   FTLGIALAEQLRACQWKKLHWRQIALIIETTILISVAFFNSDLNLIANSLTSFACGIQV
FT                   ETFRKIQGLSAATTMCIGNLRSGTENLFKYLHTKERHYFDKGAFYYLIIFCFIMELLSE
FT                   ISLSILCTAMPS"
FT   CDS             complement(267970..269301)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02850"
FT                   /product="glutamate dehydrogenase (NADP)"
FT                   /function="glutamate dehydrogenase (NADP)"
FT                   /EC_number="1.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88024"
FT                   /db_xref="GOA:D4JCV2"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCV2"
FT                   /protein_id="CBK88024.1"
FT                   /translation="MTDLKELYEVVKKRNANDTEFLQAVEEVFESLNVIAQVHPEKLDD
FT                   DVLTRIVEPERQILFRVPWVDDNGKTQVNRGYRIEFNSAIGPYKGGLRFHPSVNVSIIK
FT                   FLGFEQIFKNALTTLPMGGGKGGSDFDPKGKSDGEVMRFCQSFMTELARHIGPNTDIPA
FT                   GDIGVGGREIGYLFGQYKRIRNEFSGVLTGKGLTYGGSLIRTEATGYGLCYFTQALLKD
FT                   NGTSFEGKTVAISGSGNVAIYACEKATQLGAKVVTMSDSNGFIYDPEGIDLALVKDIKE
FT                   VRRGRIKEYVEAKPNATYTEGARPWSIKCDIALPCATQNELDLDDAKALVANGVFAVCE
FT                   GANMPTTPDAIHYLMNNGVFYAPGKASNAGGVACSGLEMSQNAQHLSWTAEEVDEKLEG
FT                   IMVNIFNTCRDTAKEYGHEKEYVVGANIASFLKVAEAMKAQGTV"
FT   CDS             269450..269617
FT                   /transl_table=11
FT                   /locus_tag="EC1_02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88025"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCV3"
FT                   /protein_id="CBK88025.1"
FT                   /translation="MKEKLYRFLAGRYGMDDLNKFLFALEILLIVLSFFVPNVIIAEYS
FT                   KVAEPSNPTK"
FT   CDS             269797..271329
FT                   /transl_table=11
FT                   /locus_tag="EC1_02870"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88026"
FT                   /db_xref="GOA:D4JCV4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCV4"
FT                   /protein_id="CBK88026.1"
FT                   /translation="MRDLKKILKLRASNKSQRFIADSLKISRNTVSRIFSLADQKQLYW
FT                   EKAHNMDENQIESYLFGNDTVNLIYQSPDFEKIHKELLKPGVTLQLLWDEYVEQCRSIG
FT                   KPFYQRSNFYKLYTDYVKKHRLTMHINHKPGDKLMVDWDGKTMEVTDRYTGEITKAYLF
FT                   VATLPFSMFSYVQACPSMDSKNWIDCHINAFRYYGGVTRLLVPDNLKTGVDSNKKYEDP
FT                   VLNKSYQEMADHYGTTVIPARIRAPKDKAAVEGTVNTITTSIMAHLRNRTFFSFDELNN
FT                   AIWIELEKFNDRPFQKREGSRKSVYLEEEKDYMIPLPERDFELSEWKTATVQLNYHIAV
FT                   DKMNYSVPYEYVGKRVEVRSTKSYIDVYYKRTLVCSHKRLYGRKNQYSTNIDHMPENHQ
FT                   LFTWNGERFKRWAAEIGPHTYQVIESLLNRYKVEEQAYKGCLSLLKLSDKYTATRLENA
FT                   CALAIAHVSKPGYKNIRLILQSGQDMKEKQEPKEENLKYALTRGKEYYENNK"
FT   CDS             271313..272062
FT                   /transl_table=11
FT                   /locus_tag="EC1_02880"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88027"
FT                   /db_xref="GOA:D4JCV5"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCV5"
FT                   /protein_id="CBK88027.1"
FT                   /translation="MKTINSEIAEKLREMRLPVFASEFERQCLEPSDQEDSFEVRLKRL
FT                   VDMEYDSRTNNTIQKNIKMAKFYDSNANINDVDYRPERNIDRGTIESLSTNEYVKNGLN
FT                   IIIVGASGCGKTWLGCAFGVHACMEKYKARYIRMPELLSEFEAVRIQGRYRDYLKQISK
FT                   IDLLIIDEFLLTSVNESERNDILEVIEKRTNRKSTILCSQWTPEGWLEKLGNGPVAEAI
FT                   LDRIINSSYKIFLQGKSMREEYSKLKK"
FT   gap             272176..272506
FT                   /estimated_length=331
FT   CDS             272655..273533
FT                   /transl_table=11
FT                   /locus_tag="EC1_02890"
FT                   /product="Domain of unknown function (DUF1848)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88028"
FT                   /db_xref="InterPro:IPR014998"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCV6"
FT                   /protein_id="CBK88028.1"
FT                   /translation="MILNISGRTDIVAFYTPWLMNRFEAGEILVRNPFYPSQVSKILIE
FT                   NVDAIVFCTKNPLPIIKYLPSIHKPMIFQVTLTPYHKDIEPFVPDKSKIIEGIKEISKL
FT                   LGQEKVYVRYDPILLNEKYTVEYHIRAFERMCSLLKGYVNHIIVSFIDDYKNVRNHYDE
FT                   LKLKNPTHEDLKKIGIHFFDIANKNNMTVQTCYEKEDLSQYGFIKDVCVSRKLAFELTQ
FT                   KHYKLWSARDCGCIEMVDIGVYNTCHHYCKYCYANYDEKKIHENIMDHDEHSPFLIGHA
FT                   KPDDIVKERFK"
FT   CDS             complement(273534..273968)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02900"
FT                   /product="Predicted acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88029"
FT                   /db_xref="GOA:D4JCV7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCV7"
FT                   /protein_id="CBK88029.1"
FT                   /translation="MLKLYIKRFDQLNVNELYEILKLRQDIFILEQQCLYPDIDFIDEK
FT                   SLHIYYQEKGKIIAYLRMFEKDTNTCQLGRIISLNRRQGFGTSLINETLQLLKQEKKYE
FT                   KVYVEAQKYAIEFYEKLGFYVISDVFLEDGIEHVKMERFL"
FT   tRNA            complement(274025..274100)
FT                   /locus_tag="EC1_T_21540"
FT   CDS             complement(274218..275825)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88030"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCV8"
FT                   /protein_id="CBK88030.1"
FT                   /translation="MSNKRVNKMLKIGSCLGLIAAIFSAAALPGMNVAVHAEENEVEPV
FT                   KQENLDETAIEATKDILNSDSVSTEDISEFEQSLTEKVQNKEIQKESVQFSGSSEPVVE
FT                   DNKVTVTVVTEFYNRDGSLNQESGGISTYTRTPGTSFNVSTAIYKRGWILESETVTGMV
FT                   DTNPNNYKAEGIIGNDDIMIKYVWREDNIGPDGQADKIPDQYQIKVSYDVVNGAWNDGT
FT                   TNTVNKVYTLTDSEGNPSDQGTARAQLPSVGNKPNEGFARGSWQSGMKYTLTKEDDGSN
FT                   FVYTYAPAKNVTVITEFYNRDGSLSTVKGGTSTYTRAIGSTIDFGTATYNRGWILESET
FT                   VTGMVDTNPNNYRAQGTVGNEDITIKYVWREDNIGPDGQADKIPDQYQIEVTYDVVNGT
FT                   WNDGTNDTIYKVYTLFDENGNPSQDGTVKHELPEVGNAPLEGYTIGEWSSNIEYELTHK
FT                   DDEAHFTYTYSVISDTDVKPSKPSDTENPKNESTVKETKTENKVVNTAYSTNVLSLLGL
FT                   FMLSLAGMLFGVVKKYLK"
FT   CDS             complement(275979..276653)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02920"
FT                   /product="HAD superfamily (subfamily IA) hydrolase,
FT                   TIGR02254"
FT                   /EC_number="3.8.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88031"
FT                   /db_xref="GOA:D4JCV9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCV9"
FT                   /protein_id="CBK88031.1"
FT                   /translation="MKKYIFLDIDNTLLDFNKCSKISIQEGFKKYGITYHEDVFDTFVK
FT                   INDSLWEQIEEGKLTKTKLYEIRWNTIFRALKIDFEGHVFERYFVNSLNYIAKEVDGAY
FT                   DLLQYLSNKYEVFLTSNAPYDQQWNRLKIADMLKYVKKIYASEKIGCAKPNKRFFNYCI
FT                   NDIGITDKNEIMIIGDSYSADVQGGINSQIETIWFDRNKKGINDSLATYKINSLYEIMN
FT                   IL"
FT   CDS             complement(276690..277085)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02930"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /function="ATP synthase F1 subcomplex epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88032"
FT                   /db_xref="GOA:D4JCW0"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCW0"
FT                   /protein_id="CBK88032.1"
FT                   /translation="MISLKIVTPHGTYSEVDVKSISLRSVEGQMTLLTDHLPIFASLVP
FT                   CKLALVDNNDQRYEYALSGGFCHLEDNKAMILTDAIEGKTEIDLERAKRAYERARARIE
FT                   KKDEVTNLKRAQLALERAVNRINVYGG"
FT   CDS             complement(277087..278490)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02940"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /function="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88033"
FT                   /db_xref="GOA:D4JCW1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCW1"
FT                   /protein_id="CBK88033.1"
FT                   /translation="MSKNIGKVVQIIGPVVDISFDEDHLPDLLTAIEIKRPDEESLIVE
FT                   VAQGIGADRVRCIAMGSTDGLVRGMDAIDTGKPIQAPVGDAILGRMFNVLGRPIDGLGE
FT                   VKDVEYEPIHRPAPAFDEQSTVSVPLETGIKVIDLLCPYAKGGKIGLFGGAGVGKTVLI
FT                   QELIHNIAKEHGGKSVVVGVGERTREGNDMYHEMKESGVLDKTVLVYGQMNESPGARMR
FT                   VGLTGLTMAEHFRDKEHQDVLLFIDNIFRFTQAGSEVSALLGRVPSAVGYQPTLATEMG
FT                   QLQERITSTNDGSITSVQAIYVPADDLTDPAPATAFTHLDAKTVLDRDIAALGIYPAVD
FT                   PLESSSRILDPLVVGERHYNVARGVQSILQRYKELQDIIAILGMDELSEEDKKVVNRAR
FT                   RVRNFLSQPFNVAEVFSGIPGKYVPLEDTIRSFERILAGEFDDLPEQAFMFVGTVEEAQ
FT                   EKARQMAGE"
FT   CDS             complement(278501..279346)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02950"
FT                   /product="ATP synthase, F1 gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88034"
FT                   /db_xref="GOA:D4JCW2"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR023633"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCW2"
FT                   /protein_id="CBK88034.1"
FT                   /translation="MAQSRQAIQARIKSVDSTKKITKAMQLVASSKLTKQKLAMEENRE
FT                   YADALQHLLTLVLRSTDDKSIFLNENMGKPAYVFVITSDMGLCGGYNANIQRTVQSEIS
FT                   NEDKIIMIGSRGVNWIKSRDYNVCDQLIDMNEDDAYDKLSSKVVEALDLFERKEISKIQ
FT                   ILYTHYKNTLTFIPTLETLLPVKKQSEEKKESHKEMIFEPSREQMLSNVIPMVTKSVVY
FT                   SKYLESKTSEQASRRMAMESATDNANELQEALELAFNQARQAAITQEITEIVGGANALT
FT                   "
FT   CDS             complement(279333..280868)
FT                   /transl_table=11
FT                   /locus_tag="EC1_02960"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /function="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88035"
FT                   /db_xref="GOA:D4JCW3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCW3"
FT                   /protein_id="CBK88035.1"
FT                   /translation="MSLNPAQISQLIKAQIQNIDQDLEMNESGTVLSIGDGIATVYGLR
FT                   NAMMSELLLFPHDVYGMVMNLEDEQVGVVLMGENNDIKEGDLVKRTGHIVEVPVGDAMV
FT                   GRVVNALGQPIDGNGEIHTTKTRPVERVAPGVMTRKSVSVPLQTGLKIIDSMIPIGRGQ
FT                   RELIIGDRQTGKTAIATDTIINQKGQNVKCIYVAIGQKASTVAQIVEKFKQYGAMEYTT
FT                   IVVSTASEPAPLQYLAPYAGCAIGEEWMENGEDVLIVYDDLSKHAVAYRTMSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARLNEDYGNGSLTALPIIETQAGDISAYIPTNVISITDG
FT                   QIFLKTDMFNEGIRPSVDSGFSVSRVGSAAQIKAMKQVSGSLKLELAQYREMESFAKFG
FT                   SDLDAATMEVLNHGARLTQLLIQKQYSPMRVSEQVVSLFAAKNKYLKDIPVEKVQAYET
FT                   GLISYVNREYPYILDQIESKKELDENLESQIKAALDAFTKEFLLMEGAQDGTK"
FT   gap             281206..281412
FT                   /estimated_length=207
FT   CDS             complement(282137..282382)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03000"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /function="ATP synthase F0 subcomplex C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88036"
FT                   /db_xref="GOA:D4JCW4"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCW4"
FT                   /protein_id="CBK88036.1"
FT                   /translation="MEFNEFFVQGMALLGAGIAMVAGLGQGIGQGFAAGKGAESVARNP
FT                   EAASKIQSIMVLGIALAETTGIYSLVIAILLIFIKG"
FT   CDS             complement(282401..283105)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03010"
FT                   /product="F0F1-type ATP synthase, subunit a"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88037"
FT                   /db_xref="GOA:D4JCW5"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCW5"
FT                   /protein_id="CBK88037.1"
FT                   /translation="MPSISALEIHVGSFTLEIQQSILVWLILCVVFATFFIVAGKKIER
FT                   QDPSKASKGIVYISEEALNLVLFVIKGNLRETTKKYIPLFGTLILMMIASNLIGLIGLQ
FT                   NPTSNVSFNATLAIMMWLMIQGNAIKKGGLIARLKELTEPMVILTPLNIIGEMALPISL
FT                   TMRLFGNILAGSIITMLVYTLIKALMPWGVLGLSATPFLHMYFDIFSGVIQTYIFFTLA
FT                   SFNLGQQVAEEE"
FT   CDS             complement(283098..283472)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03020"
FT                   /product="ATP synthase I chain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88038"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCW6"
FT                   /protein_id="CBK88038.1"
FT                   /translation="MNEVTSMNKKIVIYSLLIGISVAIIAGLLFNDIYVLVGVLVGLGT
FT                   GLIGYAMIVQMALSLKPDEKLSKRQGAANYIVRYIIYAVIFGFFVYLNISIIALLVGFL
FT                   CHKLSIFVYALLEGRMDKNA"
FT   CDS             complement(283465..283641)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCW7"
FT                   /protein_id="CBK88039.1"
FT                   /translation="MKPFTFSGVLLVNILLSLFLGYKLDEWLNTTPIFIIVGLIYSVVG
FT                   SIYILLHKANKHE"
FT   CDS             complement(283642..284262)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03040"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /function="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88040"
FT                   /db_xref="GOA:D4JCW8"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCW8"
FT                   /protein_id="CBK88040.1"
FT                   /translation="MLTVFDHPLIKHKLTIMRKKETGTKDFRQNLDEIGGLMVYEVTRD
FT                   LPLNEIPIETPLCQTIGYEMAKDVVIVPILRAGLGVVNGIQNLIPTARIAHIGMYRDEE
FT                   TLEPHPYFEKYPSNMDEAAVIIVDPMLATGGSSVAAIDMVKKQGATSIKLVCLVGAPEG
FT                   VKVVEEAHPDVDIYLASLDDHLNEKGYIVPGLGDAGDRIFGTK"
FT   gap             284752..284872
FT                   /estimated_length=121
FT   CDS             complement(285186..286532)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03070"
FT                   /product="primary replicative DNA helicase"
FT                   /function="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88041"
FT                   /db_xref="GOA:D4JCW9"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCW9"
FT                   /protein_id="CBK88041.1"
FT                   /translation="MTRELPNSLKIEQSLLGSLMIYPNVMNDCQDLDLSPDEFFTPSHQ
FT                   RIFQCMKEIKDNGQPLDINTIVTRLQDKDELEAAGGADYIVRLADSAISSANARHYIET
FT                   IKNKAQLRALIYAADKIAQEGYESPEDIDTILDDAERSIMDVTRQRRGAEFESSQEIVN
FT                   RVIEELKALKSKQGITGIQTGYTDLDKMTNGFQRGDLIILAARPAMGKSALALNFASQV
FT                   AKRNEGCVAIFSLEMPSDSLMKRLMSSESQVLSNKLRDGRLNADEMSRLYEAGTRLSER
FT                   KIFIDDTSSIKVSQIFSKVRKLKSEYGSISLVVIDYLQLITGSRADSRQQEVSDISRNL
FT                   KILAKEMECPVIALSQLSRKVEERTDHEPQLSDLRESGSIEQDADIVMFLYRANYYDKD
FT                   KEGQDETEVVDLSLAKHRNGSIGKIHLAFEKGISRFTNYASTEEDIYAG"
FT   CDS             complement(286536..286985)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03080"
FT                   /product="ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88042"
FT                   /db_xref="GOA:D4JCX0"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCX0"
FT                   /protein_id="CBK88042.1"
FT                   /translation="MKVILLKDVKNVGNKDEVKEVSDGYARNFLIKNKMAVAYTKGSVK
FT                   VLDHQLEEKKLHEEDLKKQAEKIAEELKTTPVEFMLNTGKDGQAFGSVSSKQIAEALNK
FT                   KGIIVDKRKIHMDIPVSSIGTTRVKVDLYKGQVIGEIVVQVRPKG"
FT   CDS             complement(286966..288930)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03090"
FT                   /product="Predicted signaling protein consisting of a
FT                   modified GGDEF domain and a DHH domain"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88043"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCX1"
FT                   /protein_id="CBK88043.1"
FT                   /translation="MKQFEKWRSLYIASIILSICFVIYAITRTEYWFTLIGVLLIILFS
FT                   LAFIGLWRSLRIHGVKTEVDISRVLGKDAKDALSFGHIGILTYDNEYVVTWASPYFKEN
FT                   NIDIVNHKLTSWIENIRTIFDEDVDVVIGKYEDKIYEITRKSDAQILYVREITDYYNLR
FT                   QDYLNNGIVVGLMQLDNYMEYQSYEDEELIAKINTHLRSPIISWAKENNMLIRRLRSDR
FT                   FFVVCNQEILKKVRSQNFTILQVIKDEANHLDVSITLSMAFAYGTNDFKILDGMVNELI
FT                   ELAQSRGGDQVAIRASSGTVQFVGGNSETSSTRSKVRVRIMAQSIQEAINDSSKVFISG
FT                   HIMSDFDCMGAALSMSNWVTGLNKTAYIVLKDVPRDSQLQDLMDKYQDVLHERHNFITI
FT                   SEAMSMMDYEEDLLIMVDHGIPAISSAKDFVSHAQRIIVLDHHRRNESFVKHPMLTYVE
FT                   STASSTCELIVELLQNIPNHIPIYEAEATIMYLGILVDTNRFKMHTDARTFEAAAALRS
FT                   WGANAALAEKALCEDFSRFTLKHHLIQMASTYFGKYLVVCVNEPVDKTILAQVSESLLL
FT                   VRGCVASFTIGKVINEPTTAAISARSDGTYNVQKIMEALDGGGHFSAAAVEKKSTEPEE
FT                   LKKELLQILEEEEHESNLA"
FT   CDS             complement(288944..289768)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88044"
FT                   /db_xref="InterPro:IPR018710"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCX2"
FT                   /protein_id="CBK88044.1"
FT                   /translation="MVCAIYGVLLFLNQQTGLMIEASASWLFVFPVLIYTAMSGPKSGA
FT                   IVGIAMALMTFLLGGFTTWFYSWTSLITGYVYGLGLFYQWRNMTNFLICLVFSVLSNVC
FT                   TVVVWSYLFGYDLVSEFESFRAIIPFIDMGVFIILFVAFLSLLQALCIHLVSLMICIRM
FT                   HLPYRPLTPISQQKSSKVVGIVSLFIWGIFFLSQNVIECSKGVLDIIMLIWLFDCALLL
FT                   YYGVIYFMYHSIKRNNRQFSFLAIFLAFVPGINLLWMLMGELDCLFQLRKKV"
FT   CDS             complement(289863..290267)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03110"
FT                   /product="PAP2 superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88045"
FT                   /db_xref="GOA:D4JCX3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCX3"
FT                   /protein_id="CBK88045.1"
FT                   /translation="MMNGTTLIFIIYFLFPNYTDLRFDLVPRNIFDQIVNLLWVIDTPT
FT                   NVCPSLHVSISTAVMVAVWNSKKLKKNHPVWRILIIVWQILICASTVFLKQHSIIDVFA
FT                   GCFVTLLFSVICYKVNWRKMLGKTIFRSLL"
FT   gap             290422..291627
FT                   /estimated_length=1206
FT   CDS             complement(291694..292449)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88046"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCX4"
FT                   /protein_id="CBK88046.1"
FT                   /translation="MLNMLRSDLYRILHIRSFKIGVFIMSIMTICLTMPSVNVMSNTAF
FT                   ANYDAQIGNFAEYLYYFPKSAIFMIIVMLMYVIYLNEEYTSGFIKNVYPYQTDKLKLSI
FT                   SRLLIFVIYYIVFSFINIIFSLITVGFIQGRFGTISIIDYIIYYVIQLLLATAVGSFLE
FT                   LFIHLSKKNIVSTILIFLYTFGILFGMVYIFFQEWFNLSVYENAIYYLSGTLPYRISDV
FT                   YLNTMIVGIFALGIGVLLNMVILKKKDLE"
FT   gap             293285..294595
FT                   /estimated_length=1311
FT   CDS             294677..295138
FT                   /transl_table=11
FT                   /locus_tag="EC1_03140"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88047"
FT                   /db_xref="GOA:D4JCX5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCX5"
FT                   /protein_id="CBK88047.1"
FT                   /translation="MNNRKYGYGFYFRCIQSQLEKAMNEQLKEFDLTKSQLDILRFLKY
FT                   VKKDHVNQKDIEEFFHISNPTVTGLLNRMEQKGYVVRVHSPDDKRIRYIQITDKVEDID
FT                   KKIKKHIDYSEGVIAKGLSQEERNLLFKLLAKVKDNLIKEEENHVKDID"
FT   gap             295661..297554
FT                   /estimated_length=1894
FT   gap             298504..298523
FT                   /estimated_length=20
FT   gap             300024..300777
FT                   /estimated_length=754
FT   CDS             complement(301222..301911)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03210"
FT                   /product="Listeria-Bacteroides repeat domain
FT                   (List_Bact_rpt)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88048"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCX6"
FT                   /protein_id="CBK88048.1"
FT                   /translation="MFTRAGYNFGSWNTQADGKGTTYAEGSQITSLQNNVTLYAQWIAN
FT                   SDTSYVVETYLEGEDGNYPEDPNTSITRTATTDTTVSVTDADKQAPEGYALDPNADNVF
FT                   EGTVAGDGSLVLKLYFAKDVIGPDPENPGDEIPDKYQILFTYKAKENGVVTGETYELHT
FT                   FKDNEGNYVEPTATTPDAEVKATANAGYHIDKWIDESSTDLGNGTATEFDNTTYTTNQT
FT                   FTVSFAE"
FT   gap             302249..302738
FT                   /estimated_length=490
FT   gap             303992..304916
FT                   /estimated_length=925
FT   CDS             complement(308511..309101)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88049"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCX7"
FT                   /protein_id="CBK88049.1"
FT                   /translation="MALNKTKPKKTQKKNTESKQGHKLVWFTLIIIATPVVIVAYVLLT
FT                   SMGGQGEPVVGNRFNGEDLNPSITEEAMNSIQEQVSGIGGVEEATINLKSATLRVHLNM
FT                   DDSYTQDQIQAASDQAYEIVAATLPIDQYFTNREDAKMYDLEIDVYNYIVDDSHPAEGQ
FT                   IYIKTTKTGAATDRVTDVMTTAKDPELVAQIKR"
FT   CDS             complement(309137..310192)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03260"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /function="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.6"
FT                   /EC_number="6.3.5.7"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88050"
FT                   /db_xref="GOA:D4JCX8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCX8"
FT                   /protein_id="CBK88050.1"
FT                   /translation="MEEDTAKQFHKDTGTYIDFNRAGTPLIEIVSCPDMHSAKEAAAYV
FT                   ETLRKNLLYLNVSDVKMEEGSMRCDVNISLSKDKDTLGTKTEIKNLNSIANVQKAVQAE
FT                   IERQSALLDEGKSVEQETRRYDESLKTTVLMRKKEGNVDYKYFPEPNIFPIQLDPNWVK
FT                   EIQDSLEELPEQKIERFMKEYGLSEYDANVLVNDRAMADYYEEVCKHTKNAKKVCNWIT
FT                   GDVSAYLNKKNTNFDSIEVKPEYIASLVDSIEAGDISGKQGKVVFEEVMLNKDPKKVIE
FT                   EKGMKQVSDDGAILALVTSVLDANPQSIEDYKNGKDRAVGFLVGQVMKASKGQANPKRT
FT                   NELIKEELNKR"
FT   CDS             complement(310243..310557)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03270"
FT                   /product="Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88051"
FT                   /db_xref="GOA:D4JCX9"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCX9"
FT                   /protein_id="CBK88051.1"
FT                   /translation="MDYYVTIGIEIHCELKTNTKMFSGAPVRFGKVANTCTSVVDLGHP
FT                   GILPCVNKEAVRLAIKACTAMHCELDTLLNLIVKTIIIQIFQKDSKSHNNFIQSERMDM
FT                   "
FT   CDS             complement(310562..311938)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03280"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /function="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.6"
FT                   /EC_number="6.3.5.7"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88052"
FT                   /db_xref="GOA:D4JCY0"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCY0"
FT                   /protein_id="CBK88052.1"
FT                   /translation="MEIKSSVSAVESYKRIEELQPKLNAAVTMIEPKDNPNQGKLSGIP
FT                   VILKDNINTKGIRTTASSRILDNYVPVYDATIVKKLNEAGAIFVCKASMDELGMGGTNK
FT                   NAYTGAVHNPYDLDRISGGSSGGCAVLVASDAAPLAIGTDTGDSIRKPAAYTGVVGVKP
FT                   TYGRISRYGIIPYASSLDHVGYFTTNIKDAALALEVLAGRDDKDMTSSFKPVEEYSKNL
FT                   NGDLKGKTIGVLKTVIDEIEDEYVKNTFYEFVKKLKEAGANIKEVEMPREYMELIPPVY
FT                   KTIANAEATANHSNLDGLRFGMREDGESVEEVMTNSRTKGFSSYVRARFVIGSYSLFNE
FT                   NQDRLFRKAQKIRRLIVDAYKKCFEGVDGILCMAALDIAPMIEDSQDVRFKETSFADEH
FT                   MQLANFSGYPSITLPFAQKDGMPLGINLTCRPFEEQMMFDLAQGMEDITGLKDQVKKGV
FT                   "
FT   CDS             complement(311940..312233)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03290"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /function="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.6"
FT                   /EC_number="6.3.5.7"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88053"
FT                   /db_xref="GOA:D4JCY1"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCY1"
FT                   /protein_id="CBK88053.1"
FT                   /translation="MEKFSNEYFHKLANDLKFDLSDDEINELKKDFIEVEKQVELFEKI
FT                   DTTGVEPMVYPFEEATTFLREDIEEDVLSQEDALKNVKDVRMGHVHVPKVVK"
FT   CDS             complement(312248..313327)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03300"
FT                   /product="Protein involved in sex pheromone biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88054"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCY2"
FT                   /protein_id="CBK88054.1"
FT                   /translation="MHRTVKLLTSFLVISLCLSGCMGTSTNDTLALQAGDYVAMLPFES
FT                   SDTRVKHVGLISDQDIRIEIESGLMDLSKQYFDPSSVGYRTHTFLDFDELDATDGSRGL
FT                   LGTLRDDNPNGLNPSRDEAFDTGNGEVTGATILVDIYELDWYNTNDNLRGISLALVVND
FT                   EVEDDAGNTYEITKEKLQNYIEVTAGKLVNYMRERFNDISARIPIYIAAYSLDSSQESL
FT                   GGYFYEGMFEGSSGSYNSLDEEWILVPSTQLTTDDPTTAEQFNTFKEDIQNVLPDYTYV
FT                   TGKAKYENENLVKLQLDITSHGKTAGEILAVCQTANSSLSVFTSTDCEYQITITNDDTV
FT                   YAMINRDIDSTETNVNTRF"
FT   gap             314237..314779
FT                   /estimated_length=543
FT   CDS             complement(315195..316889)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03330"
FT                   /product="Superfamily I DNA and RNA helicases"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88055"
FT                   /db_xref="GOA:D4JCY3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCY3"
FT                   /protein_id="CBK88055.1"
FT                   /translation="MAIAMAETDNSEQLANIYKFYEDARLEMKAMDFDDLLIEAHKLLN
FT                   HNVDVRTKWQNRLDYIHVDEFQDVDPVQYGIIRLITGKHAFLCVVGDPDQTIYTWRGAS
FT                   VDIILRFNKDFENCETVILDQNYRSTKPILEASNKVISYNQDRIKKDLYTQIPGDDKIL
FT                   LHASSEEGDEPLFVAREISKRHKNGIDYKDIAILYRSNYSSRSFERVFRTVGIPYIIYG
FT                   GIRFYERQEIKDALAYLKLCTYPDENDPEQFSLDLAILRVINQPRRGIGQKSIDALREE
FT                   AASRHINLFEEMRDPLDISNAIKRKCEGFVSLILDLRSHRKDYSLEDFLDYVLDKTGYL
FT                   KMLEDENETERIENLKELKSDIAQSLKEDPDMTLETYLQDVSLFTDKTSDLALNSVSLM
FT                   TVHAAKGLEFDTVFLVNFNDGIFPSARSVQEGGRKSLEEERRLCYVAMTRAKRNLIITW
FT                   NTGYSYMLDTYKTSSRFLMEIPKEYTYDDKPKPKVEYTSNMMQSSMSPSKQTMKKNQKF
FT                   RKGDLVDHSVYGQGVVLKIEGNVATVAFSHKFGVKKLNASHPSLKKA"
FT   gap             316909..317664
FT                   /estimated_length=756
FT   CDS             complement(318229..318291)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88056"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCY4"
FT                   /protein_id="CBK88056.1"
FT                   /translation="MQKNDFKIVPKKEKRDFQEI"
FT   CDS             complement(318407..319582)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88057"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCY5"
FT                   /protein_id="CBK88057.1"
FT                   /translation="MYVSMICKDRNEKEKNELYQVLGLLAQGEQVQIEDRGDVVEMIVC
FT                   PQGKIVISEDGEDMIIHANTRHAGAGFHAFVVDICKDIQEEVPGEYELVDDLEFSEDED
FT                   FHRLHHVYEDELEYLRNALLTNDLLKTQNYLYEETFFLPIEKKDRIFTSIGDIDTKEFR
FT                   EMHLHDLMDNFYIWNNFDRDAQFFKNCALVLLSKEGVGRYTMMNDQTQKHANTICDYIE
FT                   LAYKQDDSIPLPVNEYNYLCDMLQREKLLNDAVPMEEEVIQYKTKEVYHLFQDAKVVAD
FT                   GASERSFDPVNNALCLMSPYEDDAHWAWLIQASKDANICSYLNELEEVKPIVYHGKTIQ
FT                   ILDKEEDGIYKIEAKLMQDERALYFHITYADKKDENYLKQCIKESCFQDLG"
FT   gap             320350..321632
FT                   /estimated_length=1283
FT   CDS             complement(321957..322796)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03390"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88058"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCY6"
FT                   /protein_id="CBK88058.1"
FT                   /translation="MNTKFVKGLLACALVAAPLTGCSSGSGDDAAEDKTITIGASVTPH
FT                   AEIINNIVPDLEELGYTVEVVEFSDYVKPNQALYEGELDCNYFQHTPYLEDWVANNCKN
FT                   EDDLVSAAKIHFEPLGIYSSKHTDVSDVPDGAQIAVPNDTTNEARALQLLQAQGIITLA
FT                   EGKGLEATKADIVENPHNVEIIELAAEVVPTKLNEVDFAIANGNNALNADITDYLLVTE
FT                   STDSEAADQYANVIAVRKGDEDSQKIQDLLSVLETQKTVDFIEENYNGVVVPVFKVK"
FT   CDS             complement(322857..323537)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03400"
FT                   /product="ABC-type metal ion transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88059"
FT                   /db_xref="GOA:D4JCY7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCY7"
FT                   /protein_id="CBK88059.1"
FT                   /translation="MMDFIIQIMPNVVDRFDVFVESIYETLLMILISGSIALILGLIFG
FT                   TILVVTRPGDILENKAVYTVLGKIVDLFRAAPFIILAMILTPLSQLIMGTSIGLKGAYI
FT                   PLIIGTAPFCARQMEQALSEIDRGLVEASQSMGFGPFEIIWKVYLRESIPSIIRGFTIT
FT                   LISMIGLTAILGVTGSGGLGVFCINYGYNQYNYDILWVSLAILVLLTILVQGIGNFLAR
FT                   KTTH"
FT   gap             323764..324438
FT                   /estimated_length=675
FT   CDS             complement(324771..324824)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88060"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCY8"
FT                   /protein_id="CBK88060.1"
FT                   /translation="MLKEDKNSLLEHGLGVA"
FT   CDS             complement(325308..325679)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88061"
FT                   /db_xref="GOA:D4JCY9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCY9"
FT                   /protein_id="CBK88061.1"
FT                   /translation="MKATLIIKNIESLYTCDKDFTVYKHAFIACHHDKIIDLGVHDYKK
FT                   WIDSATRVLDACGETVIPAFIDCNFEGFSKVRLGDQLRENNSALYAMKTNGILTILSDK
FT                   KRITKKRTYAGCLCSKTRK"
FT   CDS             325727..326389
FT                   /transl_table=11
FT                   /locus_tag="EC1_03460"
FT                   /product="Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88062"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCZ0"
FT                   /protein_id="CBK88062.1"
FT                   /translation="MLFFKKKQKVIITIHGFGKNVQHEFDPLAKHIDKKKYQIIQFDMY
FT                   DPYDPHDDNYETWIKKAEEKIHEYKDQEIILLGFSMGGVIASYLASIYHVRSLILVAPA
FT                   FQYLDLANITNHGIKIVKNLAKKSVSVPSASQTKAFQTIINQYKESIYHIDCPVTIFHG
FT                   TKDEVIPVESSKNIYSNIPGKKRLIYIEGGKHRMLYDGIMEECIFTLIDDALEDKLI"
FT   gap             327288..327960
FT                   /estimated_length=673
FT   CDS             complement(328419..329423)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03490"
FT                   /product="RecA protein"
FT                   /function="RecA protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88063"
FT                   /db_xref="GOA:D4JCZ1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCZ1"
FT                   /protein_id="CBK88063.1"
FT                   /translation="MAKAESKDKLLEDVLTEIEREYGKGSIMKLGDRAAVDVEPIPSGS
FT                   LLLDQALGIGGYPKGRIIEIFGPESSGKTTLALHAIAQVQKKGGRAAFIDAENAIDPVY
FT                   ARNLGVDIDELILSQPDSGEQGLNIMLMLIDSGAVDLVVVDSVAALVPQAELDGEMGDL
FT                   QVGSQARMMSKAMRKLAGLMNHNECTAIFINQLREKVGVVYGNPETTPGGRALKFYSSV
FT                   RIDIRKADAIKNGTDIVGNKVKVKVVKNKVAPPFKSAVLEIMYGEGISYVSELIDLCVD
FT                   ANIIKKAGAWFSYEGEKIGQGKEAAKQYIKNNPDFMSMLEEKLKAYQNSEKEE"
FT   gap             329924..330908
FT                   /estimated_length=985
FT   gap             333758..334452
FT                   /estimated_length=695
FT   CDS             complement(334969..336075)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03550"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /function="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88064"
FT                   /db_xref="GOA:D4JCZ2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCZ2"
FT                   /protein_id="CBK88064.1"
FT                   /translation="MDKLFDWCDENEISFMDQHEFDMEEEVIDDVDEDLDSRIDDAVDE
FT                   NSIEDEISQLEQTFANASHTKINDPVKMYLKEIGQIPLLDPKEEPIIAKRIQDGEAAKK
FT                   KLEEPDLDIEERKKLASVVADGEEAKQVLISSNLRLVVSIAKKYVGRGMLFLDLIQEGN
FT                   CGLIKAVEKFDYTKGFKFSTYATWWIRQSITRAIADQARTIRIPVHMVETINKLTRIQR
FT                   QLVQDLGRDPLPEEIAEKMENITADKVREIQKIALDPVSLETPIGEEDDSHLGDFIEDK
FT                   ETLSPDDYTNNQLLKDEINNVLQGLTEREEKVLRLRFGLMDGRTRTLEEVGKEFNVTRE
FT                   RIRQIEAKALRKLKHPNRSKRLKDFVKS"
FT   gap             336212..336584
FT                   /estimated_length=373
FT   gap             339621..340438
FT                   /estimated_length=818
FT   CDS             341215..341427
FT                   /transl_table=11
FT                   /locus_tag="EC1_03590"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88065"
FT                   /db_xref="GOA:D4JCZ3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCZ3"
FT                   /protein_id="CBK88065.1"
FT                   /translation="MKLKRIRDLREDNDLTQADIAKYLNVTQRTYSRYENDDRAIPLEQ
FT                   LVKLAEYYNTSVDYLLNRTDKKEPY"
FT   CDS             complement(342250..342801)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03610"
FT                   /product="Uncharacterized MobA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88066"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCZ4"
FT                   /protein_id="CBK88066.1"
FT                   /translation="MKIDLCVLAAGNARRFCGNKLLCEFKGKPLIRHLLDKIDPTLFSH
FT                   VYVVTQYDQIADIAREYGFEIIMNDAPDLGIGYSIKLASMQCQSDAIMFVVSDQPFLKE
FT                   DTIKKMVELANHEDIIALEYDHIFYNPMIFPAKYLDDLKHLQNHRGAKQLIKGKSIVSV
FT                   PCDALEIVDIDTREDLNTLM"
FT   CDS             complement(342791..345067)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03620"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /function="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88067"
FT                   /db_xref="GOA:D4JCZ5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCZ5"
FT                   /protein_id="CBK88067.1"
FT                   /translation="MKSIGKPIVKKDAYALLSGQPVYTDDLATKDCLIVKLLRSPHAYA
FT                   RIKNINTDIAKKVPGIAAIYTYKDVPDIRFTLAGQSYPEPSPYDRKILDEVVRYVGDEV
FT                   DIVAGENEDCVDKALKLIKVDYEIKEPVLDFRKALDNPIKVHEEDNFRTLCDVGTDQKR
FT                   NLCAHGESVYGDVEDVLKNSAVVLERTYHTKANAQAMMETFRAFSYIDTYGRLNVVSST
FT                   QIPFHVRRILSNALDIPKSKIRVIKPRIGGGFGAKQTACCEIFNAFVTWKLKRPAKVIY
FT                   TRNETFMASNSRHEMQMKVRLGATKDGIIQAIDLYTLSNTGAYGEHGPTTVGLSGHKSL
FT                   PIYNHCLASRFVYDVVYTNTMQAGAYRGYSATQGLFAVESIVNELADELHMDPAELRLK
FT                   NVVHEGETLPQYYNEYLNSCTLDQCIEKAMEMIDWKNKPLVRDMGDFTRGLGIACSMQG
FT                   SSISNVDLASVEVKLQDDGFYTLSIGATDMGTGCDTILAQIMAECMDCEIDQIITNGVD
FT                   TDTSPYDSGSYASSTTYLTGTAVVKACEELKGKIVQMAAELMQIEADHITFDGSKIVSV
FT                   QDGKEMELKDFAHTCFAGGKGRNLIATGSHVSKTSPPPFMVGIAEVDVDKETGAVSVHD
FT                   YVSVVDCGTIINSNLVRVQAEGGIAQGIGMALFEDIKYSDKGKMINNSFFQYKIPTRLD
FT                   VGTIRVDFIPSYEDNGPFGAKSIGEVVINTPSPAIASAVRHATGFQVRTLPITPEKVLF
FT                   KKDED"
FT   CDS             complement(345069..345521)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03630"
FT                   /product="Aerobic-type carbon monoxide dehydrogenase, small
FT                   subunit CoxS/CutS homologs"
FT                   /EC_number="1.2.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88068"
FT                   /db_xref="GOA:D4JCZ6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCZ6"
FT                   /protein_id="CBK88068.1"
FT                   /translation="MQVQIKVNGKLIKDDVSCDLLLIDFLRDHGCYSVKRGCETSNCGL
FT                   CTVWMDEKPVLSCSILATRANNHSIMTLEGLQKEAKVFADFMANEGAEQCGFCSPGLIM
FT                   NVLAMEKELKNPSEEEIKNYLAGNLCRCTGYMAQMRAITKYLNRGV"
FT   CDS             complement(345505..346281)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03640"
FT                   /product="Aerobic-type carbon monoxide dehydrogenase,
FT                   middle subunit CoxM/CutM homologs"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88069"
FT                   /db_xref="GOA:D4JCZ7"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCZ7"
FT                   /protein_id="CBK88069.1"
FT                   /translation="MLKIQKYTCAQSLDEAYAALMKNPKNCIIGGMIWLKMEDKVVPEA
FT                   IDLSSLGLDQIEEKEDCFKIGAMVTLRELELHEQLNKATGNVLHDALKDIVGVQLRNLA
FT                   TIGGSVFSRFGFSDVLCALMCLDASVHLYHAGEMSIQEFSKSNIQRDIITHITIKKNDW
FT                   KSAFVCLRRSATDISVLNVSVSKSNQYHICVGARPGVATRYDVEIDDIDKVASMIQDKV
FT                   ICGSNMRGSKEYRSHLVKVLTARALRKVESQDAGTN"
FT   gap             346557..346836
FT                   /estimated_length=280
FT   CDS             complement(347019..347780)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03670"
FT                   /product="ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88070"
FT                   /db_xref="GOA:D4JCZ8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCZ8"
FT                   /protein_id="CBK88070.1"
FT                   /translation="MVFQTIFKNSLASPDIIGTTSGCSLGAILGILFLNDVLMIELSSF
FT                   IGGLLSLFLVYFLTRRSKGNEIVNLLISGIIVQAIFTSLIMAFKIVADPYQQLPSIEYW
FT                   LMGGFADASWSNLLICFVLILISVFILYRLRWSIQIIGFGQEANTLGVDVKKIRNRALI
FT                   FSILLVSSVVSVAGPVSWVGLLVPHMIRLWTNQPISKNYVLTLLVGAVFVLWCDNIARC
FT                   LFTIELPISIVTSFFGALYLAIIFRRGKKVI"
FT   CDS             complement(347987..348973)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03680"
FT                   /product="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88071"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D4JCZ9"
FT                   /protein_id="CBK88071.1"
FT                   /translation="MKKLLSAGLCLSMFLLAGCQGQPQDTTLTITDQAGREVTFEEPCQ
FT                   TAASGYYITTTIMIGLQQQDKLTGIEMKPETRPIYAKAAEEILDLPQLGNKKMFNVEEC
FT                   AKADPDVVFLPVSLESYVEELEALDIPVVLLEPETADDFEEAVEIIGKVMGCEDKVDEY
FT                   KQYEEDLLEKYELDEVEEEPTVYFAGSDLLTCATDDMYQGEILSYAQADNAIDAEGSSW
FT                   VNIDIETLLAANPDYVFIEAGSLSADDFKNDARVQELQAVQNDHVYVFPSTLETWDTPS
FT                   LSSCLGKLWAASILHPELVSMDDVEAESVAFYEQFYGFTPEAQDLAL"
FT   CDS             complement(348987..349322)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03690"
FT                   /product="N-terminal domain of molybdenum-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88072"
FT                   /db_xref="GOA:D4JD00"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD00"
FT                   /protein_id="CBK88072.1"
FT                   /translation="MFLKYDIKVRIGQKEASFGKGVIELMEGVERTGSLSAAYKAMNMS
FT                   SSKAWKIIQRAQQDLGIVLFESKSGGADGGHTIITAQGKELMRKYRSMMLEVERQAEIS
FT                   FQKYFTE"
FT   CDS             complement(349398..349886)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03700"
FT                   /product="Predicted nucleotide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88073"
FT                   /db_xref="GOA:D4JD01"
FT                   /db_xref="InterPro:IPR004948"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD01"
FT                   /protein_id="CBK88073.1"
FT                   /translation="MKVFLTGSKQIGKSTLIQKFIQENQVPCSGYITLPYFENGERIGF
FT                   YLHSLISLERNDILFSHGKQVVKGVFDDFGVEILEHSNSGLLILDEIGFLERDERKYLD
FT                   VLIKKIKEYPNVLGVCRKIDISYIKEIKHLPEVIVYDLDHCDFEEVKKAIEALWSMKK"
FT   gap             350595..351141
FT                   /estimated_length=547
FT   CDS             complement(351158..351655)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03720"
FT                   /product="Adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88074"
FT                   /db_xref="GOA:D4JD02"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD02"
FT                   /protein_id="CBK88074.1"
FT                   /translation="MSSQVVVGTQWGDEGKGKIVDVLAEKADMIVRFQGGDNAGHTVIV
FT                   NGKKYVLHLLPSGVLHEEATCVIGPGVVCNPFVLLEEMQHLEEGGLKCDHIVISDRAQM
FT                   LMPYHRYQDQLEEEAANSKIGTTKRGIGPCYADKYARRGIRFHEFINFETFKVRLKGVF
FT                   RF"
FT   tRNA            complement(351845..351919)
FT                   /locus_tag="EC1_T_21530"
FT   CDS             complement(351999..353018)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03730"
FT                   /product="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88075"
FT                   /db_xref="GOA:D4JD03"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD03"
FT                   /protein_id="CBK88075.1"
FT                   /translation="MIVDTLFVSEQKVGEKQESKKENKLSKEDYTKYVVDELGNVPVMM
FT                   YHGIHNIPSNETGYVGGNVDVDGYQRTAEAFRQDLQFYYDNGYRMIRLNDYINGNIDVE
FT                   AGKSPICLTFDDGLENNILVTGTDKEGNINIDPNCAVGILESFKKKYPDFNVTATFFVN
FT                   GGLFRQPEYNEQIIKWLVENGYDVGNHTYSHVDFTTTDGQIAQQEVGSVYAMLDEIIPG
FT                   QYVNIVALPFGSPYSYDHEMIPYIQSGLYKGKQYTTQSMLQVAWEADYSPYSNQFNPAF
FT                   IKRIRAYDNNGQDFDIEMNFTTLETTKYISDGDPNTIVIPDNKQDMLGNVYDKNVITY"
FT   CDS             complement(353156..354229)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03740"
FT                   /product="RIP metalloprotease RseP"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88076"
FT                   /db_xref="GOA:D4JD04"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD04"
FT                   /protein_id="CBK88076.1"
FT                   /translation="MSILGIIAFIVLLSVIIVVHELGHMLVAKHFGVYCHEFSLGMGPV
FT                   LYQKKGKETTYSIRAIPFGGYVLMAGEEDGSQDDETEWLKEVPENRKLTSKPTYQKVLV
FT                   MLAGVIMNFLLAWVIFIGISLANGYRQSDPLPVVYEVIENSPASEAGLQKDDEIISARA
FT                   DGEEIKPETQYDLLKFVQLHHDTLEITVSRNGQEFETTITPEYDKESQGYTLGYTVAAY
FT                   LEPIPWYMSFVEGTKDLWDSTVEIYQSLGLLLSGQALDQLSGPVGILNVTARTAELGLN
FT                   AYLSLVGLISVNVGIFNLIPIPALDGGRVLVLLIEKILRRKINTALVENVIMISFVLLL
FT                   GLMIFATYNDILRLVGM"
FT   CDS             complement(354242..355012)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03750"
FT                   /product="CDP-diglyceride synthetase"
FT                   /EC_number="2.7.7.41"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88077"
FT                   /db_xref="GOA:D4JD05"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD05"
FT                   /protein_id="CBK88077.1"
FT                   /translation="MKTRVMTALAIILVVALPVAFGGWLLELLALFILLSTAFEWMHVR
FT                   RDFNSWPVYVYPLTVVLVILTRFIPEHYTYIIYALGVCFFFALPVFVENFSLPDSYYCL
FT                   TYFILFSLIYHAIGYLVAEHMYLWTIVFATYGSDTGAWFVGSYFGKHKMNPRISPKKSW
FT                   EGFFGGIVFGFLLSLIVSFLYADSLNGYLNTLLCCLCPVVAELGDLCFSAIKRSNKVKD
FT                   FSNLLPGHGGVLDRVDSLMMNILLFGILHVLLIV"
FT   CDS             complement(355009..355662)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03760"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /function="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88078"
FT                   /db_xref="GOA:D4JD06"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD06"
FT                   /protein_id="CBK88078.1"
FT                   /translation="MEDGQKQRGLPRTAGHKQGADTIRTVALAANELGVKKLILYAFST
FT                   ENWKRPEDEVGYLCKLPGLFFNKYIRELMEKNIRVTFAGELERFPSDTQKVINRAVNDT
FT                   SHNTGLELCLAINYGSRREILLGIQKYADEVKNGRKNDLTEEDFSQYLFVPEDIDLMIR
FT                   TSGEVRISNFLLWQLAYSELIFTPVAWPDFNKEELVKCIEEFKHRDRRFGGLTK"
FT   CDS             complement(355751..356296)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03770"
FT                   /product="ribosome recycling factor"
FT                   /function="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88079"
FT                   /db_xref="GOA:D4JD07"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD07"
FT                   /protein_id="CBK88079.1"
FT                   /translation="MSDNLIKAEERMLKAIENLESNLKTIRTGRASSQILERVQVDYYG
FT                   SMMPINQLSSIQVVEGTQLVVKPYDRSIIKSVGHAIQAANLGLNPQVEADVIRILVPQL
FT                   TQERREQLAKDAQKYGEEAKVAIRNIRRDANDATKKNKELTEDDRKAELEDSQKLTDDY
FT                   IKQVEQIVNEKKKEILNV"
FT   CDS             complement(356318..357022)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03780"
FT                   /product="uridylate kinase"
FT                   /function="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88080"
FT                   /db_xref="GOA:D4JD08"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD08"
FT                   /protein_id="CBK88080.1"
FT                   /translation="MYKRVLLKLSGEALSGNGQPFDPEVLKSLAAELKDVHELGVDLAI
FT                   VVGGGNFIRGKMMAEMGMNRAQADYMGMLGTVINALAVQNALEQAGVPTRVQTAVEMQK
FT                   VAEPFILRRAIRHLEKGRIVIFGAGTGSPYFSTDTTAALRASEIDADVILMAKNGVDGV
FT                   YDSDPKKNPEAKKFNSLHYMDVLNKGLQVMDSTAISMCMDNDIDLVVFNMNEKGNILKA
FT                   VKQEVTGTLISK"
FT   CDS             complement(357116..358003)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03790"
FT                   /product="translation elongation factor Ts (EF-Ts)"
FT                   /function="translation elongation factor Ts (EF-Ts)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88081"
FT                   /db_xref="GOA:D4JD09"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD09"
FT                   /protein_id="CBK88081.1"
FT                   /translation="MITASQVKELREKTGAGMMDCKKALTECDGDMAKAVDWLREKGIS
FT                   KAAKKEGRIAAEGLTRVATKGNTGILFEVNSETDFVAKNEQFLHLLDVIQNAILDTKAA
FT                   DVDVVLTTSTPEGTIADLITNATATIGEKITFRRVSVVEKADDEFFGSYMHMGGKISAL
FT                   VVLKGETNETVAKNIAMQVASMAPTYVSQSDIPGDVVEHERELQLQMMKADPKMAGKPE
FT                   KVLQGILKGKVDKHFKDQCLLDQEFFLDPKMKVANFLKDNKVELVSFVRFQTGEGIEKR
FT                   EENFAEEVMSQIKG"
FT   gap             358184..358477
FT                   /estimated_length=294
FT   CDS             complement(359660..360223)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03830"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88082"
FT                   /db_xref="GOA:D4JD10"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD10"
FT                   /protein_id="CBK88082.1"
FT                   /translation="MNELIERFLQYIYRRNSQSEKTVDAYKRDLTQFKEYLESQGITNF
FT                   EDVDRLTFMNFLMELRVLPDGTSAKNSTIARKISTYRSFYRYLNEYIGINANPLSSIKT
FT                   PKNKRKIPDFLFLSEIENFLDTYDENDPVEFRDKTMFTMMYACGLRVSELVNLKWQDVD
FT                   LNQRCVRILGKGNKERIVPFFQRI"
FT   CDS             complement(361519..363648)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03850"
FT                   /product="DNA topoisomerase I"
FT                   /function="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88083"
FT                   /db_xref="GOA:D4JD11"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD11"
FT                   /protein_id="CBK88083.1"
FT                   /translation="MKKNLVIVESPSKSKTIEKYLGKDYKVVSSKGHICDLATSGKEGL
FT                   GIDVDHDFEPTYKISKEKKDVVKELKELTKKAKDVYLASDPDREGEAIAWHLARVLDLD
FT                   IDTTKRIVFHEVTKPAILEAMEHPKHIDMDLVRSQETRRMLDRIIGFKLSKLLQNKIRS
FT                   KSAGRVQSVALKLIVERENEIKSFKSEEYWSVHANLKKGTQSFEATLSKVDGKKPKLKN
FT                   EQQASEIVERSKGDFIATSITKRSKKKQPKLPFTTSTMQQEASTKLGFGARKTMSIAQK
FT                   MYEGIDLGGQMQGLITYMRSDSTRLSDLFVKDTLAYIQDEYGKEYVGKAHTKNKANTQD
FT                   AHEAIRPTDIKNTPESIKQYLTNDQYRLYSLIYARTLASLMKEASFNVTTITFEVDGLQ
FT                   YSASGQTMAFDGYTKVYKKYEKQTDELLPEIEENEVFHDVVVEPKQHFTEPPARYTEAR
FT                   LIKELEEKSIGRPSTYATIIDTLQKRGYATLEKTSETSKTKVFVPTKQGMLTDEKLGQY
FT                   FSDVINVEYTADMEKTLDEIAEGKQDSIAYMHQFYDKFAPIVEDAYSKMPKMELEKVGR
FT                   TCPSCGGDLVYRNGRYGKFISCINFPSCRYTENDEAEQENADPNQEEKICPNCGSKMII
FT                   KKGRYGPFWACSNYPECKTIQPLKEKAKPEPTGEMCPECGHELVKRKSRYGTTFIGCSN
FT                   YPKCRYIKKEPKEKK"
FT   CDS             complement(363713..364450)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03860"
FT                   /product="Predicted Rossmann fold nucleotide-binding
FT                   protein involved in DNA uptake"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88084"
FT                   /db_xref="GOA:D4JD12"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD12"
FT                   /protein_id="CBK88084.1"
FT                   /translation="MNEMRKAILYYAIKYQGDWNKIGQAIRSKESFQEIKISESYVTII
FT                   DEAYPLSFRQLRFPPWIIFYRGNYDLLKKRCVGIVGARNCSQKAIENAALVSQRLKQRY
FT                   CIVSGLAKGIDATSHWASLDKDTIGIIGCGIDRIYPYVNKELFLKMYAIQLVISEYPPG
FT                   VAPYARNFPWRNRLIAALSESLIVIEATIKSGTMLTVNEMLELSKPVYCLPTAFNDVRY
FT                   QGCNYLISQGANILSSEKELEYL"
FT   CDS             complement(364493..365101)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03870"
FT                   /product="RNase HII"
FT                   /function="RNase HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88085"
FT                   /db_xref="GOA:D4JD13"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD13"
FT                   /protein_id="CBK88085.1"
FT                   /translation="MLDRPIDFDHWNLHQDVLGIDEAGRGPIAGPLVVAGVCFEKGFTN
FT                   EMIDDSKKLTEKKREALFSLITNEALWYQILVIEEKIIDKKNIYRTTQEAMLEIAHNAP
FT                   VDIVLSDAMPLPSLDKEWESVIKGDQKSLSIAAASILAKVTRDRYMKKLDELYPMYGFS
FT                   KHKGYPTKAHIEALNIYGVLDCHRRSYGPVQKMLEIKLF"
FT   gap             365154..365693
FT                   /estimated_length=540
FT   CDS             complement(366036..366647)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03890"
FT                   /product="signal peptidase I, bacterial type"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88086"
FT                   /db_xref="GOA:D4JD14"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD14"
FT                   /protein_id="CBK88086.1"
FT                   /translation="MKKLKKSSSFRYNEEDERTLLEDILDFLKIFVIGTVLILLFINFI
FT                   AHPVTVYGKSMDPTLKDGEIGFTNIIGTLLTEPERGEVVVVRMTDPDTQETSHWVKRII
FT                   GMPNETIECINEQIYINGEVLDESEYIDENYKQSMIDQFGYFNMDFGPITLGEDEYFVM
FT                   GDNRPYSKDSRDTSVGPVHKDQIFGKNVIVIFPLSEMGVK"
FT   gap             366767..368854
FT                   /estimated_length=2088
FT   CDS             complement(368917..369294)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88087"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD15"
FT                   /protein_id="CBK88087.1"
FT                   /translation="MKIFLTILCCLFLFSGCAKPQESLKQVDSNILDQYSMVEKKEDSI
FT                   YLISGANNSYVVFYKMNVDPESVNMGIKDKEYSISFNTGDKIDTLVYELNFKRSEDSKL
FT                   ILIEDGHEVSFETVILSSKNT"
FT   gap             370057..370515
FT                   /estimated_length=459
FT   CDS             complement(371185..372651)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88088"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD16"
FT                   /protein_id="CBK88088.1"
FT                   /translation="MFYANILFHFFKKQSNLCYHLIMKTLKISYIFLILPLILGIIGLT
FT                   EAQIPMSDALFYSFSMYFVAYEGPAYNYYVEAARWLAPIMTFSSVLMFFSYYRQRIYNY
FT                   IKYQRNDSVVLYGNAELCSIIKQSLNNPIIETEDFEFVKAHRYILCGAEEENLLFYENH
FT                   KEKLRDKKVYIQCETLRSQLISNDNVKLFNMNEISARLYWNKFDIKKILANIKDAHIVL
FT                   IGFGNLGKEIILQALQNNIFDPGQHITYDVFGEEEHFTSIYSSLANISDTVVFYDHWES
FT                   HLDLINKADVVIVCEQNNQLSIIQTLLMQTTINEIEVFADNPSIYDLLSEQNRLNIFDF
FT                   KQLALTKENIFNERTLDVAKRLNLRYAHLYNNVEENEVNKELEWNKLDTFTKYSNISST
FT                   DYHVTRLKLIQDWDLNNLTDERIDYLAHLEHIRWSRYHYLSNWKYGIPANGKNKDSKQK
FT                   IHIDLIPYEKLSKVEKDKDRDTVKLLLEFK"
FT   CDS             complement(372660..374075)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03940"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /function="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88089"
FT                   /db_xref="GOA:D4JD17"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD17"
FT                   /protein_id="CBK88089.1"
FT                   /translation="MAFESLSERLNKAIKNISGQGKLTEKNMNEMLKEVRLSLLEADVN
FT                   YNVVKEFVENVKEKALGQEVMDSLNPGQMVVKIVRDEIQTLLGEEDAKINFKKQGITTL
FT                   MMVGLQGTGKTTASAKIARYCKQKLAKRVLLVACDVVRPAAIEQLQTLGKSIDIEVFTL
FT                   GAQTPAVETARQAMRYAADRQKDLVIFDTAGRLHIDDELMNELSEMKELVKPDDILLTV
FT                   DAMTGQDIVTVAKEFNERLSITGLVVTKMDGDARGGGLLSVRSITNVPVLFVSSGEKVE
FT                   DLEEFHPDRMADRILGMGDIVTLVEQAQEKLDMEVQQKTAKRMQQGVFTFNDLLDQFGQ
FT                   IQKMGSMQNMLKMIPGMGKMVNKVDDDQVNDSMKKNKAIILSMTPFERENPSCLKASRK
FT                   NRIAKGAGVKVMDVNKLINQLEQMQMLTKVMNGGKMPNMNALSNMQRGAGMPGMSKHTG
FT                   SKKQKKSKKKKKK"
FT   CDS             complement(374113..374613)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88090"
FT                   /db_xref="GOA:D4JD18"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD18"
FT                   /protein_id="CBK88090.1"
FT                   /translation="MKVRLATIEDMPVLLEIYQRARVFMMQAGNPNQWPEGHPSKDELL
FT                   EEMRQDRFYVLESEGIIQASFVYYQGIDPCYKIIYDGEWLNDEPYAVLHKVATRGLKRH
FT                   MGEEILNYAFKHNKNVRIDTHEDNIPMQNLLTRHGFKHVGTIILKNGEPRWAYHWCKDC
FT                   NFS"
FT   CDS             complement(374610..375551)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03960"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88091"
FT                   /db_xref="GOA:D4JD19"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD19"
FT                   /protein_id="CBK88091.1"
FT                   /translation="MPLVSILVPVYNVERYLSRCLDSLVAQTYKDIEIIIINDGSTDNS
FT                   RDIALLYSKRFNNIYVYDYENAGISTTRNRALDKAHGDYVMFVDSDDFLARRAIERMMD
FT                   VVQREHCDIVACGYVMDFGLFPLFRKVAPKKTMTSLEALHNMVSNKGVNNYPWAKLFSK
FT                   KCFDNVRFPSGTRGFEDTRTIFKAFHNAKKVCTIPNRYYHYVQRRGSLTNHMDLDTVYD
FT                   MRKAYEYQEAYLHKLYPDEKFSFDSNYYNSDMVILYTLIFFYSKKDNPVYIPANIDWKK
FT                   INPILCVAYHIWLSIARFKLGWSYDRQLENKQ"
FT   CDS             complement(375562..376290)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03970"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88092"
FT                   /db_xref="GOA:D4JD20"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD20"
FT                   /protein_id="CBK88092.1"
FT                   /translation="MKVRHWIYFIAGFLVFWLILSCLINNIYILPSPFMVIEIMIKLLF
FT                   ATSFYSSVFMSVFRAVLSVIVSFIVAVLVAIISLRNHFISSLLEKTILILRSIPNVTYV
FT                   ILLLFWVSRETMVFIVSFLLLFPIIYQNIFESLKEQENLWHDVLMIYPQSMYVTVTRIY
FT                   IPLMKSAVVSSLISASSLAFKVGVMAEILGQVQTGIGRQIQLARLDIDLASVMAWTIWL
FT                   ILIVFVFDALIKKLLHLITR"
FT   CDS             complement(376340..377719)
FT                   /transl_table=11
FT                   /locus_tag="EC1_03980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88093"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD21"
FT                   /protein_id="CBK88093.1"
FT                   /translation="MQEKMQDLIIEQIENDDLENAEHSIQEYCFEYGKDEFYYMASSDV
FT                   LLANEEYDYVIELMNDALEDGIENDIVYERLGDAYFGLQDFENAIQSFKQCHLEQDDPN
FT                   LMHTIYMIGLSYFHLQDYDHAISYFEDVLLENETPEVLYNCAVSYLCIGKVSRAMDYFE
FT                   KLLDNDYLIEPICQELIFANCFDEADQIAQKTNMISSASLSRIKADYLFTNNRLDEALP
FT                   YILEALKEINSDALKYNLASIYEKNNDFDNANILFHEIIENYELKDDEPFDFVLAHTEA
FT                   LKHLNISNIQYLRCLEPYVQDNCGAFTLLLKFALDHDLDDYQDYLLNDVNHTEPESDSE
FT                   YIFYMMILLDIHLKHKRYEMVVDIFDHIPKEYQTYFLTHKLKALYQLEDYEGVIGMYDD
FT                   VMPDGYNAIIILKACLKLERYSVSNRLFNDMLQVDPEKVEGKKIFWEYVVDHVDSSFNL
FT                   E"
FT   CDS             377852..379189
FT                   /transl_table=11
FT                   /locus_tag="EC1_03990"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_03990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88094"
FT                   /db_xref="GOA:D4JD22"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD22"
FT                   /protein_id="CBK88094.1"
FT                   /translation="MERKYLNSQFWKYILPSMFTMLLSGFYSIVDGLFVGNSVGNDALA
FT                   AINLVYPIQVILNASAIGIGIGGAVALSYFSGRDETKSADRSLGSTITLLIVVGIVLSI
FT                   VLFFATPTLLEILGASGTIYEYAYDYIFVILCGGLLPVLGNGLSPLIRNYGKTIVATIC
FT                   MNSGLVTNIVLDYIFVFLMEMGLSGAALATIIAQGVVALSCLVFLYASKLKEISLHCYV
FT                   PSVSLIKRIITVGISPFGQTMIPCIMIILTNWTCIMYGGNDALTIYSVISYVLSSAQLL
FT                   LQGIGDGVQPLLSYYHGKGNKDVIHYLYRKAFFVSLGVSVILFMGVYLFNEPLTGLFGV
FT                   SHSLYDGTKLALIITALSFPFIGISRLTSAVFYASGRSKNSTFLVYIEPCLLLPVFLIV
FT                   FSSLFQLTGVWCAYPATQVVLSVIALVLQSPNLVADHEKKIVEVSI"
FT   CDS             379230..379736
FT                   /transl_table=11
FT                   /locus_tag="EC1_04000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88095"
FT                   /db_xref="GOA:D4JD23"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD23"
FT                   /protein_id="CBK88095.1"
FT                   /translation="MKIAIVFSSNTGNTEYLAQGIKEVVRKNDLVYFGKFQEGIDADLY
FT                   FVGSWTDKGCCSEEIKSLLSSLKNKKIAYFQTAGFGGSQAYFKRLLDTVMKLIDSSNEF
FT                   LGSYFCQGRMPDSVKNRYLMMLEKNPNDERILASLDNFEKAKSHPDFDDLKRIKEWAHS
FT                   MIDTL"
FT   CDS             379830..381110
FT                   /transl_table=11
FT                   /locus_tag="EC1_04010"
FT                   /product="Alcohol dehydrogenase, class IV"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88096"
FT                   /db_xref="GOA:D4JD24"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD24"
FT                   /protein_id="CBK88096.1"
FT                   /translation="MNKLKSVYCRVFQTCFKIAIPVLPYRKPETISSLDKLPDVLKKEQ
FT                   CSRVLLVTDAGIIKVGLHLPIIEALTNAGYQVSVYDKTQVNPTVENVEEAVKLYHENGC
FT                   QGIIALGGGSSMDCAKGVGIRVVRKRTPLSKMKGVLKVLHKLPVLIAIPTTAGTGSECT
FT                   LAAVISDPANKTKYAIEDFCLIPKYALLDARMTTSLPPFLTATTGMDALTHAIEAYIGR
FT                   STTKDTREASLQAISLIYENLFEAYHHGDDLKARENMAHAAYLAGWAFSKSYVGYVHAL
FT                   AHALGGRYGVAHGYANAILLPVVLRGYGTKVYPALKDCAVAAGLADVTTDERIAAIRMI
FT                   ESIEEMNNVFDIGSSIEEIQVEDIPELCHHASKEANPLYPVPVLFDEKELERFYLDIVK
FT                   KESVVWSPVRSKKSFKAKETTLIPERP"
FT   CDS             381041..382408
FT                   /transl_table=11
FT                   /locus_tag="EC1_04020"
FT                   /product="NAD-dependent aldehyde dehydrogenases"
FT                   /EC_number="1.2.1.3"
FT                   /EC_number="1.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88097"
FT                   /db_xref="GOA:D4JD25"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD25"
FT                   /protein_id="CBK88097.1"
FT                   /translation="MESSQIQEIIQSQRNYFNSGKTLNVDTRIEYLKKLKRVILEKEDQ
FT                   INEALYKDLGKTSSESYMCETGMVLSELSYMIRHTKKFARKHRVMTPLAQFHASSYQMP
FT                   CPYGVVLVMSPWNYPFMLTIDPLIDAIAAGNTVMVKPSAYSPYTSQIIEEILTNVFPKE
FT                   YVSVILGGRKENQALLEEKFDYIFFTGSPYVGHEVMSKASVHLTPVTLELGGKSPCIVD
FT                   ETANIKLAARRIVFGKYLNLGQTCVAPDYIYVHTSVKDKLIHEVIQEIKRQYQDLSSYG
FT                   KIINEKHFDRISKLLDPNKIVYGGKTNRETLKIEPTIMDHVSWDDAVMQEEIFGPIMPI
FT                   LTFTNFEDCINIIKEKPSPLALYLFSSNKTRVDMVTHSVPYGGGCINDTIIHLATSNMP
FT                   FGGVGNSGMGGYHGKEGFKTFTHYKSIVDKKTWLDLPIRYQPYSKLYDKLIHIFLR"
FT   CDS             complement(382430..382798)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88098"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD26"
FT                   /protein_id="CBK88098.1"
FT                   /translation="MTIFFYDILIDRGIKYEEKKIIIFAIILIIATTGFFYLKPKPETT
FT                   VDQEWYTIENITFDQENNKISGTSISPYEGEIEVYLPDGIDTSKLKDGQNVQVLAGPGM
FT                   TMSLPPQLMNCQEIKIIE"
FT   CDS             382918..383361
FT                   /transl_table=11
FT                   /locus_tag="EC1_04040"
FT                   /product="Preprotein translocase subunit SecA (ATPase, RNA
FT                   helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88099"
FT                   /db_xref="GOA:D4JD27"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD27"
FT                   /protein_id="CBK88099.1"
FT                   /translation="MAGLFSKLFSEEQRELASLEKMADKVISYEPEMQKLSDEELADKT
FT                   TEYKERLANGETIDDILYEAFATAREMAYRQLGEKPYKVQIMGAIAMHKGDIAEMKTGE
FT                   GKTLTATMCVYLNALAGKVFMLLRSMNIWLAVTRTGWGESIVL"
FT   CDS             383337..385313
FT                   /transl_table=11
FT                   /locus_tag="EC1_04050"
FT                   /product="protein translocase subunit secA"
FT                   /function="protein translocase subunit secA"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88100"
FT                   /db_xref="GOA:D4JD28"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD28"
FT                   /protein_id="CBK88100.1"
FT                   /translation="MGRIYRALGLTVGVNKRELNAREKREAYECDITYTTNSELGFDYL
FT                   RDNMVTSVKDRVMRGLHMAIIDEVDSVLIDESRTPLIISGGKKQTANLYIQADKFVKTL
FT                   EAPEYETDKFTHEKTLISGDYDIDQKTRQIMLSEAGVEKAEKYFKLDNLYDINHTQLVH
FT                   HINQALRANYIMMKEVEYVVSDNQEIVIVDQFTGRMMPGRAYSDGLHQAIEAKEGVPIK
FT                   EETSTLATITYQNFFRLYEKLAGMTGTAKTEEEEFLSTYNMRVVVIPTNRPVIRKDLPD
FT                   EIYAHKDDKYRALVREVKALYEKGQPVLVGTIAVETSELISEMLKKEGIPHEVLNAKNH
FT                   AREAEIVAMAGRPKSVTIATNMAGRGTDIKLTEESRKLGGLAVIGSERHESRRIDNQLR
FT                   GRSGRQGDPGFSRFFVSLEDSLMVRFGGEKLQKLFEKMGDEQIESKAVTKSITMAQKRV
FT                   EGYNFDMRKQLLDYDDVLRRQREIIYAQRNRILESEEVHEMVHVIFEKTLDQTLQANIL
FT                   DEKKQTVDIPGLCKSLEMTGLTEDRAIHAQELEGLKYEEIKLHCLDRIWNDYEKEIEPV
FT                   KMQFLPFEKTVVLRNIDRNWIEHIDRMDKLRSGIYLRSYAQNNPLQQYVQEGFDMFEDM
FT                   NKRIDREIAFFLLKVRIRRETKA"
FT   gap             386847..387709
FT                   /estimated_length=863
FT   CDS             388221..389582
FT                   /transl_table=11
FT                   /locus_tag="EC1_04090"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88101"
FT                   /db_xref="GOA:D4JD29"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD29"
FT                   /protein_id="CBK88101.1"
FT                   /translation="MIVKTIQEIADMLNCDLVGEDKTSLIQGVGIDSRQITENALYIPL
FT                   IGQRADGHTFIDSVIQKGVKATLWQKDHTPYPEDITCILVDDTLEALQNLAKAYLNTLS
FT                   CLVIGVTGSNGKTSCKDMLYSIFSQEKKTQKTQGNRNNEIGLPLTVLDLDKDVEVAILE
FT                   MGMENKGEIDFLTHIARPDVSIITTIGSAHMENLGGKKQIAQAKLEILENLKPGGLFLY
FT                   DKESPEIQECLLEMDIDPSKRLVSFGFNGDISIISSIDYTENGIEFYCSSLTDKITLNA
FT                   LGDFQAKNALPCIYVALDQKISTSSILKGLKDLEMTKMRTALLKVHDAKIIDDTYKSNP
FT                   ESAKAAIDTLMKVQAKKHIAVLADMLDLGPEENDLHAMIGCYAVEKNVDTVYATGPLSK
FT                   YTIKACTNIESKWFETKDEIVEELKHLLNEDCAILIKGSRAMHMDEIVDKLKEM"
FT   CDS             389588..390631
FT                   /transl_table=11
FT                   /locus_tag="EC1_04100"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88102"
FT                   /db_xref="GOA:D4JD30"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD30"
FT                   /protein_id="CBK88102.1"
FT                   /translation="MLKLGVVFGGQSSEYSVSLHSVASFLRQIHNEKYDITMIGIDQNG
FT                   QFYVYDGSIDDIEHDHWIPQATKAAWVHKGIMALDGKNTVKELDCVFPVLHGKNGEDGC
FT                   VQGLLELMNIHYVGCDVMSSAISMDKEIMHILCDEANIPCADYVCLKANEENPSFEMIQ
FT                   EKISLPWIVKPCNAGSSYGVHKVENKEEFEEACKDAFFYDGRGKILVEKAIEGFEIGCA
FT                   VMGNEEVFTGSCDEIQISGGIFDFEGKYEMKGAEIICPARIDEETFAKAKALAAKTYKA
FT                   MNCCGMARVDMFVTPQKEVILNELNTIPGFTATSRYPSMMKEAGIEFGDLIDKLIDLAM
FT                   QRTISAC"
FT   gap             391268..391691
FT                   /estimated_length=424
FT   CDS             392190..393206
FT                   /transl_table=11
FT                   /locus_tag="EC1_04130"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88103"
FT                   /db_xref="GOA:D4JD31"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD31"
FT                   /protein_id="CBK88103.1"
FT                   /translation="MKVKRKYAAIDIAKYVSALLVVCIHTYPFYEISETFNTFFMQTIC
FT                   RIAVPFFFTTSGFFFFRKYGDDSEENTKNLRKYLMRLLKIYLIWTVIYLPYTIWDQYQA
FT                   GFSILGVFSYIRDFFLNGSYYHLWFLPALMLASVIVFYLYKEKGLVFTLKVSLGAYFIG
FT                   YLINVYTPVWESIPGINFFFAFFTKTLVTARDGIFFGPIFVSLGLLLAKTGRLPSRTSL
FT                   GGFVISFLLVVVEVLIYNMTGILRDLTSMYLFLVPAVYFLVNWLLTIKMPYKPIYKVLR
FT                   NDSLLIYTSHILFAKILLALMPNAHIVVYFLTIALAQTFASLVMYYKGRFPVLENLL"
FT   CDS             393210..393401
FT                   /transl_table=11
FT                   /locus_tag="EC1_04140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88104"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD32"
FT                   /protein_id="CBK88104.1"
FT                   /translation="MIRVFQVKCAYENEAEAQLIKKLHIKKEDLLGYTIHRRSVDARHQ
FT                   KVLFSYVIDCSLKNEKKF"
FT   gap             393645..394729
FT                   /estimated_length=1085
FT   CDS             395799..396323
FT                   /transl_table=11
FT                   /locus_tag="EC1_04170"
FT                   /product="HAD superfamily (subfamily IIIA) phosphatase,
FT                   TIGR01668"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88105"
FT                   /db_xref="GOA:D4JD33"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR027706"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD33"
FT                   /protein_id="CBK88105.1"
FT                   /translation="MALLKPKYYVSSFEHMSIERLKQQGIKLLLCDIDNTLVSYDEKHP
FT                   SPSVIAFIDRVKSSGIEVALCSNATKERATRFSKDLNVSTTYYFSMKPLPKNFIQAMKK
FT                   HNLKANQVAIIGDQMFTDILGGNLAGLYTILTAPIAVKDRGVTKINRFFENIVYKVLEH
FT                   KGDFKRGEFDD"
FT   gap             397214..398202
FT                   /estimated_length=989
FT   CDS             398355..398603
FT                   /transl_table=11
FT                   /locus_tag="EC1_04190"
FT                   /product="Uncharacterized homolog of plant Iojap protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88106"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="InterPro:IPR025656"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD34"
FT                   /protein_id="CBK88106.1"
FT                   /translation="MDSMIVVSTTNIRQNNAIAQNIKDRLKENGFDGTIRIEGNADSKW
FT                   LLIDLKEIVVQLFVKDERQVYQLDRLYRDVPVIEYDL"
FT   CDS             399304..399615
FT                   /transl_table=11
FT                   /locus_tag="EC1_04210"
FT                   /product="Uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88107"
FT                   /db_xref="GOA:D4JD35"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD35"
FT                   /protein_id="CBK88107.1"
FT                   /translation="MIIGIAGGSGSGKTTFTNAIKEMFKEDVLIIRHDDYYKDHSNLSF
FT                   EEKKHINYDHPDALETNLLVEHVKQLKDGQPIETGNTGTAKIIGKKNHGKVKGGRNHV"
FT   CDS             399608..400393
FT                   /transl_table=11
FT                   /locus_tag="EC1_04220"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88108"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD36"
FT                   /protein_id="CBK88108.1"
FT                   /translation="MCKVISVVNQKGGVGKTTTTVNVGIGLAREGKKVLLIDADPQGSL
FT                   TASLGYEEPDDLRITLATIMMDVINEEEINLEDGILHHQENVDLLPANIELSALEVTMG
FT                   NVMSREMIMKEYIDAIRSRYDYILIDCMPSLGMMTINALVSSDSVLIPVQAAYLPVKGL
FT                   QQLIKTILTVKKRLNRKLAIEGILLTMVDFRTNYARDIASRVHTTYGSQIEVFENVIPM
FT                   SVKAAETSAEGKSIYMHCPKGKVAEAYMNLTQEVLKNEK"
FT   CDS             400383..401294
FT                   /transl_table=11
FT                   /locus_tag="EC1_04230"
FT                   /product="ParB-like partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88109"
FT                   /db_xref="GOA:D4JD37"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD37"
FT                   /protein_id="CBK88109.1"
FT                   /translation="MKNRSGEKIKLASIDELLGVVNEESAMEIEISKIHPFKNHPFKVL
FT                   DDEKMQDLVESVKINGVLTPVLLRMDENEDYEMVSGHRRMHAAQLAGLTTIPAIVRELS
FT                   DDDAIVAMVDANIQREELLPSEKAFAYKMKLDAMKRQGSRTDITSGQIDQKLKPVISRN
FT                   ILADQVGESSKQIQRYIRLTELIPELLDLVDNKKLQFTVAVDISYIDKEVQGWIYEYIS
FT                   DTGFIKPKQIAALRNQLNDGPINQIQMLSIFNNCVMAKKVSRSLTFSEKKLTKYFPDDY
FT                   TAKDMEQVIESLLEKWMQEQSC"
FT   CDS             401373..401642
FT                   /transl_table=11
FT                   /locus_tag="EC1_04240"
FT                   /product="Replication initiator protein A (RepA)
FT                   N-terminus."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88110"
FT                   /db_xref="InterPro:IPR010724"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD38"
FT                   /protein_id="CBK88110.1"
FT                   /translation="MEKKMTFNYFYGTEADQFSFYRIPKALFTDSYFKDLSSDAKILYG
FT                   LMLDRMSLSIKNQWFDDKNRAYIYFSIEDIMELLNCGRIKPSNP"
FT   CDS             401639..402370
FT                   /transl_table=11
FT                   /locus_tag="EC1_04250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88111"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD39"
FT                   /protein_id="CBK88111.1"
FT                   /translation="MRELDDETGIGLIEKRRQGFGKVNVIYVKTFMPEKTDEKKFEEEL
FT                   KKFKKQTSLENEESTEVYNSNFMKSQNQTSRSPENKLQEVYNSNPNNTNLSDTEMNDNK
FT                   SNHIISMDEKRFDSDNRSEDYQAYENLVKETIDYESLEVTHHDDMRQVDEIVNLIVETV
FT                   MCKNDKILIASNWYPASLVKKKFLMLTYSHIEYVLHCMSGNTTKVKNIKKYLLAALFNA
FT                   PSTMNGYYQAEVNHDMPGLVR"
FT   CDS             402380..402676
FT                   /transl_table=11
FT                   /locus_tag="EC1_04260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88112"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD40"
FT                   /protein_id="CBK88112.1"
FT                   /translation="MFILKLAGKILLLPVRMILFVIGLAVKMTVQTYAVVRGILGFIFT
FT                   LLIIATAYCYHDWVQVAFLFSLSVILYLILFAGVFVDTVLDMTRERIIDFIIS"
FT   CDS             402690..403088
FT                   /transl_table=11
FT                   /locus_tag="EC1_04270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88113"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD41"
FT                   /protein_id="CBK88113.1"
FT                   /translation="MSENNDYIQLPPLKKDTPSDVVAFMWEYMKVPEDSREKVKNLLKD
FT                   ANENGVKLSHQAPTLYDVVPKEEITEFEELMRKTIADIVSEASSIACWVYVQKYVKQKT
FT                   LDEMLQELPGAGQFIIVMDTWFERLMAE"
FT   CDS             403190..404386
FT                   /transl_table=11
FT                   /locus_tag="EC1_04280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88114"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD42"
FT                   /protein_id="CBK88114.1"
FT                   /translation="MKINIAEQLLPEVYNRHGKDCYLDPIRQKLIYITPEETVRQRMIS
FT                   YLVNELKVPKGAILVEEHLSHYNVPSKKRADIVVHGKKDETQYPVLIVECKAPDVFLDE
FT                   KAHQQVFDYCNLINADYAIVCNGSILYCYKYIEDTDSYEELNSVPDYAEMLEGKYDVIT
FT                   KESIPERMPYERMESYLKEVFAEYPDDYYGETISKSTPFNIAKAAFNFEEALFDIRHKL
FT                   PKKDFGIFELIEDYGIRILSYGNAGGGYFGGPYRSFLIEYKGNIEFISFAFSTYARTEK
FT                   TGIVKTCLNIAHDDEKETHHALQLSFDDNIQVIGDKVTIYHSGRIAIGNKGSGKIDELR
FT                   QFVAERYPKIIDGKRFNLGSLKNDYQWNIDQPDVTEVIVNLISYALIRDEYRDYIKQQ"
FT   CDS             404403..404537
FT                   /transl_table=11
FT                   /locus_tag="EC1_04290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88115"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD43"
FT                   /protein_id="CBK88115.1"
FT                   /translation="MQIVLKLGMLTIEEIETELMNNFQFLKLRNRNLWRKQTWKIINQ"
FT   CDS             404516..404686
FT                   /transl_table=11
FT                   /locus_tag="EC1_04300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88116"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD44"
FT                   /protein_id="CBK88116.1"
FT                   /translation="MEDNKSMTVKKTVKSGITFGSALAMVISYTTWKSVGWAIFHGLLS
FT                   WVYVIYFLLRY"
FT   CDS             404723..404908
FT                   /transl_table=11
FT                   /locus_tag="EC1_04310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88117"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD45"
FT                   /protein_id="CBK88117.1"
FT                   /translation="MAKKEERFEVTFRDGSQLKDEGVRQILVDKETGVNYLCWKSGYGA
FT                   AITPLLDSEGKVIVTK"
FT   CDS             404933..405328
FT                   /transl_table=11
FT                   /locus_tag="EC1_04320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88118"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD46"
FT                   /protein_id="CBK88118.1"
FT                   /translation="MYFTDEKDYIMRMIKEMVRVLFSLMFGKKYVSVELEKENKYEVSG
FT                   KNLKDFLDMIDSGEINEAENILLDSIDYTDRNEVMAAALFYQYLSEKDSEFLKNNNYTK
FT                   EEVMSGFKQLLMQSGYTDLLCLVKAEE"
FT   CDS             405383..405697
FT                   /transl_table=11
FT                   /locus_tag="EC1_04330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88119"
FT                   /db_xref="InterPro:IPR017259"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD47"
FT                   /protein_id="CBK88119.1"
FT                   /translation="MFYIVFDFMMAVIMFLFGMWFYKSEGKATKFLSGYNMKSADERKK
FT                   YDENAMCKAYGKRMMFMSVPFIIGIIIDIQYQGIGCWIAWGIWLIMFVLLLIDRHKRER
FT                   "
FT   CDS             complement(406578..406997)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04350"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88120"
FT                   /db_xref="GOA:D4JD48"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD48"
FT                   /protein_id="CBK88120.1"
FT                   /translation="MTFGEKVRSLRKEKKMSQQELASMVGVSYRTIRSWEVEGRFPKQN
FT                   VLYQKLADALQCDVSYLMSEDEAFITEASEQFGNRGARQAQQILEQAAAMFAGGSLTDE
FT                   DKIAFMDEIQSLYLDSKRRAKKFTPKKYLKNQEEK"
FT   CDS             409240..409467
FT                   /transl_table=11
FT                   /locus_tag="EC1_04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88121"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD49"
FT                   /protein_id="CBK88121.1"
FT                   /translation="MGSGAIKWHVHCSVCGAFIEKSAQSDSEVECKKCRSTLEIFVKDD
FT                   MVSVRPIHIRDEQLKSRMRTYSRKMMNQGS"
FT   CDS             409817..409963
FT                   /transl_table=11
FT                   /locus_tag="EC1_04400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88122"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD50"
FT                   /protein_id="CBK88122.1"
FT                   /translation="MTEIEYQEFVRHCPYDAMGDYSMFRKEQTENKSEDAHSNWISQAI
FT                   WQT"
FT   CDS             410125..410745
FT                   /transl_table=11
FT                   /locus_tag="EC1_04410"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88123"
FT                   /db_xref="GOA:D4JD51"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD51"
FT                   /protein_id="CBK88123.1"
FT                   /translation="MLTLKELKKIVKVADMEKRIPSVKSLKEHKVVVKEMINADTTISV
FT                   YDHGYVLYTAGNQSTVFPLHSCDDYEYVSVTGDNKEFNKEFFDNENWYIRLLMEAEDRM
FT                   AYSQSKISTNHGVFSNSDVTDDAEIMRGSSKDFVDDVIDREILNALIKELTERQKTVLN
FT                   LVYFEEMRQQDVADYLGIKQQSVNDLLNRALKTMKKKAENEEF"
FT   CDS             411218..416479
FT                   /transl_table=11
FT                   /locus_tag="EC1_04420"
FT                   /product="Cna protein B-type domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88124"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD52"
FT                   /protein_id="CBK88124.1"
FT                   /translation="MNVKKKARRVMSGLLTAVTVLSTVLSPAVAYASDDAGSVKKIPYY
FT                   EEIKDQLDEDEVVTAKDYEIKVGDNFDVKSDYTGLTIQDDSKVKVTFQEAKDTDGNDFS
FT                   TDYANSYKAVYYVEPQTTDHPTYQINRKIVVKEADQQKDSQSESSSDQDAGSSDKTETE
FT                   DSEADSSTEGTDAADTESKTELTEKEFDAEIEATEDQETVDPETGITLSEVMQEAVDQE
FT                   VALADLEAGESITFDMPMMLASGETGTKSVTVTAGSWYYYADYGLGSYLTCPYYVKWGS
FT                   INATAYCVEPSKKGPGNGTYTIQKLADGKTLAKVCYYGTKASDENGFFDEKHPDFPAGK
FT                   RFIITHLAAAYANGSSDWASGTNATGKNLAMELYNYCVNMPDIPSVDMSFSESNVKAYV
FT                   EGNSQRTSVITFKADKLQTITFKLPSGVKLVNVTTGKTSAAGASVEISGGTQFYLTALL
FT                   DQAESVSATFSSRMKGSIDKEYSAYKIVTGSGTQDLALVFGEGVGNEKYVDFKVTWTKE
FT                   CKVSIVKKDQDTGNALAGAVYGIYSDASCTKLIAEMPATDQNSASQLTMEKTQEVVYLK
FT                   EISVPTGYQIDTKSYNVTLAIGKTTTKNVTDKRVNAKINIAKQDAETGNAAQGDATLEG
FT                   AVYGLYAREDIVHPDGRTGTIHKKDSLITSLTTDKNGEASVSDLYLGKYYLKELSAPVG
FT                   YVLDPTEHEVDCTYEGATVPTVERTSVCKETVVKQPFQIIKAANNGKTDADLLKGVGFS
FT                   AWLVSDLKVKADGSYDFDSARPVVLTADGQAEMFTDEKGYARSIPLPYGTYVVRETTSK
FT                   HNYAPVDDFIVKITENHPDTPQTWRVLLDKEFKAKLKIIKKDAETQKSVLLANTEFKIY
FT                   DLDNQKYVEQTTSYPKPTVHKSYFTNEEGYLVLPKNLKPGNYRIEEVTAPDGYTISKNY
FT                   VTVAVDTDTAYLTDPVTGDAVIAVEYTNAPVKGQLKIYKQGEVLKGFDKDFQYEMAGLA
FT                   GAEFEVYAAEDIYTADHQVDADGQRTLYFAKDALVATVTTDADGYATVKNLPLGRYYVK
FT                   EKNAPDTHVLNTVPENVEFAYADQDTAVIEKEISVTDERQKVSITVEKQDAETGNTVAG
FT                   AVFGIYNAKDIQTKDGKVIVKVDTLLQEMTSDEKGQAACTLDLPLGSYYVKELKAPNGF
FT                   VSSDEVLRFDASYQGQDVQTVTLKSVKKNQPTTVEITKSDATTGVELDGAYLKVTDKDG
FT                   NVVDSWTSSKDAPHVIKYLKVGETYTLHEEFAPHGYLVANDVTFTVKDTGEVQKVEMKD
FT                   EVPVGELIINKKGEFLDSVTLADKVKGVVEHIFNYVTGKLTDVTFEVYAEEDIKAADGV
FT                   SDDYYKKDELIATIKTDETGIAKLENLPLGKYYVKETGTAYGHVLDGEIRHVDLTYVDQ
FT                   NTPVVVYDKDWQNNRQRVEVSVLKKEKDSDRTLEGAIFGLFAKEDIKSETTGKVLIEAD
FT                   EIIELKSTDEEGKITFVADLPIGATYYVKELYAPDGFVTNDEVKEFTFEYVGENQPTVT
FT                   YDFTFDNQPTVVEFAKSSLTTGKELPGCKLKVVDSDGNIVDEWTSGKEAHVIRELTVGK
FT                   EYTLVETKPADGYVTAESVKFTIKDTADVQKVEMKDDVTKVKISKQDIAGKELPGAKLT
FT                   ILDQDGKVVESWTSTEKAHYIEMLPIGKYTLREETAPDGYLVAKDVEFEVKDTGEVQHV
FT                   TMVDEEKPAEKTPEGGKPVSDSPKTGDNTNLWLWFMLLGIGATGTGALAFMRKKKH"
FT   CDS             416536..416694
FT                   /transl_table=11
FT                   /locus_tag="EC1_04430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88125"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD53"
FT                   /protein_id="CBK88125.1"
FT                   /translation="MGETMRNIIIFVALLGAAAIFTVLYCLIAVGSQAEKKLTEIMRKE
FT                   EERNEDK"
FT   CDS             416681..416959
FT                   /transl_table=11
FT                   /locus_tag="EC1_04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88126"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD54"
FT                   /protein_id="CBK88126.1"
FT                   /translation="MKTNKDLIIEPNAAIEGRKYSEEKPWSCKYCYWWEGKKKGCSLKQ
FT                   CHYLLAEKKKAVKTTPCSGCPYGKHVPCIGYCIARLHSEMKGKKGRG"
FT   CDS             417520..418323
FT                   /transl_table=11
FT                   /locus_tag="EC1_04460"
FT                   /product="Type IV secretory pathway, VirD4 components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88127"
FT                   /db_xref="GOA:D4JD55"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD55"
FT                   /protein_id="CBK88127.1"
FT                   /translation="MMREKLQKIQVKRLVILNLPYFFIFYVADKGSWLYRHCLGESMVQ
FT                   RLGVMLVNFRLAFLSWLPSIALQDLTVGVLVASALKLVVYYRSKNAKKFRQGVEYGSAR
FT                   WGNRKDIEPFMDPVFENNVILTETERLTMNSRPKAPKYARNKNVIVIGGSGSGKTRFYV
FT                   KPNLMQMTDHVSYVVTDPKGTIIVECGKMLVNGGYRIKVLNTINFKKSMHYNPFHYIRS
FT                   EKDILKLVNTIIANTKGEGEKSTEDFWVSATRSQAVKSLRTVLVY"
FT   CDS             418982..420889
FT                   /transl_table=11
FT                   /locus_tag="EC1_04470"
FT                   /product="Retron-type reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88128"
FT                   /db_xref="GOA:D4JD56"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD56"
FT                   /protein_id="CBK88128.1"
FT                   /translation="MPKKSKTLCVDDLRHAEYYGMQGTFDELYQKSQSGEVFENLMDLI
FT                   LSRDNILLAYRNIKANKGSYTAGTDKKNITDIGSQTPDDVVKRVRFIVTGSEHGYRPKP
FT                   VRRKDIPKPNGKTRPLGIPCIWDRLIQQCIKQIMEPICEAKFCNNSYGFRPNRSVEHAI
FT                   NRTYTMLQMMNLHYVIEFDIKGFFDNVNHSKLIRQIWSLGIHDKTLIFIIKRILTAPIK
FT                   MPDNTTVLPNKGTPQGGIISPLLANIVLNELDWWIASQWEENPIAISRGRERIIGKTKV
FT                   FDKSHGYRIMKNTEMKEMHIIRYADDFRIFCRTKEDAVRTKEAVTAWIEERLKLEVSPE
FT                   KTRIVNTRKRWSEFLGFKIRVRLKHHKYVVQSAICDKKVEIERAKLVEQAKNIAKPREK
FT                   KSCLSEIQLYNSMVLGIQNYYQLATCISIDCRELHRRVMTVLTNRLNTETGSMLKHEGG
FT                   TITQAEKERFGQSKMIRYVSGIDQMIYPIAFIKNKIPMAKRSIVCSYTKEGRAPIHTEL
FT                   NLNQYVLKGLREKISVGHSTEYHDSKISLFSAQKGKCAISGEEFADAEHVAVWLKVPRA
FT                   LGGFERYKNMVLIHKKYLILLQELPQAVIKDLIKTLNITKKMLVKINSLREQANLSAII
FT                   "
FT   misc_RNA        420937..421021
FT                   /locus_tag="EC1_21590"
FT                   /product="Group II catalytic intron"
FT   CDS             422223..422438
FT                   /transl_table=11
FT                   /locus_tag="EC1_04490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88129"
FT                   /db_xref="InterPro:IPR024272"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD57"
FT                   /protein_id="CBK88129.1"
FT                   /translation="MAFFSSAINILQTLVVAIGAGLGVWGVINLMEGYGNDNPGAKSQG
FT                   IKQLMSGGGVILIGTQLIPLLSGLFG"
FT   CDS             422458..423330
FT                   /transl_table=11
FT                   /locus_tag="EC1_04500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88130"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD58"
FT                   /protein_id="CBK88130.1"
FT                   /translation="MFSQIFDAIEEWMRELLTGMITSNLDTMFTDVNQKTGEIATQVGQ
FT                   TPQGWNGSIFSMIRNLSDSVIMPIAGIIITLVLCYELISMLTERNNMHDIDTWMFFKYF
FT                   VKMWIAVYLVSNTFTITMAVFDVGQHVVNSAAGVISGSTAIDISSALTDLSATLESMEI
FT                   GELVVLALETLIAGFCMRILSVLITVIMYGRMIEIYLYTSVAPIPFATMSNREWGQIGT
FT                   NYFRGLFALAFQAFLMMVCVAIYAVLVAGIQYSDNLSSSLFGVMAYTVILCYSLFKTAS
FT                   LSKSIFNAH"
FT   CDS             423353..423742
FT                   /transl_table=11
FT                   /locus_tag="EC1_04510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88131"
FT                   /db_xref="InterPro:IPR024414"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD59"
FT                   /protein_id="CBK88131.1"
FT                   /translation="MAYVSVPKDLTKVKNKVAFNLTKRQLICIGIGAAMGIPSYFLLRN
FT                   VMGNSNAATVMVLLMLPAFLFAMYEKDGMHLEDVLMHMIRVKFLRPPVRKYETENYYET
FT                   DPEQIRQSPDAGKPKGGKTVAKKEK"
FT   CDS             426148..426606
FT                   /transl_table=11
FT                   /locus_tag="EC1_04530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88132"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD60"
FT                   /protein_id="CBK88132.1"
FT                   /translation="MKEIDKIRIRQWNQDNPYIQMKNLENAQPGYRVHTVNDDHHLYEL
FT                   PLETQNIILDWVFWNFYPAQKIYPHLTSDDLKEVLYKRTQIHLHNNQFKEAMLINGFWP
FT                   RDPSELNWVFHIQASSPAIRTQADGYPGIPIIGRQELNEYRKKSCARR"
FT   CDS             426825..428900
FT                   /transl_table=11
FT                   /locus_tag="EC1_04540"
FT                   /product="Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88133"
FT                   /db_xref="GOA:D4JD61"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD61"
FT                   /protein_id="CBK88133.1"
FT                   /translation="MEKIRKSSARQEAVEDTVEVTPEEKVSGYRKKLHRYEKIPDDDNN
FT                   LNSQKKSIRKKQLQKQMTKEQAKAGRLSFDDEGNQMVKGAGMKPGGTAGKYIATQAVIS
FT                   GIKAVSPEEEETDENAGVESARLVERETEDALRGLRHAQIRSKRTDVKTHRRGYREATV
FT                   EKKLKFGSAESMEGVKNAETVKKAEQKRHFYNRFFQKKRYKDAYRAARAGKSADSLGGA
FT                   TTIAGVENMTVKAKIALKEIIKRNRAMFAGIGIFALLFLVISVSLGSCSASIEGAGSVI
FT                   GITTYPSSDEDIYAAENRYAALESALNQQINEMERRHPNYDEYQYNIAEIGHNPYHLIS
FT                   YLTAKYGDWTYSDVENELQALFEAQYHLNTEGRTETVTETRNVRVGESLGQVVTSGYCN
FT                   CRICCGVWSGGPTASGAYPTANHTIAVDASNPFVPIGTKVVMNGVEYTVEDTGAFARYG
FT                   VQFDVYYDNHAAASAHGHQTWEAYIADDNGSQEVTVTSTSTKKILYVTLTNGSFDAVAR
FT                   ANLNAEQLIIYNALNTTYGNRNYLWDVNNVTSGSGGNGMSYEIPPEALQDEEFARMIRE
FT                   AEKYLGVPYVWGGYSPSGFDCSGFVSYVLNHCGNGWNYGRLTAEGLRGVCTYVSPGEAK
FT                   PGDLIFFQGTYNTSGASHVGIYVGNNMMIHCGDPIHYSNISTSYWQQHFMCFGRLP"
FT   CDS             429210..429947
FT                   /transl_table=11
FT                   /locus_tag="EC1_04560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88134"
FT                   /db_xref="InterPro:IPR025376"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD62"
FT                   /protein_id="CBK88134.1"
FT                   /translation="MVKWKKMNKKMAGLLLGVMMLFTASTTAFAYVDESAEASKVETTQ
FT                   TEQSTDKEEKKDEATNTNEVLPEDGTDQGTAFTTPGNGEVKDDITDDSTKEFLTVTTKN
FT                   NNTFYIVIDRSATSQNVYMLSQIDENDLSEFLDKDSTAAVVTPQPDTSKVVLDETNNED
FT                   VDKEATVDPEKTSSAKTNMGAMATILILALGGVAAYYYFRSINLKKRKMRMISRKVWKQ
FT                   VDWKKFRMRKSLKTKILKKMRNK"
FT   CDS             432156..433205
FT                   /transl_table=11
FT                   /locus_tag="EC1_04580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88135"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD63"
FT                   /protein_id="CBK88135.1"
FT                   /translation="MNFNEFVSEVKDNIKLFLPEEYENVEVSTMECQQLNRAYTGLMVR
FT                   KEGEMLTPTINLNQLYEAYKAQPGVTMETVCRKIADIVIEAPIQVDLKAIFNYEDVKDK
FT                   LFIRVSSAEANKEVLENAPHQLKEDLAITYHVAVDKDENGLSSMFIKNDLLEQYGISAE
FT                   QLHEDAMKSSPRVMVPEVSSIGALIDEMYQKNILMLTPDEREMLQETLQESSEMPTFFV
FT                   VTNTERVDGAGVIFYPEFMDNMGELLGNDFFILPSSIHEMLILPDDGQVDAEMLRDMVK
FT                   EVNATQVAPAERLTNDVYHFDTKDHVFEKADRFTERQKEKEAQAAKTEKAGKEQPDQKP
FT                   KTKKHDMEL"
FT   CDS             433288..435309
FT                   /transl_table=11
FT                   /locus_tag="EC1_04590"
FT                   /product="Domain of unknown function (DUF1738)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88136"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR025923"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD64"
FT                   /protein_id="CBK88136.1"
FT                   /translation="MTEQNKTTTIPLPVPGKDMDSIMQSLESGVEELFTSNRYQEFLKT
FT                   MAKFHNYSFNNTMLIAMQRPDATLVTSYKNWQSMGRQVMKGEKGITIIAPAPYKKMKEK
FT                   EVLDENQRPIMGSDGKPKTEQVEVTVPHFKAVTVFDIAQTSGEPIQTLAPELLTAAVQD
FT                   FDSFMQAIQKISPVPIRFDEIDGNANGYYHNADKEIVIKKGLSESQTLKTAIHETVHAK
FT                   LHDREIMESLGVEKDRLTKEVEAESVAYCVCSSFGLDTSDYSFPYIAGWSSSREMKEMK
FT                   ASMDVIRKTAGEMIDQLTEELEIILEEKQKTELHDKYGILVDALEAAGYRYDYRESEPG
FT                   HIVLAPDGTHEIAGYLQFESWGDIKDWLEDTIAEGTDISERVDRALYPFKFDYTLEEEM
FT                   FRGNGDRYAIYHVDEDTPGKQHLFMNMAMVKEDGITIDAANYKCVYSGRLHENEKLDDL
FT                   YAVFNDNPPADYKAHSMSVSDVIITNRGGDMQAYYVDRFGFAELPDFAVQREKILDIVP
FT                   EIENVDYENDLTCISFYAAECAEFPVMGEVHYDLTLPEALEAYEKIPSERMHGLKCVGF
FT                   DLKDGSDYEGMQSLMIEGKIQKEFLNSIPGFRENSYVQNAISRVEKYLEERHPNVENPL
FT                   ESNKKVDNEKNISKEKNEKELNIQMKPIPKKKRGEMSL"
FT   CDS             435306..435566
FT                   /transl_table=11
FT                   /locus_tag="EC1_04600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88137"
FT                   /db_xref="InterPro:IPR025468"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD65"
FT                   /protein_id="CBK88137.1"
FT                   /translation="MRNVNLEENELTITAIFQQHTKEETIQTLKEALEVMEQEESDPEN
FT                   DEMIEIINSTVGKLQQIEDKYYYSLDLNYYLNNLENDAYEA"
FT   CDS             435556..436440
FT                   /transl_table=11
FT                   /locus_tag="EC1_04610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88138"
FT                   /db_xref="InterPro:IPR025465"
FT                   /db_xref="InterPro:IPR025923"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD66"
FT                   /protein_id="CBK88138.1"
FT                   /translation="MKLNQFAVYRVDQQTAGKALWHLPYQEARQQNVSITVENYRLVSI
FT                   HEMQENEKVADIWKRMKKQCEVSDVLVLNKNGEISCYYVDENYPQYLAGFIRINTSGAL
FT                   ITMETENYQIDGKKGNWIATDTIIIDGKQFYLMEHQVYRDQAQGVILDAYGKMVVEECK
FT                   KFDEKTKQKIHDYIQQQVPLNPVEQLKQDGKIRLEHYQKFYQNGTYERSRESGTEANYD
FT                   MVDGLVNNQKKNQEKTSDASSNNQTSRNQQDGKSKKRRSVIKRLHQKQIAIARRSGKPI
FT                   PKYLDQEMERKRG"
FT   CDS             436444..436734
FT                   /transl_table=11
FT                   /locus_tag="EC1_04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88139"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD67"
FT                   /protein_id="CBK88139.1"
FT                   /translation="MRRLKCEKETIILTNEDDGFYDVYTFNQSLQKRLRAFAEKYPDDC
FT                   WLKGSSEDGSETYIIKKGRLSLNLRPPYSKDRIHKATERIIEEQKEQSKDS"
FT   CDS             436994..437191
FT                   /transl_table=11
FT                   /locus_tag="EC1_04630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88140"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD68"
FT                   /protein_id="CBK88140.1"
FT                   /translation="MARPKKNGTYLNVCIETPIYERLENFCKDAGHTKTVAVERALISY
FT                   FDEYEEMKKKLKELESNQDK"
FT   CDS             complement(437508..437858)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88141"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD69"
FT                   /protein_id="CBK88141.1"
FT                   /translation="MAYNNGREDRKWRIWKEAEEKVLREHGVDEATIEQIRIDDRADFN
FT                   SNRRFYHWTSDFGEYLEGMADREQSAEVKTVEDLLDEIEDENLYQALLTVDRRTLQIVL
FT                   LKMKGYSTKEID"
FT   CDS             complement(437874..438185)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88142"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD70"
FT                   /protein_id="CBK88142.1"
FT                   /translation="MFLFSGGCPSAYIKQSLFIHSTSGNGGKPVKKIPASATVLPTMKV
FT                   EVQSPYNRISISHNRKGHKAFAVFLLSFLVGKCRRTIIGVKCRSPPFNLDFYVFKDSD"
FT   CDS             complement(438576..440495)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04660"
FT                   /product="small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88143"
FT                   /db_xref="GOA:D4JD71"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD71"
FT                   /protein_id="CBK88143.1"
FT                   /translation="MKIINLGILAHVDAGKTTLTESLLYTSGAIAEPGSVDKGTTRTDT
FT                   MNLERQRGITIQTAVTSFQWEDVKVNIIDTPGHMDFLAEVYRSLSVLDGAVLLVSAKDG
FT                   IQAQTRILFHALQTMKIPTIFFINKIDQEGIDLPMVYQEMKAKLSSEIIVKQKVGQHPH
FT                   INVTDNDDMEQWDAVIMGNDELLEKYMSGKPFKMSELEQEENRRFQNGTLFPVYHGSAK
FT                   NNLGIRQLIEVIASKFYSSTPEGQSELCGQVFKIEYSEKRRRFVYVRIYSGTLHLRDVI
FT                   KISEKEKIKITEMCVPTNGELCSSDTACSGDIVILPNDVLQLNSILGNEMLLPQRTFIE
FT                   NPLPMLQTTIAAKKSEQREILLGALTEISDGDPLLKYYVDTTTHEIILSFLGKVQMEVI
FT                   CAILEEKYHVEAEIKEPTVIYMERPLRKAEYTIHIEVPPNPFWASVGLSIEPLPIGSGV
FT                   QYESRVSLGYLNQSFQNAVMEGVLYGCEQGLYGWKVTDCKICFEYGLYYSPVSTPADFR
FT                   LLSPIVLEQALKKAGTELLEPYLHFEIYAPQEYLSRAYHDAPRYCADIVSTQIKNDEVI
FT                   LKGEIPARCIQEYRNDLTYFTNGQGVCLTELKGYQPATGKLICQPRRPNSRIDKVRHMF
FT                   HKLA"
FT   CDS             complement(440862..441236)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88144"
FT                   /db_xref="InterPro:IPR026989"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD72"
FT                   /protein_id="CBK88144.1"
FT                   /translation="MVQSIFEEMGGRYERQGEYILPCLTIPPEKEQSIDLFGRRHLDYL
FT                   REYRKITYTNLLTSGRLNAYLADIDRQAQEHFERLIEGMKQAQGITECLKEENALEWTG
FT                   RTNNIRACAREIVEKEIIFA"
FT   CDS             441274..441471
FT                   /transl_table=11
FT                   /locus_tag="EC1_04680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88145"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD73"
FT                   /protein_id="CBK88145.1"
FT                   /translation="MSAIINTIYVFSLSGFIHYLKLNKKVNWVKSCFATCDKDELFLGK
FT                   NVLNARITQEQFVEEMKKIK"
FT   CDS             441560..441988
FT                   /transl_table=11
FT                   /locus_tag="EC1_04690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88146"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD74"
FT                   /protein_id="CBK88146.1"
FT                   /translation="MKKKNITLVFVAIVFSIIVGMIIGKSLLKYKEGEPDVVGSFSMNR
FT                   DENLTVVANRKNISDKEAFARLLLKMYKENSFHSIKFSTDHGYATSLDMTVYSWKEDIK
FT                   NGESIMQIELRPIEYGKDYDIVHNPDKYVLFIDGTEIK"
FT   CDS             complement(442118..442396)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04700"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88147"
FT                   /db_xref="GOA:D4JD75"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD75"
FT                   /protein_id="CBK88147.1"
FT                   /translation="MITFGRKLKHLRQKNHLTQKELGMAVGFPDSCADVRIAQYESDVR
FT                   TPKEDLMKLFASTLGVPVELFTVPVLSEPREYEAAEYWRYELGAELD"
FT   CDS             complement(442401..442727)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04710"
FT                   /product="dUTPase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88148"
FT                   /db_xref="GOA:D4JD76"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD76"
FT                   /protein_id="CBK88148.1"
FT                   /translation="MPYDCILKPGEIARIPLGFGLIIPDGFAGYVFPRSSMAAKGLVCE
FT                   LPPIDSGYRGEIHAIISNVSTSSQTIHKDTRVGQLVITPVVIADFVLDLGEKRGTGAFG
FT                   STGE"
FT   CDS             complement(442804..443583)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04720"
FT                   /product="thymidylate synthase (FAD)"
FT                   /function="thymidylate synthase (FAD)"
FT                   /EC_number="2.1.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88149"
FT                   /db_xref="GOA:D4JD77"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD77"
FT                   /protein_id="CBK88149.1"
FT                   /translation="MDHIETSILNCYGIREAEQNMVFAARLTQHGHTIQNMADLMDLYH
FT                   QSYSQKTVENIAGLPHPTVQKFMVITVAVVGASRRFLAQITRHQNEVKYMSASLQYSNY
FT                   SGHAAFAIPYGIMKADKEIQDIYKKSCQSDLDHYAELCALGIDHDSAGYATPQGLRNVL
FT                   IISATPYQWKHMIGQRTCRRNTDETRIVMLQIWQRLYKLSPILFAPDLTGPFCQRGSCM
FT                   EKQMSCQNPISKLWIPSDILKADYPLLIRKEVSSHKD"
FT   CDS             complement(443570..443896)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88150"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD78"
FT                   /protein_id="CBK88150.1"
FT                   /translation="MTQEEFNVVFELQMRKCADILAHKKKEYTGDNIDRLSAFKIAAAL
FT                   QNCDPKAALAGMMSKHVVSLYDMCYSTLLHFDMGQWDEKITDCINYLILLKALVKEEQA
FT                   YGSH"
FT   CDS             complement(443926..445479)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04740"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88151"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD79"
FT                   /protein_id="CBK88151.1"
FT                   /translation="MAIVKHIKSRNANYSAAINYLLFEHDEKTGKKIVDESGRSIMRKE
FT                   FYMDGLNCDPMSFDKECELTNAHFHKNKKREDIKSHHYIISYDPADVTENGLTGERAQS
FT                   ISLELAKQMFPGYQALVVTHTDGHNESGNIHTHIVINSVRKTAVERQLYMDKPHEEAAG
FT                   YKHRSTDKFMNTFKKTVMDRCQQEGLHQIDLLAPAEKKITQKEYMAQKHGQQKLDEINQ
FT                   KIIEDGLKPTSTVFLTQKEYLRNAIDECAATSNSFDEFQSKLLEQFQISVIEHRGRYSY
FT                   LHPDRQKRITERALGTRYGKQHLEQTFLRKDPLAILYVRSHLRLVVNLQTNVKAMQSPA
FT                   YAHRVKLSNLQQMANTIIYVQEHGFDTQSDLKNTLLASKQELKEMQTQFAQYRSDLRIL
FT                   NDQIRYTGQYYANKEVYSQFSNAKYIGKYRKEHAKEIQKYEEARNWLRSFYQDGKMTSL
FT                   KTLTLQKEKLQQQIASEEEAISSLKEKLKDLDTADQNVDAILQMQIPEPARSKAKDLER
FT                   "
FT   CDS             complement(445457..445843)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04750"
FT                   /product="Bacterial mobilisation protein
FT                   (MobC)./Ribbon-helix-helix protein, copG family."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88152"
FT                   /db_xref="GOA:D4JD80"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD80"
FT                   /protein_id="CBK88152.1"
FT                   /translation="MAPKKKEKNLKRRNIITLKLTDIELAVLNEAADVTGLSRSEYVRK
FT                   LLLEKQINHQIEVVADMNDLRKLVSEYGKIGSNLNQIAKHFNSGGSQSRAIKNEIHQCI
FT                   TDLFLLRKEVLKLAGGMNGNRKTH"
FT   CDS             446228..446476
FT                   /transl_table=11
FT                   /locus_tag="EC1_04760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88153"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD81"
FT                   /protein_id="CBK88153.1"
FT                   /translation="MIRKLLNGDIDRVADIWLKTNLKAHYFISNQYWKSNYELVKEMMS
FT                   QYEVYVFEADKMIQGFVGLNDKYIEGILSPMKCSHVA"
FT   gap             446585..446604
FT                   /estimated_length=20
FT   CDS             complement(446701..448116)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04770"
FT                   /product="Predicted transcriptional regulator containing an
FT                   HTH domain and an uncharacterized domain shared with the
FT                   mammalian protein Schlafen"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88154"
FT                   /db_xref="GOA:D4JD82"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD82"
FT                   /protein_id="CBK88154.1"
FT                   /translation="MAEESLFAGESKNIEYKVAVPKKSEKYMKTVVAFANGNGGKIVFG
FT                   IDDKTLEIVGMDEDNIFKTLDAITNAISDSCEPRIRPDVTLQTVNDKTVIVVEILPGAM
FT                   RPYYIKSEGMTEGTYMRVSGTTRPVEGYMLKELILEGQNRYFDSEPCGELQITDEDIQN
FT                   FCKTMKETAIKNTWQNSEKAKIKDITKNTLLSWGILTEVQGEIFPTNAYALLTGQLRMQ
FT                   PVIQCGLFKGKDRAYFADRKEFDGPIQNQVDAAYQYVLEKINMGMQIQGIYRQDVYELP
FT                   TDSVRELIANAVAHRSYLEPGNIQVAIFDDRLEVTSPGMLLNNVSIKKMMEGYSKPRNP
FT                   AIANAFAYMKIIEKWGTGIPRIFRECREYGLPDPELIDFDGDFRVNMYRNTAIDYSPRV
FT                   NDRVNDKVNDRVNEIEEKILKFIDNDPAITITQLSMELELSRKTIAAKLKTLKEKKMIE
FT                   RVGSSRKGYWKIL"
FT   CDS             complement(448337..449725)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04780"
FT                   /product="Phage integrase family."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88155"
FT                   /db_xref="GOA:D4JD83"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD83"
FT                   /protein_id="CBK88155.1"
FT                   /translation="MASIRERNGKFNVIYSYTNEKGERKQKWETYETKAEAKRRKKEIE
FT                   YKKEMGSFVVRKCKTLDELITEYVALYGKENWALSTYEGNVSLINNYILPVIGDAKLSE
FT                   INTRFIERYYQSLLKRRAVINPLNKTSRNEFVSSSTVRDVNKLLRNCFEQAVKWELMEK
FT                   NPCTHATVPKHKSQKRDIWTADTLMYALSVCEDERLKLAINLSFSCSLRLGELLGLTWD
FT                   CVDISPEAIEENRAYVFINKESQRIRKESLNALDGKDVLLVFPTNHKKNSTVRILKTPK
FT                   TESSVRKIFLPKSVANMLVDWKAEQDEMKEILGDEYMDYNLVMASTFGLPLGDGAIRGP
FT                   LKKLIEDYNLPPVVFHSFRHSSVTYKLKLNGGDIKAVQGDSGHAQVNMVTDVYSHILDD
FT                   DRRKNAELFEEAFYEKKNLDPQMHVQQENNNTVADEVDPELLAKVLANPEMRALLNSLA
FT                   KTMK"
FT   gap             450404..451613
FT                   /estimated_length=1210
FT   CDS             451748..452302
FT                   /transl_table=11
FT                   /locus_tag="EC1_04800"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88156"
FT                   /db_xref="GOA:D4JD84"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD84"
FT                   /protein_id="CBK88156.1"
FT                   /translation="MKQILIVEDDNLLNKTLTYNLELDGYTITSVLNARTAAESLKTNI
FT                   FDLVLLDINLPDGNGYDLCRLIKPEHPDTVVIFLTANDQESDQIRGYEAGAVDYITKPF
FT                   SISALQRKIKAMFAMLEHHKPAKDIYEDGSLFLDFSEQFASLNGKPLALSAMEYKMLNL
FT                   FLKNPKQVLTRQQLLEKAVGH"
FT   CDS             452435..452674
FT                   /transl_table=11
FT                   /locus_tag="EC1_04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88157"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD85"
FT                   /protein_id="CBK88157.1"
FT                   /translation="MKLNNLSAKKICRLISAGMVFSMLVITGIFGGIMQDTRIFIAGGT
FT                   LTLCAFFWILAIGAVFLENAFLILLLICAGRWTT"
FT   CDS             452671..452826
FT                   /transl_table=11
FT                   /locus_tag="EC1_04820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88158"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD86"
FT                   /protein_id="CBK88158.1"
FT                   /translation="MIDGNEELQKSNDSETLFARINHRLIRLYEIMQKNRTQGRHGTTG
FT                   ASNADF"
FT   gap             453007..453518
FT                   /estimated_length=512
FT   CDS             453571..453981
FT                   /transl_table=11
FT                   /locus_tag="EC1_04840"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88159"
FT                   /db_xref="GOA:D4JD87"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD87"
FT                   /protein_id="CBK88159.1"
FT                   /translation="MSSIVYAAEKKEIAVSVDCPENLIISHDSKWTSEALFNLLDNAVK
FT                   YTPSGGKISVSVVQWEMYVEVKVTDTGKGISESNQAAIFRRFYREEEVNDQQGVGIGLY
FT                   LAREIVTRQGGYIKVVSELGQGSEFSIMLPVR"
FT   CDS             454133..454798
FT                   /transl_table=11
FT                   /locus_tag="EC1_04850"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88160"
FT                   /db_xref="GOA:D4JD88"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD88"
FT                   /protein_id="CBK88160.1"
FT                   /translation="MSILQTIDLKKYYGTEPNITRALNGVNFTVEQGEFVAVVGTSGSG
FT                   KSTLLHMMGGLDTPTSGSVIVRGEELAKKNDDELTIFRRRNIGFIFQNYNLVPILNVYE
FT                   NIVLPVELDGDTVDQKFMDEVVYMLALEDKLENMPNNLSGGQQQRVAIARALITKPAII
FT                   LADEPTGNLDSKTSADVLGLLKHTSGEFNQTIVMITHNNEIAQLADRIVRIEDGKIVG"
FT   CDS             454813..457140
FT                   /transl_table=11
FT                   /locus_tag="EC1_04860"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88161"
FT                   /db_xref="GOA:D4JD89"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD89"
FT                   /protein_id="CBK88161.1"
FT                   /translation="MNYPFENDTSAVIKKLARKSVRFDKKKNLFCLSAIIVAVAMIMMS
FT                   LLTVQNIIYQKQKEIEGLHQGIFFDITQDSKEKLLANEEVKSVGLSCNIKTVKENSKEL
FT                   SLIYYDDDMLSLIPAFDGKYPEKASEIAVTDAFFASENKSPEINAIVQLNLDGTLKNYT
FT                   IVGIYHDKTSTAYPVFVSLEKCRELRGNNLLNGYVWLENADTLTKDEATEILSQISEET
FT                   GLNNWTVSSYYDYVNTTLSFSNYAVYGVVAAILFLAAALVIYSIFYISVGQKVAEFGQL
FT                   RTIGASKKQIYKIVLKQGYMLAVPGILIGSIMGTIISYCLQSKGWSVFAFIVSLCGACL
FT                   FGILLVYISVRKPAKIAANTSPISALKNPVGIVNYRTHKRHRITPVYLAKISFSRNRKK
FT                   SLLTILSLGLCGVIFFLAASYQSSFNAESMARYWDMKYGDFKISIDLENESENLDALLQ
FT                   KEYFSDYVKRVGDIEGVSNIFTYATVPVDFSTDNDISDSTLMLGYNEKDLASLNAAVLS
FT                   GNITDDTELVVSDPERIYDVYHWKPQIGDTVTFNFKNHSGKTITKAFKIGAITSSNDGM
FT                   GGYIFRMPENMLKELAGYDCTYAIEIQAEAEYQEIIEQELKLLVSDNRDVRLQTLQDFI
FT                   VEHQSDNRAGFTLAYAIAAILWIFAVINQINLTVTNLLSQKQEMGTLKSIGMTNKQLKQ
FT                   AFMMEGLFTTLIALLITAVVGIPGGYAIGIFLKNAGMSTGFVFPVVAFTLFAVAMFMLE
FT                   SLMTILLIHSWKKQSVIAIMRN"
FT   gap             457257..457669
FT                   /estimated_length=413
FT   CDS             complement(457749..458456)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88162"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD90"
FT                   /protein_id="CBK88162.1"
FT                   /translation="MIEECQDKICYLTQERDYARTHQKIVEIPVEKPVLYEKCEACNRT
FT                   AYQNAKAKYETQKERLAGQYKAKTVMFQTTLFLLAWYSLTTTLFQAVQSDMFLVDCKSF
FT                   FNDLASFIQTFVGWTIDAGHSAAQISTKIPNAFIAGMVYWLLLILIVGICMAGTGMLAI
FT                   LIEIKVIELYKKNCWDVITLLMILTSVAIVIYFGESIKKVLSVNLLLLFVLSQGAYVGI
FT                   RCYLKVWLEKRPY"
FT   CDS             complement(458434..460155)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04890"
FT                   /product="plasmid mobilization system relaxase"
FT                   /function="plasmid mobilization system relaxase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88163"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD91"
FT                   /protein_id="CBK88163.1"
FT                   /translation="MAIFHYTIKIVGRSKGKSVISASAYLNGDVMKNEETGRISYYTSK
FT                   KEVVYTSLMMCENAPPEWQIVPEENIKRFQKSVRYKRSEDKEAALEKFKITFQKQRLWN
FT                   EVLKIEKNADAQLGRSFEFALPKEWSRQEQIQYTTDYIQKTFVDRGMCADWSIHDKGDG
FT                   NPHVHLLLTMRPFNPDHSWGKKEVKDWDFVRDKNGNIVIDESHPNWWQDKKNPDRHGIR
FT                   IPVLDENGIQKIGARNRLQWKRVLTDATGWNNPKNCELWRSEWAKVCNEHLPLHNQVDH
FT                   RSYEKQGKLQIPTIHEGADARKIEQKFFAGQEIKGSWKVAENQIIKQQNTLLQKILNTF
FT                   GKVSGALSLWKERLNDIRRKPGNYTLNGIHDWSNRRTAEPNGRNDSGNAEPGHSTLSYA
FT                   KTESEITKIKQRVIRAAQHFAKYRGTAFQDGRTENEDRAFGKRKSAMAEIGTEAEQRKQ
FT                   FITETEHRIAELEQQIEKGRDIDERIQRIKERRTVGRTSALDRGDTRRTRTERTAYRGT
FT                   EDAAQRISDLEREIKQREQSREYSSIKERLEAGRQSIADREREVAKRKRHDRGMSR"
FT   CDS             complement(460112..460483)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88164"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD92"
FT                   /protein_id="CBK88164.1"
FT                   /translation="MAEGMRFSFPSLLFYEGRTYGQPEVVPISLPQVATGLRSRLPGSF
FT                   RRRGFQPDLLMPQEALFAREAHSMQAAMRRALLRRGRSGNAAFSKIESNVAGNLYRMCR
FT                   KEESRYGDFSLHNQNSRTK"
FT   CDS             complement(460483..460797)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04910"
FT                   /product="relaxasome subunit MobC"
FT                   /function="relaxasome subunit MobC"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88165"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD93"
FT                   /protein_id="CBK88165.1"
FT                   /translation="MAKSTKSYEERMLEMEKKERESLEKAKRYAAQKKELLKRKKAEES
FT                   KKRTHRLCQVGGAVESVLGSPIEEEDIPKLIGFLKKQEANGKFFSKAMQKETNTDMEEV
FT                   "
FT   gap             460868..461317
FT                   /estimated_length=450
FT   CDS             461710..462339
FT                   /transl_table=11
FT                   /locus_tag="EC1_04930"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88166"
FT                   /db_xref="GOA:D4JD94"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD94"
FT                   /protein_id="CBK88166.1"
FT                   /translation="MKDKELRKLIGSRVKQRRLELNLTQPYVAEKMGVTASTILRYENG
FT                   SIDNTKKMVLEGLSEALHVSVEWLKGETDEYETDITDKRELQIRDAMGDILEQLPLALT
FT                   KEEDAFSKDLLLLMLKQYGLFLDSFQFACKNFKGNAGQTDIAKTIGFESNDEYNEIMFL
FT                   REITPTINAFNEMADVVRLYSKKPKTAEQRLANLLSEVLYEDSESV"
FT   CDS             462426..463721
FT                   /transl_table=11
FT                   /locus_tag="EC1_04940"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88167"
FT                   /db_xref="GOA:D4JD95"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD95"
FT                   /protein_id="CBK88167.1"
FT                   /translation="MAKGSVRKKGKKWYYRFYVEDASGNLVQKECVGTESKSETEKLLR
FT                   QAMDDYEKKKFVAKAENLTVGQLLDVWAEEELKTGTLSNGTVENYLGTIRNIKKHPLAE
FT                   RKLKNVTSEHLQSFFDLLSFGGVHPDGKERKGYSKDYIHSFSAVMQQSFRFAVFPKQYI
FT                   TFNPMQYIKLRYQTDEVDLFSDEDMDGNIQPISREDYERLLAYLQKKNPAAILPIQIAY
FT                   YAGLRIGEACGLAWQDVNLEEQCLTIRRSIRYDGSKRKYIIGPTKRKKVRIVDFGDTLV
FT                   EIFRNARKEQLKNRMQYGELYHTNYYKEVKEKNRVYYEYYCLDRTEEVPADYKEISFVC
FT                   LRPDGCLELPTTLGTVCRKVAKTLEGFEGFHFHQLRHTYTSNLLANGAAPKDVQELLGH
FT                   SDVSTTMNVYAHSTRDAKRKSVRLLDKVVGND"
FT   gap             463746..464735
FT                   /estimated_length=990
FT   CDS             complement(465058..465714)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88168"
FT                   /db_xref="GOA:D4JD96"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD96"
FT                   /protein_id="CBK88168.1"
FT                   /translation="MSIPILFPSKDKCSGCSACYSICPMSAISMIPDQEGFQYPIIDEK
FT                   KCIDCRQCINVCPFKRKIDEESSDKLYKTRCCEKSRIKVGIITHYYKSTNYGGLLQAYA
FT                   LCTFLQKKGYNVEQICYDKQKGNDGVHKLKRVVRNIVNLFYFYLIYLRIGKSNLGLMLL
FT                   FVLEKKLYRIVNEFILKMILMNWLLHMMFLLLVVIRFGILMQFVMLICLIFLIKT"
FT   CDS             complement(465721..466701)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04970"
FT                   /product="Coenzyme F420-reducing hydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88169"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD97"
FT                   /protein_id="CBK88169.1"
FT                   /translation="MNTYACYIRDDRIRKNSSSGGIFYQLSSHILNLSGVVYGVTMSKD
FT                   CYFAEFIRVETMEDLPLLMGSKYIQARIKDTYKKVKIDLENNKMVLFSGTGCQINGLKC
FT                   FLQREYENLLCVDIVCHGVPSEKLWKNYVSYLEKKHGKLEAINFRYKENSTIKKNQMFV
FT                   SKNEDPFMRMFLRDYCLRPSCYQCVIKDNKMSDITIADFWGIGDIVPEMNDGKGVSLVI
FT                   ARNTKGDRAFHSVEKDCVIKKVKYEDGIKRNPAEYQSAVRPSERNDFFKNLDELSTEEI
FT                   INQYASDIPISLLGKIKQVIKKLFMIKSNSLNYGVLYNFRKDCED"
FT   gap             467299..468620
FT                   /estimated_length=1322
FT   CDS             complement(468722..469801)
FT                   /transl_table=11
FT                   /locus_tag="EC1_04990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_04990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88170"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD98"
FT                   /protein_id="CBK88170.1"
FT                   /translation="MAGKEVLLTEMDNTKEEKNIENNKKVYSFFRKFKLTIFLWIRELI
FT                   WLFGNWKNERINNYLEDFKPEIVFMPIYDCFYMHRILQYVKKKSGAKVVLWTGDDMYSL
FT                   KQFSLSPLFWINRLILRKYIKQSVKISSIRYCITPEQSEEYQKYFSVDFKILGKEMKQA
FT                   KDIDDITKNKSLVSLVYTGNIDRGRFKSLIKICEVLDSYHDIPESCFYIYSGSSLSKQM
FT                   NKKINGFRHTKFMGEVSSLEVFAIQKAADIVVHVESLDIKERLRTRLSLSTKIIDYMSN
FT                   KCCIFALGWEEASSIKFLERSNSAVICNGYEEIDKNLKPLLMNKDLRERYAYKAYQFVK
FT                   MNFPPGYCRNILKHDLNNI"
FT   gap             469887..472199
FT                   /estimated_length=2313
FT   gap             473374..475384
FT                   /estimated_length=2011
FT   gap             476118..476962
FT                   /estimated_length=845
FT   CDS             complement(477521..477943)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88171"
FT                   /db_xref="UniProtKB/TrEMBL:D4JD99"
FT                   /protein_id="CBK88171.1"
FT                   /translation="MITLNVQHLNEEISQSLYDRCLDQIDLHRLPCTCGRHDMVLHSSY
FT                   ERYARTSNGKFKLLVTVSAVNPVERRMPFFYLPSFPGSLFSSAFGRRIISATFPATDWT
FT                   TRSLPFCDLDMDMKRRGNLIEFYIFYLDAIDIEDRF"
FT   gap             478678..479834
FT                   /estimated_length=1157
FT   gap             481641..482509
FT                   /estimated_length=869
FT   CDS             482604..483026
FT                   /transl_table=11
FT                   /locus_tag="EC1_05080"
FT                   /product="Uncharacterised protein family (UPF0150)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88172"
FT                   /db_xref="InterPro:IPR005357"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDA0"
FT                   /protein_id="CBK88172.1"
FT                   /translation="MLSIYPAIFYKEKNGYSVIFPDLNYLSTCGENLNDAMEMAIDCLA
FT                   GYLYTAKLDDDKLPMPSKIDDIHPIDIANTIGFDGKDSFINLISVDLEDYAKTHFNKSV
FT                   KKTLTIPEWLNREATKKNINFSKVLQEALIAKLRSL"
FT   CDS             complement(483150..483566)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88173"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDA1"
FT                   /protein_id="CBK88173.1"
FT                   /translation="MKKNILLMGLCAGMILTGCASQSDTDSSVKEVSLDIVVKDEVNDK
FT                   ELFNETLTKEGDIENLYDFLSECDELEIVFEEGSYGAYIDSMLGLKQDFNKGPWWLFSS
FT                   ENNETCKEEGMCPAVQNLEINDGDQFVFSYTNEF"
FT   gap             483977..484080
FT                   /estimated_length=104
FT   CDS             complement(484120..484329)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05110"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88174"
FT                   /db_xref="GOA:D4JDA2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDA2"
FT                   /protein_id="CBK88174.1"
FT                   /translation="MELSVHDFIVRRRLTEVKSLLLENRLTIEEIAQNCRFKSDIALYK
FT                   TFKRIYSITPGQFKKMNTMKIEEQ"
FT   gap             485097..487238
FT                   /estimated_length=2142
FT   CDS             complement(487409..487750)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05130"
FT                   /product="AAA domain (dynein-related subfamily)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88175"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDA3"
FT                   /protein_id="CBK88175.1"
FT                   /translation="MERHIMKKLIQWKNSKKKKPLIIKGARQVGKTYIIRQFGKENYRN
FT                   VLEINFERDLSAREIFQKTHDPKEIYEYFTYFALEERIDQDTLLFLDEIQACPDALTAL
FT                   KIYRRGFSM"
FT   gap             489145..489857
FT                   /estimated_length=713
FT   CDS             489864..490100
FT                   /transl_table=11
FT                   /locus_tag="EC1_05150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88176"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDA4"
FT                   /protein_id="CBK88176.1"
FT                   /translation="MDCKRLFRKEQIWFVHKDSESVYVYSLADFTAQQGIRDTTDIIEK
FT                   YRKGILGALPDPELINSLLDLKGNNPESSKHAS"
FT   CDS             490090..490596
FT                   /transl_table=11
FT                   /locus_tag="EC1_05160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88177"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDA5"
FT                   /protein_id="CBK88177.1"
FT                   /translation="MPLRKLPIVLHKHKICIICEGDEEFDYLSCLKSLNVWNDNYEVVL
FT                   DNAKGNGNIPARYQDRYQSGSFEIVFIFCDTERKPYEQFEDIKRKINSFHGTYNAAKHV
FT                   IFYGNPCTMQIILSHWADVTLNTPAKKRNAHLIFQYTGVHDYKGKASQRKLFVYAKSST
FT                   LHEKR"
FT   gap             491467..493053
FT                   /estimated_length=1587
FT   CDS             493690..494238
FT                   /transl_table=11
FT                   /locus_tag="EC1_05190"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88178"
FT                   /db_xref="GOA:D4JDA6"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDA6"
FT                   /protein_id="CBK88178.1"
FT                   /translation="MKSIQLFSRMALFLALMILSAYIQITLPTPFMPMHITMQLFTAIL
FT                   CGFCLPDRYAFLCMFTYILVGLLGFPVFASGGGLQYIMKPTFGFVLGFLACSTICAIVY
FT                   KRKSPVSLKEYFLVGLTGLISFYVVGNIYYYFSFPILMNTRIPLWLSLTNGFLVSIIPD
FT                   ILICFLACKVAKTLQILIK"
FT   CDS             complement(494218..495753)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05200"
FT                   /product="Sulfite reductase, beta subunit (hemoprotein)"
FT                   /EC_number="1.7.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88179"
FT                   /db_xref="GOA:D4JDA7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDA7"
FT                   /protein_id="CBK88179.1"
FT                   /translation="MNTLREELLQELPEFERKTKQFIQKEISMKEYKGYSGGFGSYAQR
FT                   GGEAFMLRLRMNQGRITKEKLKFIIDQCQEHGVVRTHCTTCQTVQLHDVRPEALTPIMK
FT                   EALERDIVTRGGGGDYPRNVMCSVLSGLDPEEAFDVYPYAKVAGEYLLSIVNKYSLPRK
FT                   LKVAFSNSKANEVHANFRDLGFIANTDHTFDVYCCGGLGNNPMMGVKVGDHIDPKDILY
FT                   YINTMVLMFMEHGDYQNRAKARSRYLQMSLGKDRIVEEFHEKVELAKKYLDHDVHVEDV
FT                   VIQKEGKELDVIPDRVIKQKQSGLYAVKYHPLCGNMSLDKWKELYDVVQDMDEVELRLT
FT                   PQEDIYIVNLSGDEVQKVLEHTQDGAHTTFETSVSCIGASTCQVGLRDSNNVLKSLIEA
FT                   LRPYGFKEGVLPRVYISGCPSSCGTNQIGAIGLQGFTKLVDKKPYSAFKMSVNGSSDLE
FT                   DTQFGKEVGLILESDINDFFIELGTLVSNANATFENWQKENADQWQALLDKYL"
FT   CDS             complement(495802..497439)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05210"
FT                   /product="Inorganic pyrophosphatase/exopolyphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88180"
FT                   /db_xref="GOA:D4JDA8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDA8"
FT                   /protein_id="CBK88180.1"
FT                   /translation="MKNDEIYVIGHKKPDSDSIVSAIAYAYLLNQCGKKAVAGRLGDIN
FT                   EETAYLLDRFGYEEPVLIEDARVRLSEIELKQADHILPDTTIFEAKEIMNQNQARILGV
FT                   LDQDQKLLGVVTRSDLALLGMGDTALGIDLLKETPIELMAKTIEGKIIYKADKHHVNGK
FT                   VSIIALCKTKLERYEIQDRIVIIGDDPQGQKESIEKGAGILIAVWTDHIEEDVLKAARE
FT                   HNCSIIISGIGSMNTSRYLYFSIPVKLIMQKKITYFKEDEFVEDVMIKMRDTTFNTYPV
FT                   LDKKDCLIGYVSRYHIMNAQNKNIIMVDHNEFSQSVNGIEKANLLEVIDHHRIHNFSTL
FT                   SPIAFRNEIIGSTASIITSMFFERHIEIPENLAGLLLGAIISDGLNFQSPTTTKKDTEL
FT                   AQQLAMISHEDADALAYKMFSITMNLPKNISKEELIQRIEADMKTFDMKGSKVLISQVF
FT                   ILDLSSVRSIKEKVQEILEEMTIKYNGDLVIVAFTSIKKKGSILYGAGSKENLLWQTFG
FT                   KKNVFVKDLLSRKKQIVPDLTQTFNKFS"
FT   gap             498218..499169
FT                   /estimated_length=952
FT   CDS             499192..500247
FT                   /transl_table=11
FT                   /locus_tag="EC1_05230"
FT                   /product="Oxygen-sensitive ribonucleoside-triphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDA9"
FT                   /protein_id="CBK88181.1"
FT                   /translation="MVPDYISEKKMLELKVDKNGNGNCYPCMGCRSFLTPYVDENGKPK
FT                   YYGRFNQGVVTINLVDVACSSKGDEEAFWKIMDERLALCKEALMCRHKRLLGTPSDVAP
FT                   ILWQNGALARLEKGEPIDKLLFNGYSTISLGYAGLCECVYYMTGGPHTEEPGTSFGLKV
FT                   MQYLNDACAKWKAEENIDFSIYGTPMESTTYKFSKCLQERFGIIPHVTDKNYITNSYHV
FT                   HVTEEINAFDKLTFEAQFQKLSPGGAISYVEVPNMENNIDAVLAIMQHIYENIMYAELN
FT                   TKSDYCQVCGYSGEIQIVEDENHKLIWECPNCGNHDQEKMNVARRTCGYIGTQFWNQGR
FT                   TQEIKERVMHL"
FT   gap             500688..501540
FT                   /estimated_length=853
FT   CDS             502881..503141
FT                   /transl_table=11
FT                   /locus_tag="EC1_05260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88182"
FT                   /db_xref="GOA:D4JDB0"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDB0"
FT                   /protein_id="CBK88182.1"
FT                   /translation="MMYTWKEKIIHSFQRPYDDRKLSNALSENINGKINAHITVSRGIS
FT                   NFARFRNRLIYALNDTVMYKVTGFLQSLKHPGKPRGNYKKK"
FT   CDS             complement(503449..504048)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88183"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDB1"
FT                   /protein_id="CBK88183.1"
FT                   /translation="MGDYTWTINGKDVLSSDPSNINLEVKFDTAEIPDKVVNDLANGAP
FT                   VKQLSLTHEGNFGFKGTLNFYMGKEYAGQYGHLYYYDSDGKMVYQHTSLIDENGYASYT
FT                   FSHASDYLVVIDQNQIPSHGQEPTNPETPTKPETPTDPGNTTETNKDTQKDKTNTKKNK
FT                   DVKTSVQTNVSGLGFLMVLAVAGLIATTLKFKIDNK"
FT   gap             504058..504726
FT                   /estimated_length=669
FT   gap             506688..507910
FT                   /estimated_length=1223
FT   CDS             508498..509232
FT                   /transl_table=11
FT                   /locus_tag="EC1_05310"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88184"
FT                   /db_xref="GOA:D4JDB2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDB2"
FT                   /protein_id="CBK88184.1"
FT                   /translation="MPVYNDSGEIHYSYKSCIEEYEYSYTDDSGKTIKKKVKEKRVITF
FT                   NPKLQKKQLREINKLVEKVKKSKASQAKRDEYGDSAKYIEFKSADGKKAIASLNEKAIQ
FT                   KDMESAGYNLLITSEIKMDDREVYNAYHNLWRIEESFRIMKSELDARPVYVQKEDTIKG
FT                   HFFICYVTVLLIRLFQFKVLKNQYSTSDICTFMKEFRLVKINNNRYINMTRASYFITNL
FT                   AIATGQPVTNYYLTERQIKMMH"
FT   gap             511439..512067
FT                   /estimated_length=629
FT   CDS             complement(513014..513679)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05340"
FT                   /product="Histidinol phosphatase and related hydrolases of
FT                   the PHP family"
FT                   /EC_number="3.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88185"
FT                   /db_xref="GOA:D4JDB3"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDB3"
FT                   /protein_id="CBK88185.1"
FT                   /translation="MEKYILDVQHAKEKYKDQISIYLGIEQDVLGKRFEKNDPFDYIIG
FT                   SVHFVNVADQYLAVDMDKNTTEKIVEFCGDFLTYAKVYYEEVKKIAAMDEVDIVGHVDL
FT                   LTKFNEDESFIRFDNLDYLALAKECIDELIKANKIFEVNTGAIARGYRKSPYPHKTLLE
FT                   YIHQKGGKILLNSDCHNRFKLDCNYKESLELIKECGFQSMMAFDGKKFVEKDLDEFGY"
FT   CDS             complement(513661..513840)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05350"
FT                   /product="Histidinol phosphatase and related hydrolases of
FT                   the PHP family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88186"
FT                   /db_xref="GOA:D4JDB4"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDB4"
FT                   /protein_id="CBK88186.1"
FT                   /translation="MFKQNLHTHSLYCDGKDTIEEMVQEAISRKFLMCLDFQVMVIAAL
FT                   IHIPCRLMKWKNTS"
FT   CDS             complement(513888..514340)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05360"
FT                   /product="Protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88187"
FT                   /db_xref="GOA:D4JDB5"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDB5"
FT                   /protein_id="CBK88187.1"
FT                   /translation="MIKILFICHGNICRSPMAMFIMRKLVQDKGLENEFLIESAATSTE
FT                   EIGNDMYPCAKRKLSEKKIPYARHRARQIRANEYDEWDHIFCMDRNNMRNIQYIIREDP
FT                   KQKIHKLLDGKDVADPWYTDDFETAYQDIYTGCVTWLDRILKVNKN"
FT   CDS             complement(515145..516035)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05370"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88188"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDB6"
FT                   /protein_id="CBK88188.1"
FT                   /translation="MRYLSVTEIAKKWNISERSVRNYCAHGRVQGAFLTGKTWNIPENA
FT                   EKPERSNKKKGHTLTLLDILREQKEGKYSGGIYHRTQIDLTYNSNHMEGSRLTRNQTRY
FT                   IFETNTVGVENEVLNVDDVIETVNHFRCIDLVIDHADDILSEKFIKELHLTLKNGTSDS
FT                   RKERVAVGEYKKIPNEVGGMDTALPEEVADKMKTLLKEYNVIKEKTLEDILDFHVKFEL
FT                   IHPFQDGNGRVGRLIMFKECLKHNIVPFIIEDNLKLFYYRGLKEWDNEKGYLTDTCLTA
FT                   QDKYKTYLNYFRIAY"
FT   CDS             complement(516327..516878)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05380"
FT                   /product="Uncharacterized homolog of
FT                   gamma-carboxymuconolactone decarboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88189"
FT                   /db_xref="GOA:D4JDB7"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDB7"
FT                   /protein_id="CBK88189.1"
FT                   /translation="MWLHAALKSGVDPVAIKETVYQATAYLGIGRVHDFLVATNKVMEE
FT                   FGITLPLPSQKNVTEKTRFHDGLERQVSLFGPGMRKQQTDAPELRSNVNRWLADNCFGD
FT                   YYTRNGLNDREREMITFCFILAQGGCENQLRGHTAGNIMAGNDKSKLYSIVEQCMPYIG
FT                   YPRTLNAMNIIDEVADQLSK"
FT   gap             517099..518515
FT                   /estimated_length=1417
FT   CDS             complement(519521..520321)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05400"
FT                   /product="ABC-type spermidine/putrescine transport system,
FT                   permease component II"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88190"
FT                   /db_xref="GOA:D4JDB8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDB8"
FT                   /protein_id="CBK88190.1"
FT                   /translation="MKVKTHIWDGIILFLIAAFLILPLALTFFYSVFTEWMDILPTGFT
FT                   LSFYAGIFSDGAFINSLLRSIVISFVPVVICTISILLVLYVITLYIPKLEKYIEILCNI
FT                   PYAIQGVILAAGVISLYSGKPGFLSNRVFLLVGAYCIIILPYIFRGLKNTIGALNVRCV
FT                   IEAAQVLGCSKLHAFFTIVIPQMKRGIISTMMLAFTMLFADFVVVNMIAGSSFRTAGIY
FT                   LYQTMSKSGQTSSAIIVILFITTLIISTLTLAIQNKQATKGRKS"
FT   CDS             complement(520318..521172)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05410"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88191"
FT                   /db_xref="GOA:D4JDB9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDB9"
FT                   /protein_id="CBK88191.1"
FT                   /translation="MNKSLKGNKMYLIGLLPFFLIAFLFEILPLTNIVIESFSKTGGNG
FT                   FTLEHFVKIFTTRLYQQSIFNSLWISIFSALAGIIIAFLGAKAANAASAKVRNIFTSVL
FT                   NITSNFAGVPLAFAFMILLGNVGILTLIGKNYGISFLADFDLYTINGLLLTYIYFQIPL
FT                   ATLLMLPIFGGLKKEWREAVGLLGGNSFHYWFKVAIPSLLPSILGTFSVLFANSLAAYG
FT                   TAYALLSNNIALLPIRISQQYVGEVVQNQEFGCALSLVMMALMVLSILITNKLQKRAGG
FT                   GMA"
FT   gap             521243..522093
FT                   /estimated_length=851
FT   CDS             complement(522211..523311)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05440"
FT                   /product="ABC-type Fe3+ transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88192"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDC0"
FT                   /protein_id="CBK88192.1"
FT                   /translation="MKSKLLKAGLCALVACGCLTGCAEESAANTVDLNSMTFEEIAQKA
FT                   SEDGEVNSVGMPDTWANWGETWTEIEETYGITHTDTDMSSAEELALFANEANDATKDIG
FT                   DVGQSCGPVAEKQGVTLPYKTSYWDSIPDWAKDDDGDWIIGYYGTITFITNTDLVDTAP
FT                   TSWQDILDGDYTVTIGDVSVATQAQSALLSAAIAFGGSESDIQPGLDFFKTLAEEGRLD
FT                   MGDTSVARLEKGEIEVAVLWDYNSLGYRSQIQANNPDANFEVSVPTDGAIQSGYCTIIN
FT                   TYTKRPYAAAAAREYILSDEGQINLAKGFARPIRDDVVLPEEVQAQLLPDEQYTNARFI
FT                   EDQEAWDAAVADLATSWQEEVVAYAQ"
FT   gap             523734..524791
FT                   /estimated_length=1058
FT   gap             526322..527526
FT                   /estimated_length=1205
FT   CDS             528104..529117
FT                   /transl_table=11
FT                   /locus_tag="EC1_05490"
FT                   /product="3-dehydroquinate synthase"
FT                   /function="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88193"
FT                   /db_xref="GOA:D4JDC1"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDC1"
FT                   /protein_id="CBK88193.1"
FT                   /translation="MQLNVNLKDCAYPITIQRNALNNIQETIQTNRKVMIITDSGVPQK
FT                   WIDIVSSQCLDSFIVTIPNGEQSKCFKQYEELLLEAIEHEMTRKDAIIALGGGVVGDLA
FT                   GFVAATYMRGIDFYNIPTTLLSQVDSSVGGKVAIDAGNYKNIVGAFWQPKAVIIDPNVL
FT                   STLPQRHINNGLVEALKTGLIQDKELVELFKQDDLDIDQIIYRSINVKRKVVEQDERES
FT                   SLRKILNFGHTIGHAIEGAYGLDTYLHGECVAMGMLFFIDNKELKEDVLKIYEKLHLPK
FT                   VPDYDVDTLMNFIQHDKKSSSSSITIVLVKQAGTYELQEVSYDTIKTYLERGPYEK"
FT   gap             529884..530782
FT                   /estimated_length=899
FT   CDS             531063..532331
FT                   /transl_table=11
FT                   /locus_tag="EC1_05520"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88194"
FT                   /db_xref="GOA:D4JDC2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDC2"
FT                   /protein_id="CBK88194.1"
FT                   /translation="MKVKITPSKVSGTIAIPASKSISHRAIICASLAQGKSTITNLTFS
FT                   KDIEATISCMRSFGAKIEVQKNSCIIEGCNLFDLQDGICCDCNESGSTLRFLIPAGALS
FT                   NKKVTYLGKGRLLERPMGIYQIIFDEQKLLFEQSQDAIRIQGKLQSGHYQIDGNISSQF
FT                   ISGLLFVLPLLDSDSTLTINEPYESRSYVDLTLDMLKCFGIEIKQDKNTYYIKGNQKYI
FT                   AHDVKIEGDYSQMAFFGVLAGLNNSLTCSNMNLNSVQGDKAILDILASAGCSINSKKDF
FT                   ITIHPSKLQPKTIDLSDCPDLGPILCVLASYCEQTTTIINAQRLRMKESDRIEAMEVEL
FT                   KKWNVDIQTTFDTITIHGKNGYALDDIPIIDSHNDHRIVMAMCVFGLCANTPCIIENAQ
FT                   AITKSYPDFFEDIQRIGGKVEIL"
FT   CDS             532328..533164
FT                   /transl_table=11
FT                   /locus_tag="EC1_05530"
FT                   /product="Prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88195"
FT                   /db_xref="GOA:D4JDC3"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDC3"
FT                   /protein_id="CBK88195.1"
FT                   /translation="MNIGIIGLGLMGASFAKRLSPQKDKTIYGIDQNEQTIQTALELNI
FT                   IKEGSTDPGKLIKKCNLIILALYPTMIKPWIVENQQYLESGTILMDISGVKTNIVEPVQ
FT                   AILREDLELISIHPMCGRESRGIDFAQADIFDNANYIIVPTDKNTPKAIKAAKQLGKDL
FT                   RVKNISILSCKEHDRMIGFLSQLTHVIAVSLMNTHDNSHLVEYTGDSFRDLTRIATINE
FT                   DLWSELFLLNKDILLDEIDQFLDATKHFRDSLEKKDIDEMKRLFIQSTNRRKLFNK"
FT   gap             533961..534453
FT                   /estimated_length=493
FT   CDS             535656..535709
FT                   /transl_table=11
FT                   /locus_tag="EC1_05560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88196"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDC4"
FT                   /protein_id="CBK88196.1"
FT                   /translation="MEILNKPAEIPAQSTRA"
FT   CDS             535793..536260
FT                   /transl_table=11
FT                   /locus_tag="EC1_05570"
FT                   /product="Predicted transcriptional regulator with
FT                   C-terminal CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88197"
FT                   /db_xref="GOA:D4JDC5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDC5"
FT                   /protein_id="CBK88197.1"
FT                   /translation="MIQNVFFFLKNKGEVKFLYDNLSISDGLRLMNEHGFTAMPVINKD
FT                   GIYKGNISEGDFLWYLLNHSSITAEDLETIKIKELIRKDYMPAVRIDVDLKTLIERSLE
FT                   QNYVPIVDDRGIFIGIVTRKSIIKYLMNHTMNEAIPYDSEWSTTFDVRPSN"
FT   CDS             536423..538081
FT                   /transl_table=11
FT                   /locus_tag="EC1_05580"
FT                   /product="pyrophosphate-dependent phosphofructokinase"
FT                   /function="pyrophosphate-dependent phosphofructokinase"
FT                   /EC_number="2.7.1.90"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88198"
FT                   /db_xref="GOA:D4JDC6"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011183"
FT                   /db_xref="InterPro:IPR013981"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDC6"
FT                   /protein_id="CBK88198.1"
FT                   /translation="MKISSLQTARYEYSPKLPGMLRHGIADICVKEGEETQSVADQEKI
FT                   KALFPNTYGKKEITFEKGTNTSEAKKQVVGVILSGGQAPGGHNVICGLYDALKATNKEN
FT                   VLYGFKNGPIGLIEDDYIIFDDEYINQYRNTGGFDIIGSGRTKLETNEQFAIVAEVCKK
FT                   HGITAIVIIGGDDSNTNAAVLAEYFAAHDTGVQVIGCPKTIDGDLKNEDIECSFGFDTA
FT                   TKTYSEIIGNIERDANSAKKYWHFIKVMGRSASHVALECALETQPNICLISEEVAAKKM
FT                   SLSQIADYIADSVANRAAKGMNFGVAIIPEGVVEFVPEFSTLIQEINELLAGSKADAFN
FT                   ALPTWKDKYEFIENGLTKESMSVFAILPETIQQQLFLERDPHGNVQVSLIESEKLFSAL
FT                   VKDKLEERKKNGTYNGKFNPLHHFLGYEGRCAFPSNFDSDYCYSLGYNAFMLIQYGYNG
FT                   YLSKISNLSKPASEWVAGGMPITKMMNIERRHGEDKPVIKKALVELDGKPFKYFEAHRK
FT                   EWAVETSFVYPGAIQYYGPTEVCDITTKTLALEQE"
FT   CDS             complement(538104..538202)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88199"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDC7"
FT                   /protein_id="CBK88199.1"
FT                   /translation="MAVKQTAGRDSLGEFAPKFVKAEKKNQSANAN"
FT   CDS             complement(538411..538599)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88200"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDC8"
FT                   /protein_id="CBK88200.1"
FT                   /translation="MKCNNKEIFEKQNVFGMGEPNTTYAKYFIGESFLNPLTDPKSGLF
FT                   AANVTFEPGCRKLDYVA"
FT   CDS             complement(538625..539218)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88201"
FT                   /db_xref="GOA:D4JDC9"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDC9"
FT                   /protein_id="CBK88201.1"
FT                   /translation="MLRKFVSLLTAILMTFSLCACSTDESVEETSSRSDEMNAIVVYYS
FT                   ATGNTEKVAQTISDHFDIPIYELEPVDPYSEEDINYSDEQSRVSIEHEEHINGDLEVEL
FT                   TTTDFDEFSDADYIFLGAPVWWQELSWVVEDFVKENDFSDKTIIPFATSASSDFNLDNL
FT                   TPLAANADWGEARRFSSNVDEDEIIEWLNELNLS"
FT   gap             539370..539573
FT                   /estimated_length=204
FT   CDS             complement(540419..540625)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88202"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDD0"
FT                   /protein_id="CBK88202.1"
FT                   /translation="MPIATFIESIKGYKGKVYIFANSYTNDPQYMINSMKDLRKIDQNI
FT                   EFKEGLFNKSEEEHIQFIESEEI"
FT   CDS             540990..541829
FT                   /transl_table=11
FT                   /locus_tag="EC1_05650"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88203"
FT                   /db_xref="GOA:D4JDD1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDD1"
FT                   /protein_id="CBK88203.1"
FT                   /translation="MIDSQLLSYLIVFSETGSLLKSSEILHLSQPSLSKAMQKLEAELD
FT                   LTIFDRTGNKITLNDDGKEILYYAKDIMMMINKLETKAKDLKKKNQSLNVGLTAPGPMF
FT                   KFPSFFAPTSLNKKISVSTEGEKDLLKNLLNNIYDIVFINNPISIDNVICRKVMTEHLY
FT                   VSVPETHFLSRFKESIHFSDIDGQTFLLSSDIGCWTSILDKHMNKSRFLKQSDPNELKE
FT                   IAEYSSIPSFVTNISMNANSIKNRINIPIIDEDAYMDFYAVCKKDKSELINLLKQNR"
FT   gap             542313..542457
FT                   /estimated_length=145
FT   CDS             544410..544766
FT                   /transl_table=11
FT                   /locus_tag="EC1_05690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88204"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDD2"
FT                   /protein_id="CBK88204.1"
FT                   /translation="MKSNSTMKVSGILMILFGIVYAILAIMTYTGSVQGLLPGHESQEV
FT                   MVAVLSAAVALLALIGGICAVMGNKPVAKVIGFVFAAVGLVSLIYLQFTQNAFNIADCI
FT                   AMVLGVMLFTSAKE"
FT   CDS             complement(544976..546172)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05700"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88205"
FT                   /db_xref="GOA:D4JDD3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004191"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDD3"
FT                   /protein_id="CBK88205.1"
FT                   /translation="MSNVKRKDSKGRNLRLGESQRKDGRYVYKYTDMYEQPQFVYAWKL
FT                   VPTDKTPAGKREDLSLREKQKKIKKDLDDGINTIGGKMTVCQLYAKKNSQRKNVKRNTE
FT                   KGRQYLMKILENDPLGARSIDTVKLSDGKEWAMRMYENGFSYKTISNYKRSLKASFYMA
FT                   IEDDCIRKNPFNFKLSDVLEDNSEPKVILTPEQEEKMLAFMEQDKTYSKYYDEVVILLE
FT                   TGLRISEFCGLTIHIDMANRIINVDHQLLKDTEIGYYIETPKTKKGERQLPMTERAYQA
FT                   FKRVLQNRGKAEPIVINGYSNFLFLNQKGFPKVAGNYVSMLRGLVKKYNKTHKDQLPNI
FT                   TPHSFRHTYCTNMANKGMNPNTLQYIMGHSNITMTLGYYAHGTFNSAKAELERLALAS"
FT   gap             546182..546814
FT                   /estimated_length=633
FT   CDS             complement(547039..547287)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88206"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDD4"
FT                   /protein_id="CBK88206.1"
FT                   /translation="MKKNKAVHKGNGLLPYPVIVSASQGDILAMNVVLSHYEPYIARLS
FT                   MRTSIDEYGNPHTTVDEDMRSRLEAKLIEQVLNFKVA"
FT   CDS             complement(547274..547702)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05720"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88207"
FT                   /db_xref="GOA:D4JDD5"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDD5"
FT                   /protein_id="CBK88207.1"
FT                   /translation="MNRPTSPEDVQKVFDCYCKKILKNEAINIQKHYQHLNDVQVSFSE
FT                   LTPEQLAELATYDDYSTDYDLYKVMGYDVKIKNELLSEALQELSEEERFILLLYGLGFN
FT                   DGEIADLLKIVRRTVNYKRQRGFEKVRKRMEEKQHEEE"
FT   CDS             547701..547865
FT                   /transl_table=11
FT                   /locus_tag="EC1_05730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88208"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDD6"
FT                   /protein_id="CBK88208.1"
FT                   /translation="MFSPPFVCQKVVIVTAPSPFPSLIQMRGYELAKFEKEIQKKQKSP
FT                   RSCDNLVEL"
FT   CDS             complement(548142..548507)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88209"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDD7"
FT                   /protein_id="CBK88209.1"
FT                   /translation="MVQAEKQMKVFLSLCGQRDYDLLTGKEAMTQADFERITYITTALG
FT                   YSSCTQEMISEHLELACKEAERTDREFDILKDYPEYFKDENVYEQTDAWIEDFISQAPP
FT                   AKRDEIRQLIKENTEII"
FT   CDS             complement(548527..548751)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88210"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDD8"
FT                   /protein_id="CBK88210.1"
FT                   /translation="MMKFSKRDSKKMIKEMARLYGLSVSEVREQIQDKIIAVMDNDDPD
FT                   QQAEFKRMFGNRTPTPEEFICTASKQLKF"
FT   CDS             complement(549746..552007)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05780"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88211"
FT                   /db_xref="GOA:D4JDD9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDD9"
FT                   /protein_id="CBK88211.1"
FT                   /translation="MLIRKMLRDVWKNKVPFVAIFLMMFAGNFIFSGITSEYNGMNKSF
FT                   HSFIEETNLADVWVTSNGFNSTDIQTLKDDKNISNVEQRLLLNATLSNNSEKSVDLYVL
FT                   DNTNDISKMKVVAGKNYSADIDGLWLDYTFANENDYKLNDTLTVDVNGHEIKKVIVGFC
FT                   YSPEYIYNTKNGEMLPDHKNNGFAFVNEHFVSGLLPVSYNQLLITGNGDIEKSVKDILG
FT                   SNNITIVEKNNHPSYSMISDEITQHKEIGLIFVAVFFFIAMLITITTVHRLLNSQRMQI
FT                   GILKSLGFRKRKLYIHYISHSTFVCAVGSFIGWCIGYIILPKILYPVMEEIYTLPKLSP
FT                   SMLSGSWLMPIICTLICLLISMLVCRKYLRGNASIILYSNSTGKNYKDLPLYSLRKHLS
FT                   FYGQWNVRDIFRNKLRSFMTIFGVIGCVSLLFASLGLYTSMNNMSDWTFDKIQTYNTKV
FT                   TGDFTDEEYKNQLIKDMFGEELMETSVEIEHEGQEQTVAFTGLESQDFIRLYDTDNHNV
FT                   NLKSGIAVSKNTAKEMNIKVGDRIKWRFSGSSTWYLSVVKVIIRTPMTQGITMMKTEME
FT                   KENIPFITTSIIGEEIENAKINTDYISSIQNRADLEESLSTMLNASIMLSTLFLIMAIL
FT                   LGSVILYNLGTLSYMERYRDMATLKVLGFNNKRIRKLMIQQNIWLTIVGIIIGLPIGYG
FT                   LLGIMVSTVQTSIDMETYAPIYVYGVSILGTFILSWIINKVLSLKVKSIDMVSALKINE
FT                   "
FT   CDS             complement(552009..552710)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05790"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88212"
FT                   /db_xref="GOA:D4JDE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDE0"
FT                   /protein_id="CBK88212.1"
FT                   /translation="MGMILAKNVSKIYETGSKKTYALSDVSFEIDKGEFVVILGQSGAG
FT                   KSTLLNILGGIDSLSTGEVIVNDSPLSKMKENELAEYRAKEIGFIFQFYNLIPTLTVYE
FT                   NVALMKDIKDDILNPITILERVGLKNHVKKFPNQLSGGEQQRVSIARAITKNPEILLCD
FT                   EPTGALDSETGCKVLQLIQDVCREFQKTVIIVTHNSNIAKVADKVIRLKNGKILEISLN
FT                   DSPADIKEVEW"
FT   gap             553128..554294
FT                   /estimated_length=1167
FT   CDS             complement(555429..556625)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05820"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88213"
FT                   /db_xref="GOA:D4JDE1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDE1"
FT                   /protein_id="CBK88213.1"
FT                   /translation="MAKKKECIPNYSSTTKKGVLYYRTRITDADGKRVDLYATTCEELY
FT                   KKETEARRIIEELKFRRENPTVAEYCEKWLLMQSAKVSSATLKGYTCSVNNYIVKPLGD
FT                   MYMSDVTSDDIRVALIPASQKSASVYNKVNMLFKCIFYSAERSELLDYNPSASISAKGG
FT                   TPAKDKDALTDEQVKVLLDTVRELPPYLFIMIGLYSGLRREEILGLQWDCVFLDTRTPY
FT                   IAVRRAWRTEHNRPVVSTVLKTPAAQRDIPIPKCLVDCLLETKKSSISDYVIADSKGEP
FT                   LAYSQFQRLWKYVTVRSTKERTCYKVINGQRIKYTKKPALGTHQKNNPSIVYTMDFEVT
FT                   PHQLRHTYITNLLYAGVDPKTVQYLAGHENSKTTMDIYAKVKYNRPEELIGVVNRALT"
FT   CDS             complement(556785..558002)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05830"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88214"
FT                   /db_xref="GOA:D4JDE2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDE2"
FT                   /protein_id="CBK88214.1"
FT                   /translation="MATKRSRIPRYGTVEIKGHTYYKTYVMDSDGKQVALYEKTREALY
FT                   DKELAALEQIDNATFRRKSPTVKEYCEKWLLMQSVHVRATTLTDYTSKVRRHIISSLGD
FT                   TRMGDVTLDDIQIALVPVSKKSASVYKSVVILYKSIFRAAMDSKVIDKNPTIFLTAEGG
FT                   GVPQQEKQALTDEQAKRLLEAVQGLQTHTFVMLGLYAGLRREEILALQWDSVFLNADAP
FT                   YLKVCRAWHTEHNRPVILTELKTKAAERKIPLPENLAECLREVKAASTSEYVICNGDGN
FT                   PLTYTQFKRLWQFVVTRTAKERSYYRYENGKRVKHTVCPVLGEKAAHNGKVVYSLDFEV
FT                   TPHQLRHTYITNLIHASVDPKTVQYLAGHQNSKITMDIYAKVKYNKPDELAGIMAGAFA
FT                   LWDAAG"
FT   CDS             complement(558083..558307)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88215"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDE3"
FT                   /protein_id="CBK88215.1"
FT                   /translation="MEKLITRREAAKLLGISISTLDEARNNGLISYIQYVPNGCVYFTD
FT                   TGLQEYIAKCTHRAKPMEKRTTYRNVRQG"
FT   CDS             complement(558309..558839)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05850"
FT                   /product="Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88216"
FT                   /db_xref="GOA:D4JDE4"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDE4"
FT                   /protein_id="CBK88216.1"
FT                   /translation="MARTYRRGDLYYADLNQCVGSEQEGNRPVVIIQNDIGNKHSPTVI
FT                   VAAITSQNPSKGVLPTHCYLGAESGLERPSIILLEQLRTIDKRRLGHYIGRLSQKRIEE
FT                   MDRALMVSLDLFCQESKTTIISLCGVCVSNFRNTGAYYLCRLDPGQIKKEVCTYCNQRR
FT                   GFDYVMMKKGSDG"
FT   CDS             complement(559389..559862)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05870"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88217"
FT                   /db_xref="GOA:D4JDE5"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDE5"
FT                   /protein_id="CBK88217.1"
FT                   /translation="MDENHPKRRKDKYNPYTIGTTDDGRHWLTFSDGQGIRHHFEISNV
FT                   VFDALNAFELGDLSYLNEVDRHYEQSELTEGSLYERAVHRPDTVEESAMRRMEYQQLHK
FT                   AISELPETQRRRLCLYYFEGLTYEQIGELEGCTFQAVAKSIVAAEKRLKNILK"
FT   CDS             complement(560780..561103)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88218"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDE6"
FT                   /protein_id="CBK88218.1"
FT                   /translation="MVGLIGGLSFTYLANEIKAVEVYWRSGEVEIIESDNAELSAKESG
FT                   NELQEDTAMHYFLDDGVLRIRFCASGAKIQVNALDKHLSLEVPKGIDLSVYTTDGEIDA
FT                   RNN"
FT   CDS             complement(561150..561521)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05900"
FT                   /product="Mn-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88219"
FT                   /db_xref="GOA:D4JDE7"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDE7"
FT                   /protein_id="CBK88219.1"
FT                   /translation="MKLHASGEDYLETILVLQKKRGMVRSVDVARHMEVSKPSVSHAVA
FT                   TLRDGGFLMMDEDHFLHLTDVGREVAEKIYERHCFFTEQLIAAGVDPKTAEADACRIEH
FT                   IISDESFSRLKETATQEQE"
FT   CDS             complement(561533..563269)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05910"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88220"
FT                   /db_xref="GOA:D4JDE8"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDE8"
FT                   /protein_id="CBK88220.1"
FT                   /translation="MYGTLKKIFAFAGSKKGLLKKSLLFSFLSGLFSAMQFAALFVVIG
FT                   ALVSDNRDGKFICISLGIMAVSLIGRIITTYFSTMEQTETGYCMVAEKRIHIGDRLRYI
FT                   PMGYFNKNSIGNITAIVTTTLGDVENSAARVLVSVLGGFFNSVALVIVLLVFDWRIGLV
FT                   AAAGVLIYLAAAELALRKSAALSGVRQHTQESLVESVLEYIQGMGIVKAFGLERDSTQS
FT                   IGSAIKASCRDNLKLTKASVPYDAIKQAVVRVFSVLLLLASVWFWLDGSLPLAYGLILV
FT                   IASFMVFNDLENAGNMASLLQMLAASMDTANSIDDTPVMDEKGADITPKSSEIVFNKVD
FT                   FSYADRKILDQVSFTIPEKTTTAIVGPSGAGKTTMCNLIARFWDVNAGKITIGGTDVRD
FT                   FKLDSLMKNISMVFQSVYLFADTIENNIKFGCPDATHEQVVEAAKKACCHNFISALPDG
FT                   YDTVIGEGGGTLSGGEKQRISIARAMLKDAPIIILDEATSSVDPENEDELQRAIEALTH
FT                   DKTIIMIAHRLKTVRNADQILVLDNAHIVQRGTHAELIQQKGLYADFVSARQEAIGWKL
FT                   AQ"
FT   CDS             complement(563284..565029)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05920"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88221"
FT                   /db_xref="GOA:D4JDE9"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDE9"
FT                   /protein_id="CBK88221.1"
FT                   /translation="MKEEKKESPIGVLWGWGKPYHGKFIGSIILAVLGVACQMVPYFCV
FT                   AHIVTLMLSGEQDFSSYMTACIVALCGYLGKVVFANLSTVISHTATYYTLRDLRENITA
FT                   KLARVPMGTILDTPSGQYKTTIVDRVEGMEPTFAHLIPEMTANVLVPIVIVVYLLILDW
FT                   RMALLSLVTLVVGLVVMSAGMKNYPVKWEGAVKAGKQMTDAIVEYIGGIEVVKAFSQSA
FT                   GSYKKYSDAVNYNANYYVDWMRENQKTMSAYNAILPSVLICVLPCGFAFWLSGSLELST
FT                   FLSIVIFSLGLIGPIIAAFTFTDDLAVLGTNVEEISQLLNAEELNHKETPIKLEDTGIS
FT                   LRSVSFSYDGTTEVLHDVNLTIHPGTMTALVGPSGSGKSTVAKLIAGYWDVTSGSITLG
FT                   GHELKDIPLSEIADQISYVSQDNYLFNRSIRENIRMGRPGATDAEVEQAAKQSGCDAFI
FT                   RKLDNGYDTVVGSAGSHLSGGERQRIAIARAMLKNAPVVILDEATAYIDPENEALVQKA
FT                   ISTLTVGKTLIVIAHRLSTIVGADNIVVVKDGTIHAQGTHEKLLETCPLYRDMWQAHIG
FT                   AKDQM"
FT   CDS             complement(565026..566498)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05930"
FT                   /product="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88222"
FT                   /db_xref="GOA:D4JDF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDF0"
FT                   /protein_id="CBK88222.1"
FT                   /translation="MIRIDHVTFSYGEENENAGGVHDINLTVEDGQCVVLCGESGSGKT
FT                   TITRLINGLIPHYYEGKMNGEVWVNGAKVSEQPLYDTAKTVGSVFQNPRSQFFNVDTTS
FT                   EITFGCENLGHPEQSIRERLDKTIRDFRLEKLMGRNIFHLSGGEKQKIACAGVSIMEPD
FT                   VLVMDEPSSNLDASSILDLRAILAFWKSQGKTIIVSEHRLYYLRGLADRFIYITGGKVE
FT                   KDYSAAEFESLTEQQRAKLGLRTFILEDLLPPKALPQAGQQMELRNFCFAYKNEPETLH
FT                   IRESKIPANRIVGIIGNNGAGKSTFSRCFCGLEKRCGEVIWNGRTYRPKDRLNTCYMVM
FT                   QEVNHQLFTETVLDEVLISMEEENQEWAEEILAELDLIGFKDRHPMSLSGGQKQRVAIA
FT                   SAIASKRSILFFDEPTSGLDYKHMKEVANVLKQVRDAGITLYVITHDLELLLDCCTDIV
FT                   HFEDGSIIDQFQMDEAGLEKIRNYFIKGVPTK"
FT   CDS             complement(566516..567256)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05940"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88223"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDF1"
FT                   /protein_id="CBK88223.1"
FT                   /translation="MNGLSFSATTEKRKGILLDPRTKLILLLTITTLMFSTSNEGIMNI
FT                   VKPCLSLVPFALILSERRFKTAGKYLVLYAVCFILERIALTSLSGLLSFIVLAVTSIMT
FT                   RFAPGIMTGAYLISSTSISEFIGAMERMHITEKIVIPMSVIFRFFPTISEEYQAIRDAM
FT                   KMRGIRFGGKNPFLMLEYRLVPLMVSVVKIGDELSAAALTRGLGAPVKRTNVCQIGFHV
FT                   QDLIAILFCVICFALFLFQQQISF"
FT   CDS             complement(567256..567840)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05950"
FT                   /product="conserved hypothetical integral membrane protein
FT                   TIGR02185"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88224"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDF2"
FT                   /protein_id="CBK88224.1"
FT                   /translation="MSNKLQAKDLINLGLFTVLYFVIGCCVAIPVGFVPIFLPILGALW
FT                   SLITGIPFMLFLTRVKKFGMVTIMGILSGLLMGLTGMGFWGVPMGVIFGLLGDLILKSG
FT                   GYKSAKKSLIGYAVFSLWMVGTYIPMYFMVEDSWASFAASFGEEYADRVMAVMPMWSII
FT                   LVIAGIFIFAILGGLLGKALLKKHFAKAGIV"
FT   CDS             568041..569033
FT                   /transl_table=11
FT                   /locus_tag="EC1_05960"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88225"
FT                   /db_xref="GOA:D4JDF3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDF3"
FT                   /protein_id="CBK88225.1"
FT                   /translation="MKIDDIIRKCIEIPGVSIKRSEFNAELLMKTKEGKGSMTFFQLFP
FT                   GLTIAYIFINSPTWVAPNLGEDSFIKKGPLLLNYCVTGRCEIILNNGNFVYVKDGDISL
FT                   TECFAQKQYVYPRRIYEGMELFVDTNTLATESTWIQKEFGIDIPKIIELFCPNDNTYIS
FT                   AVTPEVEEILIKLWELFDIAPPFSISQMKIYVLALFSLLQNLNNIPPSQACTFFTETQV
FT                   DIAKRVEKIITSDLRQHHPAWELAAQFSISETSLKNYFRGVFGQNISIYLREVRMKKAA
FT                   ELLTSTRLSVAEIAELVGYMNQSKFASVFKKQFGLSPLEYRRSKNLENR"
FT   CDS             complement(569094..569210)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88226"
FT                   /db_xref="InterPro:IPR026989"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDF4"
FT                   /protein_id="CBK88226.1"
FT                   /translation="MAGVTEELKARDPMRWVGLMNTLKAQAEEIIFQELISA"
FT   CDS             complement(569403..571211)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05980"
FT                   /product="CHAP domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88227"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDF5"
FT                   /protein_id="CBK88227.1"
FT                   /translation="MLEIKTRDAVKGTIKTLDKAAIAGDRMKQVYVRTKDKAENSISVS
FT                   EGNPEEYAADRVSGNADSMVYEAVHQFDRHGRKAVKTTKDNINTVRERMEQRRVEQPKR
FT                   AAQKQAEKRTKQRAAEVVHSVQTHPSLSGSSPLPSDTEIWPQVKTRSWDTATIKSAQKS
FT                   GVSVRQTTKSTGNVVAKVRKGTIKTASRSIKNAERTGSAAVKATQASSAAQKSAFAAAK
FT                   TSKRTAQAAQTAAKRTAEVTKAAAKGTASAVKGIIAGTKALVSALLAGGWISVMIILIV
FT                   VLLGCAVSLFGGGSSNSYTPVSAEVEAYEPLIRQYASQYGIPEYVELIKAVMMQESGGR
FT                   GLDPMQAAEGSFNTRYPHEPNGIQDPEYSIQCGVQELKAALISAKVENPVDMERIKLAL
FT                   QGYNFGNGYISWAVSNYGGYSYANAVEFSARQAERLGWNSYGDTQYPNHVLRYYPYGRA
FT                   FTAGGNQVIVEVALTQLGNEGGAPYWSWYGFDSRVEWCACFVSWCADQCGYIESGVIPK
FT                   FSACVDGVSWFRSSGQWQDRNYEPQAGDIIFFDWDGDGTSDHVGIVEKCENGVVYTVEG
FT                   NSGDACRGRQYSVGSSSILGYGTPAY"
FT   CDS             complement(571198..572031)
FT                   /transl_table=11
FT                   /locus_tag="EC1_05990"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88228"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDF6"
FT                   /protein_id="CBK88228.1"
FT                   /translation="MNPKLKTTSSFCGAAVFAALFLFAGVMLAIQYADKKQSAEAFYEI
FT                   AALIQEESKQPEASEETTEKEGNPAAETTLTAHEKYAAVYEQNHDFVGWITIDGTSINY
FT                   PVMQTPDHPSFYLKHAFDGSYSNYGTPYVQENCMVGSSDNLILYGHHMNNGSMFADLCK
FT                   YESEKFYREHSTIHFDTLDGYGDYEIVAVFKTVAYSQDGFKYYHFVEADSREDFDAFME
FT                   QCRALALYDTGISAEYGDSLLTLSTCEYSRNNGRMVVVAKRIAPSPGEVNTDAGD"
FT   CDS             complement(572047..572442)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88229"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDF7"
FT                   /protein_id="CBK88229.1"
FT                   /translation="MRIHFASREHRDFYHDMMAQSRRQDCYHQAFFYVMGIAPETRANI
FT                   RQMFNFQQDCIEPEGMHGGWQTSGTVRVCQLAFNLWNGYSAERQGDEFTPNDLFCCEFA
FT                   PYFMEGIKLRYPEYCRELVTTKNEKTR"
FT   CDS             complement(572439..574793)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06010"
FT                   /product="Domain of unknown function DUF87."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDF8"
FT                   /protein_id="CBK88230.1"
FT                   /translation="MLKTLSNLLKVDKEKYKVPRRVQDVIPIRRIWSDGIFLCGNQFCR
FT                   TWRFSDINYQVASEEDKKYMFLDYSELLNSLSTGSTAKITINNRTLNRVNFEQSVLMPM
FT                   RKDQRDFYRKEYNGVIMSKATAGNGIVQEKYITVSVPKKNIEDARIFFSRIGADLTAHF
FT                   SALGSKCVELDATEKLRVLHDFYRQGEEVDFHFDAQDMMRKGHDFRDYICPDFIERHSD
FT                   YLILGGKFCRTLYLKDYANYIRDSFVSELTDLNRNMMLSLDIIPIPTDEAVREVENRLL
FT                   GVETNITNWQRRQNANNNFSAVIPYDMEQQRKESKEFLDDLTARDQRMMMGVLTMVLTA
FT                   DTKEQLDTDTEQILSLSRQKMCQMAVLKYQQTDGLNTALPIGTRRINTFRTLTTESLAV
FT                   FMPFKVQEIQDKGGIYFGENAISHNLILCNRENLLNQSSFILGVPGSGKSFSAKELIAF
FT                   LILNTEDDILICDPEGEFAPMVQAMGSDIGTVVHVAAGGRDRLNAMYMVEGYGENNPIV
FT                   EKSQFIMSLVEQIDKNGVGPQHKSIIDRCTGQIYQEAAETGIVPTLSTLREKLLVQPEK
FT                   IAKEIALSLELFTTGSLDIFGHASNVDLDKRVVVFNIHDLGEQLKPTGLLVITDTMLNR
FT                   VTLNWKMGKRTHVFIDEFHVVFENEYSGNFFNSAWRQFRKRNAYPTAITQNVEYLLDSV
FT                   QASTMLSNSEFIIMLNQAASDREKLAKLLNISKEQMSYVTNADAGCGLIKYGSALVPFV
FT                   NRWPRQTKLYDLMTTRPGEGVFGGEKQEVQE"
FT   CDS             complement(576167..576538)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88231"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDF9"
FT                   /protein_id="CBK88231.1"
FT                   /translation="MKHLFNKLTKKETKSVPHNSRLEQKVKRGYRWYCATVMAVTFMLV
FT                   NVMPAFAASDPITVVNNLSDFIFGLIRAVGLILLGWGIVQVGLSLQSHDPSQRSNGFLT
FT                   LAGGIVITFAKEILTLITG"
FT   CDS             complement(576558..578360)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06050"
FT                   /product="Type IV secretory pathway, VirD4 components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88232"
FT                   /db_xref="GOA:D4JDG0"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDG0"
FT                   /protein_id="CBK88232.1"
FT                   /translation="MKQDNRQAQLILCLFGTIPVIWLGLLIAPAVSGGLPEIITVFPTA
FT                   INNPFHIVFCEDSLKTVLIALCAYGMGIGVYLSTRRNYRRGEEHGSAKWGNARAVDKKY
FT                   RDKRPEQNKLFTQNVRMGLDGRKHRRNLNTVVVGGSGAGKSFNLAKPNLMQANTSFTVL
FT                   DPKGELVRDTGYLLEQKGYEVRVLDLLNMEKSFCYNPFVYLRDDNDVQRLVTNLFKSTT
FT                   PKGSQSNDPFWDTAASMLLLALVFYLKYEAPEDEQNFPMVMEMLRAAEVREDDDCYQSP
FT                   LDELFERLEMKNPDHIAVKYYKDYHSGSAKTLKSIQITLAARLEKFNLSSLAALTATDE
FT                   LDLPSLGEKKVALFALIPDNDTSFNFLVSILYTQIFQQLFWLADHKYGGSLPVPVHFLM
FT                   DEFANVSLPDDFDKILATMRSRNVSVTIILQNIAQLKALFEKQWESILGNCDEMLYLGG
FT                   NETSTHKLISESYLGKSTIDTNTYGKSSGRSGNYSTNYQITGRELMTPDEVRMMDNRYA
FT                   LLFIRGERPVMDEKYNPLKHPNVALTALGGAPNYEHGKTAHVTATISIGAVTGAELPES
FT                   ESTADDTMELLSNEEIEALFHLNQ"
FT   CDS             complement(578347..578535)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88233"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDG1"
FT                   /protein_id="CBK88233.1"
FT                   /translation="MEKEEKRVLTLDRYEHGVVVNALNELRNDLLEEQRSTDIVDEVLL
FT                   KAIDAPTKKVKCRDEAR"
FT   CDS             complement(578537..579433)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88234"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDG2"
FT                   /protein_id="CBK88234.1"
FT                   /translation="MNSFDDIFEGHVSQRGQTNQPFDKEAWAEKKQAERQSVYDLADTT
FT                   AVEVSTDGSKFQSYLDVQTRFSRYSATNVLLILAQKPEATQLKDFNGWKEAGASIKRQQ
FT                   KGISILEPGEEYERADGSIGTSYNVKRVFDISQTTARAKVQPAISVDDRLLLKALISRS
FT                   PVPMQTVDDLPNHMGALYDHDQQVIFVRRGMDAADIFRSVSKELAHAEIAGMEKDYTRE
FT                   GAAFAAYSVSYMLCKEYEMDTSGYDFSRLPDVFRESDAQGVRATLSEIRDAAANISGRM
FT                   TRALEQNRQPKAKEQER"
FT   CDS             complement(579437..580249)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88235"
FT                   /db_xref="InterPro:IPR024234"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDG3"
FT                   /protein_id="CBK88235.1"
FT                   /translation="MNNSGDAAEQIVRLSLEGAEVALKLSGSAAKNIAAAIYAVMKNRD
FT                   KNKIKGRQRLTAMLKSGKELKVFTISEEHLKQFATEAKRYGVVYCALRGKEKSADGMVD
FT                   VMVRAEDASKINRIVERFHLATVDTASIKHEIEKARAEKSTEEKKEAPTVPEKEQPEKN
FT                   DADKLLDELLGVPTQKEEPTPINPSAARMEKSHPSAPISEPPSKAAEGVAKSAERPSVR
FT                   KELRDIQAQRRQQEAAAPVKEPERRAKSEAPAIQHKQPSRKKKKAKER"
FT   CDS             complement(580206..581648)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06090"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88236"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDG4"
FT                   /protein_id="CBK88236.1"
FT                   /translation="MATTSIWRVKGWLGKVVIYVENPDKTDNPAFYEKQYMSDRQAQGL
FT                   SDVIDYAVNSEKTQTADEAADVVQQFVSGVNCHPGTAREEMLAVKRQFGKEDGTVAYHG
FT                   YQSFAPGEATPELAHEIGVKLAKQLWGEKYQVIVATHRDKSNHLHNHFVVNTVSFLDGI
FT                   KYHRTGQDYRQMREASDALCQEYGLSVIDQPEPGKSKQYGEWRAEQENRPTWRGMIRAE
FT                   IDEVIRQSMTERQFFENLRKRGYEIKVGADISVRPPGKPRFVRLKRNFGEDYTLENIRR
FT                   RILVQQRPERPLPEPERKTYHARLHGDFKSARKITGFRALYFHYCYLLGIFPKNAPKRN
FT                   KRLHFLLREDLAKMDAISEEVKLLVGNHIDTAEQLSSYKERLESRIELLTADRKSLYRK
FT                   QRTVSVKSDEDALTKVKAQIADISKELAAFRREVRLCEDIAIRSGVIREKTKAVRKDEQ
FT                   SQGKENKRDEQFRRRSGADRQA"
FT   CDS             complement(581653..581994)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06100"
FT                   /product="Bacterial mobilisation protein
FT                   (MobC)./Ribbon-helix-helix protein, copG family."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88237"
FT                   /db_xref="GOA:D4JDG5"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDG5"
FT                   /protein_id="CBK88237.1"
FT                   /translation="MSKRNIEIKVRLNRKEAEILNKRVKKSRLSREAYLRHLIDGVVPQ
FT                   DSPPPDYYSMMRELHGVANNLNQIAQKAHVLNVVDVQRYDMAVHQVEAAIKTITDAVIL
FT                   PRRMDERVV"
FT   CDS             complement(581975..582100)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88238"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDG6"
FT                   /protein_id="CBK88238.1"
FT                   /translation="MREMMFLTIGFLTGSLNGIILMCLLQIKHIGKESENEQTKY"
FT   CDS             complement(582249..582569)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88239"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDG7"
FT                   /protein_id="CBK88239.1"
FT                   /translation="MREFEVTLNAVSRKTFKLRADSKEEAILLAEAILENTDLLSFSDE
FT                   DVSSMDMTCEEQCGGVCEICSRACENCGDCTELEQECGCPDRNCKRRCPACGSCMADIE
FT                   DD"
FT   CDS             complement(582582..583544)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88240"
FT                   /db_xref="GOA:D4JDG8"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR025054"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDG8"
FT                   /protein_id="CBK88240.1"
FT                   /translation="MPYIPPEVVAKAKEMDLLTYLKNYEPGELVHFGGSTYCSRTHDSL
FT                   KISNGKWCWFSRGIGGRTALDYLIKVREIPFIEAVEMIVGQAAIQPPAYERTPEKSAPK
FT                   VLLLPQSNRDATHAVRYLSGRGIDHEIINFCISTGRLYESSGRYHNVVFVGHDRYGKAR
FT                   YANLRGIGSDFKGECNGSDKRFAFNIPAENSEVLHLFESAIDLLSYATICKMKGMDWRK
FT                   EHLLSLAGVYQPREKMEESAVPLALSQYLGDHPEIKTIILRLDNDRAGRLAAKALMAVL
FT                   PKNFAIEARFPPTGKDYNDFLCTHMGIPITRSKEKKQER"
FT   CDS             complement(583639..583974)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88241"
FT                   /db_xref="InterPro:IPR024380"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDG9"
FT                   /protein_id="CBK88241.1"
FT                   /translation="MTNDELNTALYEKMFAEQETYRAWLLSQPSEEILNHTYEYTVRED
FT                   ILLSMEYNDLPDAQAKALLKSPTPLADIFKDWEHKETGYMEDIWQTVADRAKSEVQKQK
FT                   KKEDKER"
FT   CDS             complement(584152..584946)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06160"
FT                   /product="Domain of unknown function (DUF1814)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88242"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDH0"
FT                   /protein_id="CBK88242.1"
FT                   /translation="MKTPEQLKGTIRSMAAKRNLRAQEVLQMFLFERILERLANSKYKM
FT                   NFILKGGLLISSMIGISERTTMDMDTTVRGIQMEEDDIVRIVKEILTVDVDDGILFDYE
FT                   SIEPIREEDAYNNFRVHLRAKYGKIDTPMKIDVTTGDAITPAAVQYDFPMLFEDKTVPV
FT                   MAYTLETVLAEKYETIIRRNISTTRARDFYDLHTLYRSRKSEVRIEVFRAAVLHTAQKR
FT                   ESVEDIKDWKDILKDLREEPQMYLLWDNYISKTGISETWNSM"
FT   CDS             complement(584946..585566)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88243"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDH1"
FT                   /protein_id="CBK88243.1"
FT                   /translation="MPCEEMCAMDQIWMRINELAEANNGFVRTAQVEELGISRPMLRKY
FT                   TDAGKLEQVRKGLYVLTDGIPDEYALLQEQCRDAVFSYGTALYLWGLSDRTPHVYDITI
FT                   PRGKNVTILKRDNPSLRCHYLPRDFYEIGITQTRSPQGAEVRLYDKERCICDLIRNKEQ
FT                   MDMQLYTQAIKDYFKTKPNNRKLLKYGKLFGIEDKIRTYMEVL"
FT   CDS             complement(585761..586084)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88244"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDH2"
FT                   /protein_id="CBK88244.1"
FT                   /translation="MSDTYFDLPSRLEDSFPEIDSDIVTDLRKTSEEYVDIQQQISDLK
FT                   KQFPCIMKVMEDKGEIHLTAEEHAAFVQCLRLSRKLDDMERLQLYFRGHTDAVAYLKKI
FT                   KAI"
FT   CDS             complement(586148..586609)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06190"
FT                   /product="Protein of unknown function (DUF1273)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88245"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDH3"
FT                   /protein_id="CBK88245.1"
FT                   /translation="MTTCTFAGHREVYQPMMDAKIEKAIRELLQTDSEFIFYTGGMGEF
FT                   DSKCASAVRSAKRQYPHLKICLALVLPYTSNKLNTEKAYYEYYYDEIIIPEELCGVHYK
FT                   AAIQKRNRWLVDRADCLIAYLFRDFGGAYETVKYAKKQGKPVINLAEQK"
FT   CDS             586819..586941
FT                   /transl_table=11
FT                   /locus_tag="EC1_06200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88246"
FT                   /db_xref="GOA:D4JDH4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDH4"
FT                   /protein_id="CBK88246.1"
FT                   /translation="MSVSTNTLDDLCNLLDCSLSEIAAHVPNEEQQRETTENDA"
FT   CDS             complement(587015..595561)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06210"
FT                   /product="DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88247"
FT                   /db_xref="GOA:D4JDH5"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDH5"
FT                   /protein_id="CBK88247.1"
FT                   /translation="MARRYETITELYSKTVAGLAAPQAWQSFLTTACHNFRLPFDEQVL
FT                   LYAQRPDATAVLPIEGKNGWNQRFGRWVNRGATGIAVFDGDAVGRSRLKYYFDISDTHE
FT                   SRFARPVPIWTMRPEYEPAVIEALENSFGELEDKTDLAAALLSAAKNATQDNMPDYLTE
FT                   LKYYKENSFLEELDDLNIEVEYRRALENSIGYMLLARCGIDPAGYFTDDDFRDVVDFST
FT                   PETLNALGTATGDIGQMCLSAVSRTAHTLQRQAERETHTFAEKPTIQYPDAEKKTTTHE
FT                   RSEPYERTDIHDAGRLPAAESASAPGAGNAPWEIRIAAEDIPETAPQSDLHEPADIGQA
FT                   EPAPNGDRAGVPLPDGTADQPDGESRGRDGGTESQRSDEVDGADEQHPALSGGDSPERA
FT                   DLQLNTEPIENAGGDELPAFLDDKLIMAIISNKDDDLKYKKQQIELYFSIHPEETDRAE
FT                   YLKSAYQDRYTEILVDGVRVGYKPQADGLLMWAGAYLSRTSESVFSWSVVAGWTAQLID
FT                   KKEYFINTKITPPKSYDSQQLSLFDFADFQAPGREESGQLSFMPRPQLSQQVIDEAFCI
FT                   GANERNSRLIICAYFMKDHTPEENAAFLAKHYGTNGAGFYINERKYSIWYGEEGIRISD
FT                   GESAQRRYATLLTWEQAARRIRELLDLGRYMPQSELDRVVEYERKTLAESLALTARDFS
FT                   EEARGTGYAPTLRLALSAKGGFPEIEQQISELLKDPDTLQRITEEWGEFVAAHEQNRNL
FT                   MRFGYNRPKELLQKLTDLQREPVTFTAAEDYNPQRRFFISMDEIDKVLRGGGEDYRLAV
FT                   YSFFVNHPDQKDREKYLKNYHGEYSGYHGGNDNRTYTSKGLSFSHGDLTQPYAKVELKW
FT                   SVIIKRIDVLMSQDRFLSDRDREAMAGYEIRQLARSIHSFFIDAPELYPRPYQANAIAD
FT                   YWEGVEEVAEQLTNPNRVEEIYQMMLPLWEGTPQDDRHYQSRKTGLENMQAYRAGTYSV
FT                   FNRAQTLRPLSSSAETPSAEPETPKPELPVTPAEEEQDNASQNEELEEAKQLINVYCLE
FT                   VFDQEADFSDLSHVDLAFSSTSDSEHTVEIFADLVAFRLVYQVDGETVHEITCGSLSEL
FT                   NGYLANLDFDEMVAYADDRYQQEHADRGELAETESDTLTVERYLSDDESIVIQKYPNGQ
FT                   YHNRYGYNEQNGNAASTAGGFETLEEAENALLSHRPSAVKIAEPSKEHAEKEQSAVLAP
FT                   PKSKRERVVFTTLHPEIPADQRRNFRITDSELGHGTRSEKYAANVAAIRTLKQIEAEER
FT                   LATPEEQEILSRYVGWGGLADCFDERHGKYLELKSLLDENEYAAARASSLTAFYTSPVI
FT                   IGAMYQALSQMGFRQGNILEPSCGVGNFIGMLPDSMADSKAYGVEIDSISGRIAQQLYQ
FT                   NSSIAVNGFEKVQMPDSFFDVAIGNVPFGDFKVRDKKYDKNHWLIHDYFFGKTLDKVRP
FT                   GGVIAFITSKGTMDKENSAVRKYLAQRADLIGAIRLPNNAFKANAGTEVTSDIIFLQKR
FT                   DRMTDIEPDWVHLDTDENGIRMNRYFVQHPEMILGDMVMESTRFGMDSTCRAYEDADLS
FT                   ELLSEAVQNLHAQITDYEVEELDEEEDRSIPADPAVRNFSFCLVDGKVYYRENSRMHPI
FT                   EVSVTAENRIRGMITIRECVRRLIEYQTEGYPDEDIQKEQSELNRLYDDYTKKYGLLSS
FT                   RGNSLAFGEDASYCLLCSLEVLDEEGNLKRKADMFTKRTIRPHEAVTSVDTASEALAVS
FT                   ISEKARVDMEYMAELSGKSEEELAADLSGVIFRDIQCAEEAAAIPKAFVQVEQFPFVAA
FT                   DEYLSGNVRRKLRMAKALYEVLPDEKKPLIAKNIEALEAVQPVDLTAAEIGVRIGANWI
FT                   PIDVYQKFMVETFGTSYYAGSRIKILRSGATGQWAITEKNADRGNIKTLTTYGTKRMNA
FT                   YQILEQTLNQRDVRVFDYVEDENGNKKPVLNKKETAIAQDRQELIKQKFSEWIWKDIDR
FT                   RERLCRIYNETFNSIRPREYDGSHIRFSGMNPEITLRPHQVNAIAHIMYGGNTLLAHEV
FT                   GAGKTFEMVAAAMEMKRLGLCTKSLIVVPNHITEQWAAEWLQLYPSANILVATKKDFET
FT                   QNRKKFCARIATGDYDAVIIGHSQFEKIPMSAERQVAILQQQIDEIMFGIEEAKSAKAE
FT                   RYTVKQLERTRKSLEAKLERLNDQSRKDNLVTFEELGVDRVFVDESHYFKNLFLATKMR
FT                   NVGGIAQTEAQKSSDLFMKCRYLDEITGGRGVIFATGTPISNSMVELYTIQRYLQYDTL
FT                   QEMGLIHFDDWASDFGETITAIELSPEGSGYRAKTRFAKFFNLPELMATFKQVADIQTA
FT                   DMLKLPVPKANFHTEVIQPSELQQEMVRGLAERAEAIRAGGVDPRVDNMLRITNDGRKL
FT                   ALDMRLINPLAADDPNGKVATCARNVIRIWEQTKEQRSAQLVFCDLSTPKDDGSFSVYN
FT                   DLKKKLMEAGIPEEEIAFIHDANTEARKKELFSKVRSGQVRILMGSTQKMGAGTNVQDR
FT                   LIALHDLDCPWRPSDLAQRLGRLVRQGNQNPEVEIFRYVTEGTFDAYLYQLVENKQKFI
FT                   AQIMTSKAPVRVADDVDETALSYSEIKALATGNPLIIEKCNLDMEVGKLNMLKASYLSQ
FT                   KYALEDMVLKKYPEAITRLTERIAGYEQDVQIAADHPKPQEGFVGITILDQPYADKEAA
FT                   GKAILDVCTKMTGSDAVFLGQYRGFSLVLSYDGPSNEYRMTMKGTLSHTAVLGADVFGN
FT                   LTRMDNVIDGLSGKLEAVRAELADTQVQLENARTELVAPFAREAELAEKTARLKELNIL
FT                   LNMDQKDKSLIDDVPDEDTPERPRSKGMER"
FT   CDS             complement(595606..595914)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88248"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDH6"
FT                   /protein_id="CBK88248.1"
FT                   /translation="MAQLPPVHMKLNPDNFDLLMTILAFHAEEREFPGLANDAHDLMDK
FT                   WMRFSRLCTNLEGQEYVDIFMYENEAVGMIWQLLFAAADADMAVSDYHSRLQKGGIR"
FT   CDS             complement(595921..596466)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88249"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDH7"
FT                   /protein_id="CBK88249.1"
FT                   /translation="MSEDRHIIWSNFYLDYDDWKDDLEADYPDLSEQERIALMYEINGD
FT                   YLDDERMNLNVQLSAPILVIGDLGLWHGRRMGYKEIASGKISDCLYSDTDYATWYVDRL
FT                   GDLRCDAIHHDGTNHYLYRIYKPGVRQSQIDHLKEKLYFGTATRADITRITRRLGDDIA
FT                   KVYGFSIPRRRQEQAAER"
FT   CDS             complement(596463..597422)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88250"
FT                   /db_xref="InterPro:IPR025463"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDH8"
FT                   /protein_id="CBK88250.1"
FT                   /translation="MDMTIRAMTPAERNYGYAQSQQISMQTGLIGHLRADMDSNGKGFF
FT                   STFFDFRADLKTEDFKAEFDKVINALRFDENYGGALKDRSALAAYCRRTPESSFSGDGR
FT                   EFGFRADTEQYSYMLRLNPNRGEYNLYCYCYQRKWLDRHLQQAERGIRFINPNYKELFR
FT                   IPDGDKIRITYADGEKADRTCRYIDDYHVEIGSGWNSLRHICQFAEMMERNGSTVIPLR
FT                   SSLPEQCYSVLPDTEELIIIKKGESGYYRTDIDMGSKAENRALADEYNAKSGISKAQEQ
FT                   AMSAGSMFGWAVPAADPKNYDESGQPIRLKHRDRGDAR"
FT   CDS             complement(597422..598033)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88251"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDH9"
FT                   /protein_id="CBK88251.1"
FT                   /translation="MSDEKRMAGDYEIIQSVYIGDREIVVGENQADSDGLPYLVAYYES
FT                   NAILGRYYDAVVSDDFPEIMEIYGRRITEQAQKTRAELSKPKIQGIDNSPITAEGCTPI
FT                   SYDDDLNGKVIVIKPEVLRPEYRRATSQVKLCTGGFGAYPHSRGSAVFCTEVYTGRQSR
FT                   FERRDVLGVLEPENQPQWVQHYLLVLQQAEKQKKGKEQER"
FT   CDS             complement(598041..598811)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88252"
FT                   /db_xref="InterPro:IPR024559"
FT                   /db_xref="InterPro:IPR025923"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDI0"
FT                   /protein_id="CBK88252.1"
FT                   /translation="MKIRIYQINSDRDEHRMMFLSRDRLERFQGSPEVDSKIYDKVYDK
FT                   EVDCSNLEEVYTMLNINHPSDYRGRSLSVSDVVEVYESDAAPQGFYFCDSFGFKQVAFH
FT                   PEKCSVSERMNEQSAEKISVLLVEPGKYPRMIEIEDSLEAMQRVVGGDIEEFMPYEEEI
FT                   AIICNEEGKMNGMLPNRAIYSEPEGAKGREMVDIIFGQFFICYAPAESEKFLSLQKELA
FT                   QKYEAQFKLPERFFKQGDNIIAVPYKPKSKEYER"
FT   CDS             complement(598876..598965)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88253"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDI1"
FT                   /protein_id="CBK88253.1"
FT                   /translation="MDAKTGIAIGLVVFILAALVFLKIRSKKK"
FT   CDS             complement(598965..603188)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06280"
FT                   /product="Cna protein B-type domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88254"
FT                   /db_xref="GOA:D4JDI2"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR008970"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDI2"
FT                   /protein_id="CBK88254.1"
FT                   /translation="METETKAQMSNHGWISFQPVKSHRKDLKVIMKIKQLFKKAAAMVM
FT                   AAVTVLSLLPATAFAATGDVGTISFTRTYDSAGNAMYYNSSAVINGYTAGGTGKNKYRM
FT                   YVDGSTAFCIQPGVPLKTGNQLTENSSETWNALSASQKKAVGQALLYGYQGNRDSLTGS
FT                   DDEKWLATQTLVWEFVTGCRNSTGSYAQTDTTVYSLHFGSNYPNSGAAAAYDQIVSMLT
FT                   RHNTVPSFMNGSSRELEYKDGKYTLTLTDTNGVLSEYDFSSSDRSVSVSKSGNTLTISS
FT                   ADPFKGSVRITATRNNIPVVSESAKLIAYGDPNLQDLVTGVENTDGVSAYLNVETPTGT
FT                   IGLKKTSEDGKVDGITFIVEGNGIKQTVTTNAAGEILIDGLTPGVYTLTEQSYEKYEPQ
FT                   SVQRVTVIGGRTTTVTFNNVLKRGNLTVTKTSEDGLVEGMKFHLYGTSLSGIAVDEYAV
FT                   TDSSGKAYFKNVLIGSGYVLEEVDTPIRYVVPDSQTAAVEWNAVTEKSVTNVLKKWSAT
FT                   VTKSDRETGTPQGNASLAGAVYGIYKGDQLIDTYATDANGQFVTAYYVCDDDWSIREIS
FT                   PSEGYLLDETSYHVGSEPQLYTVEYNSTANDVNEQVIKGSIALIKHTDDGETKLETPEA
FT                   GAEFSVYLKSSGSYDAAKDSERDYLICDENGFAQTKQLPYGIYTVHQVSGWEGRELLAD
FT                   FDVYIAKDGQVYRYLANNANFESYIKVIKVDAETGKTIPYAGAGFQLYRPDGSKVEMTF
FT                   TYPTPTTIDTFYTNDEGYLVTPEKLEYGSGYSLVEVSAPYGYVLNSDPVSFDVTADNAT
FT                   EESSVTVVEVTKPNMAQKGIIKISKSGEVFATVTESDGIYQPVYEVQGLPGAVYEITAA
FT                   EDVVTPDGTLRYSAGEVVDTITTDENGLAESKPLYLGKYEIRETTAPFGMVLNTEACAV
FT                   ELVYAGQEIEVTETSASFYNDRQKVLVSLDKVMEQNEKFGIGMNGEITAVTFGLYAKED
FT                   LTAADGSIIPAGGLLEILSVDENGLSACKTDLPFGSYCLKEISTDSHYILSDTEYPVVF
FT                   EYAGQDTALVEIRANDGAAIENDLIYGEVQGMKKDDSGNALGGALIGLFAADTEEFTTD
FT                   TAILTATSAEDGSFSFAQVPLGNWIVREIKAPTGYVLSEDAYQVNIEADCAMIEVEIEN
FT                   MLIRGTVQLTKVDKDYPDNKLTGAEFEIYRDLNGNKELDAEDEKLGTLMEVSTGIYEMS
FT                   ELTYGGYLVKETKAPEGFYLDSNAYYFEITEHGKTVTVENEAGKGFINAAQVGSLKIIK
FT                   TSSDGKVEGFSFRVTGVGGYEQVFTTDKNGEILVEGLRIGDYTISEVSNSASQNYVLPA
FT                   DKKATVFEGAVTKVEMHNELRDTPKTGDDSNPALWIALMGIAAVGAVTCGVFGIKNKKK
FT                   KEDAE"
FT   CDS             complement(604223..605041)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06300"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88255"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDI3"
FT                   /protein_id="CBK88255.1"
FT                   /translation="MAKTKVISVANQKGGVGKSTSVYCIGAGLALDGKKVLLIDVDPQG
FT                   DLTKMLGLRKPHDLPRALGDVMSDVVSGKEIAEHTEIMHHHEGFDFVPGNRALSAVETG
FT                   LVNVMSRETVLRQYVDSVKNDYDYVLLDCRPSLGMLVINALAASDYVLIPVQADYLAAE
FT                   DMTELVGTVQQIKRQINPRLKIGGVFLTMANETNFRRDTVRAVKENFGKHLPVLQTVIP
FT                   ATVRLAEVSTADKSIFKHEPKGQAAAAYGGLVKEVLAIGEKQRGRSAQCR"
FT   CDS             complement(605172..605327)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88256"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDI4"
FT                   /protein_id="CBK88256.1"
FT                   /translation="MLKKEKRYLYLSNDETRLVVQSLIRFKNKLLQQGRYTDCVDELIL
FT                   KVSDTL"
FT   CDS             complement(605896..607107)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06320"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88257"
FT                   /db_xref="GOA:D4JDI5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDI5"
FT                   /protein_id="CBK88257.1"
FT                   /translation="MAKKQENVPRYGTAMRRGIQYYRTRITDADGKRVDLYAETCEELQ
FT                   LKEMEARRQVEEAVFRRKHPTVAEYCEKWLLMQSAKVSSGTLRGYTQTMNNYIVKPLGD
FT                   MYLEDVTADDIRLAMIPLASKSAGLYSKVNMLLKCVFYSAERSQLLEYNPCEGLSAKGG
FT                   KPGKKINALTDEQVKLLLDTVRGLPPYTFIMIALYSGLRREEILGLQWDCVFLDVPTPY
FT                   ISVRRAWRSEHNRPVISTTLKTKAARRDIPIPKCLTDCLREVKEKTESEYVVADRNGNP
FT                   LSSSQFQRVWKYVTVRSTKPHNYYKYVNGQCVKCTVTPTPGSHQKNNPKLVYAIDFDVT
FT                   PHQLRHTYITNLLYAGIDPKTVQYLAGHENSKTTMDIYAQVKYNKPEELLSVVNAAFAP
FT                   SVGV"
FT   CDS             complement(607251..608483)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06330"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88258"
FT                   /db_xref="GOA:D4JDI6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDI6"
FT                   /protein_id="CBK88258.1"
FT                   /translation="MAAKRKRIPRYSKVQINGHEYYKTDIEDADGKRVILYGKTREEVY
FT                   DKEMAALEQIDNATFRRKSPTVAEYCEKWLLMQSVHIRATTLIDYTSKVRRHIIKELGE
FT                   KRMADVTLDDIQVALVPVSKKSASVYKSVVILYKSIFRAAKESHVIDTNPTIYLEAKGG
FT                   GVPQEERQALTDEQVERLLDAIRGLPPYVFVMIGLYAGLRREEILALQWDSVYLDTDAP
FT                   YLTVRRAWHTEHNRPVILTELKTKAAERNIPLPDRLAECLKAAKKKSTSDYVIANQDGE
FT                   PLSYTQFKRLWQYIVTRTAKPRIARKLVDGKYVKYMLYPKLGEKARNNGHVVYSLDFEV
FT                   TPHMLRHTYITNLIHASVDPKTVQYLAGHESSKITMDIYAKVKYNKPEQLAGVLSGAFA
FT                   EWDGGEYEAAQ"
FT   CDS             complement(608791..609321)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06350"
FT                   /product="Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88259"
FT                   /db_xref="GOA:D4JDI7"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDI7"
FT                   /protein_id="CBK88259.1"
FT                   /translation="MNKTYLRGDMYYADLGRGIGSEQEGYRPVLIIQNDTGNKHSPTVI
FT                   VAAISSKVDAKAKLPTHYLLKAENGLELPSLVLMEQLRTIDKRRLETYIGHLEEQHIRR
FT                   LNRALAVSVGLIEETSKNLIMCLCPACANNFYGTGSYYLRRVHPGRVEKDICTYCGQRP
FT                   GFDYEVVKKKERK"
FT   CDS             complement(611292..611465)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88260"
FT                   /db_xref="InterPro:IPR025957"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDI8"
FT                   /protein_id="CBK88260.1"
FT                   /translation="MQQTEWVYCPVCGNKTRDRIREDTVLINYPLYCPKCKRKSLIQAK
FT                   QLHIVVIKEPDA"
FT   CDS             complement(611597..611968)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06390"
FT                   /product="Mn-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88261"
FT                   /db_xref="GOA:D4JDI9"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDI9"
FT                   /protein_id="CBK88261.1"
FT                   /translation="MPLTSSMEDYLEAVLIVAKKQIEVRSVDIARQLNVSKPSVWRAMT
FT                   VLKDGGFLTMDDHSFLLLTDLGQETAKKIYERHCFFTEQLIAAGIDPKTAEADACRIEH
FT                   NISDESFSRLKETATQKQD"
FT   CDS             complement(612007..612594)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06400"
FT                   /product="conserved hypothetical integral membrane protein
FT                   TIGR02185"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88262"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDJ0"
FT                   /protein_id="CBK88262.1"
FT                   /translation="MQTENKKGFQVKDLIVTALLSLCALVIYIICAFLSFSPYTMLVVS
FT                   PLWSLLAAITYFLVAAKTKKPWALFIFCAVTGIYGFYPPMIICCIIAGIISALIAWKTG
FT                   CTNGKTLTFSYIIYMVLAAFSGTYIPFLFFSNQTLEQYAGMFGESYLGILQTLVSPVTA
FT                   IIMLVVVAICAFVGALIAKKLLKKHFKKAGMV"
FT   CDS             complement(614817..616541)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06430"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88263"
FT                   /db_xref="GOA:D4JDJ1"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDJ1"
FT                   /protein_id="CBK88263.1"
FT                   /translation="MFSIIKRILRLSGKYRPRVIAGLIFNALKSCCAAFVFFAVLLVML
FT                   NIEHLTETVILQAFGIVALSVLGRFLFQYLSDVLMSASGYEIFREKRLEIGNQLKRAPM
FT                   GYFTENNLGTVQTVLTTTISDLEGNCMLALTFLVGGFVQALAMTLMLGIFCWQIGFLAL
FT                   TGILAGILVLGQIKKRAGAHTEDMQNAQELLVGSALEYIKGISVLRIFGKGKEGKGKVD
FT                   QAFENKCRSDIAVTISTAGIMKLYEAVFKITSCLLFLLSALLYLWGVITLPYCLLFIIC
FT                   AFLMFMELELMNDGAFLSKMLATQLDRLDFISDIPVLDGDGKDIVLKSYEIELKDVIFA
FT                   YDSRPVLDGITLKIPQNSTCAIVGPSGSGKTTLCNMIARFWDVNSGSVKIGGHDVKEFT
FT                   CDSLLSYVSMVFQKVYLFNDTIENNIKFGKPNATHAEVVEAAKRARCHDFIEALPQGYE
FT                   TMIGEAGSTLSGGEKQRISIARAILKDAPIVILDEATSSVDPENEKALLDAIFELTKNK
FT                   TLISIAHRLSTVRTADQIIVIDQGHIVQKGTHKELAEKEGIYRTFLKCREKSISWKL"
FT   CDS             complement(616543..618300)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06440"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88264"
FT                   /db_xref="GOA:D4JDJ2"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDJ2"
FT                   /protein_id="CBK88264.1"
FT                   /translation="MKKKTKPGAIQQLLSYAGNNKKQLYLSTFLATLGELFGMAPFITV
FT                   SLLVAELFNKTATIQNVCILFAVALGGQILKLWLTYQSSFMSHKATYKILKNIRSKIAD
FT                   KMLRVPMGVMLDTPTGNFKNLMADTVSKLEDSMAHFMPEITSNVVAPLCCILLVFILDW
FT                   RMGLAALITIPLGLLGYIGMMNDYVNKSTTYMKSQNAMNSTLVEYVNGIEVIKAFNQGS
FT                   ASYSKFTGAINFFHDSTLAWWKQSWLWSAVIQAVMPTTLLGTLPIGAWLYMTGTLPLSD
FT                   FITCIILPIGFIAPLMRVGKYSEQFNMVKACLDQIRDFIEKPELKRPEKNVALDETAYR
FT                   FENVSFAYNETEVLKNVSFEIKPGTVSAIVGPSGSGKSTIAKLMAGFWDATKGKVIFGG
FT                   KNIKEIPFAQLMGEVSYVAQDNFLFDESIRENIRLGKPDATDDEVVAAAKAACCHEFIV
FT                   KLENGYDTNAGDAGGKLSGGERQRITIARAILKNARVIILDEATAYADPENEYLIQNAI
FT                   SKLVKGKTLIVVAHRLATIQKADQILVVENGKIVGCGRQEELLSECPLYQRLWSDYVSS
FT                   ADQVEGGTF"
FT   CDS             complement(618368..618958)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06450"
FT                   /product="transcriptional regulator, TetR family"
FT                   /function="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88265"
FT                   /db_xref="GOA:D4JDJ3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDJ3"
FT                   /protein_id="CBK88265.1"
FT                   /translation="MECAKVEFLKKGFQATQLKDIVTAAKVTTGAIYRHFKDKEALFFA
FT                   LIEDVYHYTLDFLDNAEPYDKVGIREAIERDSVEASYVQAMTYVNYMYEHLEEFQLLLK
FT                   CSKGSRVENFIEEITIQYTKQNALFVKAAYEAGYAKCLPNDIEIHILTHGYITALCECV
FT                   LHDVPYKKAEDYVKNIIKFQHYGWYGVLGLPLK"
FT   CDS             complement(619161..619988)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06460"
FT                   /product="CHAP domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88266"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDJ4"
FT                   /protein_id="CBK88266.1"
FT                   /translation="MSGSRAVWKEVLAVYAVKTTTDSDNAQEVATMDDEKLELLKDIFW
FT                   QMNEISSSTSTQTETVIETSDDGNGNIVETETTVTQTYLYITVSHKTAEEMANQFGFNE
FT                   DQREQMAELLADENNSLWSQVLYGITGGDGEIVTVALSQVGNVGGEPYWSWYGFGSRVE
FT                   WCACFVSWCANECGYIEAGVIPKFAACASQGVPWFQERGLWQDNSYEPRPGDIIFFDWD
FT                   DGGQDGSSDHVGIVEKVENGRVYTVEGNSGDSVRQNSYPVGYYEIYGYGTPAC"
FT   CDS             complement(620023..620316)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88267"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDJ5"
FT                   /protein_id="CBK88267.1"
FT                   /translation="MGKGIKTRVSAKKGIKAIDKAAVASERMKEAYIRTKDKADHSLYA
FT                   EDRRAGNYCNLPHRYDYRLLLWDFLFRRGFRHRADHADCCTGDQYRLPGEPG"
FT   CDS             complement(620350..621138)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06480"
FT                   /product="sortase, SrtB family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88268"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDJ6"
FT                   /protein_id="CBK88268.1"
FT                   /translation="MSDKVKSRLMIAGAAFCAALFLFSGAMLAREYLDQKQSAEAFDEV
FT                   AGLVKEDVELPALELADDPAQEPEELTAFEKYADVYAKNSDLVGWISIPGTRIDYPVMQ
FT                   TKDNPNFYLKHAFDKSYSSYGVPYMQENCDVGISDNLMLYGHHMNNGSMFSDLCKYESE
FT                   DFYQDHKTIHFDTLDSFGEYEVIAAFKTVAYSEQGFKYYHFVRAEQEEDFDEFIAKCKE
FT                   LALYDTGVTAEYGDQLITLSTCEYSRTNGRMVVVAKLLEE"
FT   CDS             complement(621156..621908)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88269"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDJ7"
FT                   /protein_id="CBK88269.1"
FT                   /translation="MAEPALTLRDHPQIIDLISVLEQSGLQKQKEEVQALVGYIDGMEE
FT                   KLSQMMDEMKKMRLEVGKLHDKGIRARCSQLADTVEGKVRQTKVMVSTAKENLISSAKQ
FT                   MVQTFREKGRSALCHAAQALHIPSVLSRMGRGFAHSEKSMGQLAVRLDSMREELHQAGG
FT                   HIKNAGLALTGKEPQESKELSADKGVLAKLRSFVLSCGKVFSEMERDMALTVERINGGR
FT                   SSVKTELQGLRSAQAGQRRQAASKEQAR"
FT   CDS             624692..625192
FT                   /transl_table=11
FT                   /locus_tag="EC1_06530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88270"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDJ8"
FT                   /protein_id="CBK88270.1"
FT                   /translation="MLGLLPFAKVFRLLPALLAGPPGLQLLDGIFQGRIVVVAVLELKL
FT                   LRLQHFRAQPRPDKLFRRHTVIGDEPQHGKGGRPQNAHPGQGFHPKVGAQDKVKAHGHA
FT                   AGEDRKDELPHTQPEKHGFGVVADFPVDLDFQNITSQSHRRFPGKQCCSWVYRQSPAAG
FT                   RPR"
FT   CDS             complement(625335..626171)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88271"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDJ9"
FT                   /protein_id="CBK88271.1"
FT                   /translation="MSDNWVVQNLQNALDTWNKYLSEIWQLITQSPEQFKGGSIWGVIV
FT                   NIHDAVRAIGLALLVLFFVVGVMRTCGSFAEVKKPEHALKLFIRFAIAKGVVTYGLELM
FT                   MALFNIVQGLVSTIMNAAGFGTAQQTVLPQEIVTAVESCGFFESIPLWAVTLIGGLFIT
FT                   ILSFIMIMTVYGRFFKLYLYTAIAPVPLSTFAGEPTQNVGKSFIKSYAAVCLEGAIIVL
FT                   ACIIFSLFAAAPPAIDPNAAAVTQVWSYIGELVFNMLVLVGAVKMADRVVREMMGL"
FT   CDS             complement(626245..626598)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88272"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDK0"
FT                   /protein_id="CBK88272.1"
FT                   /translation="MKLFHKESKQKKETRSLPMGKKSRSAFAVYAALVLMLCCCTTTAF
FT                   AASDPLTVINNLSDFIFGLIRAVGMILLGFGVVQIGLSLKSHDPSQRANGFLTLAGGVV
FT                   ITFAKEILTLITG"
FT   CDS             complement(626582..628405)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06560"
FT                   /product="Type IV secretory pathway, VirD4 components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88273"
FT                   /db_xref="GOA:D4JDK1"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDK1"
FT                   /protein_id="CBK88273.1"
FT                   /translation="MKPDNKAGGPWLYALGLVPVIWFALLIAPAISGGLSEIVSALPAA
FT                   MNNPFKIVWCEDSVKTVLIFIAAYGLGIGIYLSSRRNYRRGEEHGSAKWGDPRAVNKKY
FT                   RDKDPFKNRIFTQHVRMGLDGRKHRRNLNTLVVGGSGAGKSRFYAKVNICQCNTSLFIL
FT                   DCKGELLRDCGGLLEQMGYEIKVVDLLNMEKSHCYNPFAYLKSDNDVQKMVTNLFKATT
FT                   PKGSQSNDPFWDTAASMLLMALVFYLWYEAPEDEKNFPMIMEMLRAGEVREDDDSYQSP
FT                   LDELFDRLEMRSPDHIAVKYYKDYRSGSAKTLKSIQITLASRLEKFNLSSVAALTATDE
FT                   LDLSSLGEKKVALFALIPDNDASFNFLVSLLYASTFQELFYSADRVHGGSLPVPVHFLM
FT                   DEFANVSLPDDFDKLLATMRSRNISVSIIIQNIAQLKALFEKQWESIIGNCDEFLYLGG
FT                   NETSTHKLISENYLGKSTLWLDTYGKSTGHSGSYSTNNQITGRELMTPDEVRMLDNNLA
FT                   LLFIRGEAPLMDEKYDLLKHPNIKYTTDGGAPVYSHGGTENAVADMTIGRLTPGDLANI
FT                   QEPETLYELLSDEDMENIFQFKEDTKNETVS"
FT   CDS             complement(628392..628589)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88274"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDK2"
FT                   /protein_id="CBK88274.1"
FT                   /translation="MEKQEKVVLTLDSYEHGIMIRALNELRNDMLEEQRDPGPVEDVLL
FT                   KTIDAPAQKDKKAKRRDEAR"
FT   CDS             complement(628605..629528)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88275"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDK3"
FT                   /protein_id="CBK88275.1"
FT                   /translation="MNNFDDLFEQQPQAEAAPQKQESQKERPKRQWWQIREEKQRKEAY
FT                   ATLDRIFGEFSEGTGSMEAYLDVQSRFPFHSARNALLIGDKCPDAVRVGGYKEWHAQGI
FT                   EILEDEKRLPIIILEPGKAYRREDGSVGQNFYAKEVYDISQTTARDQVQPQVRYDDRLL
FT                   LKGLIASSPVPIRAVEELPQGRGAMFSAEQNAILVKKGMDAPDIFRCVSLEVANVQLAQ
FT                   SMDGYSRETDGYKAYAVSYMLCKRYGVDAKEYEISKLDGVFQGQVPREDIPAALTDMRD
FT                   TFKSLNGRMARAMGLTRDSKQKEQER"
FT   CDS             complement(629535..630347)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88276"
FT                   /db_xref="InterPro:IPR024234"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDK4"
FT                   /protein_id="CBK88276.1"
FT                   /translation="MYNSGDAAEQVVRMSLEGAEFALKITGSAAKNLAAALYTVLKDQK
FT                   KTKGKARIEAMLREKRPLKVYTIKKEDCPEFAKQAKGYGILYAPIPVKKGDDTIDILVF
FT                   EDDAARANRIVEKFKLTVVDTASIKEDIEKSREQRGSEPAAPEQAMPEKSVDDQLLDEL
FT                   MEKPTQKEKAQPENPAAEKNAPFAPAAEKSPPSEPISESSSKSARGTSDGAEKPSVRQE
FT                   LRDIQAQRKKEAEAARAEEPAAPQKKAAQKTTRHQPPKPKKKPKSKER"
FT   CDS             complement(631792..632223)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06610"
FT                   /product="Bacterial mobilisation protein
FT                   (MobC)./Ribbon-helix-helix protein, copG family."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88277"
FT                   /db_xref="GOA:D4JDK5"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDK5"
FT                   /protein_id="CBK88277.1"
FT                   /translation="MRKRNVHVQFWLDKKEAEAFNKKVKRSGLSREAYLRHLVNGLVPQ
FT                   DAPPPAYYDFMRELHRIGGNLNQIAQKAHVLGVIDERRYDEEMRKFDQLVRDITKAVIL
FT                   PRAMDTKGSPRSLLRGEKEHPRSGEPFDACGKSGKRSAV"
FT   CDS             complement(632220..632333)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88278"
FT                   /db_xref="InterPro:IPR024522"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDK6"
FT                   /protein_id="CBK88278.1"
FT                   /translation="MEGLFFAIGFLLGGVVGVLIMCLLQINRIGRKEDSEE"
FT   CDS             complement(632475..632666)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88279"
FT                   /db_xref="InterPro:IPR025575"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDK7"
FT                   /protein_id="CBK88279.1"
FT                   /translation="MNHYDVTIRETLEVKMKVAANSREEAEQFARDQWKRGEVVLDASH
FT                   FTGVEFHAKRYFRDRGER"
FT   CDS             complement(632746..634140)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06640"
FT                   /product="Predicted transcriptional regulator with
FT                   C-terminal CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88280"
FT                   /db_xref="GOA:D4JDK8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDK8"
FT                   /protein_id="CBK88280.1"
FT                   /translation="MDELRKRQKIISQLVEARLEQGISQAELARRLGIQRSGINRLESG
FT                   TQNPTLDMILKIASALGKDVSLELNDKEEPMSNVYSLRIYDTELMRFSMEKQGLSGLVA
FT                   EILYTNEEQAHLLPLDMERTGEGVIHWLERRVIPKNRAFVDEILKTLGLSHNDTKGIID
FT                   VCKGLSLNDSYWVVPEGFEGGFSQYNLYENRFSEILALVAYTGAGGSRQAFTTSPELTT
FT                   GGMLPKAWRYVEHDGIYLYKGGTTGASNAGREPYCEYYASQIAETMRLNAVHYDLENWK
FT                   GITASKCALFTNIDTAYIPIGRIVRTGGIAACLAYYDKLGPEFSEQIRSMLVFDALIYN
FT                   EDRHFGNFGVLRDNHSGNIIAPAPIFDNGLSLFCYAGKEDYANLDEYAKTRSNPYNISY
FT                   EEVCAEVMGPKQKEQLRRMIGFRFKRHESLGLPEEHLQAIEKHLESRVRKLLAIPTRHL
FT                   KQEKAR"
FT   CDS             complement(634225..635196)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88281"
FT                   /db_xref="GOA:D4JDK9"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR025054"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDK9"
FT                   /protein_id="CBK88281.1"
FT                   /translation="MPFYDSEAIERARQVDLLTYLQTCEPQELVHVSGNVYCTKTHDSL
FT                   RISNGKWCWFSRGIGGYSALDYLIKVNGYSFLEAMETISGRAAIPPPSFVPAPKEEKPK
FT                   HLLLPQAAPDNRAMMAYLKGRGIDQEILDYCVQTGRIYESRNKGHSNVVFVGFDKDGKA
FT                   RFGCLRGISEARFHGDLSGSDKHFSFALPACVENPAVHLCECAIDVMSYATLCKLDGID
FT                   WRRHNLLSLAGVYQPKKKMEESKLPVALTRFLDDHPHVKTVYLHLDNDTAGRLAAKAIM
FT                   AVMPEGYRVENKPPPRGKDVNDFLCHRLGIPIRGSHSKEPER"
FT   CDS             complement(635532..635864)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88282"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDL0"
FT                   /protein_id="CBK88282.1"
FT                   /translation="MDDSYCLLPERISEQFSEIDSDIVMDLAAASPEYTELKAQMEELK
FT                   RQNLVIGALLEGKGELSFTAEEHEALKEFIRLYMRADNMEREHIYFRGHADGFAYLKKI
FT                   GAFKTE"
FT   CDS             complement(635948..636283)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88283"
FT                   /db_xref="InterPro:IPR024380"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDL1"
FT                   /protein_id="CBK88283.1"
FT                   /translation="MTNEELNTRLYEKMFAEQEQFRDWLLSQPPAEILNHAYEYTVRED
FT                   ILMSLEYHDLEDSQARALLKSDKPLKQIFERWENQETSYMDTVWDTVQEQARAAEAKQK
FT                   AKAQKER"
FT   CDS             complement(636295..646056)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06680"
FT                   /product="DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88284"
FT                   /db_xref="GOA:D4JDL2"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDL2"
FT                   /protein_id="CBK88284.1"
FT                   /translation="MAIRYKALTELYQETQRSVTAPDQWRAFLASACRNYRLSFDEQLL
FT                   VYAQRPDATAVLEIERWNRQFGRWVNRGANGIAVFDGEHNGKPRLKYYFDISDTHEARF
FT                   PRPVPLWTVREEYAPDIIETLENSFGELERKEDLGEALLSAAKNAVEDNMPDYLAELKT
FT                   LTEGSFLEELDELNLEVEYRRAVQNSIGYMLLVRCGLDPSEYFEDMDFRDVTDFNTPQT
FT                   LNALGVATGDISQMCLSAISRTVLALQRQPQKENRTFEPQQKNQYAVTEQENTQLERSF
FT                   EYDRDHLHQAGRLQSAEPSAAPGGAGSPWEIRIASEEIPQGAPQGDVHQPADQRQAEQP
FT                   SGGDPADRPAPDGADRGADGQEPGRDRGTESQRPDEVGADDEQPAERGGGNGAGGADLQ
FT                   LIDEPEESAGGEQLPALLDEKQIMAIIANKDDDLKYKKNQIELFFSVHSDVQERADYLK
FT                   SAYQDRYTEIIADGQRLGYKPQENGLLMWEGSYPSRTRESVFSWEVVAGWTAQLIDKKE
FT                   YFIQTDIPQLPTQESQQMSLFDFAAFQQPTQAEGTAKPSIFPHPALPQQVIDEALCIGA
FT                   NDQNSRLIICAYFKKDKPDNARFLAEHYGENGAGFYLDGRQYAIWYNAEGIRIAQGESA
FT                   QRSSATLIPWEQAAARIRELLDLGRYMPQSELDRVDEYERQQRAAQLWYLRQDFAEGTA
FT                   DAGYLPTVNTIYGKNHGFPEESAAISDLLGHPEGLQNLRDELEQFVQAYRENRELLRFH
FT                   FHRPQKLLEQLSDLQREPLHFTAAEGYAPQRRFFISGDEIDNLLRGGKRSTDYRLAVYS
FT                   FYRNHTERKERENFLKHYHGEYSGHSSGNDDVTYQLSKGVSFSHGSITAPYAKVELKWN
FT                   AVEKRVSAMIAQGRFLTDEDRAAMPQYEKHQLARNIRTFFENVPQEQPHPYPFGFDYWD
FT                   AVKLIEPQLDDPARVEEIYQMMVPIWEATPQDDRMYALRQQAFENLTAFRQGTFTLFAE
FT                   HKEPVVPTMPQAKAYDLGYGYLGNGVTVWNRLEEEHGDYKTVAHIAPDRTVTFYEEEMP
FT                   QAVREEIQRIADTSEMTISATQDAPVFTVPPRAQEPPQKEEPVDPYPKLAAQVLRFVGE
FT                   FDGSRMGYGEDDAQAVENIARQLHDPVQREEIRRLLQSFLDHADLEEEIAVDITLCMEQ
FT                   IAELPPALTPEQAQIEEIAGYLEEAGYAVSSELVEEGLMDYRAHGGKGNSQDVADFIER
FT                   EFLSEEPEPASLEIAKEFINDFCEAEYGSPADFSDLEKVGIAYTTVTDEEIPIQVNADL
FT                   VHYRIERYLDGQFLERRQYESLDELIQNELAELDFDQLTSVDQDYFNGKYPPDIEPYIF
FT                   CEWSESPVFEDGKRYGIREFDTLMKQADEEQVAGAKAALEKYGTWQAWYESDDPENARF
FT                   LGYDKVKFTVVMPDGTTYTERQDIGDGDGGVLDFLAQYPKYQDILPLLQQSTPPQNDYM
FT                   LLSRLKADCDYFLGAGGRAEKHLWAGNVREQIAKMRELYDALPEKPEWLTMEDIDRYAQ
FT                   RMEPPYEVVVYHHFENGFDERLDYQTLAEAEQAAQKYVAGTMEGEDGFAYDGAGIYDLQ
FT                   ENRWLRVYGNFPDERAIEQAKQAPAAEEPSASPEQADLQPKKEEALPLPPKHPRRERIT
FT                   FTTLHPEVPRDQRHDFHITDDALGHGTPSEKYAANAAAIRTLKQIEAEERLATPEEQEI
FT                   LSRYVGWGGLANCFEQTSPHYEELKSLLDSEEYAAARASSLTAFYTPPVVIRGIYKALA
FT                   QMGFTQGNILEPSCGTGNFLGLLPTDLAGSKAYGVELDSISGRIAGQLYQNANISVNGF
FT                   ETVQMPDSFFDVAVGNVPFGDFKVLDKRYDKHHWLIHDYFFGKTLDKVRLGGIVAFITS
FT                   KGTLDKENSSVRKYLAQRADLIGAIRLPDNTFKRNAGTEVTSDIIFLQKRDHITDLDQD
FT                   WVHLDTDENGIRMNRYFVQHPEMILGDMVMESTRFGPDSACKAREGEDLSEQLANAIQF
FT                   LQAEIKPYELEELDEEEDRSIPADPTVKNFSYTIADGQVYYRENSLMHPVEVSVTAENR
FT                   IRGMIELRECTRRLIEYQTEGYPDEDIAAEQQKLNALYDSFTAKYGLLNSRGNKLAFSE
FT                   DSSYCLLCSLEVLDEQGNLKRKADMFTRRTIRPHVAVTSVDTASEALAVSISEKARVDM
FT                   DYMAELSGKSPEELEKELAGVIYRDIRCAENPEDILPSLADLSRYPLVTADEYLSGKVR
FT                   QKLRMAKAFLEVAPDNQKETARRNVEALEAVQPQDLGAGEIGVRIGANWVPIEVYQQFM
FT                   VELLTPNYYVRDRIKILRSEATGQWSIREKNADRSNVKAITTYGTKRMSAYHILEQTLN
FT                   QRDVRVFDYIEDENGKKKPVLNKKETAIAQDRQELIKQKFAEWIWKDIDRRELLCRVYN
FT                   ETFNGVRPREYDGRHIRFEGMNPEISLRPHQINAIAHILYGGNTLLAHEVGAGKTYEMV
FT                   AAAMEMKRLGLCTKSLIVVPNHITEQWAAEWLQLYPSANILVATKKDFETQNRKKFCSR
FT                   IATGDYDAIIIGHSQFEKIPMSLERQQAILERQIEEILEGIEQAKAQKAERYTVKQMER
FT                   TRKSLETRLAKLNDQSRKDDTVTFEQLGVDRLFIDESHYFKNLFLATKMRNVGGIAQTE
FT                   AQKSSDLFMKTQYLDELTGGRGVIFATGTPISNSMVELYTIQRYLQYRLLQEMGLVHFD
FT                   DWAGSFGETVTAIELSPEGTGYRAKTRFAKFYNLPELMAAFKEVADIQTADMLCLPVPK
FT                   ANFHTEVIQPSELQKEMIRGLAERAEKIRAGGVDPHVDNMLRITNDGRKLALDMRLINP
FT                   LAADDPNGKVAVCARNVFRIWEQTKEKRSAQLVFCDLSTPTTDGSFSVYDDLKKKLMDA
FT                   GIPEEEIAFIHTADSEAKKKELFSKVRAGQVRVLLGSTAKMGAGTNVQDKLIALHDLDC
FT                   PWRPSDLQQRLGRIVRQGNENEEVEIYRYVTEGTFDAYLYQLVENKQKFIAQIMTSKAP
FT                   VRVADDVDETALSYSEIKALATGNPLIIEKCNLDMEVARLNMLKASHLNQVYALEELVY
FT                   RKYPEEITRLTERIAGYEQDVALAAAHPKAQEGFCGMEVDGRHYTEKEGAGKAIIDVCT
FT                   RMTGSDAVLLGQYRGFSMVLAYDGRSNEYRITLKGTLSHTVTLGADVFGNITRLDNALE
FT                   NLAGSLQAEQNSLEETKAQLENARTELATPFAREEELAEKTARLKELNILLNMDEKDKT
FT                   LMDDTPDEGEDVPARRVAELAR"
FT   CDS             complement(646075..646383)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88285"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDL3"
FT                   /protein_id="CBK88285.1"
FT                   /translation="MASLPPVKLDTHEDWFNLLMTVLHQQAEQNPYEEYREMAQKLIDQ
FT                   FMRYGRPFVDSDHAPCVALRMYPKEAGNTIWLLLLSLCNQYDPDKDYSAELKAAKKE"
FT   CDS             complement(646394..646939)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88286"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDL4"
FT                   /protein_id="CBK88286.1"
FT                   /translation="MKEERHVIWSNYGLDYEDWRDDLEADYPDLSEDERISLMYEINGD
FT                   YLDDERANLNVQLSQPILVVGDLGLWNGRRMGYKEIPSGNIRDCLYSDTDYSTWYVDRL
FT                   GDLRCDAIHHDGTNFYLYRVYKDSASPSQIELLKEKLYRGIATRADITRVTRRLGDDIA
FT                   KVYGFSIPRQRQAVAMER"
FT   CDS             complement(646936..647892)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88287"
FT                   /db_xref="InterPro:IPR025463"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDL5"
FT                   /protein_id="CBK88287.1"
FT                   /translation="MELTITSMTPADRLYAYNQSSQLEGQTGCIGHLRGDFGAGKEFYT
FT                   SWFDHRREYKTDEFKAELDEVVNTLREKNGLLCTRDSMTRFCYQNPEAEFEGNYCAEYG
FT                   FKVQTPQHTYMLRCNPNYGDYNFYLYAYVSRFLEHHMEKAKQGIRFITPGYKELFRIPD
FT                   GDHIRIFTGGGETRDRTCRVIDETHFETSGGYSSALYHICEFAERLEQTHGSVIPLRSS
FT                   LPVQCFSVLPSSGELILLTRGEKGYSPCYDFSTPDAQQNREFADDRNVKNGVTKAQEAA
FT                   MLAGSMLGWQTPAADPRNYDEQGQPIKPRQKDRGEAR"
FT   CDS             complement(647892..648530)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88288"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDL6"
FT                   /protein_id="CBK88288.1"
FT                   /translation="MMDYRENAGYIITDSCHVGDSEFVLGVHLTAPQQFVTWKCSNRTD
FT                   YDWGHYFSDLFSAQKDLVARAQEEVQCLEEQRQNTIAPEAPPYSPWGKVQECETLCPGV
FT                   YSVSTPGHGGVMVRRELAEKVFRKEAMGCGFIASGYLCFEEDNDAQVALRELMDKKMIQ
FT                   APVNGRFAPGAYEAVINSSVQIHHPEYWQAREKAISEQKRQAKKKGRER"
FT   CDS             complement(648527..649150)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88289"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDL7"
FT                   /protein_id="CBK88289.1"
FT                   /translation="MNDDSTEKRMAGDYEIIQAVQIGDREVVLGENPQDETGMKYMCAF
FT                   CRQNALFAEYSEVMASDDFPEIVELFGQRVAEQAQKTHIELNKPRIQGIDDRPITAEGC
FT                   IPISYEDDLHGKIVVIKPEVLRREYRRATRQLKLCMGGFGASPHSRGSACYCVDLYTGK
FT                   ESRYERMDVLGTIQPEDLPGWAKHGLTAIQQEQAKKKTAKERER"
FT   CDS             complement(649150..649389)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88290"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDL8"
FT                   /protein_id="CBK88290.1"
FT                   /translation="MNELHLLDILAARHGCFISDLNLSPILRRAALLDLCRMDENSYPL
FT                   SQWQDTVRYLTGDERDFASVKEIKVFIKQELEAE"
FT   CDS             complement(649382..649624)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88291"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDL9"
FT                   /protein_id="CBK88291.1"
FT                   /translation="MRERFEQRLFRIFAQAGYSPVQLLTITPEEMVEVPGITVPNIRAV
FT                   LCVQNKVLADRNKVRSGRLVEELLKEAEESRCCHE"
FT   CDS             complement(649689..649778)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88292"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDM0"
FT                   /protein_id="CBK88292.1"
FT                   /translation="MELKAIIAIALVVFIIGGLIFLKVRSRKK"
FT   CDS             complement(649814..654043)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06770"
FT                   /product="Cna protein B-type domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88293"
FT                   /db_xref="GOA:D4JDM1"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR008970"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDM1"
FT                   /protein_id="CBK88293.1"
FT                   /translation="MKALRKPLSLFMAMLMCLGIFAGTGTTAFAAGETMTTYMVEFPRA
FT                   SDPNKAGWGHSAMNFLGGWSTGENNGFTIHTQDSFNGKVIYCIEPGVSVHSGDQFTGRG
FT                   EDFWDDYPSDLNPTIPPDTIKEYIGRIMTYGWQGNASTSWMTDDPEDASKMAGAIATQL
FT                   LVWETVVGERDSQFNHVDANAQGKNNIAEYTSPENPLYSEIFSQYSAIESAVKRHTMLP
FT                   SFFSSTADAGAYELKWDGQQYSLTLTDTNGVLGDYTFTSNITGLNFSVDGNQLTITSSQ
FT                   AIKGSVTVKAEKISAQRSGVVVWTDGIIGGGKQDFATYGETVSDYMVGYLNLEVKTGNM
FT                   KLVKTSEDGQVAGISFTITGEGYSATKTTNEAGEIDISDLNPGVYTVTEQSIDKYEPQE
FT                   SQRVTIVSGQTATVTFSNVLKRGSLEVTKTSEDGLVEGMTFHLYGTSLSGQPVDEYAVT
FT                   DGNGVARFENVLIGTGYVLEEVDTPIRYVVPDSQTATIEWNEVTHKSVNNVLKKFRVTV
FT                   TKSDVETGAPQGDGSLAGATYGLYKGDTLIDSYTTDENGQFTTGYYVCDSDWTIREINP
FT                   SEGYLLDSSIHKVGAEPELYEIELNDTANDVTEQVIKGDIAIIKHTDDGETQIETPESG
FT                   AEFQVFLKSAGSYENAKESERDVLVCDENGFAQSKKLPYGTYIVRQTKGWEGRELMDDF
FT                   EVYIAQDGQTYRYLINNANFESFIKVVKVDAETGVTIPYAGAGFQIYRPDGSKVEMTFT
FT                   YPTPTTIDTFYTNSEGYLVTPEKLEYGAGYSLVEVQAPYGYVLDSTPVYFDVTEDNSSV
FT                   EGGVTVIEVTKPNMAQKGIIKVSKTGEVFSSVTENEGVYQPVYEVQGLPGAVFEITALE
FT                   DVYTLDGTLRYSAGEVVDTITTGEDGTAQSQPLYLGKFQVKEIQFPHGMVDTGENVTNV
FT                   ELVYAGQEVEVTETSASFYNQRQKALVTLDKVLEQDETFGIGMNGEISAVTFGLYAQED
FT                   ITAADGSVIPADGLLEIVSVNENGQAVCSTDLPFGSFYLKELSTDSHYLLNGETFPFTF
FT                   EYGGPSVAVVEISANDGEAVTNELIRGEIKGLKTDENGTGLGGAVIGLFKSDETEFTAE
FT                   NALATTTSADDGSFSFTNVPYGDWVLKELESPEGFILSDEVIPVTVEEDGQVVEISLAN
FT                   ERVYGDLRLTKVDKDYPDNKLTGAEFEVYRDTNGNKELDEGDELLGKLEETSTGIYEMS
FT                   HILYGGVFVRETKAPEGFLLDENAYYVEITENGKIYEVENEAGIGFTNMAQTGSLRIEK
FT                   TSSDGKVEGFSFRVTGANGYDQTFKTDKNGEIFIEGLRVGDYTVSEVSDGASANYVLPA
FT                   DKKVTILADKTTVAQMHNELRDTPKTGDDSKPWLWAALMGVSAMGAAALGVAAYVGKRK
FT                   KDNHTAK"
FT   CDS             complement(654327..655298)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06780"
FT                   /product="ParB-like partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88294"
FT                   /db_xref="GOA:D4JDM2"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDM2"
FT                   /protein_id="CBK88294.1"
FT                   /translation="MAKSNGLNFNLPSVDDLFSTEEERAEARLEKVVNLSPTEISDFPN
FT                   HPFKVRMDAAMQEMTESVKQYGVLVPALVRPKPEGGYEMVAGHRRKKAADLAGLAKIPC
FT                   IVRQLTDDEATIIMVDSNLQREQILPSEKAFAYKMKLDALKRQGQRTDLTSSPLDNKLK
FT                   GVTAAQQISRDSGDSQPQIYRYIRLTHLIPEILELVDNSVLKDQEMLQIAMRPAVELSY
FT                   LRKEEQADLFAIMDEMDCTPSHAQAIKMRQMSEAKTGGERLAKDALVSIMKEEKPNQKE
FT                   QFKIPKEKISRFFAPGTPTQKIEDTIVKALELYRKRQRSLER"
FT   CDS             complement(655252..656100)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06790"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88295"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDM3"
FT                   /protein_id="CBK88295.1"
FT                   /translation="MPEQRSRPRDGRVIALANQKGGTGKTTTTVNLGIGLARLGKKVLL
FT                   IDADPQGDLTTCLGWQDQDSLPTTLATVMEKVIRDEPFTTDEGILHHSEGVDLMPANIE
FT                   LSALEMSLVNAMSREFTLRTYVNEAKKHYDVVLIDCMPSLGMITINALAAADSVIIPVQ
FT                   AHYLPAKGMTQLMKTINKVKRQINPALKVDGVLLTLVDGRTNLARQTADTLRQSYESVL
FT                   KIYRSEIPVAIKAAEISAAGKSIYAYDKGSKVAQAYADFSKEVLADGEKQRAKLQSSLS
FT                   R"
FT   CDS             complement(656246..656410)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88296"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDM4"
FT                   /protein_id="CBK88296.1"
FT                   /translation="MKKRKFKIYLTPAENSIVIQSLNHLRNTMLRENRDTGCLDELLLK
FT                   AMCAPVKKM"
FT   CDS             complement(656853..657260)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06810"
FT                   /product="SSU ribosomal protein S9P"
FT                   /function="SSU ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88297"
FT                   /db_xref="GOA:D4JDM5"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDM5"
FT                   /protein_id="CBK88297.1"
FT                   /translation="MPAKKSNSVQYHGVGRRKTSVARVFLRPGTGNIEVNGKTLEEYLP
FT                   LETLRMVVKSPLELTNTLDQFDVMINVYGGGYTGQAGAMRHGITRALMECNEDYRPVLK
FT                   AAGFVTRDPRAKERKKYGLKAARRAPQFSKR"
FT   CDS             complement(657274..657711)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06820"
FT                   /product="LSU ribosomal protein L13P"
FT                   /function="LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88298"
FT                   /db_xref="GOA:D4JDM6"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023564"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDM6"
FT                   /protein_id="CBK88298.1"
FT                   /translation="MRQTTMAKPADVKRTWYVVDGEGQTLGRLATTCAHVLRGKHKVTY
FT                   TPNVDCGDYVIVVNADKVDMTGNKLNTEKYYNHSGYFGGLRVRTAKEMKEKYPVEWVER
FT                   AIKGMLPHTKLGDKQRTHVFVYAGSEHPHAAQQPVELKVKG"
FT   CDS             complement(657803..658630)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06830"
FT                   /product="histidinol phosphate phosphatase HisJ family"
FT                   /EC_number="3.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88299"
FT                   /db_xref="GOA:D4JDM7"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDM7"
FT                   /protein_id="CBK88299.1"
FT                   /translation="MKQTNFHTHTWRCNHANGSDEEYVLEAIENDFEILGFADHCCWKY
FT                   DSGFVPWIRMKEQEFPHYKSSIMNLKKKYAKDINIRLGMEAEYFPDKMDWMLDFCIDED
FT                   IDYLIFGNHYYQSDETGIYYGSVEPEYVQSYFDSCIEGMKTGMYAYLAHPELIMRNKYL
FT                   GWNETVEIGFHRICQTAKELDMPLEYNVLGMMYNERYKVDAYPNSRFWKIASQYKNKAI
FT                   IGMDSHQPFDLNKTNYMKALDNLSKYNVEIIDDIKRVDYLAIKAKKALNNLEF"
FT   CDS             complement(658642..659373)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06840"
FT                   /product="pseudouridylate synthase I"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88300"
FT                   /db_xref="GOA:D4JDM8"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDM8"
FT                   /protein_id="CBK88300.1"
FT                   /translation="MIYKVILAYDGSNYAGWQKQENALGIQEVIEKALTTIHKKEIFIT
FT                   ASGRTDAKVHALGQVFHFEADKKIGPDRYKMALNALLPEDIRILKVSMEADDFHARFSA
FT                   KSKRYDYICTYEKENPFVYKYKEILNHTLNIEAMRKASEYLVGTHDFTSFSSSKIDPRK
FT                   PRIKTITRIDIFEENQDIRFIYEGTGFLRYQVRMMTETLIMVGSNKIDTEEVKRILDKK
FT                   DKSACRYNASPNGLYLVHVNY"
FT   CDS             complement(659370..660170)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06850"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88301"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDM9"
FT                   /protein_id="CBK88301.1"
FT                   /translation="MNNIALGRYMPLNSVVHKMDPRAKIMILLFLMIAVFIPAGVWGYV
FT                   LLSLFILVALFLSKLQLSFALRAMKPMIWMMVFLLVINILVIKTGTLWFELGWFSIYSD
FT                   AIYQTLYIVVRLTLMIIMTTILTASTKPLDLTLGIEKLLKPFEKIGLPSHIIAMMISIA
FT                   LRFIPTLIEETQRIMNAQASRGVDMENGTIKEKVMAILSLIVPLFVSSFDRADQLANAM
FT                   EARGYNPMQERTRYKVLKMTGIDYVGLLSSIALLVLCIVLAVIL"
FT   CDS             complement(660163..661023)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06860"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88302"
FT                   /db_xref="GOA:D4JDN0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDN0"
FT                   /protein_id="CBK88302.1"
FT                   /translation="MSIKIHQLEHVYNPNTPFSHAALKGINLEIPEGKVTAIIGQTGSG
FT                   KSTLVQHLNGLLIPTAGTLDICGYHIQPLLKIKDVKQLRKEVGLVFQFPEYQLFEETIE
FT                   KDIAFGPKNFGVEETEASQLVRNILPVVGLDESYLDRSPFELSGGQKRRVAIAGILVLD
FT                   PKVLVLDEPTAGLDPQGAKEMMTLFMRLNREQNKTVLLVTHDMEHVMKYCDHVIVLDHG
FT                   AVKQTSDVKTFFEHPEWIVNIGINPPSIIRLKMRLKEAGFDIPDEIIDEDGLLKCIKRQ
FT                   VKIHE"
FT   CDS             complement(660999..661826)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06870"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88303"
FT                   /db_xref="GOA:D4JDN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDN1"
FT                   /protein_id="CBK88303.1"
FT                   /translation="MSAVEVSHLSFSYDGQNDVIKDVSFEIPKGSYTTIVGHNGSGKST
FT                   IAKLLIGLLKAKSGEIKILGNTLNEENVYSLRNHVGIVFQNPDNQFIGSTVADDIAFGL
FT                   ENHCVPQEQMQAIIEDVAARVNMSDFLDSEPTKLSGGQKQRVAIAGILAIAPDIIIFDE
FT                   STSMLDPQGKASINEQIQKLHDERNITILSITHDMEEVAQSEYVIVLKDGKVEMQGTPK
FT                   QIFEHKGKLKEMKLELPFALSFSEKLKNEGVFKDSYCTLDEVVNELCQLRSTN"
FT   CDS             complement(661892..662347)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88304"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDN2"
FT                   /protein_id="CBK88304.1"
FT                   /translation="MKFLKFLLGVGVIGAAGAAIATKKSRDKKRQAELDEFLMPEDDTV
FT                   IIDVPKKEPESLTKLEADLYALENEKENILPLTFIFSFENFEEANKFKNELTLRTITST
FT                   INDQDRFVEVIYNDVITHDTFTVLLNDFKEAMEKSQVTYQGYRYFAK"
FT   CDS             complement(662350..662931)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06890"
FT                   /product="Predicted O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88305"
FT                   /db_xref="GOA:D4JDN3"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDN3"
FT                   /protein_id="CBK88305.1"
FT                   /translation="MNLEKEMNEFAKANHVPVMMDEGVELLIAKVKEYNCKSFLELGTA
FT                   IARTAIRVASLDPEMRVVTIERNPEMIEQAKINIKQSGYQNQITLIEGDALEVELPDQK
FT                   FDCIFIDAAKAQYTRFFKKYSPLLNSNGIIVTDNMYFHGLVEHPENTNNKNTKDLVRKI
FT                   RNYHEFLSSLDEFETTLYSKGDGVAVTRRK"
FT   CDS             complement(662964..663326)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06900"
FT                   /product="LSU ribosomal protein L17P"
FT                   /function="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88306"
FT                   /db_xref="GOA:D4JDN4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDN4"
FT                   /protein_id="CBK88306.1"
FT                   /translation="MWNRRLGRTADHRKALLRNMATSLIENEQIETTEMKAKELSAVMD
FT                   KLVTLAKRNDLHARRQAAAYVRNVEVDDEGTTALQKLFNEIGPRYAERNGGYTTVIKTR
FT                   IRRGDAAPMAIVQFVK"
FT   gap             663340..664953
FT                   /estimated_length=1614
FT   CDS             complement(665080..665730)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06910"
FT                   /product="Adenylate kinase"
FT                   /function="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88307"
FT                   /db_xref="GOA:D4JDN5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDN5"
FT                   /protein_id="CBK88307.1"
FT                   /translation="MNIFIMGAPGSGKGTFSSRIKEEFNLNHISTGDIFRENIANETEL
FT                   GLQAKSYTEKGLLVPDEITNNMVKEYLSHLADKKNGYLLDGYPRTLDQAKAFEEMTKGT
FT                   DLAVEKIVVMDVPFDELTRRITGRRLCKKCGAIFNIYSKPPKTEGICDECGSALTQRKD
FT                   DNEESLKVRLDEYAKNTEPVIAYYEEKGMVSRIDASKAIDAIWPELKETLKNK"
FT   CDS             complement(665751..667046)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06920"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /function="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88308"
FT                   /db_xref="GOA:D4JDN6"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDN6"
FT                   /protein_id="CBK88308.1"
FT                   /translation="MAFRGKAIFTNKDIRNRILFTLFAFLVYRLGSAITVPDVNTADLV
FT                   AGIEDNSLFAMINLLGGGGLEQFSIFALGVTPYITASIIIQLLSMDVVPHLSELAKNGA
FT                   TGRKTLDKYTRYLAVVFAFVQSFSLVYGFSQTYTTLIEGGVTMAKIMYIATIFTAGSMF
FT                   LVWIGDQISIKGIGNGISMVIMAGIVGRMPQQFADAWTTLIGAESTIENGAWLFAGYIL
FT                   VYLLIIIFVTLINTAERRIPIQYTSSSIQLSKRSESNYLPLKVNSASVIPVIFASSLMM
FT                   APLQIASFFPTNDIIRTMQDWLGLQTWYSLVIYVLLILFFTFFYTKMQINPEKISENLG
FT                   KSGAYIPSVRPGTETKNYVNKVLSRITVLGSICLALIAVLPHIMPLIWTDMPTSMALGG
FT                   TGMIIVVGVAIETVRQVQGLITQKSYKKYFED"
FT   CDS             complement(667048..667485)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06930"
FT                   /product="LSU ribosomal protein L15P"
FT                   /function="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88309"
FT                   /db_xref="GOA:D4JDN7"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDN7"
FT                   /protein_id="CBK88309.1"
FT                   /translation="MKLHEMTSTEARKSRNRVGRGPGSGNGKTSGRGQKGQKARSGGGV
FT                   RLGFEGGQTPLARRLPKRGFTNFNRKEYAVVNVETLNRFEDGTTVNMALLIEEKIVKKE
FT                   LCGLKVLGNGELTKKLTVQAVKFSKSAKEAIEKAGGTAEEI"
FT   CDS             complement(667500..668009)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06940"
FT                   /product="SSU ribosomal protein S5P"
FT                   /function="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88310"
FT                   /db_xref="GOA:D4JDN8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDN8"
FT                   /protein_id="CBK88310.1"
FT                   /translation="MAMERKPRRDQKEFEEQVVAINRVTKVVKGGRRFRFAALVVVGDR
FT                   KGRVGIGTGKANEVPDAIKKAIEDAKKNVFTVPIVGTTIPHDIVGNYGAGSVFMRPATE
FT                   GTGVIAGGAARAVLELAGINDILTKCLGSRTKINVVRATVDALQNLRTLDEVAALRGKK
FT                   PEEIRG"
FT   CDS             complement(668021..668377)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06950"
FT                   /product="LSU ribosomal protein L18P"
FT                   /function="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88311"
FT                   /db_xref="GOA:D4JDN9"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDN9"
FT                   /protein_id="CBK88311.1"
FT                   /translation="MINKVSRNEQRIRRHKRVRRKISGTPECPRLCVFRSNANIEVQII
FT                   DDVAGNTLVSASSVNMKLENGGNIEAASKVGAEIAKRASEKNIKKVVFDRGGYIYTGRI
FT                   KALAEAAREAGLEF"
FT   CDS             complement(668399..668944)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06960"
FT                   /product="LSU ribosomal protein L6P"
FT                   /function="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88312"
FT                   /db_xref="GOA:D4JDP0"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDP0"
FT                   /protein_id="CBK88312.1"
FT                   /translation="MSRIGNKLITIPAGVTVEVAAGNEVTVKGPKGTLTRKFSDLMEIK
FT                   VEENQVTVVRPNDEKHTKQLHGTTRALLHNMVVGVSEGFTKSLELVGIGFRTAVKGNVL
FT                   TMNVGYSHQVEMPIADGLQVTCPSATEITVAGIDKQLVGEFAANIRAVRKPEPYKGKGI
FT                   RYKGEHIRRKEGKTAGKK"
FT   CDS             complement(668964..669359)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06970"
FT                   /product="SSU ribosomal protein S8P"
FT                   /function="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88313"
FT                   /db_xref="GOA:D4JDP1"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDP1"
FT                   /protein_id="CBK88313.1"
FT                   /translation="MIMTDPIADMLTRIRNALQQKHESVSMPASKEKQAIAKILKDEGF
FT                   ITDYSVEGDVKKTLTITLKYAEDNKRVISGLRRISKPGLRVYAKVDNLPRVLNGLGIAI
FT                   ISTSNGMMTDRDAKKNHLGGEVIAYVW"
FT   CDS             complement(669375..669560)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06980"
FT                   /product="SSU ribosomal protein S14P"
FT                   /function="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88314"
FT                   /db_xref="GOA:D4JDP2"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDP2"
FT                   /protein_id="CBK88314.1"
FT                   /translation="MAKKAMINKQQRPQKFKVREYTRCERCGRPHSVLRKYKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   CDS             complement(669571..670110)
FT                   /transl_table=11
FT                   /locus_tag="EC1_06990"
FT                   /product="LSU ribosomal protein L5P"
FT                   /function="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_06990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88315"
FT                   /db_xref="GOA:D4JDP3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDP3"
FT                   /protein_id="CBK88315.1"
FT                   /translation="MNRLQDKYQNEVVPAMMKEFNYKSVMEVPAIEKVVVNIGVGDAIQ
FT                   NSKLLDEAVEELAAITGQQPVITKAKKSIANFKLREGMPIGCKVTLRRQKMYEFLDKLF
FT                   NISLPRVRDFRGVSDTSFDGRGNYTLGIKEQIIFPEIDFDKVNRSRGMDVVIVTSAKTN
FT                   EEAKALLTKMGMPFKK"
FT   CDS             complement(670455..670823)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07010"
FT                   /product="LSU ribosomal protein L14P"
FT                   /function="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88316"
FT                   /db_xref="GOA:D4JDP4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR023571"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDP4"
FT                   /protein_id="CBK88316.1"
FT                   /translation="MIQNESRMRVADNTGAKEVLVIRCLGGSVRKFSNIGDVVVCTVKQ
FT                   ATPGGSVKKGDVVKAVIVRTKRGVRRENGSYIRFDDNACVIIKDDNTPKGTRIFGPVAR
FT                   ELRDKDFLKICSLAPEVL"
FT   CDS             complement(670844..671101)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07020"
FT                   /product="SSU ribosomal protein S17P"
FT                   /function="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88317"
FT                   /db_xref="GOA:D4JDP5"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDP5"
FT                   /protein_id="CBK88317.1"
FT                   /translation="MERNARKVYRGVVTSDAMDKTITVVVETKKTHPLYGKRVKYSKKF
FT                   KAHDENNEAHVGDRVVIMETRPLSATKRFRLVEIVEKARV"
FT   CDS             complement(671115..671318)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07030"
FT                   /product="LSU ribosomal protein L29P"
FT                   /function="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88318"
FT                   /db_xref="GOA:D4JDP6"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDP6"
FT                   /protein_id="CBK88318.1"
FT                   /translation="MLAKEIREKTNEELLQEIDTLKDELFNLRFQQATGQLENTARLKA
FT                   VKKTIARIKTVLTERENAAQQD"
FT   CDS             complement(671318..671734)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07040"
FT                   /product="LSU ribosomal protein L16P"
FT                   /function="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88319"
FT                   /db_xref="GOA:D4JDP7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDP7"
FT                   /protein_id="CBK88319.1"
FT                   /translation="MLMPKRTKYRRPHRLSYEGRSKAGRTIDFGEFGLVAESGNYVSNR
FT                   QIEAARIAMTRYMKRGGKVWIRIFPHMARTKKPLEVRMGSGKGAPEGWVAVVKPGRVMF
FT                   EVGGVSEEVAREALRLASHKLPVKTRFARKGEVE"
FT   CDS             complement(671721..672542)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07050"
FT                   /product="SSU ribosomal protein S3P"
FT                   /function="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88320"
FT                   /db_xref="GOA:D4JDP8"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDP8"
FT                   /protein_id="CBK88320.1"
FT                   /translation="MGQKVSPIGMRVGVIRDWQSRWYADDKEFGTLLMEDVKIREFIES
FT                   YYAKLSNEAQDKRKADPQISRIEIERTKGRMTVIIRTAHPGVVIGQDGKSIEGLKKKIE
FT                   KMASAKNVQINVVEVANPNLDARLVARWIANELEARKSFRATQKKAIQNTMRAGAKGIK
FT                   TAVSGRLGGADMARTEGYSEGVVPLHTLRSDIDYAWEEASTTYGRLGVKVWICRGEVLP
FT                   GEMVKEPEAPKQRPMRKGKGRRRPARNPRQAAPAQNAEAPVEKGGNTDVNA"
FT   CDS             complement(672553..672888)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07060"
FT                   /product="LSU ribosomal protein L22P"
FT                   /function="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88321"
FT                   /db_xref="GOA:D4JDP9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDP9"
FT                   /protein_id="CBK88321.1"
FT                   /translation="MEVKATAKTLRIQPRKARLVLNLIRGKDVEEAAAICKFTPNKGGY
FT                   LVGKVLKSAVSNAVNNNDLDESKLYVKACWADEGITMKRYMPRAKGSASPINKRTSHIT
FT                   VVVAEKE"
FT   CDS             complement(672903..673181)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07070"
FT                   /product="SSU ribosomal protein S19P"
FT                   /function="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88322"
FT                   /db_xref="GOA:D4JDQ0"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDQ0"
FT                   /protein_id="CBK88322.1"
FT                   /translation="MSRSLKKGPFCDDHLMKKVEALNANNKKEVIKTWSRRSTIFPNFV
FT                   EHTFAVYNGKEHVPVYVTEDMVGHKLGEFVPTRKYTGHASDDKKSKR"
FT   CDS             complement(673201..674034)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07080"
FT                   /product="LSU ribosomal protein L2P"
FT                   /function="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88323"
FT                   /db_xref="GOA:D4JDQ1"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDQ1"
FT                   /protein_id="CBK88323.1"
FT                   /translation="MPIKTYKPTTPGRRGMTSLTYEEITTSKPEKSLLAPLKSKGGRNN
FT                   TGRITTRHQGSGHKRTYRIIDFKRNKDGIPAKVATIEYDPNRSANIALLNYADGEKRYI
FT                   IAPKDLKVGMTVISGAEVDIKVGNAMELRNIPEGTFIHNVELKPGKGGQLARSAGCSAQ
FT                   ILGIEEKYVTLRLTSGEVRKVLGNCRATVGIVGNEDYSLVNIGKAGRNRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGRTPIGRKSPMTPWGKKALGVKTRRNKKASTKLIVRRRNGK"
FT   CDS             complement(674094..674387)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07090"
FT                   /product="LSU ribosomal protein L23P"
FT                   /function="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88324"
FT                   /db_xref="GOA:D4JDQ2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDQ2"
FT                   /protein_id="CBK88324.1"
FT                   /translation="MKDFRDVIIRPIITEKSMKLMADDNKITFEVAKGTNKIEVRQAVE
FT                   AIWNVKVEKVNMLNVKPRTKRVGRYTGKTHAVHKAIVKLAEGSTIDLFGEAE"
FT   CDS             complement(674387..675016)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07100"
FT                   /product="LSU ribosomal protein L4P"
FT                   /function="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88325"
FT                   /db_xref="GOA:D4JDQ3"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDQ3"
FT                   /protein_id="CBK88325.1"
FT                   /translation="MATIDVINQTGAVVGSMELNDAVFGIEPNQQSLFDALVMQQASRR
FT                   QGTADTKGRSEVSGGGRKPYRQKGTGRARQGSIRATQFRGGGTVFGATPRSYKYTINKK
FT                   VRRLAVKSALSEKLAAQALSVLDKFEISEPKTKTFVSIMEAIKAPKKTLFVVAENEEAT
FT                   NAYLSARNIPGVMMLTSTGINVFDLVNANAIVMTSAAVKEVEEALA"
FT   CDS             complement(675016..675711)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07110"
FT                   /product="LSU ribosomal protein L3P"
FT                   /function="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88326"
FT                   /db_xref="GOA:D4JDQ4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDQ4"
FT                   /protein_id="CBK88326.1"
FT                   /translation="MKGLLGRKLGMTQVFTEDGVLIPVTVVEATPNVVLQKKTAQSDGY
FT                   DAVQLGFEEIKEKRTTKANIGHCKKANTSPKRFIKEVRNCDMEVNVGDLIDVTIFAAGE
FT                   TVDVIGTSKGKGYNGTIVRNNAHQGPKSHGGSKNIRHIGSLATNGITSRQGRIMKGTIM
FT                   AGQEGGYTTTNPNLTVIKVDKENNYLLIKGNVPGPKKGLVMVRTAKTSKGDKEPVTLID
FT                   YSATKEVQE"
FT   CDS             complement(675727..676038)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07120"
FT                   /product="SSU ribosomal protein S10P"
FT                   /function="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88327"
FT                   /db_xref="GOA:D4JDQ5"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDQ5"
FT                   /protein_id="CBK88327.1"
FT                   /translation="MAKNTMRIRLKAYEHRILDDSAKKIVEAATKHGAKKVVGPVPLPT
FT                   EKQVVTILRAVHKYKDSREQFEMRTHKRLIEIVAPTKETIDSLQRLELPSGVDIEIKL"
FT   CDS             complement(676348..676992)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88328"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDQ6"
FT                   /protein_id="CBK88328.1"
FT                   /translation="MIDYTKYKWLDVQASLPESAQIKEKEAKRLLDTLDKKDFTSAKKD
FT                   ILARYYFDQCEKYAQEDRLDQIKLDSNLTRDFRSWPKSSSFKKMVEQVVQSDKGKFVMS
FT                   GIVIVMTGTLLVFFLVAILTGKFLFNIWVDGIVGALSIVFLYRNMKIKYRLVKRYTSSR
FT                   DYLYLDIASFVLCFLLKIWLPVSFDFSLIILFIAHFVSKKKFEKMLDEFTI"
FT   gap             678230..679486
FT                   /estimated_length=1257
FT   CDS             complement(679705..680163)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07170"
FT                   /product="AIG2-like family."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88329"
FT                   /db_xref="GOA:D4JDQ7"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDQ7"
FT                   /protein_id="CBK88329.1"
FT                   /translation="MMSNIKYLDLYYAAYGSNMNLEEMKKRCPDAKHEGTGTIEGYELL
FT                   FCGEAGRAYLNVRPNSAKKVNVCLFKISENDLKSLDEYEEYPKLYGRSKCDVFMDDGSI
FT                   KQAFFYEMDPSYEISTPSESYYRRVEQGFRDNDLDTRFLEEAYAKCKR"
FT   CDS             complement(680164..680646)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07180"
FT                   /product="Bacterial transcription activator, effector
FT                   binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88330"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDQ8"
FT                   /protein_id="CBK88330.1"
FT                   /translation="MFDPQQLDETIYLSGVMMETNSDTLFEDLKTISKKYAKIKPQIKH
FT                   LKKPVYTVVATSSKKLFMGDMTEKANKQMASLKIEKGQWIVKVPVKYHTQALLPAKVAE
FT                   LRKKFYQDWLPYQDFDQDDAWQDLEVYHYRKRRFRKATKMVMELWFCIKPIQKDKV"
FT   CDS             complement(680646..681290)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07190"
FT                   /product="pyroglutamyl-peptidase I . Cysteine peptidase.
FT                   MEROPS family C15"
FT                   /function="pyroglutamyl-peptidase I . Cysteine peptidase.
FT                   MEROPS family C15"
FT                   /EC_number="3.4.19.3"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88331"
FT                   /db_xref="GOA:D4JDQ9"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDQ9"
FT                   /protein_id="CBK88331.1"
FT                   /translation="MKILVTGFDPFGGEKINPAFEAVKLIPDCIEGAEIIKLEVPTVFK
FT                   KGPQATIDAIEKYHPDYVFCIGQAGGRSQITPEFVGINYAQARIPDNDGDQPFNQPLVE
FT                   GGPAAYFTQLPVYAMVEKMKENGIPASVSYTAGTYVCNAMLYCVLHALNTKYPNIKGGF
FT                   MHVPYATSQTVNQPAGTPGMNLNDIARGIELSIEAIIENPTDIMAQGGTTH"
FT   CDS             complement(681301..681846)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07200"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88332"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDR0"
FT                   /protein_id="CBK88332.1"
FT                   /translation="MGVGVLVAFIMLLAYSKDNTPSIIMHDCRRMMDIVGPLSMLPTLL
FT                   AALGSVFTAAGVGDVLSGLVANVIPEGNIVIGMIVYCVGMALFTMIMGNAFAAITVMTV
FT                   GIGAPFVLAYGADPVIVGSLALTCGYCGTLCTPMAANFNMVPVAVLEMKDNNGVIKNQI
FT                   LIAVIMLVIQTVMMIILS"
FT   CDS             complement(681900..682256)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07210"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88333"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDR1"
FT                   /protein_id="CBK88333.1"
FT                   /translation="MTNPIEYFMSVDITMSDKLLEVLYFVIGLVTLYVAFRNLQDKENK
FT                   KRYGSFIFWFLLGLMFVIGPWIPPLYTGILMVLMVLSPILKQVGVGSEPAPSNEETEKN
FT                   YKKIGMKFLYLHYQ"
FT   CDS             complement(682259..682936)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07220"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88334"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDR2"
FT                   /protein_id="CBK88334.1"
FT                   /translation="MELLKLLGILIVIIGFVLKMDSILIIMVAAVVTALVGGMDLVTFL
FT                   ETLGSSFVSNRSMCTFIIVLVVTGTLERNGLKQAAAALMKKFKGASAGMVVGIYGVFRL
FT                   IFAAFNISFGGAAGFIRPIVMPMAEAAVEKEGYEINEDHLEQLKGMSAGMDNVAWFFGQ
FT                   VLFVGTSGMLLVQSTLADLGYEVELIDLASVQIPVAIMAVGCAIVYYYIKDKRLMKQYK
FT                   KGA"
FT   CDS             complement(683124..683261)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07230"
FT                   /product="GTPases-translation elongation factors"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88335"
FT                   /db_xref="GOA:D4JDR3"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDR3"
FT                   /protein_id="CBK88335.1"
FT                   /translation="MVMPGDNIEMNVELIHPIAIENGTKFSIREGGRTVGAGNVIEIIA
FT                   "
FT   gap             683374..683820
FT                   /estimated_length=447
FT   CDS             complement(684109..686208)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07250"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /function="translation elongation factor 2 (EF-2/EF-G)"
FT                   /EC_number="3.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88336"
FT                   /db_xref="GOA:D4JDR4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDR4"
FT                   /protein_id="CBK88336.1"
FT                   /translation="MPREYSLQNTRNIGIMAHIDAGKTTTTERILYYSGVNHKIGETHD
FT                   GASTMDWMEQEQERGITITSAATTCHWKKLDGTGEECRINIIDTPGHVDFTVEVERSLR
FT                   VLDGAVTVLDAKAGVEPQTETVWRQATTYGVPRIVFVNKMDATGADFIMSCNTIIDRLG
FT                   AKSCPIQLPIGAESDFEAIIDIIERKTYHFSGDYGRNITTSEVPEDMVDQVEEYRTKLL
FT                   EYLADYDEDFMMQVLEGEEPSIDEIKRVLRIAVCAGDFFPVLCGSAYKNKGVQLVLDAV
FT                   VDYLPAPTDVPSIKGTTLDGEDAVRHSSDEEPFSALAFKIMTDPFVGKLSFFRVYSGTA
FT                   TAGSYVLNSSKGKKERFGRIVQMHANSRKEIDQVWAGDIAAAVGLKVTTTGDTLCDEKD
FT                   PIILESMEFPEPVIELSLEPKTKADQDKMGLALAKLAEEDPTFKTYTNEETGQTIIAGV
FT                   GELHLDIIVDRLRREFKVEANIGKPQVAYRETIRQAAECEGKYIRQSGGRGQYGHVWIK
FT                   FEPNEEGKGFEFVDAIVGGTVPREYIKPTMEGLEAALENGIIAGYPVIDIKATLFDGSY
FT                   HDVDSSEMAYKIAASMALREAAKKCKPVILEPIMFVEVTAPNEYLGSVMGDVSSRRGQI
FT                   TEQEERGNAVIVRAHIPLSEMFGYVTDLRSFTQGRGTYSMKFDHYAEVPKSIAEKIIKE
FT                   NSKEN"
FT   CDS             complement(686227..686697)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07260"
FT                   /product="SSU ribosomal protein S7P"
FT                   /function="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88337"
FT                   /db_xref="GOA:D4JDR5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDR5"
FT                   /protein_id="CBK88337.1"
FT                   /translation="MPRKGHIAKRDVLVDPMYNSKLVTRLINKIMIDGKKGVAQTILYN
FT                   AFEIVEVKTGKQPMEVFEQALENVMPQLELKVRRVGGANYQVPVEVSDERRLTLGLRWI
FT                   VNYARLRNEKTMEQRLAAEIIDASNGTGASVKKREDTHKMAEANKAFAHYRW"
FT   CDS             complement(686723..687136)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07270"
FT                   /product="SSU ribosomal protein S12P"
FT                   /function="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88338"
FT                   /db_xref="GOA:D4JDR6"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDR6"
FT                   /protein_id="CBK88338.1"
FT                   /translation="MPTINQLIRKGRKASQNVSKSPALNRGYNSLQSKPTNLSSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLSNGMEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGTLDCAGVNDRKQSRSLYGTKKPKK"
FT   CDS             complement(687332..688309)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07280"
FT                   /product="Protein of unknown function (DUF1700)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88339"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="InterPro:IPR025386"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDR7"
FT                   /protein_id="CBK88339.1"
FT                   /translation="MTKETYLERLEKLLEGMDPKEKEEALAYCREYFEDAQDKDVEQII
FT                   KELGTPEEFAEQLKSDESFKQKITPPEFKYQMKNVSNEMSKTSRKKSKLPFIIVGVIAA
FT                   FIIIGVLLKFVLGFYTFHVVDKVIISNKNTQVSSSEEMLAADYTFPQINNIELETNCSV
FT                   LIRQGNSNKIMFNELYDREVNVNSNENKVEVKVNSTRDETNKKVIIEVADENANFDIEC
FT                   DSGNVTVENMVGNNIEVSCENGNIEAKTINFNIVSLDSSNGNIDAELSGKFEDYRYELE
FT                   NENGTTNVGDISTSHSIETEGNHGANKKLSLESSNGNIDVRFAG"
FT   CDS             complement(688306..688623)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07290"
FT                   /product="transcriptional regulator, PadR family"
FT                   /function="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88340"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDR8"
FT                   /protein_id="CBK88340.1"
FT                   /translation="MAFQLGAGLLEACVLGVLADEDTYGYKLTQEVRNVMSVSESTLYP
FT                   VLRRLMKEGYLETYDQEYMGRNRRYYHLSAKGKLKHLDNIKEWTHFSQNVDSLLRKGEL
FT                   K"
FT   gap             688870..689013
FT                   /estimated_length=144
FT   CDS             689042..689701
FT                   /transl_table=11
FT                   /locus_tag="EC1_07310"
FT                   /product="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88341"
FT                   /db_xref="GOA:D4JDR9"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDR9"
FT                   /protein_id="CBK88341.1"
FT                   /translation="MKLILERVHFDYYVLINGSYILDKDFNEISAYPIKKENVEKLVKL
FT                   CADEKYGLMFHFGDATYIYNDFYPMYYFCKYCNVLDSLFYDPNQAFHKRHRVFNAVVLT
FT                   KDDQKLKHFMEDHPELRKDLINVKTDGFCYDIFNADNDKAKGIEAILEKEGLTWKDTIC
FT                   FGDSTNDIHMLEKADIGVAMGNASDYVKSFANFSTTTTYDNGIYNAVKKILEEEKD"
FT   CDS             689843..690691
FT                   /transl_table=11
FT                   /locus_tag="EC1_07320"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88342"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDS0"
FT                   /protein_id="CBK88342.1"
FT                   /translation="MSVLKSIIPVVIGNIIYALVVKLFILPTNLMSSGTTGIALLANHF
FT                   LGIPVSFFILIFNVCMLILGLIVLGKKFAMTTIVSTLMYPIALEFFNQTLGEFVITNNE
FT                   LLNTIFAGLGIGLALGIVLRSGASTGGMDIPPLVLNHFFRIPVSVSLYVFDFIILSSQS
FT                   LYNPLERLLYGIILILLTSIVLDKVLLMGTTKTEVKIISPKFEKIAEEILSEMDRGVTL
FT                   LNARGGYLKNEHSVVLSVVSNRELPKIEKLVRALDPDAFMIVSRVSEVWGRGFSTKKKY
FT                   Q"
FT   CDS             complement(690744..691172)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88343"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDS1"
FT                   /protein_id="CBK88343.1"
FT                   /translation="MYAQRAYALAKKAHLGQKDKGGNDYIEHPKAVASMMDTDIEKAVA
FT                   YLHDVVEDTKISFDDLKEYGFPNQIIEAVKALTKRKNESYDVYIDRVIKNPIAKKVKLA
FT                   DMKHNSDITRIKNPSQKDYDRCQKYLDKIQYLINKPLS"
FT   CDS             complement(691180..691734)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07340"
FT                   /product="Chromate transport protein ChrA"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88344"
FT                   /db_xref="GOA:D4JDS2"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDS2"
FT                   /protein_id="CBK88344.1"
FT                   /translation="MILIQLLLSFLQVGLLSIGGGYAALPIIQNQVVDLNHWLTVREFG
FT                   DIVTISQMTPGPIAINAATFVGTKIAGVPGAIVSTLGTVLPSFVIVLFLAWFYYKYRQL
FT                   RSVKAILKGLRPAVTALIAASGVSMIIACFWPEGAVSLSALNIESLILFIGAFIVLRKF
FT                   KTGPIKVMVACGLVALVISYL"
FT   CDS             complement(691731..692291)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07350"
FT                   /product="Chromate transport protein ChrA"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88345"
FT                   /db_xref="GOA:D4JDS3"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDS3"
FT                   /protein_id="CBK88345.1"
FT                   /translation="MKLDYKVLFQLFRSTFSLSAFTFGGGYVIVPLMQKKFVEEYEWID
FT                   KYEMMDLVAIAQSSPGAIAINASIIIGYRIQGVVGAIVSVFGTVLPPFLVISIITLCYD
FT                   WFIQVEAIQTILFGMQAGVCAVICDVVYKMAKDIVSQGEAIYIVLMLVAFLLSVVFNVH
FT                   LLLIILGCGIAGYIFEKKRGEVK"
FT   gap             692436..693373
FT                   /estimated_length=938
FT   CDS             complement(693396..693767)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07360"
FT                   /product="LSU ribosomal protein L12P"
FT                   /function="LSU ribosomal protein L12P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88346"
FT                   /db_xref="GOA:D4JDS4"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDS4"
FT                   /protein_id="CBK88346.1"
FT                   /translation="MAKLTHEDILAYLEEATILELNDLVSAIEEKFGVVAAAAVAAPAA
FT                   GAAEEAAGPTEVTVTLTDVGGTKVAVIKAVREITGLGLVDAKKLVDGAPAAIKENISPE
FT                   EAEEIKKKLMDAGASVEVK"
FT   CDS             complement(693788..694351)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07370"
FT                   /product="LSU ribosomal protein L10P"
FT                   /function="LSU ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88347"
FT                   /db_xref="GOA:D4JDS5"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDS5"
FT                   /protein_id="CBK88347.1"
FT                   /translation="MNKDILAKKEADVNALAEKMEAASSVVLVEYRGLTVAEVTELRRA
FT                   LREEDVELKVYKNAIARRASEKLGYNDFSEGLVGPNALAFGKDPVAPARVLAKFAKNHE
FT                   NLVLKTGIVDGSMVDTDTIKKLSSLPNKEGMLAKFASCLNAPVIKFAMTIKALAEAKEN
FT                   GTVKAEEVKPAEETAEPAVEAAAE"
FT   CDS             complement(694542..695228)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07380"
FT                   /product="LSU ribosomal protein L1P"
FT                   /function="LSU ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88348"
FT                   /db_xref="GOA:D4JDS6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDS6"
FT                   /protein_id="CBK88348.1"
FT                   /translation="MAKVSKRYAEAAKLVDSEKTYSIEEAVALAKKSSTVKFDASVEVS
FT                   FRLNVDPRHADQQIRGAMVLPNGTGKTQRVCVVAQGDKEKAAKEAGADFVGGADIIEKI
FT                   QKGWFDFDVLVATPDMMGQLGKLGRVLGPKGLMPNPKTGTVTMDVAKAVDEIKKGKVTY
FT                   RVDKEGNINVMIGKVSFEEDKLVENFRAIYNTIAKARPTTVKGAYMKNLVLSTTMGPGI
FT                   KVTIEK"
FT   CDS             complement(695240..695659)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07390"
FT                   /product="LSU ribosomal protein L11P"
FT                   /function="LSU ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88349"
FT                   /db_xref="GOA:D4JDS7"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDS7"
FT                   /protein_id="CBK88349.1"
FT                   /translation="MAKKKVAKVCKLQFMAGGAKPGPALASAGINMPQFCTAFNDATKD
FT                   RKGDIVPVIITAYEDKSFDFVLKTTPAANLLKKAANIQKASGDQKQIAGTITVDQLKEI
FT                   AEYKMPDLNANDIEAAMKIVAGTARNMGIKIEGFE"
FT   CDS             696011..696562
FT                   /transl_table=11
FT                   /locus_tag="EC1_07400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88350"
FT                   /db_xref="GOA:D4JDS8"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDS8"
FT                   /protein_id="CBK88350.1"
FT                   /translation="MKQYFVMLNENARSIKNVHVIVGVSLFFALNVIMNLFVSVYITPE
FT                   IKVGFASIATAASCYFYGPIPNLIVAPLLDFVNFIVKPSGTYFPIFMISTFATAAIFSF
FT                   FFYGQDKVSLKRVILARLSYDIIVSLFLNSLFTSMLWGTPFWAIVSPKIVKNLICLPIQ
FT                   VVVLYLTMKTCTQLKPRLKA"
FT   CDS             complement(696578..697720)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07410"
FT                   /product="folylpolyglutamate synthase/dihydrofolate
FT                   synthase"
FT                   /EC_number="6.3.2.17"
FT                   /EC_number="6.3.2.12"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88351"
FT                   /db_xref="GOA:D4JDS9"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDS9"
FT                   /protein_id="CBK88351.1"
FT                   /translation="MYKIKLKKWKQKRERITIWFFLVKWLDEYLPEHKSLKKIQVAGTN
FT                   GKGSTCKWLSMFLQSEDYKTGMFTSPHLVSHMERIQIDSKDISLEDWERIYDTWDTFFE
FT                   EKQLTMFEMDLWMALVYFIEQNVDVAIIEVGLGGRLDATTSLDYMATLITNVGLDHQEF
FT                   LGDTLEQIAYEKSGIFKPNAIALTTEKDPACQKVMELVADYLNAMLGFVSLSDISKTKD
FT                   GYKIVYNGVDYFAKIPEYQIDNMILALETLFVLGYSISSKHIQEVLDNFNWLGRFSVLR
FT                   EDPYVLVDGAHNVPGIKALVNELQSFDGTIYFSVLKEKDASDMIEELKKLTKDIVLVRF
FT                   DTDRLYPLEHLGLPIIEFDELETIIKTQKKIFFCVDLFIL"
FT   CDS             697767..698426
FT                   /transl_table=11
FT                   /locus_tag="EC1_07420"
FT                   /product="Uracil-DNA glycosylase"
FT                   /function="Uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88352"
FT                   /db_xref="GOA:D4JDT0"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDT0"
FT                   /protein_id="CBK88352.1"
FT                   /translation="MIMNNDWDALFNQEIQKEYLLNLRYFLAREYKTKQIFPAKENIFA
FT                   AFKTTSLKDTKVVILGQDPYHNVGQAQGYAFSVPSDFPLPPSLKNIYKELENEYHVPVH
FT                   RSGDLTDWARQGVLLMNTVLTVEAHKAFSHSKMGWQNFTNEALRWINKKDGPVVFMLWG
FT                   NSAINAKKFLDNPKHLVLTCAHPSPLSASRGFFGCNHFRLANEYLESYGETPIKWI"
FT   CDS             complement(698434..700860)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88353"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDT1"
FT                   /protein_id="CBK88353.1"
FT                   /translation="MKHHKFAYYAKNRKLFIRFSVVLFSSLMLILFSLFMQIRVFETKK
FT                   EHNEDLYGSWYASVYDVTKENENMLYDHQMLDTIGKMSVYGQVQYNDEYAGNIGIVDDS
FT                   FYELSNISLKTGKLPSSPEEIAIEAYILDGLGIDYTLDQKISLSIQSGDQIFKKEYRLC
FT                   GILDNYSATWINQGSLVNFFIQEDDSFSLQQTNLFILPLQDYFDVMDEIVLKDENHFVY
FT                   NDMVEFVYDPFSRQNLPYTILACFAIIYTLLLITYTFYNWTNQHTKEIQMLKSLGASSF
FT                   MLCKDFLKLLSKALILPIMIFGICCILFTIYPITIVVSLSIYLAALILVIIFCFLQIRK
FT                   VPLNINSFSDQEMVVKQAIRVKYKKQTPFRMMLRSLRFHWKQELIQMMISIVLLVFLYQ
FT                   GLASQIHNQYIADIWDETSDIDLESSRSLVYMTQESEDVYQVRHERYNSIDQEIVQKLT
FT                   ANQNLTKYETYYYDNTSYITWNGMKDSDIWDSGLDQFIIDLDWNLNKQIFPDMVYVPVD
FT                   SLEDFLEENLSEGTFDKEAYLKGETVYIYLPEYTFYIDELGSQLSANPEFFYDTDKIYQ
FT                   EDTIHVGDTITIHSYDKEDKEVKIGGIIREYKSSNSFQYNLHTPYRIYASDIVFGLDDP
FT                   VSHIELYYDKEADTLPIETDISKIASENNMMFSNNVFIKQENYQIAHDELILNCMLSFI
FT                   VLCVMVFTQYHFKKQQIKEKLEKQRVFFQLGVDSNVFMKMQVVEMILKLILIFVSALML
FT                   FGLIQYIGYLQDANPMLTYASRFSKQQWSWMGYGLINLVFGFLFVINDLFCKNID"
FT   CDS             complement(700847..701527)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07440"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88354"
FT                   /db_xref="GOA:D4JDT2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDT2"
FT                   /protein_id="CBK88354.1"
FT                   /translation="MKPIVTLTEVNKTYHGLSTPTKALQNCSLKIMPSTFSCIIGKSGC
FT                   GKSTLLNAIGGLISVDSGSILVKDHELTKLDQRELSRFRREHIGFIFQFFNLLQEQTVM
FT                   ENLMLPFDLNGERVDQVFVNEVIQYLDLNKLVDKFPFELSGGEQQRVSIARAVIRKPDI
FT                   ILADEPTGNLDRENTKQVMNLLKECQAMYSQTIIMVTHDIDLAKRADALIYMEDGQVKR
FT                   YETS"
FT   CDS             complement(701668..702315)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07450"
FT                   /product="Predicted transcriptional regulator, contains
FT                   C-terminal CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88355"
FT                   /db_xref="GOA:D4JDT3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDT3"
FT                   /protein_id="CBK88355.1"
FT                   /translation="MFKVKDFMTKDVICTEKDTTISEIIDLMNQNKIHRVPVTENGKLV
FT                   GLITEGMISNSGTSQATSLSIYELNYLLSKTTVETVMIKNVVSVDQDELMEYATSKMLK
FT                   SDIGCLPVVDQTGDVVGILTQTDVFSCFLNVLGWDEVGARITVSVKDEVGAIGKLSAIF
FT                   VEKGINISHIGVYSFENGVANLVIRCDTLDPKEICEALEEHGYKVLEYFVHK"
FT   CDS             complement(702320..703030)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07460"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88356"
FT                   /db_xref="GOA:D4JDT4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDT4"
FT                   /protein_id="CBK88356.1"
FT                   /translation="MAMLSVKDLHVHYGVIEALKGVSIDVNEGEIVSLIGANGAGKTTM
FT                   LQAISGIVKKSSGDVEFLGQSIYKTNPKNIVAAGLTQVPEGRRIFTGLSVYENLMMGAF
FT                   LRKDKKGIEEDLQKVYKQFPILEQRINQDASTLSGGEQQMLAMGRALMAKPKLMLLDEP
FT                   SMGLAPILVKEIFSIIKEINAQGTTVLLVEQNAKMALSIAHRAYVLETGKIVLSGTGEE
FT                   LINSPEIQKAYLGG"
FT   CDS             complement(703033..703812)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07470"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88357"
FT                   /db_xref="GOA:D4JDT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDT5"
FT                   /protein_id="CBK88357.1"
FT                   /translation="MEPILEVKNLTKNFGGLCAVSNVSMTINQGELIGLIGPNGAGKTT
FT                   LFNLLTGVYEPSSGLIELNEDGQKIQLGGLKPYKITSYGISRTFQNIRLFKAMTVLENV
FT                   KVAMHKNVRYGTIAAILRLPSYYSEEKWVEEKACELLKEVGLYSKRNEMATNLPYGEQR
FT                   RLEIARALAIQPKILFLDEPAAGMNPQETADLTKLIHHIREKYKLTVILIEHDMSLVMN
FT                   ICERIYVLDYGKMIANGSPEEIKNNEFVIKAYLGEEI"
FT   CDS             complement(703812..704765)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07480"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter membrane
FT                   protein 2, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88358"
FT                   /db_xref="GOA:D4JDT6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDT6"
FT                   /protein_id="CBK88358.1"
FT                   /translation="MRKEYLSKENIAWLLLAVGAFVLCSLLMNLGIINSYYQITLYNIC
FT                   INIILAVSLNLVIGICGQFSLGHAGFMCIGAYAAGIITKMMPNFGGFMIGILVGFAISA
FT                   LVALIVSIPTLRLRGDYLAIATLGFAEIIRILVQNMKITNGAAGLNGIPQLTSWPLLMI
FT                   GVVISIMIVCNFTHSAPGRACISIREDEIASEAMGINTTKYKVIAFVIGALLASLAGAL
FT                   YACNFYVIKPNQFTFNKSIDILVMVVFGGMGSMTSSVIAAIVIGIINMVLANFSEIRMI
FT                   IYGLALVAIMIFKPTGLLGQRELSFKKLFASRKGDK"
FT   CDS             complement(704769..705650)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07490"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter membrane
FT                   protein 1, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88359"
FT                   /db_xref="GOA:D4JDT7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDT7"
FT                   /protein_id="CBK88359.1"
FT                   /translation="MIQFLQQMINGLSLGSIYALIALGYTMVYGIIKLINFAHGDIYML
FT                   GAFTAFYATTFFHLNFFVALIIAMLLCGVLGVVIERIAYKPLRHATRITALITAMGVSY
FT                   VLEYTMQYFAGSDVKTFPTDLLENTAFSLGGVRITMMQIYIFVITIILMVLLTYIVNKT
FT                   KMGRAMRAVSVDEDAAKLMGINVDTTISFTFFLGSCLAGVAGVLVGVYYNSINPLMGMT
FT                   PGLKAFIAAVFGGIGNIPGAMIGGLFIGIAETLVTAYGSSLYKDAIVYVILILVLILKP
FT                   DGLLGKNVKEKV"
FT   CDS             complement(705720..706904)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07500"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family (TC 3.A.1.4.-)"
FT                   /function="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family (TC 3.A.1.4.-)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88360"
FT                   /db_xref="GOA:D4JDT8"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDT8"
FT                   /protein_id="CBK88360.1"
FT                   /translation="MKGNFWKVLASGTIAASMLVGCSSGGAANEAVTLSEGDTVKIGLN
FT                   YELSGNVATYGQAMNKATELAIKQYNESEDAKYKAEAVSMDNKSDSGEAYSIATKLMTE
FT                   DQVVMQLGPATSGDSIATYPAADENQTPVLSPAVTQNGGMLKEDGSAYEYAWRVCFEDS
FT                   AQASAMAVFARENLGKTKAVVYSDATSDYAKGLAEDFVSKFEALGGEVVAQESYSSGDT
FT                   DFNAALSKISEEDFDVLYVPGYYSESGLIIKQARDAGISQTILGPDGMDSPKLAELAGV
FT                   ENLNDVYFTTAYTTVDASEELTSFIEAYKAEYNEEPDMFSVLAYDATNLGLQALEKAGK
FT                   TGEAFNEAIKNIEFTGLTGSFTFDEEHTPLKKVLVVELQNGEQVNPVEVDPNAE"
FT   CDS             707072..708280
FT                   /transl_table=11
FT                   /locus_tag="EC1_07510"
FT                   /product="L-serine ammonia-lyase"
FT                   /function="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88361"
FT                   /db_xref="GOA:D4JDT9"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDT9"
FT                   /protein_id="CBK88361.1"
FT                   /translation="MQSIKNIYKIGPGPSSSHTFGPMKASSYMLENYPEADRFDVILYG
FT                   SLALTGKGHLTDMIIKKTLNPKETNIEFNLKDTCKHPNTMTIEAFKENQSLGKHQFVSV
FT                   GGGKIEIDGQKNDEVDDVYPHSTMDDIQNYCKQRHLRLDQYIDIFEGPEFDAYMKNIFK
FT                   AMLKCVKTGLNKTGVLPGSLKLDRVAHALFQSANSCEDITDKNNLLVCSYAYAASEQNA
FT                   SGGMVVTAPTMGSCGVLPSLVYHFYHDLHYPKVTLIQGLKVAGLIGNLIQTNATISGAK
FT                   AGCQAEVGAACAMGSAMVAYCQMQANEQIECAAEIGLEHHLGLTCDPVGGYVMIPCIER
FT                   NAVAATRCIDAARLAKYIRNVKKNRVSFDMVVKTMNLTGKKLPIELKESALGGLAVVVP
FT                   DKV"
FT   gap             708296..710597
FT                   /estimated_length=2302
FT   CDS             complement(710850..711323)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07530"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /function="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88362"
FT                   /db_xref="GOA:D4JDU0"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDU0"
FT                   /protein_id="CBK88362.1"
FT                   /translation="MRIGQAVDIHQLCNGRDLILGGVKIKHEKGLLGHSDADVLTHAIM
FT                   ESVLGALALGDLGKHFPDTDPKYKGVSSMILLEHVYHLMDEKGYKIGNIDSTILAEKPK
FT                   MAPYIQKMRENIASILHCNVDKISIKATRGEKLGFVGNEEGILSMAVCLLEEK"
FT   CDS             complement(711328..711840)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07540"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88363"
FT                   /db_xref="GOA:D4JDU1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDU1"
FT                   /protein_id="CBK88363.1"
FT                   /translation="MNQAYENIIERRSCKSYKEQRVPKDVLEKIVAAGQMAPSGMNRQA
FT                   YAFVVVQDKKMMNTISKLNASIMQADTDPFYHADCVIIVFGKKDVRTHVYDGSLAMENL
FT                   MLAANSLGVSSCWIHRAKEVFETEEGKELLKKWGLEEYEGIGNCILGYSDGEIAPRKPR
FT                   TSKVVWE"
FT   CDS             complement(711882..712874)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07550"
FT                   /product="NlpC/P60 family."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88364"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDU2"
FT                   /protein_id="CBK88364.1"
FT                   /translation="MNYVENNGKKVAAVLCVASCFPVVATVYAMETEPGWHGDKYIKED
FT                   ATVAKGWEEIEGKSYYFSEDDGTIEKETTQKAVVASVSSNISGDVQETVANVAKEAVVK
FT                   EVQKQEEEKNTQEVVETPVDNTTETQTPAEEVPAEPTTPVEEVPAEEPTTPVEPETPAE
FT                   PSTPVEEPSTPETPAEPTTPVEPETPSTPETPTTPVEPTVPETPTEPTTPTNPYADLNA
FT                   RIAAAAQTLVGVTDGQWCTQVVQQALALAGVSDAYQLWPDEYAGMYGYYTNDPQPGNLI
FT                   YYNNGGRGVDHIAIYIGNGLAVHGNYNGRTVIESVYIPGGAPQFIQVCR"
FT   CDS             complement(712989..713735)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07560"
FT                   /product="triosephosphate isomerase"
FT                   /function="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88365"
FT                   /db_xref="GOA:D4JDU3"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDU3"
FT                   /protein_id="CBK88365.1"
FT                   /translation="MRKPIIVGNWKMNKNNAETKAFFEAVDAVAASENATYGIGCPFTD
FT                   LRTAQDNAKNLIVAAENCHWEDSGAFTGEVSVPMLEEIGIKYCIIGHSERRQMFGDTDE
FT                   TVNKKAKRLLKAGITPILCIGETEAQYDAGETEKVIRDQLTGSLADLCAKCVGSMVIAY
FT                   EPIWAIGTGKSATKEDAQKCCAIVRDQVKVMYGEEAAENVRVQYGGSVKPENIVEYMAC
FT                   PDIDGALIGGASLKEASFIDIIEKTK"
FT   CDS             complement(713750..714934)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07570"
FT                   /product="phosphoglycerate kinase"
FT                   /function="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88366"
FT                   /db_xref="GOA:D4JDU4"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDU4"
FT                   /protein_id="CBK88366.1"
FT                   /translation="MAKRTVKDLDVAGKKVIVRCDFNVPRKDGVITDDNRIVMALPTIK
FT                   YLVENKAKVVLMSHLGKVKTEEDKAKNNLECVAVRLQELLPETKVSFCPVTRGPELEEA
FT                   VNALNEGEIVLMQNTRYEKGESKNDPELGAYWASLGEVFVEDAFGSVHRAHASTVGIPT
FT                   NIKENGLGFLVEKEVTMLGKAVDEPAHPFVAIIGGSKVSSKIDVIDNLLKKADKVIIGG
FT                   GMAYTFMKAKGGSIGTSLVEDDKLDLAKEYLEKAGDKLVLPVDNVCADAFSEEANTQVC
FT                   KSGEIPEGWMGLDIGPASVELFKETLAGAKTVVWNGPMGVFEMKKFAKGTELVCQAISE
FT                   LPDAITVIGGGDSAAAAKQLGYADKFSHVSTGGGASLEYMEGKTLPGIAIISEK"
FT   CDS             complement(715072..715416)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07580"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88367"
FT                   /db_xref="GOA:D4JDU5"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDU5"
FT                   /protein_id="CBK88367.1"
FT                   /translation="MQIHKIYELKSERQLVRVPEYKMMYCYLEDGFMYLELDHEKRIRL
FT                   SYRTLIELKNILSARFWRINRNCIVNKDKIIAIDHARHEIKLINGHSFHVSRREWVQFK
FT                   KSNHTTLGEH"
FT   CDS             complement(715425..715757)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88368"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDU6"
FT                   /protein_id="CBK88368.1"
FT                   /translation="MKLAIVCDHFVFLKKLLRVIEKEYSIADIDVYEDLNGYQNCGRYH
FT                   DALLADIDTIGLKGLKCINSHPQPFTYIIYLAMNRNYMEDAYGVNVLGYVLKNQIEDKI
FT                   YIKLQK"
FT   CDS             complement(716352..717578)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07610"
FT                   /product="serine hydroxymethyltransferase"
FT                   /function="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88369"
FT                   /db_xref="GOA:D4JDU7"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDU7"
FT                   /protein_id="CBK88369.1"
FT                   /translation="MRDTAMFSIIDKEAKRQKQNVELIASENFVSKEVREAQGSVLTNK
FT                   YAEGYPGKRYYGGCVYVDQAEDLTRQRAKELFKAEHANVQPHSGSQANMAVYNTLLQPG
FT                   DVVLGMDLAAGGHLTHGHPLNFSGTLYKFVAYNVDPETELIDYDALEELAIKTQPKLIV
FT                   AGASAYPRIIDFKRFSEIAKKVNAYLMVDMAHIAGLVATGLHPSPIPYADFVTTTTHKT
FT                   LRGPRGGMVFCKEEFAKKLDSKVFPGMQGGPLEHVIAAKGVCLYEASQPEFKSYMEQTL
FT                   KNVQVMCKGFKEAGFRLVSGGSDNHLLLVDVLGSIGMTGKEAERLLDIAGITCNKNTIP
FT                   YDTQKPFVTSGIRLGAAAMTTRGFKEKEFEKVTDLMIQVLKSKDEEFAKKIREEVLKLT
FT                   QDHPAEATF"
FT   CDS             complement(717597..718691)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07620"
FT                   /product="DnaJ-class molecular chaperone with C-terminal Zn
FT                   finger domain"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88370"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDU8"
FT                   /protein_id="CBK88370.1"
FT                   /translation="MTIWTILGIEPTQNKKEIKKAYAKMAKVYHPETHPEQFEQLQEAY
FT                   QKALEYAKGNPVHQEEPVKVEPETKPETHLEFDVDPIESNVPPIPRSKELFQETKETNK
FT                   TDNNQYVVENIVSSLPKKIDATTLKDLFENSLVQTYKSDPIFCGKLEKALIKKTFVGTY
FT                   EEFQVMLKLLDEHGFIQAKKKVQKFQNAYLVSSKQSKVYRAIFIIVVIAVSGALTLFMQ
FT                   NIEGDSEPDDTKQVESLDIDTDKTMNQLNEPFLNGFTIKDGSLIDENDHVVIENIDDVI
FT                   YTMSNYIVIHNDQGYLSYDTKTKTSVNLEYNDVVLVQRKEETTTYYLGLNQDGTWYLSD
FT                   LQGNVLEQLAEDPSLSNDLEVIEY"
FT   CDS             complement(720136..720426)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07640"
FT                   /product="Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88371"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDU9"
FT                   /protein_id="CBK88371.1"
FT                   /translation="MAVIGIDLGTTNSLCVTYRNNKVELIPNAFNEYLTPSAVWIKDDE
FT                   VIVGKIARQRLVSDPAHTASLFKRAMGTNKLYELDNKKFTPSQLSSFVVNN"
FT   CDS             complement(720407..720958)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07650"
FT                   /product="Membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88372"
FT                   /db_xref="GOA:D4JDV0"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDV0"
FT                   /protein_id="CBK88372.1"
FT                   /translation="MNILNWITNLDLAINYWIQENLRNDFLTRFFTFITSLSNYGWFWI
FT                   LLIIVLLINKKTRKVGIIAFVSFCACALVVNVFMKPLFMRTRPYDLVDFLIYIGHKPWD
FT                   YSFPSGHTSAAFSVALICFWQLDKKYSWIFVLIAALIGFSRLYLGVHYPSDVLGGFLIA
FT                   LIISYIVNKKGSEYYGRNRN"
FT   CDS             721045..721644
FT                   /transl_table=11
FT                   /locus_tag="EC1_07660"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88373"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDV1"
FT                   /protein_id="CBK88373.1"
FT                   /translation="MPKIQFDIENTIEIKKSKFITYLHRTSDEEEAKEYIRQIKKMHPN
FT                   ATHHCTAMIIGSIMRSNDDGEPSQTAGHPMLNVLMQKEMQDILVVAVRYFGGIKLGTGG
FT                   LVRAYSSSVSEALDKSVLVEETMFDEYEIEFNYSLIGKLDHYFATHGIHISLKDYAENV
FT                   IYHYLSTEDISKDLKEISGGVIEPKWINKQSMEKVI"
FT   CDS             721684..721956
FT                   /transl_table=11
FT                   /locus_tag="EC1_07670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88374"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDV2"
FT                   /protein_id="CBK88374.1"
FT                   /translation="MNLFFYFIVILIIFILIGYILPFLAPILLFFLVLGVLRSFFQGRK
FT                   HYDDYEDNTYYEDIHNQSDYTYTNPPKHDAIDVEYTEHEDNGDAQ"
FT   CDS             721953..722864
FT                   /transl_table=11
FT                   /locus_tag="EC1_07680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88375"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDV3"
FT                   /protein_id="CBK88375.1"
FT                   /translation="MICQNAIGYHNEIQELLKKSMLNMNDAQIRAWMEHEFKPETMFCY
FT                   WQDGRLTSCLQTKRRILSFKHQKIAVATISLAATLPDYRQRDQFGQLLEAFLEQSSHNE
FT                   LLTMVYTNFPKLFENRSFSCISKTKYYWIPADKCNQGNDKNIRFYHPNIDLYPLYLEFM
FT                   SHFDGSIILSKKDFEDQIHYAIDCKKKVALMMHGEKPHGFAIYKVLNNHVKIDVLVYLD
FT                   SNAILDLLRYLAIRNDAISFVVSMDERIEKLFPFDIPRNQGTILARLNNYKLFSKWTKE
FT                   DVRNANQAFELIQEPMWNHFIE"
FT   CDS             722987..723709
FT                   /transl_table=11
FT                   /locus_tag="EC1_07690"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88376"
FT                   /db_xref="GOA:D4JDV4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDV4"
FT                   /protein_id="CBK88376.1"
FT                   /translation="MIEINHVSKTFGTKKAVDDITVTIPTGCITGFIGPNGAGKTTSIH
FT                   MMTGVLQPDTGSIKLNGKDITKDPIEAKREFGLVPDSPDLFLRLSGLEYINFMADLYHI
FT                   DTATRNARIKALAEQFEIQDALNDRMSSYSHGMRQKAILIATLVTDPNIWILDEPMTGL
FT                   DPASSYLLKEKMKEHARQGNTVIFSTHVLEVAEKLCDKIIIIDHGKIRYDGTLEALKAQ
FT                   YPEKESLEDVFLEVTRHA"
FT   CDS             723702..724832
FT                   /transl_table=11
FT                   /locus_tag="EC1_07700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88377"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDV5"
FT                   /protein_id="CBK88377.1"
FT                   /translation="MHDFITLSKLLFKSNYKLDLHSKKGKQSLIVGFVVFLCLLPSLGM
FT                   FYMLFHSAFSTLNLDLLILQLGFSVIGFLVLWIALFMFPSVFYFSNDLTHLLVLPVSPT
FT                   MIIFSKFIIVYISLFLTSLLVTAPMLAAYIIAGAKISQIFMFILQLPLISLAPAFMVGI
FT                   FWIIVLRFIPFFQNKDRFNLITGVISIVIAVGIGAASGFMSGTSVEDPAALISMLQNNP
FT                   ETLSLLTQIFFNVPFASKAIVNLSIIDLFIHIIIVIITGGLFYLCSKYLYLISATSAKG
FT                   SPSKKKAKLKVNHQANPFFSYFKTDFYKLVRTPAYFSNCVLSGLVAPIIMVVVFMALPD
FT                   IEEAKAALAQIDITKLINLPLYLYLGGMIVGFFSAL"
FT   CDS             724883..725332
FT                   /transl_table=11
FT                   /locus_tag="EC1_07710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88378"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDV6"
FT                   /protein_id="CBK88378.1"
FT                   /translation="MLYIPLDFSIQLAAKVSLGIFFSLLSCILLLIPVHMLLPYPIYYD
FT                   AAFVIGALLASLVVNFLALLIDGIHPKINWEDETSAIKQNLNVVFEFLASWAIVVILCV
FT                   PFFLFNIFDYLIYYTIFVSIVFVILIAIMYIFGPKIILRSLKKGS"
FT   CDS             complement(725368..726075)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07720"
FT                   /product="Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)-cyclophilin family"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88379"
FT                   /db_xref="GOA:D4JDV7"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDV7"
FT                   /protein_id="CBK88379.1"
FT                   /translation="MKLYTKIASALVLSLALVGCSSTQSEPQTENTTDETTQIPELDSL
FT                   IQFQDSYPDDMQVAIMNTDQGEIDFVLFADQAPKAVENFVTHAKEGYYNGVTFHRVIDD
FT                   FMIQTGDPTGTGSGGESIWGEPFEDEFSYELYNFRGAVSMANSGEDTNGSQFFIVQADT
FT                   MDQELNGWPTLAEEKYHEVGGTPWLDQVHTVFGQVISGMDVVDAIADLEDTDITAVINT
FT                   IEITTYKEYKETH"
FT   gap             726490..727296
FT                   /estimated_length=807
FT   CDS             complement(727297..727491)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88380"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDV8"
FT                   /protein_id="CBK88380.1"
FT                   /translation="MNNTIVFALSSSVGLAKEICKELNLPLGKCEVKHFADGEILVELG
FT                   ESVRGKHVYFVQSTNKPVK"
FT   CDS             complement(727507..728859)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07750"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase
FT                   /glucosamine-1-phosphate N-acetyltransferase"
FT                   /function="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /function="glucosamine-1-phosphate N-acetyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88381"
FT                   /db_xref="GOA:D4JDV9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDV9"
FT                   /protein_id="CBK88381.1"
FT                   /translation="MRNAIILAAGKGTRMKSDASKVMHTIIDRPMLGYIIDALKAVHVD
FT                   RIVVVVGYQAQTIKDAYPDVEFAMQETQLGTGHAVMQCQCLKDAKGDTLIINGDGPCIQ
FT                   PETLERLFKENEDAAGTLLTAVLEDGAHYGRIVRNENNDVISIVEAKDCTEEQKNIREI
FT                   NAGMYCFKNDVLFENINELKTNNAQHEYYLTDIVSILSSKGMKIKGLPIEDRDEVMGIN
FT                   DCLELNKAYIWMRNKINRCWMANGVQIVDPERTVIGKDVKIGHDVIIHPNVEILGKTVI
FT                   GNHVEILGGSYLNNAVIKDHVTIDSSKIQDSSVDEYTTIGPMSHLRNNTHVGKHCRIGN
FT                   FVEFKNTNFGDGSKCAHLTYVGDSDVGKNVNFGCGVVTVNYDGKNKFRTTIKDGAFIGS
FT                   NVNLIAPVTIGENALLAAGSTITDDVEDGDMGIARNRQSNKEGYGTQYKNK"
FT   gap             729479..730756
FT                   /estimated_length=1278
FT   gap             731359..731721
FT                   /estimated_length=363
FT   CDS             complement(731768..732145)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88382"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDW0"
FT                   /protein_id="CBK88382.1"
FT                   /translation="MSQKHSKSQDEISQLLDSFEVEDTLEEKMENFTQEKERQSRIERA
FT                   RKNSQDFNRRNTEEMDLTQIIDPIDDSEFEDEEYEEDGSQTKTMMWDKDQIDPETTDTN
FT                   KTVVINDERSSLCWRKIKVLD"
FT   CDS             complement(732169..732759)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07790"
FT                   /product="Predicted amidophosphoribosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88383"
FT                   /db_xref="GOA:D4JDW1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDW1"
FT                   /protein_id="CBK88383.1"
FT                   /translation="MFLNDDVLCSSCRSKWLEHKKIYNINGINYHVLYEYDENLESFFF
FT                   RYKEQRDIVLAPSFLHLYKDQFQKTMKKYMVCGVCSSDEKYFQRGFLPLEEIFNSINIK
FT                   IYFPLYKALDFKQSKHSKKERAQIEKIIQRKNIYPIALKNILLVDDVLTTGATLHRSCE
FT                   LLKPSAVFVIAAHSLWIKENKPYEQVEKKHTFW"
FT   CDS             complement(732792..733949)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07800"
FT                   /product="Superfamily II DNA/RNA helicase required for DNA
FT                   uptake (late competence protein)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88384"
FT                   /db_xref="GOA:D4JDW2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDW2"
FT                   /protein_id="CBK88384.1"
FT                   /translation="MKCYQCGNEDERYFAYDKGVYYCRKCVAFGRMDAYVRKESCHLST
FT                   RVIEVSPQLKYELTDKQKAISHKIVEYLKQKKDVFVYAATGAGKTESVFECICFYLSQG
FT                   KKVGFAISRRQVVLEIAQRLRQAFPTLHVVEVTQGYTTITDGDIIVCTMHQLYRYPDGF
FT                   DLLIMDEVDAFPYVGNDVLQTITRRACKGQRVLLSATPDEESLQKIKQKEMEMVTLFER
FT                   PHKHPLVVPKVYECNLFFQVLMIIGCCYSWIRQSKQVLVFVPRRQDCIWLNTILKLFFR
FT                   SSMIHSQTKEKDEILDQFRQKGLDVLVCTTLLERGITVPSVQVIVCQADHAVFTSASLI
FT                   QIFGRVGRSFDDPTGKGVCLCFQKNQAIKECVDQLCQMNASASTV"
FT   CDS             complement(734033..734245)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07810"
FT                   /product="LSU ribosomal protein L31P"
FT                   /function="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88385"
FT                   /db_xref="GOA:D4JDW3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDW3"
FT                   /protein_id="CBK88385.1"
FT                   /translation="MKKGIHPNYHTVKCICSSCGAEFETGSTIKGDEMRVDTCSNCHPF
FT                   FTGRQRFAAAQGRIEKFNKKYGLNK"
FT   CDS             734393..735223
FT                   /transl_table=11
FT                   /locus_tag="EC1_07820"
FT                   /product="histidinol phosphate phosphatase HisJ family"
FT                   /EC_number="3.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88386"
FT                   /db_xref="GOA:D4JDW4"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDW4"
FT                   /protein_id="CBK88386.1"
FT                   /translation="MFADYHVHTDFSDDSIYPMEKVIQDAISMHMDEICFTEHVDYGIK
FT                   FDQEPGKKIIYRQNEPLTNCDYPNYMKTIEEMKQRYGAQITIKTGMEFGMQMHTIPQYE
FT                   ALFQKYSFDFIILSIHEIGDLEFWNQGYQKDKTQQEYNEGYYEAMHKLVSNYKNYSVLG
FT                   HMDLINRYDLAGIYPFEKIKPFIEKILKVVIQDKKGIEINTSSKRYGLKDTTPSLEILK
FT                   LYHQLGGEIITIGSDSHKPEHLGSQIEESKILLKELGFQAFCTFDQMKPIFHDL"
FT   CDS             complement(735240..735923)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07830"
FT                   /product="Uncharacterized homolog of
FT                   gamma-carboxymuconolactone decarboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88387"
FT                   /db_xref="GOA:D4JDW5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDW5"
FT                   /protein_id="CBK88387.1"
FT                   /translation="MSTVKTDAQFMERFENFAFKEVVEEESVALETNTRYLAILASLVG
FT                   SQGLDAYKFILNKALDEGMDPIMVKEMVYQSIDYVGMSRMWSFLAATNEIYQERNISLD
FT                   AGEATTTMSDRLEKGAQAQVEIFGEHMKEAWKTSVVNRWLAANCFGDYYTRTGLDLAQR
FT                   EMITFCFLMSQGGCEPQLIAHSKGNMNMGNDAEFLKKVVHQCLPYIGYPRSLNALNAID
FT                   KAQEA"
FT   CDS             complement(735938..736972)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07840"
FT                   /product="Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88388"
FT                   /db_xref="GOA:D4JDW6"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDW6"
FT                   /protein_id="CBK88388.1"
FT                   /translation="MKKRRLGNSDLMVSEICMGCMGFGDPTRGQHTWTLDEKSSREIII
FT                   QGLEAGINFFDTAIAYQSGTSEKYLGKTIREVSNRDDVVIATKFLPRNDEEIEKGIDGI
FT                   QHVENMLNKSLENLGMDHVDLYIYHMWDHRTPLIEILEGLNKLVKQGKTRYIGISNCFA
FT                   WQLAQANDLARERNLTPFVSVQNHYNLIFREEEREMKAFCEQENIAMTPYSSLAGGRLS
FT                   KHLNETSKRLKEDDYARLKYDSTKEVDQKIIERVEELASAHHTSMSAISLAWLLTKTTS
FT                   PIVGMTKPSHVKGAVDASNLVLNKDEIHYLEELYVPHKLVGVMAQNTKESSNEAHVWSV
FT                   QEKQ"
FT   CDS             complement(736976..737338)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88389"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDW7"
FT                   /protein_id="CBK88389.1"
FT                   /translation="MPQINIQIHDHDLLVEMIDNSSSKALIKRLKQSDIVLEMKEFANM
FT                   EKFGVLDKKYPQNDEWVTTLCRDVILSEGYLLVIYYAPNTWNFTKIGKVINVSDGEFKR
FT                   ILGKGNVHARIHLVKE"
FT   gap             737724..739014
FT                   /estimated_length=1291
FT   CDS             complement(739100..739930)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07870"
FT                   /product="Metal-dependent hydrolases of the beta-lactamase
FT                   superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88390"
FT                   /db_xref="GOA:D4JDW8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDW8"
FT                   /protein_id="CBK88390.1"
FT                   /translation="MRITVLVENTGPSEFKIEHGLSLYIEFNDKKYLLDAGPSDSFFKN
FT                   AHALSIDLGRVDKAVLSHGHYDHGDGFMVFLNQYKDKVVYGAKNIFDDYYSGSGGSVHY
FT                   IGLSSKLKQMKNRFNTISKDTKIDEKIYLILDDVSNTKEIGVQKKLYKKVDDVLQPDNF
FT                   DHELSLVFDTPKGLVICNSCSHAGLESIVDNIKKRLNKPVYAYVGGLHMKSTKNHIETS
FT                   SFTEEQIQNLCIFIKKNIQYVLTGHCTGNVSYDLLKKYLKDRIDFLTTGKTIEI"
FT   CDS             complement(739932..740252)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07880"
FT                   /product="Predicted EndoIII-related endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88391"
FT                   /db_xref="GOA:D4JDW9"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDW9"
FT                   /protein_id="CBK88391.1"
FT                   /translation="MSLAGVGRKTANVVRSVAFDIPSFAVDTHVDRISKRLGLAKPYDS
FT                   VEKVEEKLKRKIDRDRWNRGHHEFIFFGRYLCHSRNPECYRCPFIDICKKDKVDAYLKK
FT                   KA"
FT   CDS             complement(740252..740575)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07890"
FT                   /product="Predicted EndoIII-related endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88392"
FT                   /db_xref="GOA:D4JDX0"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDX0"
FT                   /protein_id="CBK88392.1"
FT                   /translation="MNANEILDEMEKLYPNAECELKHETPFQLLVAVVLSAQTTDESVN
FT                   KVTPALFAAYPTSKAMAQASLSDIESYIRRIGLYRNKARSILKLSQDLEEKFHGEVPSS
FT                   YKV"
FT   CDS             complement(740572..740859)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07900"
FT                   /product="DnaD and phage-associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88393"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDX1"
FT                   /protein_id="CBK88393.1"
FT                   /translation="MVFDISGVYALENTSEVNYAKSLLEEFEDEFKRSLSPSEMDRILN
FT                   LASIYSERMVIVALNEAASYDKRDLNYIERILISWTDKGLSVEDVENGKR"
FT   CDS             complement(740870..741112)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88394"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDX2"
FT                   /protein_id="CBK88394.1"
FT                   /translation="MEKISWDAPYLDRKVWLLEHLETLHLDAKEALVLLLIDHFNTIHV
FT                   NIHHELLATKLKINEEEVEDIFNALAEKGYLKFRF"
FT   gap             741416..741791
FT                   /estimated_length=376
FT   CDS             742016..742663
FT                   /transl_table=11
FT                   /locus_tag="EC1_07930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88395"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDX3"
FT                   /protein_id="CBK88395.1"
FT                   /translation="MIKTISLWVKNDSKWNILLFIFALWILYVFSVSGDATNPMNNGYG
FT                   FLIFSLFAITWINILPLCTPTKNKSMIQILEETNNIPITLLMIFLFKTFILYIVLLFIW
FT                   ILHSIFNHTPVMILPASLMYWLSSSLSILLHSFCLFLRFSKSEYWRRQAYFPAIILFTF
FT                   TPFITRYTRFNYQVFSDLFKEYTIWILLLFFLFYIIGYLWIKRIIRKYFKEL"
FT   CDS             complement(742770..743162)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07940"
FT                   /product="Inorganic pyrophosphatase."
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88396"
FT                   /db_xref="GOA:D4JDX4"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDX4"
FT                   /protein_id="CBK88396.1"
FT                   /translation="MKELENNAFFWQKLDTLMFSSDCTIDRPKGSTHFKYSNLVYPVDY
FT                   GFLSDTTAGSDQDPIDLFKGSIPTHTVDAIAVSADILKKDCEVKLLVGCTEEEILDILR
FT                   FLNQTEFQKAILIRRGDETPIWSTND"
FT   CDS             complement(743231..744205)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07950"
FT                   /product="asparaginase"
FT                   /function="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88397"
FT                   /db_xref="GOA:D4JDX5"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDX5"
FT                   /protein_id="CBK88397.1"
FT                   /translation="MKNIVIIATGGTIAGSGKIGESASYQAGTINVKQIVDSIPQIDTL
FT                   ANLTMIQLCNLDSNDIGISHWKKLREYCERYDKDDSIDGIVITHGTDTLEETAFFLNLT
FT                   LNCHKPVVLTGSMRPATSTSADGPMNLYQAVALACSTDAYDAGVLALFSDTIYSGRDLQ
FT                   KTNSYKTDAFKMGEFGSLGYMRDDQVYLLSEPHKKHTHQTIFANLSIDILPKVGIYYVH
FT                   SDCDPQLLEDMMKRYDGVVIAGTGSGNYPSAIKDVIEKNDDCILVRSSRVIEGAVFDSK
FT                   YFDPELKTIPALKFSPQKARILLQLSLLVTKEPKKIKEIFSIY"
FT   gap             744540..745181
FT                   /estimated_length=642
FT   CDS             complement(745207..746367)
FT                   /transl_table=11
FT                   /locus_tag="EC1_07970"
FT                   /product="glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88398"
FT                   /db_xref="GOA:D4JDX6"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDX6"
FT                   /protein_id="CBK88398.1"
FT                   /translation="MYMKFVVACDSFKGCMTSKEVGQTIEKGILKANFQHRVKVFSMAD
FT                   GGEGTAQAFCDVINGKMVDVNTLDAYHRKIRAGICLSQEEDIAIIDVASCIGLSMVDKK
FT                   DRNPMITSSKGVGILIKQALSFGVSKIIIGLGGSSTNDGGMGLLSEFGVRFYDSNRELL
FT                   RPNTYALGKIAFIDKRAFSIPSNVEFIVACDVKNHLLGQEGATYIFGKQKGIYENQMEE
FT                   IDSWLRHYRDKLDQTFHVDVNEFEASGAAGGIGAVLLGMFHARMVPGIQLLTEYAHLED
FT                   EISKCDIVITGEGQTDRQTVYGKVPYGIAQLAKKYDKPVICLSGALGLGYEELYKEGVI
FT                   GIFSSADRAMSFQTALKTASAKLEALAFSVVRLIEGVIKYEENKLK"
FT   CDS             746443..747648
FT                   /transl_table=11
FT                   /locus_tag="EC1_07980"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase,
FT                   prokaryotic"
FT                   /EC_number="6.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88399"
FT                   /db_xref="GOA:D4JDX7"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDX7"
FT                   /protein_id="CBK88399.1"
FT                   /translation="MSKKRIVVGVSGGIAAYKACDLVSKLSKKDYEVKVILTKHAEKFV
FT                   SKLTFEALCHNYVETDLFDESNEDPIAHITLAKWADLMIIVPATANIIAKVTHGISDDL
FT                   LSTTFLACNKHKMICPAMNTQMYENPITQKNIQACKDLGYQILDPVVGHLACNDTGKGK
FT                   MIEPADIVEAIDNYFNTSNKLSGKTVLISAGPTQEAMDPVRFISNHSSGKQGYAIAKAA
FT                   KAMGANVILVSGPVQLEKIDGIQTIDVTSALDMFEAIKQNADKADYIIMAAAVSDYRPE
FT                   NIAEHKIKKSDDTIEMTFVKNPDILAYLGQCKTKKQIICGFAMETQDLDKNAKEKLEKK
FT                   NCDMLIANNLFVSGAGFQTDTNIVSLLTKDSIEHLPKLSKEELGQKILETMMKIEEGKT
FT                   KC"
FT   CDS             747642..748415
FT                   /transl_table=11
FT                   /locus_tag="EC1_07990"
FT                   /product="pantothenate kinase"
FT                   /function="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_07990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88400"
FT                   /db_xref="GOA:D4JDX8"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDX8"
FT                   /protein_id="CBK88400.1"
FT                   /translation="MLVAIDIGNTNITIGIFDKDELIGNYRLTTKVRRTSDEYGFMLKT
FT                   FLDNSNIHKADVDDVIVSSVVPKVMHSFRNGIKKFMEIEPIMVAPGIKSGISVQLENPK
FT                   SVGSDRIADCAGAFYEYGGPVLIVDFGTATTYDYVDENGCFKAGTIGVGIETGANALWG
FT                   QTAQLPEIEIKPPKTILAKNTQTEMQAGIFYQYLGGIEYTIKQFRKEVGKDFKVIATGG
FT                   LGRIVCNHTKLIDVYDPNLIFKGLKIIYEKTKENK"
FT   CDS             complement(748437..749798)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08000"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88401"
FT                   /db_xref="GOA:D4JDX9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDX9"
FT                   /protein_id="CBK88401.1"
FT                   /translation="MNNQYLLKLRNGEKLSTSQQVKMILLLSLPAILSQVSSTVMQYID
FT                   ASMVGSLGADASASIGLVSSTTWMFGGVAFAAITGFTVQVAHAIGAKDLLHARNIMKQG
FT                   FIVGEIFVFILMIIGVSISFQLPIWLKGTESIQYSASMYFLFFALFLPFQQLNYLATGM
FT                   LQASGNMKIPSLLNICMCFLDVVFNLFFIFYMGLGVMGASIGTGCSQLVISLCLCAFLF
FT                   FKSDSLSLHKNEKMSWEQDTLKQALRIGLPVGLDRLVTSSAYVAFTRIVSPLGTIAIAA
FT                   NSFGITAESLCYMPGYGVQSAAVTLIGQSIGAKRHDLTYRLGVLTTILGIGLMTCSGLF
FT                   MYFGSPLMMSLLSPDPSIVILGVQILQIEAFAEPMYGASIVVAGVLQGAGDTLSSSLMN
FT                   LISMWCVRIPLAALLAGNYGLTGVWFAMALELNVRGILFLYRLFKKKWMSKLAN"
FT   CDS             complement(749893..750459)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08010"
FT                   /product="Protein of unknown function (DUF3737)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88402"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022208"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDY0"
FT                   /protein_id="CBK88402.1"
FT                   /translation="MHGIKALRECNDIVIKDCQINSSEFGWMSRNIQVKDAKAISEYFM
FT                   MRAENVRFENVEFTGKYSFQYLKDAYLENCVLDTKDAFWHSENVWVKNSVVKGEYLAWY
FT                   SHGLVLENCKIIGTQPLCYCEDLKLINCEMIDTDLAFEKSTVKATIKNSVLSIKNPKEG
FT                   EIIVPAVKEIIMDDPFAKANIIQNR"
FT   CDS             complement(750597..750725)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88403"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDY1"
FT                   /protein_id="CBK88403.1"
FT                   /translation="MYIENQTFDEERALYGIKMQLFEIVFSMVLRMGRVHLRNVKI"
FT   CDS             complement(750848..751315)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08030"
FT                   /product="Protein of unknown function (DUF2798)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88404"
FT                   /db_xref="InterPro:IPR021529"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDY2"
FT                   /protein_id="CBK88404.1"
FT                   /translation="MPKTKFQDLTFTVIMVLIFVYVMTFYNAGMENGVTFSTFGYALKN
FT                   MWVEVIGAFIAQRYIASKIVKKLVARIFDENDKPVFKLLATAGFTVSLMAPIMTFYVSF
FT                   YHFGFSSEFLGHWLSKLVLNFPFALCAQVFYVGPLVRWIFRSLFKKQLATN"
FT   CDS             complement(751444..751983)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88405"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDY3"
FT                   /protein_id="CBK88405.1"
FT                   /translation="MSEKEIILKSKHLGPMVEDAFYQERMMILKLTDKEKFDYMVSKMN
FT                   YCKRKEYSSGKALDLNVNKGDLAYIDFGQAYQHEIGYLHFGLVMTVKRGKAFVVPLSGK
FT                   YKAYLEAYDNKGNPTGKRHLMRLGYIEGLTKVSVLFINDSKWINTSRIIEIKAHIDVNG
FT                   EIFKEVQKRIIEMIIE"
FT   CDS             complement(752560..752952)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08060"
FT                   /product="UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88406"
FT                   /db_xref="GOA:D4JDY4"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDY4"
FT                   /protein_id="CBK88406.1"
FT                   /translation="MAVNGMILGGSLMFFAGLIDDLIDMKPLVKLAFEVCAAFILVAFG
FT                   VGVDVLRLPFGITIDSIALSIVFTIIWIVGITNAVNLIDGLDGLCGGMSVVIFVVIGCI
FT                   AIVERRMDITIIYFSFGSQYIWLFGL"
FT   CDS             complement(753156..754082)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08070"
FT                   /product="Actin-like ATPase involved in cell morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88407"
FT                   /db_xref="GOA:D4JDY5"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDY5"
FT                   /protein_id="CBK88407.1"
FT                   /translation="MFAHWIALDPGSNSLRLYDYFNDREVCLKTCIAYDKQKMIALAEQ
FT                   ALAYVYQNKKDIKVRYPIKQGDILNDVTPLIRQALKELKVSQNVFKPCFLVCLNEDVSD
FT                   EQKLKWQQQLAACKVRKVEFITPMEVLQTEQACFIIHAGHSYTEMGIYAHGHEFAHKII
FT                   YFGGMGMDEKIKMTIAQKQNCLISNEDASALKEAVSQAFKMNKNPMLQCMAMDRYGKLV
FT                   NIQIRASDLWPAMEEQILQVVLWAKHCYMNMGSEMKQRLMNNGIMLSGGLANCFGLKEA
FT                   LKHEFDCPIICTTKPECDIIEQMKGLK"
FT   CDS             complement(754085..754294)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08080"
FT                   /product="Protein of unknown function (DUF1146)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88408"
FT                   /db_xref="InterPro:IPR009526"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDY6"
FT                   /protein_id="CBK88408.1"
FT                   /translation="MIASLINYIVFFACFGLSFYALSVIKFEDFCKVKQPGKVTLLMFL
FT                   LSLALAYLSSQAILSLTIYNGLGV"
FT   CDS             complement(754291..755130)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08090"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88409"
FT                   /db_xref="GOA:D4JDY7"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDY7"
FT                   /protein_id="CBK88409.1"
FT                   /translation="MKVYAPAKVNLGLDVVRTMENGYHELDMIMAPISLYDELDIEYAD
FT                   QDKIEIENMELSEDNTISKTLGLLRDCYDIKHHYLIRVKKNIPSQAGLAGGSADAAAVL
FT                   KTVLELEGIEVEMEEKLNLAKQIGADVPFCLVNQFSRVKGIGEKIEILDTNWKFNILLV
FT                   KPDFGVSTPEAFRLWENQEKFHPDIDYVQMACENQILDLLVQAMGNALEPVAFELRPEL
FT                   AKIKEEMLDLGMVRVMMSGSGSSMMGFCIDEDVLQKAKSVLEKRYGFVEVVSVGAKL"
FT   CDS             complement(755102..755971)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08100"
FT                   /product="dimethyladenosine transferase"
FT                   /function="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88410"
FT                   /db_xref="GOA:D4JDY8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDY8"
FT                   /protein_id="CBK88410.1"
FT                   /translation="MDRPIATIKRTKEIQEKYNVFTKKSYGQNFIIEPRVVEKIADAAI
FT                   KSKDELVFEIGPGIGALTQYLTMKSNQVIAFEIDDRLPEVLENEIGYDHLKIVLKDILK
FT                   VDINEEIKKYRKPDQKIVFASNLPYYITTPILFKLFEATEPIERITVMMQKEVADRFLA
FT                   SQNDKEYNALSVITQYRCDIKKVMDVSRHVFWPSPNVDSAVLQFTFHHKYNLKDEELFF
FT                   KMVKACFVQRRKTIYNNFQTLFKDKEEALQLLEKAQLKSSIRAQQCTLEDFIRLYEVSY
FT                   ESLCTGKS"
FT   gap             756244..756447
FT                   /estimated_length=204
FT   CDS             757335..758045
FT                   /transl_table=11
FT                   /locus_tag="EC1_08130"
FT                   /product="purine-nucleoside phosphorylase"
FT                   /function="purine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88411"
FT                   /db_xref="GOA:D4JDY9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDY9"
FT                   /protein_id="CBK88411.1"
FT                   /translation="MSTPHNTAQNDEIAKIVLMPGDPLRAKFIAENYLDDPICFNTVRN
FT                   VLGYTGAYKNKRISVMASGMGMPSIGIYSYELYKFYDVDTIIRVGSCGGYIPELHAMDV
FT                   LLAKSCWSESTFAKVQSGEGSDVQYPSPSINQAIKDTAKIMNIDLKEYRLHSSDVFYHE
FT                   TNQAQDIAIKNECAAVEMESFALFHNAHVLNKKAACICTVSDSFVHDENLTSKQRENSF
FT                   DTMIKLALETTLRI"
FT   CDS             758136..759509
FT                   /transl_table=11
FT                   /locus_tag="EC1_08140"
FT                   /product="Uncharacterized FAD-dependent dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88412"
FT                   /db_xref="GOA:D4JDZ0"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDZ0"
FT                   /protein_id="CBK88412.1"
FT                   /translation="MHDYDIIIIGAGPGGIFSAYELIKLKPELKIGIFETGGPLEKRKC
FT                   PIDGKKIKSCINCKTCAIMNGFGGAGAFSDGKYNITNEFGGDLYAYVGKQEAIDLMEYV
FT                   DEINCKYGGSKTRLYANQDPTIAKKCLQNDLHLLKAKVRHLGTDINYIVLENLYNQLKD
FT                   CVDFHFYTAIQSVDKLDDGYQVKSEDKSFTSKQCIISTGRSGSKWMESICSNLGIETKS
FT                   DRVDIGVRVELSADTFSELTDSLYESKIVYRSKKYQDRVRTFCMNPKGVVVNENTNGIV
FT                   TVNGHSYEDPARFTNNTNFALLVSNHFTEPFSSSNQYGESIARLSNMLGGGVIVQRFGD
FT                   LIRGQRSTPSRIESGFVTPTLKATPGDLSLVIPKRQLDDIIEMIYALDKVCPSTASDDT
FT                   LLYGVEVKFYNMQVKVDKHLETKHKGLYVIGDCSGVTHSLSHASASGVYVARTIAENL"
FT   gap             759598..759915
FT                   /estimated_length=318
FT   gap             761896..763020
FT                   /estimated_length=1125
FT   CDS             763156..764634
FT                   /transl_table=11
FT                   /locus_tag="EC1_08180"
FT                   /product="ATP-dependent exoDNAse (exonuclease V) beta
FT                   subunit (contains helicase and exonuclease domains)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88413"
FT                   /db_xref="GOA:D4JDZ1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDZ1"
FT                   /protein_id="CBK88413.1"
FT                   /translation="MPFSKAQQQAIDLRNKNILVSASAGSGKTSVLVERLCKLVLVDKI
FT                   SIDRILAMTFTEDAANEMKDRLKKRLQAETQTDYIQSQLALLETASICTIDGFCLSIVK
FT                   NYYYKIPISYKMSKSVASSAQANKAFLDAYNEACNSINTNDFVKLKLFFSSLGKTEDDI
FT                   LSNIRDLINVAMSKPDSNEWIRSLMNKPCSEKTFNWFFQYFIEQIESMIEICKNMKEAD
FT                   EQLFSLKEENLNTCLDFLYKKDYAFFKKQFEIYFNNTPGFKKTINKVSYEKEQGEFKKI
FT                   EGNILNVLYEKEEYDQDLNNNIERINTFCTLSLLTMDIFAKKKKEMEIIDFTDMEHFAY
FT                   KLLKQPMIQEEVRNKYQMILVDEFQDTNELQENIIQCFARKDNVFRVGDIKQSIYGFRQ
FT                   ARPEIMQGHMDKEDENSCLIVLDENYRSNQSIVEFNNEFYDHIMNTTFTREKLSPRRYC
FT                   QSWNSQAKRCRAASCPFSLYRISKLDGKPGRKFQ"
FT   CDS             764606..766282
FT                   /transl_table=11
FT                   /locus_tag="EC1_08190"
FT                   /product="ATP-dependent exoDNAse (exonuclease V) beta
FT                   subunit (contains helicase and exonuclease domains)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88414"
FT                   /db_xref="GOA:D4JDZ2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDZ2"
FT                   /protein_id="CBK88414.1"
FT                   /translation="MENQEESFNKIQAKSLHKNNVYDLIANDILTKHEQGIPYSSICIL
FT                   TRTHSPQEELKKVLEAYEIPVLAEIDHGFYTNHAIQIVLSTLISLNDPNDDIALMASLC
FT                   SPIGNVLYNDIAGCCINKEKNTSLYSLVKDKPFMQSWQQLRQYKNEPISDLIRHIYSHN
FT                   DFYFNYTTNQDKTNLDQFLEMASQFEVQNDLDLFLEQIINDSNQDAVGEAYPYGKDANV
FT                   VKIKTMHHSKGLQFPIVYILSSHTTKDKYSNNPVLVDPVLGISLNALDPSLKFKRASLS
FT                   HLAFVTKKNHDDLKEEMRVFYVATTRAEKELVIVDYIDDIKSYSSSLNTSSLLEKSSYT
FT                   GWLLHTYLNKPSSLFKLDKKNQLYKRPLPLKKDDDIDTNQFYQGSISSISGHTASAAKQ
FT                   SLEWPDIDLTKKLSTTRGTLFHEIVANCSFPYQKEDCINYAHKHNFTLQATDIKQLLSL
FT                   NECHIYKEMMQNKHEFECSYIIRENEEIYHGFIDLIAWHPEHISILDFKTDTVQNETEL
FT                   IDKYHAQLDAYKKAIHTIEPDKKIKTYIYSFHLRKIIYLDQ"
FT   gap             767391..768108
FT                   /estimated_length=718
FT   CDS             768209..768997
FT                   /transl_table=11
FT                   /locus_tag="EC1_08210"
FT                   /product="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88415"
FT                   /db_xref="GOA:D4JDZ3"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDZ3"
FT                   /protein_id="CBK88415.1"
FT                   /translation="MIVFLDLDDTLWRWHQVCSSAKESIIQAHRNGHKIFINTGRTKCE
FT                   VPLKPLEGLPIDGYCFSAGSEILIENKQVLYKPLRPQIVKALIERIEPMNLGMSLEGSQ
FT                   KTFQNEVNYEIFKKFAKDDRTGAGMMVHHHLSEITEDDYRQIMKVSIHYPEGSDISNLI
FT                   DNLPEGLVFTPFKNTGGEITNCTYNKATAIQFVKSYYQSDEKTMAVGDSENDITMLKEA
FT                   DISIAMGNGNDHVKKISNYITTNIDEDGLKNAFKHFGLID"
FT   CDS             complement(769037..769333)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88416"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDZ4"
FT                   /protein_id="CBK88416.1"
FT                   /translation="MEKWTQEQYAARLQEMKQEAHDKMWLYIELNAKEFMEECEPGVKN
FT                   LTACCKAMLDAMLEGDGFIVEPKSRSKVAGALTVRYYVDNLHPGRRKYSEVNQ"
FT   CDS             769493..770494
FT                   /transl_table=11
FT                   /locus_tag="EC1_08230"
FT                   /product="Membrane protease subunits, stomatin/prohibitin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88417"
FT                   /db_xref="GOA:D4JDZ5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDZ5"
FT                   /protein_id="CBK88417.1"
FT                   /translation="MLQNIEQKEIHPINGMIMLVVITIGLILSVGLIILGSILLEQNNS
FT                   VLGGIILAIGIILVVIFPIMYGGLKIVGPNEALVLTLFGNYYGTILKPGYYYVNPFVSY
FT                   NNPIFNKAYINRNKIENNDKTTVIPDITPKKTVSLKSITLNNGTQKVNDVLGNPIIIGA
FT                   VVIWKVTDPTKAVFNVDNYAEFLSIQTDSTIRNIARKYPYDDLDCEDENMNEKTLRSSS
FT                   LEIANDMKDELIKRVQIAGLDIEEVRITHLAYAEEIAAAMLQRQQASAIIAARQKIVDG
FT                   AVGMVKMAIDKLGEEEVVVLDEERKATMVSNLLVVLCSNKDTQPVVNSGSIY"
FT   CDS             770494..770760
FT                   /transl_table=11
FT                   /locus_tag="EC1_08240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88418"
FT                   /db_xref="GOA:D4JDZ6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDZ6"
FT                   /protein_id="CBK88418.1"
FT                   /translation="MNDLDIKEKALQERAKRLEELEKEIQEKEKALKQKEKQKKQIILR
FT                   LAPSLWQDIATWANDDFRSINSQIEYILTKAVKERKNRNRNNL"
FT   CDS             770890..771084
FT                   /transl_table=11
FT                   /locus_tag="EC1_08250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88419"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDZ7"
FT                   /protein_id="CBK88419.1"
FT                   /translation="MIKLYKKQDDKINVLKHIDQFLTSPDSRTHSTKQILLRYYFKTSN
FT                   PSRIKKPLKDNTTKALIYI"
FT   gap             771298..771727
FT                   /estimated_length=430
FT   CDS             772579..772788
FT                   /transl_table=11
FT                   /locus_tag="EC1_08270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88420"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDZ8"
FT                   /protein_id="CBK88420.1"
FT                   /translation="MKKTILLLCMLTFLCPTPIAANEISSIENTNIEVRADIKEWKYKF
FT                   INGKFYKRLWNSTQRRWETDWIPV"
FT   CDS             772941..773561
FT                   /transl_table=11
FT                   /locus_tag="EC1_08280"
FT                   /product="transcriptional regulator, TetR family"
FT                   /function="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88421"
FT                   /db_xref="GOA:D4JDZ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:D4JDZ9"
FT                   /protein_id="CBK88421.1"
FT                   /translation="MQDTSNLTLNKIQQAAIDEFLEKGFRGASLRQIVKHAGVTTGAFY
FT                   GYFSSKEALFASIVEPHAQAIMANFMEAQLRFADLPKNEQPSHMGIESSSCIDWMVDYI
FT                   CEHHDPIKLLLSKAEGTSYENFVHNIVEVEVEYTLKYMDVLRELGYTVPRLDKTLCHII
FT                   ASGMFGGIFEVVIHDIPKKQAMRDVGQLRAFYTAGWLALIEEK"
FT   CDS             773645..774472
FT                   /transl_table=11
FT                   /locus_tag="EC1_08290"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88422"
FT                   /db_xref="GOA:D4JE00"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE00"
FT                   /protein_id="CBK88422.1"
FT                   /translation="MKEKKKNAITTLLNYAGNFRILTYIGLTLSAISMLCSIVPYICIW
FT                   LVVRDLIEAIPNFSNIQNIETYGWVAFSFSVCGIIIYFIGLLCTHLAAFRTAENIRKIG
FT                   MNHLMKAPLGYFDNNASGLIRGRLDSAANDTETLLAHNLADIVGTIVLFTGMVVLMFIF
FT                   DWRMGASCLLSSIISIIAMFSMMGGKNAQIMAEYQAAQDKMTKAGTEYVRGIPVVKIFQ
FT                   QTVYSFKTFKKSIEEYSDKAEYYQGKICRVPQSINLTFTEGAFYFSSTCCYFF"
FT   gap             774517..774929
FT                   /estimated_length=413
FT   CDS             774950..775828
FT                   /transl_table=11
FT                   /locus_tag="EC1_08300"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88423"
FT                   /db_xref="GOA:D4JE01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE01"
FT                   /protein_id="CBK88423.1"
FT                   /translation="MFASSGIMLANTALNRIDLVMKAPTLKECIHPKTPIDNSVVFKNV
FT                   SFTYEGSSTPALSSISFRVKPGQTVALVGPSGGGKTTVASLIPRFWDVKKGVIEIGHVN
FT                   VKDIDQHVLMDKVAFVFQNTKLFKTSILENIKISNPNASDKDVMYALKAARCEDIIEKL
FT                   PNGIHTIIGSEGTYLSGGEQQRIALARAILKNAPIVILDEATAFADPENEVLIQKALNV
FT                   LCQNRTVIMIAHRLSTVINADKIIVLDKGYVIEEGTHDELLNKKGLYQKMWTDYNQAAK
FT                   WKITSVEKGAL"
FT   CDS             775829..777580
FT                   /transl_table=11
FT                   /locus_tag="EC1_08310"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88424"
FT                   /db_xref="GOA:D4JE02"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE02"
FT                   /protein_id="CBK88424.1"
FT                   /translation="MFGREFKRKYALTDKGVQNVKKGTFWTVIVNLVVMSGISILYLLM
FT                   NNFVNLIKGNQFKVNTITILVLLTLFVILSFITHLQQYKTTYGLVYGEVKVTRIALAEK
FT                   LRKLPLGYFNKKDIADLTETIMGDVNRMEHVWSHVLGYLYGSYISTAIIAIFLFIYDWR
FT                   LAIACLWGVPVAFGLLFGSRKWTSNASEMLKQSAIRVSDEIQETLENIREIRATNQEDT
FT                   YLKGLYKKIDAHESVMIRGELISGIFVNAASVIMRLGVATTILVGANLIVHGQIDFMIL
FT                   FMFLLVITRIYAPFDQSLALIAEMFVSQVSANRMMEIYDTPIASGKDTFEPKGYDIEFH
FT                   HVSFSYDNHDVLKDVSFIAKEGEVTALVGPSGSGKSTCAKLAARLWDTNKGSIKVGGID
FT                   INTIDPEVLLSDYSMVFQDVVLFDDSIKENIRLGKRDATDLEVYKAAKAANCDEFAHKL
FT                   PDGYDTLIGENGTKLSGGERQRISIARALLKDAPIILLDEATASLDVENETKVQEALST
FT                   LLANKTVLVIAHRMRTVQSADKIIVLENGRVKEEGAPESLYKQNGLYHHMVDLQSESSK
FT                   WHIDTLL"
FT   CDS             complement(777631..779772)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08320"
FT                   /product="Transcriptional accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88425"
FT                   /db_xref="GOA:D4JE03"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023097"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE03"
FT                   /protein_id="CBK88425.1"
FT                   /translation="MDKEIIKRIANELNIGVDQVSNTLKLLEEGSTVPFIARYRKEMTK
FT                   GLDEEQIRVIQEEYNYQVNLQKRKEEVINRIETLGKLTDTIKKQVLECTKLSQVEDIYR
FT                   PYKQKKKTRASVAITNGMKPLADLLLKLPRHFEEKDVEDYLNDKVTNIQEALQQAKDII
FT                   AEMVSDDHDIRNKIYDSMMNYGRIVTKEKKGHDDQAKVYRMYYDRVEKVSHLASHRIMA
FT                   IDRAEKEKVINVQIEFNEEYIENFVKRRYVRYPNSPCAVYVNEAIVDGLKRLAYPSIER
FT                   MVRSELSAKAHESSIDVFSMNLEKLLLQAPIKNKRILGFDPAFRTGCKLAVIDESGKML
FT                   CVDVIYPHQPNAKIKEAKTKLVKLIKDYDVSIIAIGNGTASRESETFVSNVISEYGLNV
FT                   QYTIVSEAGASVYSASKLAIEEFPNLHVEQRSAISIARRLMDPLSELIKIDPQSIGVGQ
FT                   YQHDLPAARLKERLDFAVEKAVNLVGVNINTASPTLLKHVAGLTSAMANNIVTYRQENG
FT                   KILSRQEIKKIPKIGTKSFEQSAGFLRIEDGKEMLDRTSIHPESYKYAKIVLDILGLDE
FT                   HAMGTQIAQKAVDSCNKEELLKQMKCDSYTLNDILDSIKQPLRDYRDNNDGPILRSDIL
FT                   ELEDLHIHDKLQGTVRNVVDFGVFVDIGLHEDGLIHISQMADHKIGHPSEMVSVGDIID
FT                   VWVYKIDEEKHKVQLTMIP"
FT   CDS             complement(779889..780755)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08330"
FT                   /product="methionine aminopeptidase, type I"
FT                   /function="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88426"
FT                   /db_xref="GOA:D4JE04"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE04"
FT                   /protein_id="CBK88426.1"
FT                   /translation="MISKNMPCWCGSGKKYKHCHEEWDNTINVLKLQGQQVPSHNLIKS
FT                   PDDIKWIKKAAKINNEILDLVEKEIHAGMSTEDIDKMVYDYTVSHGAIPACLGYEGFPK
FT                   SVCTSINSEVCHGIPNKNIILKEGDIINVDCTTIVHQHYADASRTFCIGQVSDEAKKLV
FT                   EVTKECLRVGIEAVRPWGHFGDIGAAIQEVAHANGYSVVRDFCGHGVGNAFHEDPYVHH
FT                   VGIKNTGMVIAPGMVFTIEPMINQGTSELYIDKNNGWTAYTRDGKLSAQFEHTILVTDK
FT                   GVEIIAY"
FT   CDS             complement(780815..781714)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08340"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88427"
FT                   /db_xref="GOA:D4JE05"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE05"
FT                   /protein_id="CBK88427.1"
FT                   /translation="MIALGMNPFINAQGFASTGMMTIFIGAVTNIILDPVFIFGLNLGV
FT                   KGAAIATVASQIISAVFVLLFLTGKKPELKLQRLKDVEFRFDEVGDVLSLGSSSFVMQC
FT                   TNSLVQIACNSMLSQFGSDLYVSCMTVINSVRQILEVPVLAIGDGSSPILSYNYGAKNY
FT                   KGVKKAIRIITCAGVFYTLVAWLFVFLFPSFFIHIFNDDSKLLQIAIPAIHMYFFAFVF
FT                   QAFQYCGQTVFKSLNKKKQAIFFSLLRKVVIVVPLTFFLPYLGFGTMGVFMAEPISNFI
FT                   GGSICFITMLVTVYFRLD"
FT   gap             781824..782075
FT                   /estimated_length=252
FT   CDS             complement(783455..784405)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08380"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /function="bacterial peptide chain release factor 1
FT                   (bRF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88428"
FT                   /db_xref="GOA:D4JE06"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE06"
FT                   /protein_id="CBK88428.1"
FT                   /translation="MSKMEDRLDSLVERYNEINELMMSSSVVSDRKQMAKLGREQNELT
FT                   PIVETYAEYKQAKEEFEEAKTLQKEDDKELRELANAEIERLEPAIKEYLDRLELLLVPK
FT                   DPNDSHNAFMEIRGAAGGDEANIFAGDLFRMYAKYAESKGWKVEVTDSEDSEAGGFSLI
FT                   TFKVTGQNAYGTLKFESGSHRVQRVPKTESQGRIQTSTATVLCYPELDEEDFDIDMNDL
FT                   EIEAMRASGAGGQHVNKTDSAVRIVHKPTGIVVKCQDGRSQHENRATALATIAARVKEE
FT                   HQRELDEKAGAERRTKIGTGDRAERFVHITTHKTV"
FT   gap             785482..785868
FT                   /estimated_length=387
FT   CDS             complement(786490..788022)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08410"
FT                   /product="IMP cyclohydrolase
FT                   /phosphoribosylaminoimidazolecarboxamide formyltransferase"
FT                   /function="IMP cyclohydrolase"
FT                   /function="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88429"
FT                   /db_xref="GOA:D4JE07"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE07"
FT                   /protein_id="CBK88429.1"
FT                   /translation="MKRALVSVSDKTGLVEFVQGLVDCGYEIISTGGTKKALENAGIKT
FT                   IGISEVTGFPEIMDGRVKTLHPKVHGALLCVRDNPDHVRQLKELGIEYIDLVCVNLYPF
FT                   KETVQKEGVSHEEIIENIDIGGPSMLRSASKNYQSIPVLCDPKDYEKVLNEIKENGETT
FT                   LETREHLAAKVFRHTARYDAMIADYLTKRTHEEFPESLTITFDKVQDLRYGENPHQKAA
FT                   FYKGMNPKYSLANATQLHGKELSYNNIQDGNAAIEVLKDFEGQYAAVGLKHMNPCGVGI
FT                   GENIEAAWDKAYEADPVSIFGGIVALNDKVEKGLAEKLSKIFLEIIIAPDFSEEALEIL
FT                   TRKKNIRLMKLDTTLSTSTALKYTNVNDGLLVQEMDTHVVREEDLRCVTNRKPTKEEIE
FT                   QLLFGWKVVKHVKSNAIVLVKDNMTIGVGAGQMNRVGAAKIAIEQAQEKAKGSVMASDA
FT                   FFPMPDTVQEAIKAGVTAIIQPGGSIKDQLSIDECNEHGIAMVFTGIRHFKH"
FT   CDS             complement(788019..788609)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08420"
FT                   /product="formyltetrahydrofolate-dependent
FT                   phosphoribosylglycinamide formyltransferase"
FT                   /function="formyltetrahydrofolate-dependent
FT                   phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88430"
FT                   /db_xref="GOA:D4JE08"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE08"
FT                   /protein_id="CBK88430.1"
FT                   /translation="MLRLAVLISGGGTDLQSIIDEHKKGNINCEIALVISNRKSAYGLE
FT                   RAKQAGIPTACIKDQKELLKKLQDEKIDFIVLAGYLAILQEDLIKAYPNKIINIHPSLI
FT                   PSFCGPGMYGLHVHEAALAKGVKVSGATVHFVSEEVDGGPIIYQEAVSIADLDTAEAIQ
FT                   KRVLEIEHKILPMVVRYYCEDRIRIEKGRVHIL"
FT   CDS             complement(788603..789547)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08430"
FT                   /product="phosphoribosylaminoimidazole synthetase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88431"
FT                   /db_xref="GOA:D4JE09"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE09"
FT                   /protein_id="CBK88431.1"
FT                   /translation="MRPEVLGGLGGFAGAFDLSKIKGMEEPVLLSGTDGCGTKVKLAFV
FT                   LDKHDTIGIDAVAMCVNDIACAGGEPLFFLDYIACGKNYPEKIATIVSGVAEGCKQSEC
FT                   ALIGGETAEHPGLMPVDEYDLAGFAVGVVDKKDIIDGSNIKEGDVLVGIASSGVHSNGF
FT                   SLVRSVFDMTEESLNTYYDELKKTLGEALIEPTRIYVKALKNVKEAGVTIKGCSHITGG
FT                   GFYENVPRMLPENAKAIIKKDSYPVPAIFDLIAKNGNVEETMMYNTFNMGLGMVIALDP
FT                   EDVDTAMEAIQKAGDTCYVVGNIVEGQKGVELC"
FT   gap             789567..790326
FT                   /estimated_length=760
FT   CDS             complement(792919..793404)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08450"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide mutase"
FT                   /function="5-(carboxyamino)imidazole ribonucleotide mutase"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88432"
FT                   /db_xref="GOA:D4JE10"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE10"
FT                   /protein_id="CBK88432.1"
FT                   /translation="METKVLVVMGSRSDLPAMEGCMKQLDDFKIGYEVRVLSAHRTPNE
FT                   VIKLSSEAKNRGIKVIIAAAGGAAHLAGVIASSTPLPVIGIPMQTSALGGMDSLLSTVQ
FT                   MPQGVPVATVAIGKAGARNAAILACQMIGLADEAVQKTIEDFKKEQAENVLAQSIVE"
FT   CDS             complement(793820..793936)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88433"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE11"
FT                   /protein_id="CBK88433.1"
FT                   /translation="MQNQLLFHEFFMAERLYWCRGVYDSRNDTWINTYFDDA"
FT   CDS             794084..794977
FT                   /transl_table=11
FT                   /locus_tag="EC1_08470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88434"
FT                   /db_xref="GOA:D4JE12"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE12"
FT                   /protein_id="CBK88434.1"
FT                   /translation="MKRLLSCQASEILAMNGKELKQAILASEGRTVLTEMTVFNGCLLG
FT                   NITNAEVASAFGSDMILLNGLDCFDPVIPGLPETDEPIKLLRELCGRPVGANLEPVDDS
FT                   ISLMSEKIEIVPGRKATAETFKAAEELGLQFICLTGNPGTGVTNKMIAKAIKECKGNFS
FT                   GLIIAGKMHAAGVDEPVVDIPTIKEFIKAGADVILMPAAGTVPGLQESTITEACKIIKE
FT                   AGCLSLSAIGTSQETSDTDTIRELALSSKRSGIDIQHIGDAGWGGMAFPENIMAMSVAI
FT                   RGIRHTYFKMAQSAKR"
FT   CDS             complement(794979..795824)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08480"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88435"
FT                   /db_xref="GOA:D4JE13"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE13"
FT                   /protein_id="CBK88435.1"
FT                   /translation="MIRLFASDLDGTLLNEHHECDEKIEKGIQKIIDAGKIFTVATGRG
FT                   IKMVNLKKAGDISYYICLNGAAVLDPKKQLLHCEPIDKEVLSKIMDVFEDLNLEYVSWN
FT                   KVYSRIDKESVLRYRKNVWKEAANDSWLDRFLNNIIVNFECLQSKEEILQKDICKINYH
FT                   FSDDTDTSRLDDFLKQYDDKLVNAPSGDGIYEITKNGVNKASAVSWLADFLNISKEEVA
FT                   VYGDGGNDIMMLSSFKHSYTPSTGSIEAKEAASQIIGPYEDYSVIEHILNTIEEEKKIE
FT                   "
FT   gap             795948..796655
FT                   /estimated_length=708
FT   CDS             complement(797507..798964)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08500"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88436"
FT                   /db_xref="GOA:D4JE14"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE14"
FT                   /protein_id="CBK88436.1"
FT                   /translation="MHFFENSKIFVSFGTLKITWYAVLILTGAFIGYMIAQKTVKKWGY
FT                   AKEMLEDYIIPTFIIAILGARVYYVIFEWGYYSTHLNEIIAIWNGGLAIHGGLIAGLLY
FT                   SIYFFKKRNVSCLRMADAIMPSVMVGQVFGRWGNFMNQEAFGRIVPESFFDHFPSFIKN
FT                   QMYINGAYHEPTFLYESIGNLIGFLFIYFIFRKKFYKRHGDCAFMYLVWYGVVRFFIEG
FT                   LRTDSLMFGPIRVAQLVSLIMIVIGILGLSGIFHKVFHLYQKPVVLFDLDGTLIDSREL
FT                   VFETFTQVFKEEKPDYVLSKEELYSFFGPTLETTFSKYFEEKDVDRIIERYQTINRQLH
FT                   DKLLKPIDHAKETVKWLHDQGYKIAVVSNKRHAMVEKGLKTSALYPYFEVIMGKEDLPK
FT                   PKPSASGLIEATVLLHTGHDNTIYVGDNAADVMAAKDMAAYSIGFSNDAKQIEKLEEAK
FT                   PCRIIKDLSELKEIVKEEQSWSDKSIW"
FT   CDS             complement(798966..799907)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08510"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /function="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.11.-"
FT                   /EC_number="2.7.4.-"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88437"
FT                   /db_xref="GOA:D4JE15"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE15"
FT                   /protein_id="CBK88437.1"
FT                   /translation="MNKVCVKHLAQKFMWEIVCGDAESLDRPITLPDTNRPGLELAGYF
FT                   PDSQTKRLVILGEKEMGYIDEVMDEISQRRSFEFLTSENTPCIIVAHGYDCPKVLKEIA
FT                   QRKNFPIFKSPQKTTAVVVSVTNYLDECLAESVILHGELVRVHGVGVLITGKSGMGKSE
FT                   IALELIKRGHQLVADDRVDCYAMHNMLIGKTAPLLEGFMELRGVGIINVGRMFGVGSYA
FT                   RRTEIELQIDLEPYDSNHDYDRVGIEEKEYAEILGVKIMRIRIPVSSGRPMSTIIESAV
FT                   TNFLLLKEGLDSAKEFEERVLTQIAMNKEETE"
FT   gap             802051..802522
FT                   /estimated_length=472
FT   CDS             complement(803340..803948)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88438"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE16"
FT                   /protein_id="CBK88438.1"
FT                   /translation="MRNILVLIGIIVFVAVLISFVLQFLRNSKQKQFMYLLQNNEFDTL
FT                   YKKIDSFYTKSIFPEYNREYVRLNALIMQDRKEEIDATFDKLIPMAKDKNAKIDILDKA
FT                   FEYYVYDENQEKCDQIIKEIEKLDDEKMLKHTKMMYDIMILKKSNYIKELEKDFDKQPV
FT                   MQRVTNAYLLSVQYKNKGNEEKAQYYENVSKSLVEGSKG"
FT   CDS             complement(804048..805166)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08550"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88439"
FT                   /db_xref="GOA:D4JE17"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE17"
FT                   /protein_id="CBK88439.1"
FT                   /translation="MAEKRDYYEVLGVSKNATPDEIKKAYRKLAMKYHPDVNKDPGAED
FT                   KFKEINEAYEVLSDEQKRQTYDQFGHAGMDGAFNQGGFQGGFTDFGDLGDIFGSFFGGG
FT                   FGSGFGGSSRRQSNQPRQGQDRYMQMRIDFMDAIFGKTETISLEVDETCKHCNGSGAES
FT                   PSDVQTCPTCHGSGYVMSQQRTPFGVIQQQSVCPDCHGTGKKVSRSCHVCHGKGYEHRR
FT                   VKLDIKIPAGIQTGQQIRIAQKGERGINGGPNGDLYIEIIVNPHPTFKRENNDIHIKVP
FT                   ISAIDATIGCTVQVPTVYGDVDLKIPEGTQPNTKFRLKGKGVKSRSGQGDEYVEVAVEI
FT                   PKKLSRKERELYEQLKSGQSDSPFERFKRAFK"
FT   CDS             complement(805224..807035)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08560"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88440"
FT                   /db_xref="GOA:D4JE18"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE18"
FT                   /protein_id="CBK88440.1"
FT                   /translation="MSKIIGIDLGTTNSCVAVMEGKDSKVIPNPEGNRTTPSVVAFKNG
FT                   ERIIGDAAKRQAVTNKNTISSIKRLMGTNQKVEAEGKQYTPQEISAMILQYLKSYAEDY
FT                   LGEKVTKAVITVPAYFNDAQRQATKDAGKIAGLDVERIINEPTAAALAYGIDKTEKEQK
FT                   VLIYDLGGGTFDVSILDLADGTFEVLSTNGDTHLGGDDFDNVLVDWMVDTFKKENGINL
FT                   TADPMAMQRLKEAAEKAKKDLSGVMQTQISLPFISAGPAGPLHFDTTLTRAKFDDMTRS
FT                   LVERTLLPIENALRDAKLSKSDIDQVLLVGGSTRIPAVQEAVRKALGKEPSHSVNPDEA
FT                   VAMGAAIQGGVISGDVKDVLLLDVTPLSLGIETMGGVMTVLIPRNTTIPTSKSQIFSTA
FT                   ADNQPAVDIRVLQGERPMAADNKELGNFQLTGIAPARRGVPQIEVTFDIDANGIVHVSA
FT                   KDKGTGKEQSITIQNSSGLSDEEIDRMVREAEDHKAEDEKRKEEIDLRNKAEGFISQID
FT                   AMLEDNKDKIDPKQAEETKKLRDDLQKALDENNMDEVKSKLDMLEKAAQAAGQQMYQQQ
FT                   AQSQGASQDNTTHANDDVVDGEFTEKH"
FT   CDS             complement(807618..808661)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08580"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /function="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88441"
FT                   /db_xref="GOA:D4JE19"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE19"
FT                   /protein_id="CBK88441.1"
FT                   /translation="MPESKLTQRQKIIFKTIVEEFTRVAEPVGSKTLMQLLDFPVSSAT
FT                   IRNEMAVLEKAGLLEKTHTSSGRIPSQKGYRFYVEHLMETHLDVSTRNSLQQVFRERHY
FT                   SLDEVVEKSCDILSHMTNLTSIVLGPDARHQALQHIQVIPINSKNAVAIFVTNQGHTEN
FT                   KMFQFEQDVSVEDIKNCTDLLNDQLVGTSICDVVDKMREIEPMMAAKLVRHEVLFEAFV
FT                   TAFMRFATEKVAVSGRDNMLGQPEFSDINRLKELMKVLDNGRLFHQWTDQADNVAVQIG
FT                   TRNELIQIGDCSVVTTKFHYNNEEEGQLMVVGPNRMQYSKVVALMDYMSNVIEDVFGNG
FT                   KGGKDGE"
FT   CDS             808800..809345
FT                   /transl_table=11
FT                   /locus_tag="EC1_08590"
FT                   /product="Predicted hydrolase (HAD superfamily)"
FT                   /EC_number="3.8.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88442"
FT                   /db_xref="GOA:D4JE20"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE20"
FT                   /protein_id="CBK88442.1"
FT                   /translation="MKKILTFDCYGTLLDTSSLYDLIENIAKTNNLSSIETIHIFSSYE
FT                   DRLMYGEPFISYEQLIKNVLSYCDMELKTSLFSNYYDAIMKAHQEFPVFDDVMPCLTSL
FT                   KDKGYELALMSNTTNSLMKYHLLKMNNIFDYVLTSDETKCYKPNLEFFRLAEIKFDLIN
FT                   KDHTHIAKGYWWDIVELE"
FT   gap             809587..809786
FT                   /estimated_length=200
FT   CDS             809797..810438
FT                   /transl_table=11
FT                   /locus_tag="EC1_08610"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88443"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE21"
FT                   /protein_id="CBK88443.1"
FT                   /translation="MINRYQLSQELNQPLSNWALPWQKHTANIYEVTQKDKQKGAFDKD
FT                   TSIMNVDAVYTCEKNILIGVFTADCVGIFLVDETKPSICCIHSGWKGTVQAITDKCVKE
FT                   LIQNKIINPKTTKAFFSPSILFDSLEVGMEVIDQIKQLNFDVEPFIRYMPNQKAFIDNQ
FT                   GLNIQMLLNNGLNIDNIYPSKLDTKKELNDCFSFRNDKKTGEHFTYGYIK"
FT   CDS             complement(810444..810725)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88444"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE22"
FT                   /protein_id="CBK88444.1"
FT                   /translation="MCNKVVHLEPEEFIKILQKEQLSVYARVYVLDSGIAGLIYMCSDS
FT                   HNLYYLDRFVPAPNKQEDFDKISFYDVHKDLYRKINLDNYLRDINPIN"
FT   CDS             810875..811630
FT                   /transl_table=11
FT                   /locus_tag="EC1_08630"
FT                   /product="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88445"
FT                   /db_xref="GOA:D4JE23"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE23"
FT                   /protein_id="CBK88445.1"
FT                   /translation="MTKKKEARQIRIQKILLERTKVKISDLAKELNVTPETLRNDLNEM
FT                   ENLSLLVREHGYARVISSSFETPLTMRNRENPEDKRRITFRAFQEIKDGQIVYLDSGST
FT                   VLLGANALQMKKDITVVTNSIPLLTHCIAMNINTIVCGGFLFNTGARTYGHFAANIIDH
FT                   LHIDVAIMGTDGILDSNGFTTMNSNELSLKRHVMNQTKKLIAVCDGSKFYTSAPYIFCK
FT                   FKEFDMLITNKLTDEQRKMVQDIKEVVEV"
FT   CDS             complement(811627..812790)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08640"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88446"
FT                   /db_xref="GOA:D4JE24"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE24"
FT                   /protein_id="CBK88446.1"
FT                   /translation="MINLIVKRFVKNSEDTKNPDVRSAVGRLCGWIGILCNVFLFGIKF
FT                   VIGIIVNSVSIQADAINNLTDAGSNIIAIFSFYLSNKPADKDHPFGHERTETIASLFVG
FT                   LMIGFLGIEMAKESFGKILSPDTIDFRLVTVFILIISILVKLWMYLYNKSLSKKYESTM
FT                   LEATALDSISDVIGTSAVLVSTVISPFIGFNLDGYMGVIVSAIILYNAYGLIKEVVNSL
FT                   LGEAPDKTLVDDIVKEMMTDKRVLGVHDLIIHNYGPNKLFASAHVEVDSDCDIFDVHDH
FT                   IDNVEKEIKSKFNVEMSLHMDPVKVNDPLTDQYKEKLACAIEEIEPSWQFHDFRIVSGP
FT                   THVNLVFDLVIPYEEKRNEDQIKEEILNHLSSDRKVYLVMTLDHPFA"
FT   gap             813651..814037
FT                   /estimated_length=387
FT   CDS             complement(814304..814894)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08670"
FT                   /product="16S RNA G1207 methylase RsmC"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88447"
FT                   /db_xref="GOA:D4JE25"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE25"
FT                   /protein_id="CBK88447.1"
FT                   /translation="MSHYFINDEKVKDQPFTFSFQIKEKKFEFESNQGVFSKDKLDEGT
FT                   KILLNTVLEHESNPETVLDLGCGIGVIGIVLSSFWKTNMTMIDINARACELAKKNLERH
FT                   SIQATLKNDDGIKEGNFECILLNPPIRTGKKVIYSLFDQCLEHLNEDGRLWIVMRKQHG
FT                   AQSAVNYFEEKQANVERVARDKGYWIMKITKTR"
FT   CDS             complement(814891..815811)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08680"
FT                   /product="transketolase subunit B"
FT                   /function="transketolase subunit B"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88448"
FT                   /db_xref="GOA:D4JE26"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE26"
FT                   /protein_id="CBK88448.1"
FT                   /translation="MASIATRIAYGDALKELLQEDENIVVLDADLAGSTKSGEAKKVDP
FT                   SRHFDMGIAEGNMMSVAAGLAASGKIAFASTFAMFATGRGFEQIRNSIGYPRLNVKVCA
FT                   SHAGISVGEDGASHQCIEDINLMRGIPGMTVVVPCDYNEAKQAVRSIAYHDGPCYVRLG
FT                   RSGVEEVTPEGYQFELGKGVVLKEGTKVALVATGSMVQESLKASELLDFEPTVVNIHTI
FT                   KPIDKELIVELANSHDLIVTCEEHSIIGGLGSAVAEVMAEAGCPCKLARVGVQDVFGES
FT                   GKPKELFEAYGLDPQSIVNVVKNNL"
FT   CDS             complement(815814..816629)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08690"
FT                   /product="Transketolase, N-terminal subunit"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88449"
FT                   /db_xref="GOA:D4JE27"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE27"
FT                   /protein_id="CBK88449.1"
FT                   /translation="MKNIELEKHANSIRKSIVTEVFYAQSGHPGGSLGAADIITSLYFE
FT                   ELDINEDNLNSIDRDRFVLSKGHASPALYAAFAEKGWIEKEELKTFRHLGSRLQGHPSM
FT                   RALPGVDMSTGSLGQGISCAVGMALANKLDKNDHRIYTLCGDGECQEGQVWEAIMAAAH
FT                   HKLDNLCIIIDNNNLQIDGKVEDVMSIYPLNEKMKAFNCHVIEIDGHDFDQIRAAFKEA
FT                   RETKGQPTVIIAKTIKGKGVSFMENQAGWHGVAPNEEQYHAAIKELEAC"
FT   gap             816749..817590
FT                   /estimated_length=842
FT   CDS             complement(818202..818693)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08720"
FT                   /product="3-hexulose-6-phosphate synthase"
FT                   /function="3-hexulose-6-phosphate synthase"
FT                   /EC_number="4.1.2.43"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88450"
FT                   /db_xref="GOA:D4JE28"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE28"
FT                   /protein_id="CBK88450.1"
FT                   /translation="MKLQAALDTLTLDECLKLLEETKGYIDIAEVGTPFIIEEGMVPVR
FT                   AIKENFDNIEVLADAKIMDAGEFEADKCFEAGADIVTVLGVSNDETIEGCVRSAKKYGK
FT                   KIMVDMIAVKDLEQRTIEIDNMGVDYICVHTAFDVQASGKDPLEELKAVNKVIKMRKVL
FT                   "
FT   CDS             818851..819618
FT                   /transl_table=11
FT                   /locus_tag="EC1_08730"
FT                   /product="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88451"
FT                   /db_xref="GOA:D4JE29"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE29"
FT                   /protein_id="CBK88451.1"
FT                   /translation="MSKSSLSRQNKIYQAILSKGRIYVSELSKNFHVSSETIRKDLDIL
FT                   ERQGLILKKHGYAEIMNDYFQLPLNVKITEHALAKQAIAKKALEYIKDNSMIFLDPGST
FT                   TLALAKYLPLKKGLTIVTNSLAIAQLVSDMKHDLIFTGGRLQKKGKAFVGAFTANNIDA
FT                   IQIDTAFMGCDGFLNTDGPTTFSFEEVLIKQHVIKKASQKILLCDASKFEKTGTYTFAS
FT                   FKDYDVLITNPVSNKEKELVKDVKEVIYVNADQ"
FT   CDS             complement(819602..820549)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08740"
FT                   /product="Predicted dehydrogenases and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88452"
FT                   /db_xref="GOA:D4JE30"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE30"
FT                   /protein_id="CBK88452.1"
FT                   /translation="MINMVVYGLGKISRRVCNGCLGAKHMNLYGFVSRDFNKATTYKEE
FT                   YHAKKAYASIKDIYEDENVDVIYLCTPNYLHYEQIKEALENKKSVICEKPMVLGSFQLD
FT                   KLFELAKRNKVFLMEAHKTAFNPLLVKVKEMIQEGAIGDIYYIDAEYSHNILNDDPNFE
FT                   QWVFGQSGGASRDIGVYPACFSNYFAQSDIVSHYIVKSGYKDLPCDFFFQSLLEYENGI
FT                   KASIKSSWLYDKDHKGTGYIYGTKGYFKIPAYWKEKEAFLIQGDKTTKIMVDFYSDFTS
FT                   EIEHGAKCIESNCIESNIMSLHASKEILKAIGQH"
FT   gap             821434..821955
FT                   /estimated_length=522
FT   CDS             823190..823792
FT                   /transl_table=11
FT                   /locus_tag="EC1_08770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88453"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE31"
FT                   /protein_id="CBK88453.1"
FT                   /translation="MIKREKYIQKIRPFINKDLIKVLTGMRRSGKSVMLDLIKEELLSS
FT                   EVDPSQFISINFENMNNTHLCDAVSLHNEIIKLSASIKGKTYLFFDEIQEVKNWEKCIN
FT                   SLRIELDCDIYITGSNANLLSSELATYLAGRYVEFVIYPFSFSEFIELYNTIHPGMTNQ
FT                   RLFNEYLMYGGMPYLANLNYNKEAVNRYLLDLFNSVE"
FT   gap             824341..825366
FT                   /estimated_length=1026
FT   gap             825436..825436
FT                   /estimated_length=1
FT   CDS             complement(825836..826426)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08800"
FT                   /product="Tfp pilus assembly protein, pilus retraction
FT                   ATPase PilT"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88454"
FT                   /db_xref="GOA:D4JE32"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE32"
FT                   /protein_id="CBK88454.1"
FT                   /translation="MDVKKILEQAVKMDASDIFFVAGSPYAFKIKKEIIKQDDVRLMPE
FT                   DLKDIVQQLYSFAPYCRYENFQENGEDDYSFSLANIGRFRVNVYRQRNSEAAVLRVVKF
FT                   ELPDPKKLSIPDVVLDLADQKKGMILISGPAGSGKSTTLACIIDRINSTRNAHIITIED
FT                   PIEYLHSHKKSIVSQREVYHDTKGYLPALRAAL"
FT   CDS             complement(826428..826802)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88455"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE33"
FT                   /protein_id="CBK88455.1"
FT                   /translation="MNKKRNIKPGTGIATILLIFVVLAMTIMAALSYVRTWQDDQSLQR
FT                   EYAYKQAYYKADAKAKYICDEIMQLKDVEEISTQNQVDIQFEENIYSFQIEIRSNQVLE
FT                   VQMDQDGNILEWMTKTKEEM"
FT   CDS             complement(826795..827154)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88456"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE34"
FT                   /protein_id="CBK88456.1"
FT                   /translation="MRKIETSKPFAFFLELLLVIFFFAISATIILQVYASAIQKNQFDH
FT                   DRRKAMLFAQNVIEGNQDLNTIQKEYDQNFEDEGDYFQVEIVESNEDFPHYTLCIWQDE
FT                   QLLVEYSLYTGEDYE"
FT   CDS             complement(827147..827599)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88457"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE35"
FT                   /protein_id="CBK88457.1"
FT                   /translation="MNQLKNVYIFFSLSLLFIFAGCSFFLLNSQLIGTQKLEDKIAQDS
FT                   KLYTPIAYLTQKIHSYDSQGQVTTETIDGIQCLVLSDDQTKTYIYQKEDFLQELYVLST
FT                   SEVDLDSGQKMMSCDSFEVQIEENVVEMKVQDQSFEVSLRSGDLYA"
FT   CDS             complement(827596..827904)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88458"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE36"
FT                   /protein_id="CBK88458.1"
FT                   /translation="MLQKLSRFTSLVLFLGALLILWFGLIDADHINIVQDKERIEDSIV
FT                   KAMVECYSVEGFYPSNLDYLKEHYGLILNEDLYFISYEYEGENLMPNIYVYRKGEDV"
FT   gap             828377..828706
FT                   /estimated_length=330
FT   CDS             complement(829046..829942)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08870"
FT                   /product="Transglutaminase-like enzymes, putative cysteine
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88459"
FT                   /db_xref="GOA:D4JE37"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE37"
FT                   /protein_id="CBK88459.1"
FT                   /translation="MMKWKKLLLSLSLCIFVTGCSSSQEYPTEYPESPAQQVSEILWPQ
FT                   SPGVDVLTDSRYAMVDMSNVSQGYVTARLLSSASKIKLQISKDDKKYNYDLTSMEYTAF
FT                   PLQMGNGIYTIKILSQIEGTKYAVVASTQKEVTIQDEFSVYLYPNQVVNYGPDSIVVNK
FT                   SFELTKDDKDDLTRIYHLFEYTVDVLDYDYEKADYVSDTYVLPNLTQAIENGSGICFDY
FT                   ASLLAALCRIQGIPARVIVGWTDIEYHAWVEIYLENEGWINPKVYFAKNDWSLVDPTFS
FT                   DSGNADYTGKYEEVYHY"
FT   gap             831593..832077
FT                   /estimated_length=485
FT   gap             835988..838017
FT                   /estimated_length=2030
FT   CDS             complement(839248..840960)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88460"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE38"
FT                   /protein_id="CBK88460.1"
FT                   /translation="MMKHLKRFVAITISMVMAFQFCTNDFYLYAETEPADPGQTQVTNE
FT                   PESGPSDSTGEAAEETPPSDIGTPEPSAPVEEQPAAPVEEQPAPPVEEQPEVASTLKVE
FT                   FVDVNNASVKETVEQALKSKYVKETINLDELEIDINVEGYTLTEVKDKNDNTQFYTTET
FT                   KDFVLTGNVTELQFVYEKIPDESNDSESENAKTNEDLNSIQKNHQELSVNILSTEQMIS
FT                   VKINRAGTEEDGQIAAGNITEETAPKYDGYTFVNATVGNDVIQYVGQYNDRVYYSIDGE
FT                   TGMLLEKGQDIVLNYEVTVNTYPVTYIINDETLGTVQKGADKVREGESTTFRVTPNYGN
FT                   TIESVTVNENPIDGKVVDKSTNATDYVINNVTGDQEVKINFKKTESFQFTYDNGDIRQG
FT                   NITSPESGFTFQNGETFSFTLKSKEYGELPDGGGKGGEWHLNQLNINGYYINLPTSFDN
FT                   SALNKPVSTDLPNGVVVEVEMTERNKDGHGYNFTYEVTITGAKENIEVTSGNFKLGGRY
FT                   EIIIKELGGIEAIYYGEGNKHNNWKEKYINDVMSDDDEVHSTYDFRFTLVTWL"
FT   CDS             complement(841021..841137)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88461"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE39"
FT                   /protein_id="CBK88461.1"
FT                   /translation="MKTIIMCMAIDPFFAILAIGQFISYLGFIIFWVNMQLK"
FT   CDS             complement(841256..842161)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08940"
FT                   /product="Membrane protease subunits, stomatin/prohibitin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88462"
FT                   /db_xref="GOA:D4JE40"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE40"
FT                   /protein_id="CBK88462.1"
FT                   /translation="MFILIIAIIVVIGFILFYTIRIVPQTEEYIIEFLGKYKTTWSAGI
FT                   HFLIPFFERVVCKATSKEQCADFEPQSVITKDNVSIYVDTVVYFKIFDSKLFAYGAANP
FT                   LFALENLAATTLRNLIGDMTLDEALTSRDTINIKLKEILDEATDPWGINVSRVELKNID
FT                   PPAEIKNAMEKQMKAEREKREKILQAEAFQESEIKKADGEAKAMVKRAEAKRDADIAIA
FT                   QGKAKAIEMTYEAEAKGLEKLKDAQANSTVVQLKSFEALQKLADGKATKIIVPTSVAES
FT                   TTKQSIFAEMLKTPIEEDVK"
FT   CDS             complement(842176..842412)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88463"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE41"
FT                   /protein_id="CBK88463.1"
FT                   /translation="MNLNGESSKNKKTILNGKPLYGYDQAKKKNYFRHIQIHNKLTKQW
FT                   RNNPGKLSKVQISNIVIRAVIIMFIILFVLSFL"
FT   CDS             842550..843104
FT                   /transl_table=11
FT                   /locus_tag="EC1_08960"
FT                   /product="Methyltransferase domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88464"
FT                   /db_xref="GOA:D4JE42"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE42"
FT                   /protein_id="CBK88464.1"
FT                   /translation="MMMIHFFNKYRQMFRSQKGLDGAGEWYELKKILPDFKEKHVLDLG
FT                   CGYGWHCKYAAEHKAKSVVGVDISEKMLKVAQEKNQDDKITYIHSAIEDFDTDPESYDA
FT                   IISSLAFHYIKDYDRLINNIYKWLKPNGEFVFSVEHPIFTSYGNQDWYYDKKGEILHFP
FT                   VDNYYYEGQRQAIFLGEEVIQ"
FT   CDS             complement(843094..843345)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08970"
FT                   /product="LSU ribosomal protein L19P"
FT                   /function="LSU ribosomal protein L19P"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88465"
FT                   /db_xref="GOA:D4JE43"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE43"
FT                   /protein_id="CBK88465.1"
FT                   /translation="MNLNLVNEITKSQLKTDIPEFRSGSTVRVHVKIIEGGKSRIQVFE
FT                   GVVIERTGGGIAESFTVRKISNQIGVERKFPLHSPIIE"
FT   CDS             complement(843448..844167)
FT                   /transl_table=11
FT                   /locus_tag="EC1_08980"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /function="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /EC_number="2.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_08980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88466"
FT                   /db_xref="GOA:D4JE44"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE44"
FT                   /protein_id="CBK88466.1"
FT                   /translation="MKISILTLFPEYFEPLWNTSIIKRAKEKDLFEYEVIDFRKFTQEK
FT                   HGHVDDTPYGGGAGMVLMCQPILDALKSIRTEDSTVILLTPQGQTFKQSRAKELSLKDH
FT                   LIFICGHYEGFDERIRDYVDIQMSLGDFVLTGGESACVVMCDAILRLLPGVIRQDSWQD
FT                   DSFSKGLLEYPQYTKPVEYDGKRVPDVLLSGHHANIAKWRHQKALENTYYHRKDLLNEY
FT                   PLTKEDKDFLDSLLPKE"
FT   CDS             complement(844693..844941)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09000"
FT                   /product="RNA-binding protein (KH domain)"
FT                   /function="RNA-binding protein (KH domain)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88467"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE45"
FT                   /protein_id="CBK88467.1"
FT                   /translation="MVDLEKTLLDLCTPLVDDKNSLSVKTMSSTNENEVLLYVYANSED
FT                   VARLIGRKGSMASSIRQMMSIAARETHKRVSVKFEAY"
FT   CDS             complement(844941..845045)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88468"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE46"
FT                   /protein_id="CBK88468.1"
FT                   /translation="MKWLNNGAKPTDTVRAILSKEGIMKEFHEAKMSK"
FT   CDS             845176..845988
FT                   /transl_table=11
FT                   /locus_tag="EC1_09020"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88469"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE47"
FT                   /protein_id="CBK88469.1"
FT                   /translation="MTYKIGFDIGSTTIKAVVLDENQQICYKSYERHKAQVRQKALEKI
FT                   KELERYTKEPFQFAISGSGALGLCDDGKLPFVQEVFASATAIRKYYPDTDCAIELGGED
FT                   AKILFFKGSIEQRMNSTCAGGTGAFIDQMASLLDVDLETMNEVSLKHDKIYPIASRCGV
FT                   FAKTDVQPLINQGVSKSNLSASIFQAVVDQTITSLAQGRNIEGNVLFLGGPLYFLSGLR
FT                   DRFQETLKLRDDQITCPDTAINFVALGAALCADKMFTRDELVSILEDL"
FT   CDS             845957..848101
FT                   /transl_table=11
FT                   /locus_tag="EC1_09030"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88470"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE48"
FT                   /protein_id="CBK88470.1"
FT                   /translation="MNLFLYLKIFRTHHPARKVQGLCEDKADYETFKARHHQSDAKYAD
FT                   LSLYTGKAYLGVDSGSTTTKLVLLNEDHEILYESYTSNKGDPLAVVRADLMKIYETNPN
FT                   IRIYGSYATGYGEELMRHAFHLDGGIVETIAHYTAACLFNPEVDYILDIGGQDIKCFKI
FT                   RDGRIDDIVLNEACSSGCGSFIETFAKSLGYDVETFAQLGLKSKNPVELGTRCTVFMNS
FT                   GVKQAQKNGATIEDISAGLCKSVVKNALYKVIRAKNKKDIGEHIVVQGGTFQNDAVLRS
FT                   FEQELGLEVIRPSIAHLMGAFGAALYAQKLHRTRSSILNYEQLKNFTHKSVSTTCQGCT
FT                   NHCALTINTFSDGSRLVAGNKCEKMIIHDQKEKLEIPDLFKEKASMMQKVQKNISHAKK
FT                   IGMPLVLNNYDLLPFWTNFFDVLGYEVVWSTPSTLDMYHDGQHTIPSDTACFPAKLVHG
FT                   HIKQLVDQELPLIFYPCMTYNLDENQSDNHYNCPLVAYYPEVIAANMDLNNTKFLYPFI
FT                   SFDNEKNFVEKMIKSFETVDIHFNKNDVKIAFRTAMNKYRDFHEELVQKHIDAVKFARE
FT                   HNLQIAVLCGRPYHLDPLVNHQINQLLTTLGFVVVSEESVPRQPAHKVNILNQWTYHAR
FT                   LYQAAHYVCENPDMNLIQLVSFGCGIDAITTDEVKTILKEGHKFYTQIKIDEIDNQGAV
FT                   KIRLRSLQSALAQNKGGQHG"
FT   gap             849250..849714
FT                   /estimated_length=465
FT   CDS             849727..850491
FT                   /transl_table=11
FT                   /locus_tag="EC1_09050"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88471"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE49"
FT                   /protein_id="CBK88471.1"
FT                   /translation="MELLYAYTYFIVYAFLGWVCEDIYCGIGKRKFINRGFLYGPYCPI
FT                   YGFGALLVIYPLLMVSKHPIVVFIFGMVLTSILEYITSFVMEKLFATRWWDYSTYPFNI
FT                   NGRICLQNSLLFGLMALVVVYGLHPIVSRFVERIPLGFLVIFLIMFTIFFVIDIVNTVI
FT                   VLLRRKKVFLKLKEDIDELRAQFESDRDILNEEFERWINDHKELDVVRKRIQKRVEMID
FT                   ELRKKHIVRAFPDRKLSDQLNQLQDIVKKLTK"
FT   CDS             850557..853181
FT                   /transl_table=11
FT                   /locus_tag="EC1_09060"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88472"
FT                   /db_xref="GOA:D4JE50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE50"
FT                   /protein_id="CBK88472.1"
FT                   /translation="MYNNNIFELEVNILLECKNLVKDYQTSNEVVHALKGVSVTFRDNE
FT                   FVSILGQSGCGKTTFLNIIGGLDHYTSGDLIINGKSTKDYSDKDWDTYRNHRVGFVFQS
FT                   YNLIMHQSVLSNVELALTLTGVGKEERRQRAIEVLEKVGLKDQLDKKPTQMSGGQMQRV
FT                   AIARALVNNPDILLADEPTGALDSVTSVQIMDLLQEIAKDRLVIMVTHNPDLAKQYSTR
FT                   IIRLLDGEIQSDSDPVSEQEKIDVSQENLAKPSMSFKTALSLSLNNLMTKKGRTFLTSF
FT                   AGSIGIIGIALILSLSNGVQTYINTVENDTMASYPIEIQDNSMDMSAMMSAMMEMHSDE
FT                   SVNDTDNITSRPYVNDILNSLSSEESNNLTAFKEYLDSKEGKEFVKNTKAIEYDYSITP
FT                   LIYNDNGDKGLIQVSPNGLLERLGFSDMMSLQNQFMSSSTTMANNEVWTKLPTSSVLRD
FT                   EEYELVNGEWANDYNEVVLAVDENNQITDYALYSLGLMDQDELVNNYNQLLNGNIEKIE
FT                   TSDTVSYTPEEILNMSFKLVLPSDLYRESNGVWIDQSDDEKFVQNVVDNALEVKVVGII
FT                   KPKDSSVKRMTMGGVMYTDDMQDYIIEQSSQSEIAKQQIENPNTNVFTGQSFDEQDELS
FT                   LSNLTDEQRMMMASMSESELMQYMASYNENVNATYESNLSKIGVVDTDSPTAISIYASS
FT                   FEQKELISDMINDYNEEQKSNGEMADVITYNDFIGMMLESVSTVINMISYVLIGFVSVS
FT                   LIVSSIMIGIITYISVLERTKEIGILRAIGASKKDISRVFNAETFIEGLISGVLGIVIT
FT                   LILNFPISTIVEHYTGVANIAILPWQGGIILVLISLLLTIIAGLIPSKYASKKDPVEAL
FT                   RSE"
FT   gap             854163..854306
FT                   /estimated_length=144
FT   gap             855586..856297
FT                   /estimated_length=712
FT   CDS             856307..856627
FT                   /transl_table=11
FT                   /locus_tag="EC1_09100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88473"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE51"
FT                   /protein_id="CBK88473.1"
FT                   /translation="MPSLFEPCGLSQLCSLRYGTLPLVRETGGLKDTVNAYNEYDKTGN
FT                   GFSFEKYDSNDLIHTLYYAIDVYYNRKQDWDMLVTNALNSDVSWQNSAKTYCLLYDELL
FT                   NQ"
FT   CDS             857116..857382
FT                   /transl_table=11
FT                   /locus_tag="EC1_09130"
FT                   /product="Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88474"
FT                   /db_xref="GOA:D4JE52"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE52"
FT                   /protein_id="CBK88474.1"
FT                   /translation="MKQVTVTVIDPVGLHARPATVAVNAASKFKSEINVAFKGREVNMK
FT                   SIMGVMSLGIPTQSEITISCTGEDEEAAVAAIEEVLRAQKIIA"
FT   CDS             857567..857947
FT                   /transl_table=11
FT                   /locus_tag="EC1_09140"
FT                   /product="Phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88475"
FT                   /db_xref="GOA:D4JE53"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE53"
FT                   /protein_id="CBK88475.1"
FT                   /translation="MSLTQERYEKWVNHPNLDARYKDVLENMNEEEKNDAFYTLIEFGT
FT                   AGMRGLLGPGTNRINIHTIRKATQGYANYIIAAGKEACEKGIAIGYDNRHMSRELAFDC
FT                   ADLLAKIIFDLMYSNHYDLHQN"
FT   CDS             857986..859266
FT                   /transl_table=11
FT                   /locus_tag="EC1_09150"
FT                   /product="alpha-phosphoglucomutase"
FT                   /function="alpha-phosphoglucomutase"
FT                   /EC_number="5.4.2.8"
FT                   /EC_number="5.4.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88476"
FT                   /db_xref="GOA:D4JE54"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE54"
FT                   /protein_id="CBK88476.1"
FT                   /translation="MITASHNPKEYNGYKLYDDKGCQLIPSLAAQVIDQVNAIEDELAI
FT                   DANCTEEQKKLITVIGKDVDEEYYKNVLSIQLNPDVNKDIKIVFSPEHGTANIPVQEVY
FT                   KRAGYTCIPVEEQCTPDPDFSNTPTPNPEQPGAYELALEYAKKNDADLILVCDPDADRM
FT                   GVGVKHNGEYVVLTGNQSGSVEIEYICSQLTKQNKMPENPVMFNTVVTSDLGEKVAADY
FT                   GVTTEKTLTGFKFIGEKVAKYEVTHEKNYVFGYEESYGSLIKPFVRDKDAPQACLMLAE
FT                   ACAYYKQEGKDLVDVLDSLYDRHGTYEESQVALTLSGEAGANRIKEILANLRKDSPAEI
FT                   GGTKVVKSEDYKECVIKEGDKVTELTGFTKSDVLKYYLEDGSWIAVRPSGTEPKCKFYY
FT                   CIKGASKEDAHNKTVHFQQAMKELTQS"
FT   CDS             complement(859331..859630)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09160"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88477"
FT                   /db_xref="GOA:D4JE55"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE55"
FT                   /protein_id="CBK88477.1"
FT                   /translation="MKNDYLNRRNLLVNRLNRMGLKTNMPHGTFYVFPNVQITGLSSDE
FT                   FCEKLLEEEKVACVPGTAFGESGEGFIRISYAYSLDHIKEACDRIEHFISSRIK"
FT   gap             860213..860625
FT                   /estimated_length=413
FT   CDS             complement(860654..860779)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88478"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE56"
FT                   /protein_id="CBK88478.1"
FT                   /translation="MNQSKLLDLLESDARLTSQDLADILNEDKDEVAKEIKKIRR"
FT   CDS             860964..861626
FT                   /transl_table=11
FT                   /locus_tag="EC1_09190"
FT                   /product="Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88479"
FT                   /db_xref="GOA:D4JE57"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE57"
FT                   /protein_id="CBK88479.1"
FT                   /translation="MTVKVAINGFGRIGRLAFRQMFGAEGYEVVAINDLTSPKMLAHLL
FT                   KYDSTQGTYAKADTVTAGENSITVDGKEITIYAEADASKLPWGDLGVDVVLECTGFYTS
FT                   KAKAEAHIKAGARKVVISAPAGNDLPTIVYNVNHETLTPEDTVISAASCTTNCLAPMAN
FT                   ALNKLAPIQSGIMTTVHAYTGDQMTLDGPQRKGDLRRSRAAAVNIVPNSTGAAKAIV"
FT   CDS             862092..862265
FT                   /transl_table=11
FT                   /locus_tag="EC1_09210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88480"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE58"
FT                   /protein_id="CBK88480.1"
FT                   /translation="MAIKTRLIDEDRDNLTKDVNDLDAAYLERMKEDGIDPELLAQFRD
FT                   LSLEMDEQTQIK"
FT   gap             862798..864736
FT                   /estimated_length=1939
FT   CDS             864809..865354
FT                   /transl_table=11
FT                   /locus_tag="EC1_09230"
FT                   /product="transcription antitermination protein nusG"
FT                   /function="transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88481"
FT                   /db_xref="GOA:D4JE59"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE59"
FT                   /protein_id="CBK88481.1"
FT                   /translation="MAELKKEWYVVNTYAGQENRVKENLERRVKTMGLEDSLFQIVVAE
FT                   EKEIEYKNGKPVEKTKNLFSGYVLVQMIMTDEAWYVVRNTPGVTGFIGSSGKGAKPFPV
FT                   SQEEIDSVLRRLGRQDMSVQVDFEVGDTVEILNGAFKNSEGTVEKMDDDKKEATVLLIL
FT                   FGRETPTDIPYMDLKKVD"
FT   CDS             865378..865860
FT                   /transl_table=11
FT                   /locus_tag="EC1_09240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88482"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023215"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE60"
FT                   /protein_id="CBK88482.1"
FT                   /translation="MKTVVLDLDGTMYRGSQIIQSAKEFIDYCLENKIPFIFLTNNAMR
FT                   TRAQNVKHMLDMGYSGISSEQFFNSAMAACAYAKKQYSIKRAVYLGKDGLKEAMELSSI
FT                   EYDPKHPQAVFVGLNKEATYQEYSQYLAYLLKGAKLIGTNKDRILASPKGFEISLN"
FT   CDS             complement(865795..866520)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09250"
FT                   /product="Alcohol dehydrogenase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88483"
FT                   /db_xref="GOA:D4JE61"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE61"
FT                   /protein_id="CBK88483.1"
FT                   /translation="MSNYNFFCPTRVLFGQGSLNEFHKQPMPGKKALLVISNGQSTIKN
FT                   GSLERVKKELAAANCEYVLFNEVAANPLKSTVEKGAQVARQENCDFVVALGGGSVMDAA
FT                   KVMAMFIPQPSNDLWDYAGGKTGKLKSLDKEPLPWIAITTSAGTGSEVDTAGVITNPDT
FT                   NEKIGVGGPDSLFAKFAIVDPELMKTVPPKFTAYQGFDALFHSLEGYISCVHNPMSDLV
FT                   QRYFKSFWACQDTIFICTY"
FT   CDS             complement(866536..867015)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09260"
FT                   /product="Flavodoxins"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88484"
FT                   /db_xref="GOA:D4JE62"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE62"
FT                   /protein_id="CBK88484.1"
FT                   /translation="MSNILVAYFSASGTTEKVAQKLASQIHADLFKIQPKQAYTRADLN
FT                   WNDSHSRSTLEMKDPNSRPEILNKVEKMEQYNAVFVGFPIWWYREPSIIDTFIESYDLT
FT                   NKTIIPFATSGGSGMGKSSTYIQKLAPKSKVTQGKRLSFSITDEELNTWASSMIK"
FT   CDS             867142..867588
FT                   /transl_table=11
FT                   /locus_tag="EC1_09270"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88485"
FT                   /db_xref="GOA:D4JE63"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE63"
FT                   /protein_id="CBK88485.1"
FT                   /translation="MLYTVGEMARFLNVSASTLRYYDKEGLLPFVERSNSGIRMFSDKD
FT                   YEWLKIIECLKKSGLSIKEVRSYIDMTKRGDDSLEERLQLFEERKKDVERQMKELQETL
FT                   DLLKYKCWYYEMAIQDQSEERVRSLSVEELPEEYKKIKNHIQSM"
FT   CDS             867641..868273
FT                   /transl_table=11
FT                   /locus_tag="EC1_09280"
FT                   /product="thymidylate kinase"
FT                   /function="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88486"
FT                   /db_xref="GOA:D4JE64"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE64"
FT                   /protein_id="CBK88486.1"
FT                   /translation="MKQGVFLTFEGNDGSGKTTVCKAICEELKKLGYDVVYTREPGGSK
FT                   IAESIRNILLDVENTGMDPRTEALLYAASRRQHLKDRVLPALKNKSIVLCDRFVDSSLA
FT                   YQGYARDLGMQEVYDINQFAIDGCMPIKTFFLSVSIETGQKRMDLRGDKNRLDLEQSDF
FT                   HKKVREGYAKLIEMYPERICVIDAEPELKVVVKNTLNEVMKVIHEYE"
FT   gap             868316..870330
FT                   /estimated_length=2015
FT   gap             871087..871106
FT                   /estimated_length=20
FT   CDS             872641..874275
FT                   /transl_table=11
FT                   /locus_tag="EC1_09310"
FT                   /product="ABC-type oligopeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88487"
FT                   /db_xref="GOA:D4JE65"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE65"
FT                   /protein_id="CBK88487.1"
FT                   /translation="MKKLKLLVASALTASMLVGCGSNQLEGKTYTYSAELDIKNLDSSD
FT                   ADDGMSFSAMHACIDGLMGLDEEGNIVPAIAEEHTVSEDGLTHTFKLRDAQWSNGDEVT
FT                   ANDFVYAWQRIIENSGNYAYMLGSDGAKVKGADELMAKQAELGEGEELTQDDLNTLQAV
FT                   AVDDKTFQVTLTSPVSYFEELMTFPCYYPINQKFCEEKGAEYAKSAENVLSNGAFIMET
FT                   WEPGRQATFSKNENYWNADAVNLDNLVLNLVQEPEVAATAFDNGETQFALINSELVDKY
FT                   KDSESYKSIKEGYLFYLQLNFGNSDLQNLNLRKALSYAINREDFVNNVLKDGSTAATGF
FT                   VPSGLSTSPSGTDFRSDAGSYTSYDLEQAQQYLDAAKEELGKDTISLRLLYGTDESPMD
FT                   QLATYLQDAFSQLDGLEIEMVATTKQDRIYTKQANQDFDIACTRWGPDYGDPTTYLNLC
FT                   ISDNTNNYGKWSNTEYDSIMDQAAVETDVNARWQLMIDAEKIMMDDLCYIPVFEKGSST
FT                   LQDTSVTGLVQKPVGVPYTFNYVDIAE"
FT   CDS             874352..875299
FT                   /transl_table=11
FT                   /locus_tag="EC1_09320"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88488"
FT                   /db_xref="GOA:D4JE66"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE66"
FT                   /protein_id="CBK88488.1"
FT                   /translation="MNKSTLKYIGKRLIISAITLFVILVVLFLMVRFLPGSPINNEKLS
FT                   AAQRAVIEAKYGLDKPLFTQFVIYVKDMLTGNFGVSMNLYKDMPVASLVGNAAKISFLY
FT                   GLAAVIIGTIIGMALGVFAALHRNSIWDTLATALSVIGVSIPSFVFALLILIFFASYLR
FT                   ILPTAYSSSQPIYSSIMPVAALSTGVIANVSRFTRTEMIEVLDSDYMILAKAKGLDRKT
FT                   LIFSHALRNALIPVITILGPILVNLMTGTMVVELLCSVPGLGKLLVNSILSSDYNIILA
FT                   CAFLYAAMYIIMMLVIDIAYGIIDPRIRLGKDEG"
FT   CDS             875299..876225
FT                   /transl_table=11
FT                   /locus_tag="EC1_09330"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88489"
FT                   /db_xref="GOA:D4JE67"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE67"
FT                   /protein_id="CBK88489.1"
FT                   /translation="MEDNKFLPNDFEFVGDKRDITIDEVIPTTSAWKDAVKRFCRNKGA
FT                   VVAVILILIITLFAILAPMFSSWDYAEINTSLKNIAPNGEHLFGTDSYGRDLWTRLWYG
FT                   TRISLFVAVAAIIIDVVIGVTYGLISGYFGGKVDSIMQRIQEIINSIPTLVVLIILLMF
FT                   MKPSLGTIIIALAFTEWIGMSRITRAQVLKVKEEEYVLASRTLGAKDFFIIFKEILPNI
FT                   YSQMIIMVMMSIPNAIFYEAYLSFIGLGLPIPEASLGTLINDGYKSFLVYPYIMLIPVA
FT                   IFSLLMLCFNLFGDGLRDALDPTMKER"
FT   gap             876272..876956
FT                   /estimated_length=685
FT   CDS             complement(877067..877828)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09360"
FT                   /product="Transcriptional regulators of sugar metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88490"
FT                   /db_xref="GOA:D4JE68"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE68"
FT                   /protein_id="CBK88490.1"
FT                   /translation="MFVEERQALIYEELQSNGRVRVKDLSKKFNVSEDLIRKDLNVLEK
FT                   EGKLRKIYGGAVLAKENVQRKLASQRKNINLDAKKNIAKKAINIIEPGDIIFLDISTSS
FT                   IEMAKLLINEQKPMTVITNMLEVINILVSSNINVIFIGGELDYGHDGFVGSLTNQMIDG
FT                   FRFDKAFLGVVGVDINDNSVMTYMPADAQTKKLVLSHSKETYMLCESEKFNQIGNYQYA
FT                   KIDDFYGLICDKDLSLGLHKELKQYDIKVIE"
FT   CDS             complement(878149..878196)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88491"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE69"
FT                   /protein_id="CBK88491.1"
FT                   /translation="MIHSLVLVIIMSVMK"
FT   CDS             complement(878523..878885)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09390"
FT                   /product="Predicted branched-chain amino acid permease
FT                   (azaleucine resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88492"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE70"
FT                   /protein_id="CBK88492.1"
FT                   /translation="MNKDLIKYAFMQTLPIMAGYLVLGMGFGILLYDHGYSVLWAILMS
FT                   ITIYAGSMQYVAIDLISSGASILTTLLMTLMVNARHLFYGISMVDKYKDTKPYKPYLIY
FT                   ALTDETYSLVCDASYS"
FT   CDS             878997..879326
FT                   /transl_table=11
FT                   /locus_tag="EC1_09400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88493"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE71"
FT                   /protein_id="CBK88493.1"
FT                   /translation="MKFIKQYKEALSMELREHRSSFLVYMVLRLLVILVLILQIFNQNW
FT                   ENVFYALLTLLLLIVPSVVQMTFKIELPITLEIIILLFIFAAEILGEIDDFYLKYSNWD
FT                   TMLHT"
FT   CDS             879323..879814
FT                   /transl_table=11
FT                   /locus_tag="EC1_09410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88494"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE72"
FT                   /protein_id="CBK88494.1"
FT                   /translation="MNGFLSAAIGYSLVDILNKSKKVKFELSPIFICIVAFSFSMTIGV
FT                   IWEFFEFSMDTFFAMDTQKDTIIHTINSVSIDPSGAMTSISDIKNVMIDGQALNINGYL
FT                   DIGLIDTMEDLFVNFIGAIIFSIFGFFYTKNQDKKNIAALFVPRQKSKERDYLEIVQKK
FT                   "
FT   CDS             complement(880498..880983)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09430"
FT                   /product="Domain of Unknown Function (DUF349)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88495"
FT                   /db_xref="InterPro:IPR007139"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE73"
FT                   /protein_id="CBK88495.1"
FT                   /translation="MYEDNDNLYLVSDMDEDIKKRKELIEEAKNINADKNWNEIYRQIS
FT                   DLRRKWRRISSWESAYEDSLNEEFESYIDALYAKRNEVYKNASGIKEELIAQAKKVAAS
FT                   NDLKHATEEMNELMNQWKQAGSAGKDDDALWESFNQIRQSFFDKKHEQWEQMQTKVL"
FT   CDS             complement(881512..881850)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09450"
FT                   /product="Uncharacterized homolog of
FT                   gamma-carboxymuconolactone decarboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88496"
FT                   /db_xref="GOA:D4JE74"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE74"
FT                   /protein_id="CBK88496.1"
FT                   /translation="MAKITQTAGRNALGTFAPEFAHFNDDVLFGENWNNEDIDLKTRSI
FT                   ITVVALMAQGITDSSLKFHLQNAKDHGVTQKEIAAIITHIAFYAGWPKGWAVFNLAKEV
FT                   WNEEEIEK"
FT   CDS             complement(881875..882297)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09460"
FT                   /product="Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88497"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE75"
FT                   /protein_id="CBK88497.1"
FT                   /translation="MDIEQMKKDLGGGNVFPIGEENVAFAKYFTGECYLNMLTTERVPV
FT                   GLVTFAPKTINAYHVHHKGGQILMVTGGRGWYQEEGKPARELKAGDVVNIPPEVKHWHG
FT                   AAKDSWFQHLAVEVPAEGASNEWLEFLPEEEYNKLP"
FT   CDS             complement(882584..882967)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88498"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE76"
FT                   /protein_id="CBK88498.1"
FT                   /translation="MSKYDKMLELNKRKSEEKVERAVLTIRTMVLEREKVSVPVLMQKT
FT                   GLSRGFFYKNPIVRGEIDAAMEQQAGMVDPRRNIISQAMEAEMNLLRQQLQKLKSENEN
FT                   LIKENQKLKKALSKKELNLIKQI"
FT   CDS             complement(882933..884450)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09480"
FT                   /product="Phage integrase family."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88499"
FT                   /db_xref="GOA:D4JE77"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE77"
FT                   /protein_id="CBK88499.1"
FT                   /translation="MDNKLKFQQLECYKLATDEQKEKLNKEQYFDLDKLPGNQLQTEFV
FT                   EYIYYRGTQVSILTIKRERHYFNSLCEFFQKSSHQENSLLDREKDFWIKQLKMWMIQNG
FT                   RALTKHKVTNIQTESVEKAALIRYFESLLEFTLDRSETNELAKDIWHLERLPLILRTNP
FT                   IVNHKTLNFRGIRQPDIREEVKKAIYHHLKTEALGSIKRELSAMNKFSKYLDEKHSKIS
FT                   TCEEIDREIIEQFLINIKVESNGGNGIRDDLLKLRNVLETIGKIYDFPHLTKLFLKSDF
FT                   PPERKAEFKSYSDSELKRLNAQIVKMEEQIARAMIIHQMLGTRISDTLTLRKDCLYKHD
FT                   RQDMIIIYQPKTRRYEKPISRELAQLIGKAVSYANEHYPESIYIFADENKPERPISYQT
FT                   LQDKVLRMIYEKDIRDDSGKLFGFGTHMFRHCYGVKLTELHVDDWTIAKLLGHKGVKSV
FT                   QYYRKMSNQRLADETREVRNLMSQIILANLDGWGEEYEQIRQDAGIE"
FT   CDS             complement(884443..886194)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09490"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88500"
FT                   /db_xref="GOA:D4JE78"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE78"
FT                   /protein_id="CBK88500.1"
FT                   /translation="MPAFLQSFIEAEQERSRRIEQLRKEIREFAKEEAGSSITEQILLF
FT                   LADEMVEHLSEIDYELRMKFELYITPLIKRNYIYRYTGTFDRIRQAYIRERMKTPAGQR
FT                   ECEWKYKNEILFVPYHSDPVIVKSVETVRCRSNMVWNFKAAASEKLKRQIFTVLEYILE
FT                   NYEISRLREYKLTGLQLFYEFCIREQITDIQLLELEQETAFQDYLKQKVEKEQRRKRLK
FT                   SIVETARKVIFIETDETRWDATIWYLERFRIAKERINQSDSIEKISFQEVLQPKNRLLL
FT                   QEYMKYEIGIGELALSTVYERFRTIRNFLQEISELEVTKCDTSLIDVYLKNLQNGAMGA
FT                   KTFNTNVSGIQFFMKFLEVKGYIKKVPFYASYYLEKQIPVHHDRSVEEDVYMEIIQNLS
FT                   QFPEHLRMMFLHLWCVGLRISEVCTLKGDAYYIQNGDCWMKVYQVKMKNYKRVPIPVTL
FT                   YRLMQVYLKKHPTEKEAYIFRNRKGGAFSKSTFMGQMKKYCSQIGIQNGEYIFKSHDYR
FT                   HTVATNFYEHGVSIQSIRDYLGHTFEEMTMQYIDYMPRKIAKENDAYFEEEENSLLACM
FT                   QKGEKHG"
FT   CDS             complement(886207..887325)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09500"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88501"
FT                   /db_xref="GOA:D4JE79"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE79"
FT                   /protein_id="CBK88501.1"
FT                   /translation="MRRYELETEREGSTVYFFIRDVETLDIVLLPTKYLMHKIRRKCSP
FT                   NTVRRSALAILYYLEYIHEKKKELTDVYQMPYVEQTNHFVEFLYWLKAGKHTRDKNHRS
FT                   PNNGTCNAYLRDVFRFYLFIEEEYQQFGELKVLSYNYFVAVDAVGVKKSIRSKSFKGYL
FT                   KEEEHKARAAKKDEIVEILKACTNIRDRLLMLLLAETGYRIGEILGIDYSKDIDYQNHI
FT                   IRVYFREDNENGARAKNAEYRSAKISKDTFGFLNLYIAEYRKLLQHQTSLFVNISGDNI
FT                   GKPMNVEAVYSMLKRMDKKTGIKITPHMLRHYFGNERRKAGWSLELIQLAYGHRHIQTT
FT                   INYLDIVDDELLDASQEFYEKHSSLYGIEELL"
FT   CDS             complement(887495..889471)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09510"
FT                   /product="Rad3-related DNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88502"
FT                   /db_xref="GOA:D4JE80"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE80"
FT                   /protein_id="CBK88502.1"
FT                   /translation="MCYKNEYQKRAHGEVEQIFRELLPKAGLHVREEQIRLCHEMLDAL
FT                   MKNEITLCDAGVGIGKTYAYLTACILMRKYSVLHSGYSGCDRRSVVVSTSSIALQKAII
FT                   EEYVPFLSDVLLKADLLQGELKAVVRKGKEHFVCDYRLAQRLEAVRDKNKNQAQMEALK
FT                   SLRHNFDLDSVHNLSGFDRRLVCVPKFCPRECPGKAGCRYQKHLDISRKEDIFLQICNH
FT                   NYLLADAMHRANGYRPLLADYRALVVDEAHKLPEAASQMYGRSIGREDVQEIAYFLVRE
FT                   HKGTDGKRLLEGVSALQMEIRKHRKDGIEDMAGKESFYFPPGAGTALAQMQERLQLMIK
FT                   RLAGNIPYWTFRRLEEMEELFGWFLKNDKRYILFLQQDSRGHLTFMAVNREIPKYLDAT
FT                   LWSRGFPAILTSGTLKAGNGFARTRQMTGLEKETGVRECVAESPFCYQENCLLYIPEHL
FT                   KPRKKGSREEAEQLAGQICDLVCSTYGHTLVLFTSYTLMGNVQQLLRDQIPFPMVQVWR
FT                   NSQEEIARFKKMENAVLFAAGSCWEGVDFPGDMVSSLIIVKLPFSVPDPIHEAQREQYR
FT                   SLKSYIQTIVVPDMQKKLRQGFGRAIRTEQDTCVVSILDHRATKKGRYRSDVLEALPKC
FT                   QMAERIEEVEDFIRSRKVERYYS"
FT   gap             889951..890168
FT                   /estimated_length=218
FT   CDS             complement(890942..891436)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88503"
FT                   /db_xref="InterPro:IPR024559"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE81"
FT                   /protein_id="CBK88503.1"
FT                   /translation="MDEKEGSEMQEEMMTVLVVEPMKAPYVKNIPNELEDLQQAVGGDI
FT                   EMTYPFDDKVGILLNGNGKFEGLPLNRALYDDHGQVYDAIAGTFLVVGLTEDDFTSLTP
FT                   GQIEKFKEKYQSPEIFTLFNGELHVMKMPPEEAKKQKESRKNDEKQKNPAKKKNRSGDA
FT                   R"
FT   CDS             complement(892206..892925)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09570"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88504"
FT                   /db_xref="GOA:D4JE82"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE82"
FT                   /protein_id="CBK88504.1"
FT                   /translation="MKDTKYKILAYFDNQSYRKLFNEINSDYAENLQILLHNLSLFSYD
FT                   VLIIGVILYKENISNIISAIRKITQIPIIILTDASSLLCMSWKKELIYAGADCVMDINS
FT                   TIEEVDLQIFSLARRNNKQKITQKQSETMINKGKLVMDHKKHKVFWNNVALHLTRQEYN
FT                   FLYLLAVTPMRVYTFEQIYQLVWKDYSVGDIKNIIWCLVKRLRKKLNVVEDGAGNCIVS
FT                   VRDIGYKFELNNENEQQ"
FT   CDS             complement(892956..893372)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09580"
FT                   /product="Mn-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88505"
FT                   /db_xref="GOA:D4JE83"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE83"
FT                   /protein_id="CBK88505.1"
FT                   /translation="MKLHTAGEDYLEAVLILQKKLGMVRSVDVARYMEVSKPSVCYAVG
FT                   TLREGGFLTTDENHYIHLTDLGWDVAEKIYERHCFFTHQLISVGVNPQIAEVDACRMEH
FT                   AVSDESFQKLKEHAMREIASQKIDNTFDDFPVKK"
FT   CDS             complement(893391..895139)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09590"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88506"
FT                   /db_xref="GOA:D4JE84"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE84"
FT                   /protein_id="CBK88506.1"
FT                   /translation="MFALFSRILKLSDHYKSRIQGAFVCAFLESILSKMPIFLAFVVLS
FT                   GFANKTITGQTCLYVGLGLAAIVLVQMLVHYLSDSLQSAAGYLMFADKRIELGGHLRKL
FT                   PMGYFTSGNIGKISSVLSTDMVFIEEVAMSTLGNMMSYLLSSLVLLAFMFYLNWQIGLI
FT                   AAIVTILAWLVSKGMNKVSLREAAGRQEQSERLTDAVLSFVEGIGVIKSYNLLGEKSEE
FT                   LSGNFKRSRNTSLDFERKMTPWTMGLNILYGIGIAAIFGLSIVLEQSGALSLAYVLGVL
FT                   LFVFDLFGPLKALYGEASRLTVMNAALDRIEAVLDEPELSDNGKQHIPAQAQPGQPEVL
FT                   FNDVTFAYQDKEVLHHISFAMKKNSMTALVGPSGSGKSTIANLLARLWDVKSGNVTIRG
FT                   VDIRNVPLSELMNQISMVFQRVYLFQDTIYNNIIMGKPDATEEEIYEAARKARCYDFIM
FT                   ALPDGFQTVVGEGGATLSGGEKQRISIARCILKDAPIVILDEATASVDTDNESYIQEAI
FT                   SELVKGKTLLVIAHRLNTIQNADQILVIDNGQIAQQGTHEELLKQPGIYQDFVNIRKSA
FT                   AGWSLA"
FT   CDS             complement(895140..896924)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09600"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88507"
FT                   /db_xref="GOA:D4JE85"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE85"
FT                   /protein_id="CBK88507.1"
FT                   /translation="MFKKIFEYAGPYKKNMYVATVVVLVSVLMGILPFVLAYQVISPLV
FT                   MGDSVETEFVLLRVIGVLICLVLQAFFYGWGLSISHKAAYNTLFRLRVSLQKKFEKLPL
FT                   GIVEEKGTGTIKKLFVDDVDSLELLLAHSVPEGIANLLIPLVIYVAMFCADWKLALMSL
FT                   ASIPISLLSMVIMYSVGMKRMGPYYQSAQKMNNTIIEYINGMEVVKVFNKDADSYERFR
FT                   KDVSDYRDYTLAWYKAAWPWMAIYSSLLPCTIILTLPVGAWFVLSGWSTLPNLILVLCL
FT                   SLSIGMPLLKSLGFLPTMPQLNYKISALEQVLDAPELQQTEDAFHGKDDTITYDHVSFA
FT                   YQTTQPGPDGKPVVIEDEVLHDISFTAKAGQKTALVGESGSGKSTLAKLLIHYYDPQKG
FT                   SISIGGQKLCDMSLEALNSRISYVAQDQYLFNTSLLENIRLGRLNATDEEVVEAAKKAQ
FT                   CMEFLEKLPQGIHSMAGDAGKMLSGGQHQRISLARAILKDAPIVVLDEATAYADPENEE
FT                   KMEAAIAELVKGKTLVVIAHKLPAIMNADQICVMDHGKLVATGKHQELIQSCPEYQKLW
FT                   KAAQDSAEWKVHTAKEGK"
FT   CDS             complement(897929..898516)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09620"
FT                   /product="ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88508"
FT                   /db_xref="GOA:D4JE86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE86"
FT                   /protein_id="CBK88508.1"
FT                   /translation="MIDFQNVSFSYGEESSGGGIRNVNLTINTGEFVLLTGESGCGKTT
FT                   ITRLVNGLVPHYYEGNLEGNVLLDGKSVSDTPLYDLAAMVGSVFQNPKSQFFNVDTDSE
FT                   LAFACENLGYPQEDILKRIDRTVSDYHIEDLMGRSVFALSGGEKQKIACASSSVLLPGI
FT                   MVLDEPSSNLDMAAIDDLRQVLSLWKSRAKQF"
FT   CDS             complement(898513..899265)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09630"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88509"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE87"
FT                   /protein_id="CBK88509.1"
FT                   /translation="MAREILLSKKTEQGLRLDPRTKLLLIFIISIFVMGGTGGEAMGLI
FT                   RLVLCVVPAILLLTSKQCAKAVGYIAVFSVFYAVQIYVLPHFTGILNFLVLFTTGFFCR
FT                   ILPSVAIAAYAVKTTTVSELISGMERIHMPKEVTIPLTVMFRFFPTVFQESEAISDAMK
FT                   MRGIKLGGKKSSKILEYKLIPMITCSVKIGEELSAAAITRGLGAPVKRTNICQLKFNFA
FT                   DVVLILFCCFVVFWAIASPIISAGGILP"
FT   CDS             complement(899265..899861)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09640"
FT                   /product="conserved hypothetical integral membrane protein
FT                   TIGR02185"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88510"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE88"
FT                   /protein_id="CBK88510.1"
FT                   /translation="MSSQKKSSRLEGKDLITIGIYTVIYVVIVMLVAMLGFIPIFIPLM
FT                   AVLCPLIGGIPYMLYVTKAKKFGMTAIMGFLIGLIMVFFGNGYLTMVTGLVGGLLADVI
FT                   LKKADYKSAKSTVLSCGVFSIWVFGNFAPIFLNRESYMVMLTEGYGAEYAATLNTYMPM
FT                   WIAPILLVACFVFGLVGGMIGKAICKKHFQRAGIA"
FT   CDS             complement(899992..900957)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09650"
FT                   /product="transcriptional regulator, AraC family"
FT                   /function="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88511"
FT                   /db_xref="GOA:D4JE89"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE89"
FT                   /protein_id="CBK88511.1"
FT                   /translation="MTNQYMTKLYHDLLSNSPQTVTIDIPADMGTGQISQVVTKQGAVV
FT                   SDWKMNYFSDMNVQGVSSEEYIQMLFCFNDGVSWNIADSRQSISIQKGESCIYRGHGKM
FT                   EYLCYSKQNDFLFKNVKVPLSYFRKIMNDYFDVGEIEVYQKKLLEGISKVGITPYMEHI
FT                   FAELKDFTQYRGGLGYLFLESKVFELLSVYLSEILELSILASTYIAISRSDRESIIEAK
FT                   RIIDSQLALAPSCEELARKVNISTSKLSKGFSSLFGTSVHAYIIDQRLEKAASLLLESN
FT                   LNVSQVAAFVGYSKPSNFASAFKKKYGVIPKNYKTENTIG"
FT   CDS             complement(901073..903016)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09660"
FT                   /product="CHAP domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88512"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE90"
FT                   /protein_id="CBK88512.1"
FT                   /translation="MKDIKTKEVTTKPKTKNPASRIPKELMRTAILESKEKSQAIANAR
FT                   DNDMGEQSPSEYASGKVASAEEWAARKTGRTVTRAGKTAAQTSYEKIKQRAAGKKEVEK
FT                   EAEKETARGTGDTQTADPASREAPEQKSREVQIQNAQRQKAVSDAVKTKEQKIRAARET
FT                   PRIQNGQEMSEGGSLSIKRQNQKSKAGDTARQNAIRQKQPETIRIKEKPRKQLEPKTIQ
FT                   RRTIKTASPSVKISIQPEQKLRVASSNALTARMQKQMERRAAKQAAKKAALQTSDGVRR
FT                   IQKTARAGENTFKAAKAAVEAAAKTVQSMMAALGAAGAVMVLLLVIMVGIIGGAAFSGS
FT                   SESNEALSQEVLSYTATIQKYANQYGILEYVSVIQAIMMQESGGRGTDPMQSSECPYNT
FT                   RYSNSPNAIQDADYSIHVGIQYYADCLKEAGCTSPQDMDKLKLSLQGYNYGNGYITWAL
FT                   RNYGGYSAENALQFSNDQAASHGWSAYGDPEYVPHVLRYYSSGGLFAGLFGGNGQIVSV
FT                   ALTQLGNEGGQKFWSWYGFDSHVAWCACFASWCGDQAGLIESGKMPKFSLCDDGIAWFQ
FT                   GKGKWKSRGYSPAPGTLIFFDWNGDGTSDHVGIVEKIEGSTVYTVEGNSSDAVNKRSYD
FT                   INNGTIMGYGIL"
FT   CDS             complement(903048..905384)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88513"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE91"
FT                   /protein_id="CBK88513.1"
FT                   /translation="MPLIKTLSQTLKQDKEKFKVPKSVQQAIPIRKIWPDGIFQVESKY
FT                   SRTFRFTDINYSIASKADKTEMFLDYSELLNALDSGCTAKITLNNRKINKEEFEQSLLI
FT                   PMKGDGLDEYRKEYNDMLLSKISGTNNSIYQERYLTISVHKKNIDEARTYFARVGTDII
FT                   THLAKLSSIGEELDAEQRLQIFRDFFKADVPQSFSFDMKAFAKKGHSFKDWICPDTMEF
FT                   HNDHFKLGEQYGRVLFMEDYASYVKDEMISELCSLGRNLMLSIDIIPVPTDEAVREIQN
FT                   RLLGVETNVTNWQRRQNANNNFSAVVPYDMELQRKETKEMLDDLTTRDQRMMFGILTMV
FT                   HMADSKKQLDSDTETLYSIARKHLCQMATLKWQQVDGLNTVLPYGLRKIDAVRTLTTES
FT                   TAVLIPFHTQEIMQPGGIYYGQNAVSKNMLVADRRKLLNGNSFRLGVSGSGKSFSAKEE
FT                   IVDLALSTEDDILILDPESEFASLVEALNGEVIRISATSDTHLNALDMDSAYGNDRNPL
FT                   VEKSEFILSLFEQLVGAGNLSAKEKSILDRCTADVYRDYMRGGYKGQVPTLKNLYRQLM
FT                   LQPEEEARGLALSSELFINGSLNTFAQETNVNTKSRIIDYDIRELGEQLMPLGMLVTLD
FT                   SIFNRVIQNWKKGKTTWIFADEFYLLFRYEYSADFFYRLYKRIRKYSGFVTGLTQNVEE
FT                   LLKSDTARLMLANSEFLILLNQATTDRDELAALLNISDNQLSYITNVGAGHGLIRCSGN
FT                   LVPFENSFPRNTKLYRLMTTKPGEG"
FT   CDS             complement(905371..905805)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88514"
FT                   /db_xref="InterPro:IPR024414"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE92"
FT                   /protein_id="CBK88514.1"
FT                   /translation="MEVKMNKEIRDYQESMFWGLSFRQCLFSVLAILAALGIYFVTRKY
FT                   AGEQVTGWLCILGAAPFAACGFFRYHGMTAEQFAWVVIKSELLYPKRLVFKSENLYFSC
FT                   MEESLRLGEKMMGNGAELLEKKRTKQKKPKKRRGRGDAFD"
FT   CDS             complement(905814..906251)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88515"
FT                   /db_xref="InterPro:IPR025462"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE93"
FT                   /protein_id="CBK88515.1"
FT                   /translation="MEEPKTLSYDWQYGREELFLRVDSYMSDDNLYIGLYHMEDGYPES
FT                   FADLTVNLPFAPLGGINEAYIDHNFSKEKLRFIKQHKLGTIQPDTASSGYCIFQRVAFD
FT                   LKKLAELDPEGTKRFMERNGIRQRDVPKQKQKKKQRLQRER"
FT   CDS             complement(907178..907552)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88516"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE94"
FT                   /protein_id="CBK88516.1"
FT                   /translation="MGGMPMNLLKNKKHTEIRKETAPLKMKRGQKKLFALYAVTVLSIC
FT                   IGATCVYAAGDPLTVVNNLSTFIFSLIRAIGLILLGFGIVQVGLSLKSHDPSQRANGFL
FT                   TLAGGIIITFAKEILDLIMG"
FT   CDS             complement(909309..909560)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88517"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE95"
FT                   /protein_id="CBK88517.1"
FT                   /translation="MTQERIEAMRRRYPPGTEVTLNSMEGESHMPPGLKGKVDMVDDAG
FT                   QIHVNWENGSSLALVPGVDSFHITDLPRAERPKQQPSR"
FT   CDS             complement(909591..909905)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88518"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE96"
FT                   /protein_id="CBK88518.1"
FT                   /translation="MTRMRYVKMDRIMNHMLIHALREVFRQEKEQGLPVDTTRDLVLKL
FT                   AEQEEGKLYLTEAEHSKSVEALNQLRDTYLKNGRYSDGIDSVLLKIMKSRYRPYRGRGR
FT                   "
FT   CDS             complement(910002..910940)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88519"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE97"
FT                   /protein_id="CBK88519.1"
FT                   /translation="MDLTKFLGQDTQEQSTQRLSKEEYAAQKKQEREEIWGMIDGKAQE
FT                   VFQNGDSLKGFLDFMGQCKPQRTDNLFLLYAQNPEIRQVKTFEKWKEEGKVVKTGSKGY
FT                   NFIVGQEYEKDGVIQQGYSIQKAYDISQIRTKQPEEAEPKPMDQLMEALLTDSEVRIQI
FT                   ADHLPDKVQAQYIPNKRTIYVRNGMSENATFHSISRELACASLDHHDGSYSRAGVSAQA
FT                   YCAAYVTAQKYGVDVSGFSFDKVCQMQAFGQKDPKELRSFIQDVKSAAYSIGKQVDRNL
FT                   GKSEQEFMTDEFAIPEEKTEKPAKSKKSPER"
FT   CDS             complement(910944..911783)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88520"
FT                   /db_xref="InterPro:IPR024234"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE98"
FT                   /protein_id="CBK88520.1"
FT                   /translation="MNYGGDAADQIVRYSLDGVDHGLRLSGTLAKHLAVFVAAVLKDQK
FT                   KTRGRTRMVRMLKENKPLKFFTVPSDRLREFCSEGRKRGLLYVIIRDKKNPEMSEVMVF
FT                   ADDAAKVNRVMDKMNLDFVRSEVGEAVHEVTEGMEAPETEAVQETVQMPEGEVQFEISD
FT                   LDEAFQVGDMDFSEGEKNQNHDGKEFSEPENFIPVQEEGEENLSGSSLHSRNISTGQEN
FT                   GTDGAKPREQERPSVRRELENIKREKAEESQKKSREKNRGPKKTQKKARNKRKVKAR"
FT   CDS             complement(911789..913087)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09770"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88521"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D4JE99"
FT                   /protein_id="CBK88521.1"
FT                   /translation="MAYTSIIPVSRLDNSITYIRNKDKTTKKGQSAGSLEEAIDYAMNR
FT                   DKTERSVFEDAIGCVCETAYQDMVATKKRYHKMDGVQGYHLVQSFVKGEVTPELAHQIG
FT                   MEMAERLLQGKYEAVITTHLNTEHYHNHIVFNSVSMEDGKKYHSNSRSYYEDVRKASDA
FT                   LCLKYGLSVIEPKNGKGKSYAQWMAEQDGKPTWRTSIRLDIRDAVAESFTWKQFLEQMK
FT                   QRGYQWKLNRKYIALKAPGMERYIRLRSLGKHYSEESIRQWILQPKSRIPVGKEKTSQP
FT                   PKKKLKGIQALYYSYLYQMGVLKQKPKRISPVLRVDIRKLDARIEQMEFLQKHQITTRE
FT                   EMMAYRTPLEEQVQALIKERRRLYRSEPDSDRISQITEELKPLRKDIRICVRIEQQSKE
FT                   MEERMHLAEQIHRQAEQEEEQTEKTRQQRTESR"
FT   CDS             complement(913091..913441)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09780"
FT                   /product="Bacterial mobilisation protein
FT                   (MobC)./Ribbon-helix-helix protein, copG family."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88522"
FT                   /db_xref="GOA:D4JEA0"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEA0"
FT                   /protein_id="CBK88522.1"
FT                   /translation="MEQQPITRWKAGEEMRKRNHVIPVRLNAKELRFLEEQVEKSGLSR
FT                   EEYIRSIVMGGEVRARPCEHHTELLRKISGLCNNANQLAHVANGCGMAGEESIREMLRM
FT                   TKETWRLVKEEW"
FT   CDS             complement(913441..913521)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88523"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEA1"
FT                   /protein_id="CBK88523.1"
FT                   /translation="MKKKIIAAAVAIGVLAGFLIWKNREM"
FT   CDS             complement(913529..913906)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88524"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEA2"
FT                   /protein_id="CBK88524.1"
FT                   /translation="MLGFILGTMTGGVMGIFAMCLFIAGKREDEALERCRMKRKEIIDH
FT                   GVCICFVNSQGEELFRLADGESLVQNAPNGERNVSTCHYLNADSAMIDGKKWNLLEFAK
FT                   EMEKRGIMFAPMVLCQVSERG"
FT   CDS             complement(914049..914516)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88525"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEA3"
FT                   /protein_id="CBK88525.1"
FT                   /translation="MSGRHLKKRRKESRCPQDIHRAECFVGVSFWKNAGQRKPVRPGKE
FT                   MVVLEQALAYVCCSAEEGKTKVQRYCRKIYELGYVPICPQYSFSPFLDDGDAEDMQAMR
FT                   RMSHQILRRCRMVVVCGKETTGTMNTEISMADRLHIICTTLDGLSKIKENE"
FT   CDS             complement(914748..915332)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09830"
FT                   /product="DNA modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88526"
FT                   /db_xref="GOA:D4JEA4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEA4"
FT                   /protein_id="CBK88526.1"
FT                   /translation="MGNTLKLEDLLKPDCVPDESAGGENWRILHGDTLKLVKGFQPGIF
FT                   DAVITDPPYASGGTKQNERNRTTNQKYSSMKAENALPDFDGDNKDQRSWTHWMAEWLYD
FT                   VRKACKRGAPICLFIDWRQYPSITDALQWAGWIWRGTAVWDKGTPVRRKADSASRQNIL
FT                   YGEATDRCRSTARCPAFRVCSVMGIPRTASM"
FT   CDS             complement(916177..917148)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88527"
FT                   /db_xref="GOA:D4JEA5"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR025054"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEA5"
FT                   /protein_id="CBK88527.1"
FT                   /translation="MPWIPEEEIKRAREITAIEYLKKYQPNRLKKSSARNEWELTDHDS
FT                   FKINEQTSQWHWKSRDIGGTSALNFLIHVDGCSFLEAVQMLKDEYPTYIPPPVEAKPKK
FT                   PFVLPTASPDCRRVFRYLKERGISGEVLQRCVHLGILYESLPYHNAVFIGRDENQVARY
FT                   AFLRGIYDASGKSFKMEQAGSEKAYAFCVPAKSGCRRVAVYEACVDVLAHMTLEQRQGS
FT                   RDKYRLELGGISAPKEGQSQRSMKKPQALEHFLSQHPEITEIEVCTDNDFAGRWACEHI
FT                   RKAYEGSYRIIENLPEIEGADWADMAKMAARTPEKRQNREAR"
FT   CDS             complement(918555..919358)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09870"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88528"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEA6"
FT                   /protein_id="CBK88528.1"
FT                   /translation="MKKKPKTGILQRFFKIICLAVTLTSAGFLIYHMVYLPMENKKLVA
FT                   ELKGNFPEPEAPGASGSEKKEQPAGRKCPVAAVDLVSLREQYPDVQGWLTIPDTGIDYP
FT                   VLQSEQENGEFYLKRNYKKEYDINGSLFLQADCKVSESRNLIIYGHNMNSGAMFGNLDL
FT                   YTDETYYQEHPFAYLQTEDSIQEYRIVTVLKADRNLFPFQQKLPDVAAVQEYLKAAKQR
FT                   EVFETGDDYLKCIYDKVLTLVTCSYEWSGARNIVLAVPVSGAVWS"
FT   CDS             complement(919854..926279)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09890"
FT                   /product="Cna protein B-type domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88529"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR008970"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEA7"
FT                   /protein_id="CBK88529.1"
FT                   /translation="MRDNRIMRTDRPGGNIRLFLCKMKKKKKEVENMKSKYRFRRILSG
FT                   VMAAVTILSTVISPLTVYASEEPKAAEPPAYESVKDQLDENEVVKATDLELEVGQDFDV
FT                   STDFTNLEIKDESKVKVTFQKAENDAGENFSTSHADTYHAVYYVEPVNQNHPVYQIGRN
FT                   LIVKEPVTAAQSEPQTEQAVTEEDTGSDDEEAASQEETETVPVETEIVEPETAESETEE
FT                   PEETEPEFQGGLSESEFDAALEEAETENTTDKESGLTLSDVLEQAGEQDIDLMAMEDGE
FT                   TVSFTAVNTSTRATQDVDVTRGTAYYYADYGLGSYVTYKYTVKFGNVSATAYCVQPSKA
FT                   GPGDGVYKITKLGDSKALAKVCYYGTKASGENGFFSEKHPDFSAGKQFIIVHLAASYAN
FT                   NSSDAFSGTNATGQALAMELYNYCMSQPEIPEVDMSFSNADVTAYISGNIQRTEEITFK
FT                   ASELQTITMKLPSGVKLHNVTTGKTSSAGASVEICGGTKFYLSAPLTQAVDVKGEWSVT
FT                   MKGSIIKDYSAYKITTGSETQDLALVFGEGVTDEKYVDFKVSWVKQATLEIVKKDRKSN
FT                   KAIAGAVYGVYSDKDGKNLITKMPATDANGASSVTITKTQDTVYLKEISVPNGYLLDTK
FT                   AYDVKLVIGDTVKQTVTDAEQMASLTVYKLGEVLTGAKVTDDGVSFVYTEQRQKGAVYN
FT                   VYAAADIVSADGTVIYKKDALVKAGLTTGDDGSATLDNLYLGKYVVKEMQAPQNLVCTG
FT                   ESQEITLSYAGSNVEKVMGSVTFKNARQKASVSVYKQDKETKKYLPGGTYGLYAGNDIK
FT                   AADGTVVVKKDTLIEKAVTGTDGKAVYQADLPIANSYYMKEVAAPAGYTRNSEDVYSFT
FT                   FQYTTDKEATVSFSHTFQNERVNAKIKLVKEDSETGKTAQGDATLEGAVYGLYAREDIV
FT                   HPDGQTGVLYPAGTQIATLTTDAEGNAEVADLYLGKYYVKELTPPLGYLADPEEHDLEC
FT                   NDEGDLVQTVERTATSLEDVIKQPFQVIKAANNGKTDADLLKGVGFRAYLESSLKKNKD
FT                   GSYDFASATPVVLTADGQTEMFTDERGYACSIPLAYGTYIVRETTTPHNFKPVDDFKVV
FT                   ISENHPDQPQVWRVLLDEEFEAKLKIVKKDDETKKSVLVPNTEFKVYDLDNQKYVEQVT
FT                   TYPSTTVHKSYFTDENGYLILPQNLACGNYRIEEVTAPDGYTHSINTVEIKVDSDTAYQ
FT                   EDPVSGDLIIEVDFENHPAKGRLTIRKEGEVVKGFDKDFTYEEASLAGAVFEVYAAEDI
FT                   YTADHQKDENGNRYLEYAKDTLVATVTTDETGSAVVENLPLGKYRVEEKKAPEGYTWNA
FT                   KGEEVTFIYAGQDTPVVDEEVTFTNERQKVSITVEKQDVETGSTVAGAAFGLYNKNEIK
FT                   SGDKVIVKADTLLQEITSDEKGQAHFTLDLPLGTYYVKEISAPDGFVSSDEVLEFDATY
FT                   QGQDIPTIKLKSVKKNQPTTIEVTKSDLTTGVELNGASLSVLDKDGNVIDSWTSVKDEP
FT                   HVIKYLTVGKTYILRESLAPLGYLKTTDVEFTVQDTAEVQKVEMKDDVPKALLIVNKKG
FT                   EFLDKISLLDNVKGVVEHLFEYITGSLSDVTFEIYAAEDIKAADGVSPDYYSKDELVAT
FT                   VTTDANGIAEVSDLPVGKYYVKEVGTAYGYVLDDEPRYVDLSYRDQDTPVVVYDEDWQN
FT                   NRQKVKVNVLKKEKDTDRVLKGGIFGLYTRNDILSASGKVLMEADTLIELKTTDADGKI
FT                   SFIADLPIDGTYYVKELYAPDGFVTTGEEQEFVFEYQGDKEAEASYEFVFEDEPTTVEL
FT                   SKTDLTTGEELPGARLQLTDENGAVVEEWTSTKEPHIIKELVVGKSYTLTENKPADGYA
FT                   TAESITFTVENTAEIQKQVMEDDVTKVEISKTDITGDNEIEGAKLTITDENGNIVETWT
FT                   SGKEPHYIEKLPIGKYILKEEQAPNGYVVAEEITFEVADTAEIQKVAMKDDTAKGRLII
FT                   EKTDKDTGAALKDAEFELRDADGKVVETLTTDENGHATSGLLAIGTYKDGKFDKTATYY
FT                   LVETKAPEGYQLDEIKHEVTFTYVDDKTPVIEVIQKVTNEKLPEDTPSASNPKTGDDTN
FT                   LWIPALCLILSAGGLIGMSVASRRKKKKGGR"
FT   gap             927771..928129
FT                   /estimated_length=359
FT   CDS             complement(928970..929542)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88530"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEA8"
FT                   /protein_id="CBK88530.1"
FT                   /translation="MEMKNICGKIPVELHEKLKLEVEELGISIPKYLEMVIEEHMTRKG
FT                   EKTNMADLRTVAVQVTEDLFSRLKAVLARNGMKQKDFLIGLIEDAIEKEEAKWKAESEE
FT                   AEETEMEDPETAKSEPDEESVEPEAEEPETEALEAETDGEMTEPDEAEADEEPTEPENE
FT                   EPAEAEPTELETEEAEESEPEEAESEE"
FT   CDS             complement(930008..930853)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09950"
FT                   /product="plasmid segregation actin-type ATPase ParM"
FT                   /function="plasmid segregation actin-type ATPase ParM"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88531"
FT                   /db_xref="InterPro:IPR009440"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEA9"
FT                   /protein_id="CBK88531.1"
FT                   /translation="MQNVLQYNGKFYVCGTGRQTLVRSKTSNDNYYLLTMAAIAQEIRY
FT                   RRGERKTDVVLAAGLPLASFGREKKGFREYLFRKEQSLRFRYEDESYEIRIQDVKLFPQ
FT                   GYSALALHPECVRDEPSVLLADIGGWTVDLMRLDNSVPNAATCRSLELGVIRCVDEITE
FT                   QVRRNTGLSVTDIQIERVLNGQSCSMDPAAKEIIVRQGRLYTEKILSAIMEAGFDLKAI
FT                   PSVIMGGGASILKRHVTPQDGLCRQIYLTDVHANASGYERIVGQMCRSKETRFLVPPEP
FT                   "
FT   CDS             complement(931207..931986)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88532"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEB0"
FT                   /protein_id="CBK88532.1"
FT                   /translation="MDLKEFYFQNIKESEYHYRFLESVKKVNYTYNIFYGEEETQNYQF
FT                   EIYDVEEAITKFKELCQPDVDFSGENKCWFYLITYYLHMLGYEIKEFPRILARPPVDPT
FT                   DFTYRDIRNRIIALGGDDNGTVRYATRRTFVADLTFEQKSCNIEVNDSINQKFIEISTR
FT                   QASFNSMHIDEKIAEIANLIENLLKQDGKFITPEYEDVCCGFIDDTIVKNYRKKMQCFR
FT                   HCTDEAIEERKTYSEEQKNFLVDYGLTMVKAIHELVK"
FT   CDS             complement(932000..932770)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88533"
FT                   /db_xref="GOA:D4JEB1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEB1"
FT                   /protein_id="CBK88533.1"
FT                   /translation="MTEQQYKDLLIATAKMSDYEHKDEVVEALKVASVSFQKEWAFTYH
FT                   LPDHRQEYIIISVVPDKLIVLKEHEDFVDDLCKQVYEPNDYNEYSGLVLKPGILNIAPE
FT                   EVSQEILFDDIQNRIIDEIREAKFSIWIAMAWFTNKKIFDELLKKRNEGLDVKIIIDNN
FT                   RVNKEKPSFTLEDHFEVYRVDVMSERYKNIMHRKFCVIDLEVAMHGTFNWTNAANYNKE
FT                   HWDVDHNRETAKTFAEEFVKMRRDAELSMLWLDF"
FT   CDS             complement(932887..933237)
FT                   /transl_table=11
FT                   /locus_tag="EC1_09980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88534"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEB2"
FT                   /protein_id="CBK88534.1"
FT                   /translation="MEQAKIEQLAFLYLCSEHDKRLLLKKEKMPLADFDRLTYLIYHLG
FT                   FKEYHIKVWMEFAGDFQKEWDCLEALQETGGCVGNIDSTESEVKLHEMWIQDFCKSTPK
FT                   EIGEWIQDLDYK"
FT   CDS             933369..933620
FT                   /transl_table=11
FT                   /locus_tag="EC1_09990"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_09990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88535"
FT                   /db_xref="GOA:D4JEB3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEB3"
FT                   /protein_id="CBK88535.1"
FT                   /translation="MPKPRTQSGEKNLISQRLIELRKTHNMSQRDLAYKLQLAGYDMDK
FT                   NVITRIETNKRYVTDLELKAIAEIFQVSYIFLIDGKDE"
FT   CDS             complement(933675..934283)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88536"
FT                   /db_xref="InterPro:IPR024271"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEB4"
FT                   /protein_id="CBK88536.1"
FT                   /translation="MTIQPDIIWNEQCLGIRIGEQVCTYLKKHDAEYQRLQNKILELTE
FT                   RYPVIETFMESNQAISLTTEEHKAVHQYFRLESEKEMIEEQYHFYMGQAQMISYGAMLG
FT                   KIKKAILGNDDGDTKKLLELLLDTWIDEVEDQLKENTVYQGMLEKISKYEEQVQTMGLS
FT                   KEKRKTIDKYVTEVSERWILYAESLYQAGMQKILELLNL"
FT   CDS             complement(934556..934747)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88537"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEB5"
FT                   /protein_id="CBK88537.1"
FT                   /translation="MKTMDKKVFDEQNVFGLGQPNDAFAQYFIGNSYLNGLTNPKECGL
FT                   ALANVTFEPGCSKLDYVA"
FT   CDS             complement(934763..935305)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10020"
FT                   /product="Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88538"
FT                   /db_xref="GOA:D4JEB6"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEB6"
FT                   /protein_id="CBK88538.1"
FT                   /translation="MSKNILIISTSLRFNSNSDLLAQSFEKGALEAGHLVERVTLRDKT
FT                   IQFCKGCLSCVKTQKCVIHDDVNEIVEKMKEANVLVFSTPIYYYEMCGQMKTLLDRANP
FT                   LFNADYKFRDIYFIASAAENGDHVWAKAVNGLEGWIDCFEKSHLSGVVFAGGVTDPGEI
FT                   QGHQSLKRAFEMGKNIR"
FT   CDS             935428..936303
FT                   /transl_table=11
FT                   /locus_tag="EC1_10030"
FT                   /product="transcriptional regulator, LysR family"
FT                   /function="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88539"
FT                   /db_xref="GOA:D4JEB7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEB7"
FT                   /protein_id="CBK88539.1"
FT                   /translation="MELRVLKYFQEVAKEQNITKAAENLHITQPTLSRQLKSLEEELGQ
FT                   QLFVRSSHNIQLTNEGKLLSKRTADILNMVDKTTNEFKAMHDFTGGYVDLGCAESKGIT
FT                   YIAKTAKNLLKEYPNIQLNMYSGNATSVCDQLDKGLLDFAVIVQDLDISKYNSINIPFH
FT                   DRWGLIMRKDSPFVSKKSIHLDDLYDIPLLVSRQRGYNKMAHWLNQNESRLNIVATFDL
FT                   IYNAAILVKENVGYALGFDNLVNTSLESVLCFRPIEPEMQANMYLIWKKNQILSKSATL
FT                   FLEQLQNQMK"
FT   CDS             complement(936601..938307)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10040"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88540"
FT                   /db_xref="GOA:D4JEB8"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEB8"
FT                   /protein_id="CBK88540.1"
FT                   /translation="MNRYGKRCVLYPRVSTEMQVDGYSLEGQKNMLTRFADREEMIVVD
FT                   TYEDAGKSGKSIEGRPAFQKMLRDIEDGLDIDYILVYKLSRFGRNAADILNSLELVQSY
FT                   GVNLICIEEGIDSSQTSGKLLISVLSAVAEIERENIIEQTMNGRREKARQGGWNGGFAP
FT                   YGYTLEDNKLMIEETEAVAIRKIFELYTSSEIGLGGIANQLNLQGIRKIPRQNGTLEDW
FT                   TGHFIKLILDNPVYCGKIAYGRRTKEKVKGTKNDYQMKRNDDYILTEGQHKGIVSEEVW
FT                   EKAHAKRLRTGVKQPSKIGRDRVHLLSGLLKCPVCGSPMYTNKHAWTNKDGTYKEIYYY
FT                   VCSRNRMVRGKHCEYKAMLKKTDIEPMVIEAIREIVRNEEYAQAIKKRIGVQIDTKAVD
FT                   KELEGYQAKLKEVDLNKTRLEREIDSLPADAKYRERKLHDMTLRLDSLYDVIVELEEKI
FT                   EDARLRRDAIKQQAITLENIYKIMVNFDCVYNIINDEEKRNVVTALIKEIEIYRNDESE
FT                   YPLKRIGLNFPVFKDGGEVTELLWDKGNTVESICVLTKREIGNVNKKNYKR"
FT   CDS             complement(938363..938524)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88541"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEB9"
FT                   /protein_id="CBK88541.1"
FT                   /translation="MENIQNKSALIPSDEIRSEELLAEQKFEAFITSLAHIIEKYGMRV
FT                   LGEVDGAA"
FT   CDS             complement(938604..938954)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10060"
FT                   /product="Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88542"
FT                   /db_xref="GOA:D4JEC0"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEC0"
FT                   /protein_id="CBK88542.1"
FT                   /translation="MFEKFHRGDIYSADLSPGIGSEQSGSRPVLILQNNVGNCFSPTII
FT                   IAAITSVSKKSRKFPTHYHLNDRCGLVKPSVVMLEQIRTIDKSRLKNYIGHLNKDDMEN
FT                   INKTLLCSLGIT"
FT   gap             939023..939333
FT                   /estimated_length=311
FT   CDS             complement(939355..939660)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88543"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEC1"
FT                   /protein_id="CBK88543.1"
FT                   /translation="MDKLFRSDQRPCDPDGGTSGAMRARGLKDTSSRPAKDLGGTLRHT
FT                   IRTMLRSYDSRASGDLLCSHRQGGVANMASNPNRITVAAPGFYPKISFRLVRLFKY"
FT   CDS             939989..940363
FT                   /transl_table=11
FT                   /locus_tag="EC1_10080"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88544"
FT                   /db_xref="GOA:D4JEC2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEC2"
FT                   /protein_id="CBK88544.1"
FT                   /translation="MELIKELGRRIQKARKEKGLTQQELADLSHVSLKHVQGCERGVKN
FT                   PSFEVLRAFCKVLNLSLDSLMNLDLPEDEQAANDMRQLYLSCPPAARKVLLNSTRALTD
FT                   ELKEMVQTAVVDPDKHLENK"
FT   CDS             complement(940423..940848)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10090"
FT                   /product="Sigma-70, region 4."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88545"
FT                   /db_xref="GOA:D4JEC3"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEC3"
FT                   /protein_id="CBK88545.1"
FT                   /translation="MQKINLRELYPDVYKTDAFVDVAEEVVAAIRGQEQDDAAYERRKF
FT                   RHKAHYSLNREDGIENDALNRPLTPEEVLEQKLLREEVYAALMQLTAIQARRIYARFYL
FT                   GMTVAEIARIEGADRRRVWESIRRGLKKLARLLDMAQ"
FT   CDS             complement(941314..941685)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10100"
FT                   /product="Mn-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88546"
FT                   /db_xref="GOA:D4JEC4"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEC4"
FT                   /protein_id="CBK88546.1"
FT                   /translation="MKLHASGEDYLETILVLQKKLGMVRSVDVARHMEVSKPSVCHAVA
FT                   SLRDGGFLTMDEDHFLHLTDVGREVAEKIYERHCFFTEQLITAGVDPKTAEADACRIEH
FT                   IISDESFDRLKEAAEQEQN"
FT   CDS             complement(941702..943450)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10110"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88547"
FT                   /db_xref="GOA:D4JEC5"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEC5"
FT                   /protein_id="CBK88547.1"
FT                   /translation="MIKALKKKYALSDQGAKDLLKGIVYSVLANISLMFPVILLAIVLN
FT                   QLLAPVLGASAPEISAAVYTVIGIVILAVVFIFHYCQYTATYLGTYDESARRRIGLAEK
FT                   LRTLPLTFFHQRDLADLTSTIMGDCANFEHAFSHTVPQFFGAVISTGIVCIGLLIFNWQ
FT                   MGLALLWVAPISFAIVILSRKWQEKLSKKHMNARLELAEGIQECLETVQDIKACNQEED
FT                   YLRKLDAKMDAAEKAQISSEMTTASLLTTGQMFLRLGLATVIVVGNSLVVSGDTSLFTY
FT                   ILFLIAASRLYDPLSGAMSNMAELFSVQLQVNRLKEIEEYPEETGEKNIHTNGYDITFD
FT                   HVQFSYEKGKPVLRDVSFTAKQGQVTALVGPSGGGKSTVAKLAAKFYPLDGGRILLGGT
FT                   DIAPLNSTMLMKNFSIVFQDVVLFNNTIMENIRVGKKDATDEEVIAAAKAAQCDEFISK
FT                   LSDGYQTVIGENGSTLSGGECQRLSIARALLKDAPVILLDEATASLDVDNETEIQNAIS
FT                   RLVKGKTVLIIAHRMRTVEAADNIVVLSDGIVVENGTHEELMKENGLYHRLVDLQTASA
FT                   NWKLSV"
FT   CDS             complement(943443..945251)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10120"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88548"
FT                   /db_xref="GOA:D4JEC6"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEC6"
FT                   /protein_id="CBK88548.1"
FT                   /translation="MEKQKNGELSRMFGYAGKFHVLTVLGCVLSGISTILSMLPFVCIW
FT                   LVIHDLIQAFAAGDISLATGSAHYAWMAVVFAAASILIYFIALNCTHLAAFRTATNMRK
FT                   SAIHHIVTLPLGYFSQNASGRLRNIIDDNAGLTEGFLAHQLPDLTGAAVMPVAVIILIF
FT                   LFDWRLGICCLIPMGISVIFLKQMMGGDNAQFMGKYMTALETMNKEAVEYIRGIPVVKV
FT                   FQQTIYSFKNFHAAIEEYEKFASGYALKCRIPLTGFTVTLNGTFVLLIPVAMFILSGVS
FT                   GQAAYENVVLDFLFYSLFTPVCATMMNRIMFASEQLMAAKSAVSRVDEILQEKPLKEPE
FT                   HPLIPADASIVFSDVSFAYPGAKEKALDHISFEVPAGKTVALVGASGSGKSTAASLIPR
FT                   FYDVQSGSVTIGGVDVRNIEKQELMKRVAFVFQNTCLFKDTLLNNIKAARPDATREEVL
FT                   KAADEAQCKDIIDRLPDGLDTLVGTGGTYLSGGENQRIALARAILKDAPIIVLDEATAF
FT                   ADAENEHQIQLAFERLTQNKTVMMIAHRLSTIQDADLILVFKEGQIAERGTHEELVALN
FT                   GIYSSMWKDYQTSIAWKVGKEDEQHD"
FT   CDS             complement(945374..946855)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10130"
FT                   /product="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88549"
FT                   /db_xref="GOA:D4JEC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEC7"
FT                   /protein_id="CBK88549.1"
FT                   /translation="MVNDKARRSVIQFEDVSFEYPGAETDSIHHISLDVKEGEFLVLTG
FT                   GSGCGKTTLTRLVNGLGEQFYEGTLKGRITLLGRNISEYPLYEIGKKVGSIFQDPKSQF
FT                   FASITEDEISFGCENYGVPYEELDRRVSSAIKRINGDMLRGKEIYPMSSGEKQKIAVAS
FT                   VNAVDPEIYVFDEPSANLDMYSVEALKNLMGGLKAEGHTIIVAEHRLYYLTDLADRFLY
FT                   MENGSIKEEWTAGELRSIPEEKRRAIGIRAADLHHIEVDISPVKEKDMTMEVKDLAFSY
FT                   RKHPVFHDVSFQAYAGDLIAIVGHNGIGKTTLSNILCGMQKEKEGQVIYNGTKVSKGKR
FT                   KNFAYFVMQNTDCQLFGDSVEEELLLNGKGSTQEQRDDLLKLYGLFEWKERHPATLSGG
FT                   QKQRLTLAVSDWIDTPVLILDEPTSGLDFKNMMRISEHLKALAQKGKTILIITHDYEFA
FT                   AMTCNRVLHFVDEGHVETFPLQENLSRLYSCLMCQ"
FT   CDS             complement(946855..947307)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10140"
FT                   /product="Cobalt transport protein."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88550"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEC8"
FT                   /protein_id="CBK88550.1"
FT                   /translation="MPEMFLFMVLRILMMVMAAQPVIGMPPGEVVAVFKKIHAPNGIAL
FT                   PVTFMLRFFPTVRSEFSDVFSSLRLRKLLSWKHPLDAMEYIVTPVIFRSSRIAEELAAS
FT                   AESRGISNPGKHTCRRKIEFQKRDWIMCVIAVCVTAFYFVLERTVA"
FT   CDS             complement(947536..948141)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10150"
FT                   /product="conserved hypothetical integral membrane protein
FT                   TIGR02185"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88551"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEC9"
FT                   /protein_id="CBK88551.1"
FT                   /translation="MENEKSTGNKYTVKDAAIIGIFCAVMFVVFMVYSTLTGASLFYSM
FT                   IFNAAGAALILAPFYVYMCMKVGKHGPALVYNIMWAIIAGLMMGPFMIPWFLGGGIIAE
FT                   LSMCGKNAYHDIKRVSISWVITALVRAAHGMSEIWFFRDAFLATGVSEQQVQVQTQYYT
FT                   DPKYVLLSLAVTAILAVLGCMISNKLIVKHFRKSGAIK"
FT   CDS             complement(949757..951172)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10170"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88552"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D4JED0"
FT                   /protein_id="CBK88552.1"
FT                   /translation="MATTRIMPLHIGKGRIESQAVSDIIDYVANPQKTDNGKLITGYGC
FT                   DSRTADAEFLLAKRQYIAATGRVRGADDVIAYHVRQSFKPGEITPEEANRLGVEFAKRF
FT                   TKGNHAFVVCTHIDKSHVHNHIIWSAVNADCDRKFRNFWGSTKAVRRLSDTICIENGLS
FT                   IVENPKLHGKSYNKWLGEQAKPSHREQLRVMIDRALEQKPADFDALLKLLTEMGCEVSR
FT                   RGKAIRLKAPGWKNVARMDNKLGAGYSEAEIRAVLAGEKQHTPRKKSLVQPEPPKVNLL
FT                   VDIQAKLQAGKGAGYARWAKVFNLKQMAQTMNYLSENNLLEYAVLEEKAAAATAHHNDL
FT                   SAQIKAAEKRMAEIAVLRTHIVNYAKTREVYVAYRKAGYSKKFREEHEEEILLHQAAKN
FT                   AFDEMGVKKLPKVKELQTEYAKLLEEKKKTYAEYRRSREEMRELLTAKANVDRVLKMEV
FT                   EQDVEKGKDHGQR"
FT   CDS             complement(951228..951560)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88553"
FT                   /db_xref="UniProtKB/TrEMBL:D4JED1"
FT                   /protein_id="CBK88553.1"
FT                   /translation="MKKHGHYCKVCGEYKANEKFSGKGHAAHICKSCASLSPEKQAEQM
FT                   TVNHLLNLPWRLSKEQISWLKNRMKDKHPEVRALAKEQYEMRFPPKQLEDTDDDFDFLD
FT                   EDDFIE"
FT   CDS             complement(951557..952411)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10190"
FT                   /product="Domain of unknown function (DUF1814)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88554"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D4JED2"
FT                   /protein_id="CBK88554.1"
FT                   /translation="MIKTARQLKDLIRNLSREKSADAQLLMRNYMMERFLERISLSEYR
FT                   DKFILKGGMLVAAMVGLDARSTMDLDATVKGANVNVEDIENLISAIVSVPIDDGVKFQL
FT                   KSISEIMDEAEYPGIRVSMTTTFDGVVTPLKIDISTGDAITPREVRYSFKLMLENRSID
FT                   IWAYNLETVLAEKLETIITRTTTNTRMRDFYDIYILDQLHGNTLNRQTLHDALRATAHK
FT                   RGTEQHLAEAAEVFEEVENSPVMQKLWESYRKKFFYAADLEWSIIMGAVRSLYALSEKG
FT                   SSL"
FT   CDS             complement(952408..953016)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88555"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:D4JED3"
FT                   /protein_id="CBK88555.1"
FT                   /translation="MDVTKSERFEQLDRLLTEHDGMLQTAQVIASGIVKPIFYEYVKEK
FT                   NLQQVAHGIYVSEDTWIDAMFLLHLRCGQAVFSHESALFFHDLTDREPSPYAITVRRGY
FT                   STTRLKAEGLSVYTIKPELYEVGLTTGQTPFGHTVPVYDMERTICDLLRSRSSMEIQTF
FT                   QGALKMYARRKDKDLRTLMRYAGMFRVEKILRQYLEVLL"
FT   CDS             complement(953112..953423)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88556"
FT                   /db_xref="UniProtKB/TrEMBL:D4JED4"
FT                   /protein_id="CBK88556.1"
FT                   /translation="MRALVFLLKLLLKIVMVPVILALTLFVWICVGIVYVSGLVLVLIS
FT                   MVIALLGMAVLLTCSLQNGIILLVMAFLISPYGLPMAAIWLLGKVQDLKFAIQDLVYG"
FT   CDS             complement(953579..953923)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10220"
FT                   /product="Bacterial mobilisation protein (MobC)."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88557"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4JED5"
FT                   /protein_id="CBK88557.1"
FT                   /translation="MSSPKRKRDVPVLFWVSADEMELIQQKMAQFGTKNLSAYLRKMAV
FT                   DGYVVQLDLPELKELVSLLRRSSNNLNQLTRKVHETGRIYDVDLEDISQRQEQLWDGVK
FT                   EILTQLSKLS"
FT   CDS             complement(953920..954726)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88558"
FT                   /db_xref="InterPro:IPR024380"
FT                   /db_xref="InterPro:IPR024383"
FT                   /db_xref="UniProtKB/TrEMBL:D4JED6"
FT                   /protein_id="CBK88558.1"
FT                   /translation="MNTNNLNTALYEKMATEQEKYRDWLKSQPPEEILHHTYEYTVRED
FT                   IVMAMEQLELTDAQAQALLDSPSPLADVCRYFEKLETGYMDVIRDSIKNRADDVCKAQE
FT                   ELRTAPLYPHSAAYASEHGEMAQYNRSYQANSACKEAIEQAISAHYAENRLDTEAAIKD
FT                   VLEKFGAERVQFILANTIQHKNHDGRISQDNKAWAKTIPMPEDSDASRHCAYLVVDGVN
FT                   PGLTDLFTRQARKAMQEQQKSSVLQKLKQEPPARKPAAPKKQEPER"
FT   CDS             complement(954728..963517)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10240"
FT                   /product="DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88559"
FT                   /db_xref="GOA:D4JED7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JED7"
FT                   /protein_id="CBK88559.1"
FT                   /translation="MPTKAELYAQMAEKVTTQLTGSWQEWAGFLTTASRLYKYPFHEQL
FT                   MIYAQRPDATACAEYDLWNEKMGRYVRRGSKGIALVDDSGDRPRLRYVFDISDTGTREH
FT                   SRTPWLWQLEEHHLDSVQAMLERTYEVSGDDLAGQLTEVAGKLAEEYWTEHQQDFFYIV
FT                   DGSFLEEYDEYNIGVQFKAAATVSITYALMSRCGLEPERYFDHEDFMAIFDFNTPSTIG
FT                   ALGTAVSQINQQVLRQIGVTVRNAERETNQERSKQDEQSHDLYPERRLSDSRPEAEPAA
FT                   GETLGQVRKDEENLPEGTPSHPLQPDAAEREAVPAPSGDRRDRPEQTGADDAPAGEGSG
FT                   SHRGPESQRSHEVGGADEHLQSSGRGDPDGGAYQQLTLNLFLSEAEQIQSIDEAENVAH
FT                   TSSAFSFSQNDIDHVLRLGGNTDRQRERVVAAFEKQKTTAEIAEILKTLYHGGNGLGSV
FT                   SAWYAEDGIHLSHGKSVRYDRSAQVISWESAAERIGELLESGQFASNVELAEAASYERS
FT                   LLSEKLWHLYHDLSEDARKGGYLSCLSEIKGNDFPEETRRLMEQLSEPAFRQTLKEEYA
FT                   AFWTAYQQDRDLLRFHYHRPREIWENLKDLDLPRRTFSSELSQVPTVQHFITEDEIDAA
FT                   MTGGSSFAGGKGRIYAFFMENHTDKEKVRFLKDEYGIGGRSHALSGATHSGEDHDGKGL
FT                   HYKKQDCPDVHLNWEKVAKRITSLVQKGRYLTEQEQAQYDKIQSEKELAEEDAIQAQQP
FT                   EMEEETPKPILREQFEQYKPVVTAAISEDAAYRNACGHSDRENAVIEGNAAVRRAVLGS
FT                   KDMELIRLYSDVPEFRQRLHREVIDETYPKLHELLRPLSQEDIDTALCAWNGNIESKHA
FT                   VIRYMKDHAREKDTAAWLAQEYGGSNSNSLFVVRAGSPEETQLPWPKVQRRLAQLIQED
FT                   RFYTEEEQNRFDDIDPIAIREALEERGIINGQVTDPEKLDNDPFIQQVMSDAEQIADAE
FT                   TEQTSKVSISDEEYDAVRRPIPQRTSYDPAAPVYAVGDTVYIEDDAYQITELREDTVQL
FT                   LPTGMVYPIYRAERKEQFEQLLRADRRNAYYTEFLPIAPDKADQDLRDVLAHGLMDEAD
FT                   KKQISTLLQSGRSNSEIAYWLSRAYSGEIETLNLETGDIADYRTTAQGIELEVMDAEEK
FT                   RLVMLYFRWDEVAPLLRGMYARQQDGFGQEQPQPATESPTFHSETMAVYPGDKNNLPYD
FT                   VVVERLHIEEPEPPVPVTEPEKTFEEVLDEHPVSIQVNGQWETFSNAKAAEEASYEEYK
FT                   ANLRRNAKNFRITDEHLGEGGPKAKFQANVNAIRLLKELEAAGQQASPEQQEVLSRYVG
FT                   WGGLSDAFDPEKPVWALEYAQLKELLTPEEYAAARSSTLNAHYTSPTVIQAIYEAVDRM
FT                   GFEAGNILEPSMGVGNFFGMLPEKMRNSRLYGVELDSISGRIAKQLYPKADITVAGFET
FT                   TDRRDFYDLAIGNVPFGQYQVRDKAYDKLNFSIHNYFFAKALDQVRPGGVVAFVTSRYT
FT                   MDAKDSTVRRYLAQRAELLGAIRLPNDAFKKNAGAEVVSDIIFLQKRDRPLDIVPEWTQ
FT                   TGQTEDGFAINRYFIDHPEMVLGRQEPVSTAHGMDYTVNPIEGLELSDQLHDAVKYIHG
FT                   TYQEAELPELGEGEAIDTSIPADPNVKNYSYAIVDGQVYYRENSRMVRPDLNTTAEARV
FT                   KGLVGLRDCVQELIDLQMDAAVSDSTITQKQAELNSLYDSFSEKYGLINDRANRLAYAD
FT                   DSSYYLLCALEVIDEDGKLERKADMFTKRTIKPHQAVAVVDTASEALAVSISEKACVDM
FT                   GYMSQLTGKTKEELAGELQGVIFRVPGQLEKDSTPHYVTADEYLSGNVRRKLRQAQRAA
FT                   QQDPVYAVNVEALTAAQPKDLDASEIEVRLGATWIDKEYIQQFMYETFNTPFYLQRSIE
FT                   VNYSSFTAEWQIKGKSSVSYNDVAAYTTYGTSRANAYKILEDSLNLRDVRIYDTIEDAD
FT                   GKERRVLNAKETTLAAQKQQAIREAFRDWIWRDPERRQTLVSQYNEEMNSTRPREYDGS
FT                   HITFGGMNPAITLREHQKSAIAHVLYGGNTLLAHEVGAGKTFEMVAASMEAKRLGLCQK
FT                   SLFVVPNHLTEQWASEFLRLYPSANILVTTKKDFETHNRKKFCARIATGDYDAIIMGHS
FT                   QFERIPISRERQERLLYEQIDEITEGIAEVQASGGERFTVKQLERTRKSLEARLEKLQA
FT                   EGRKDDVVTFEQLGVDRLFVDEAHNYKNLFLYTKMRNVAGLSTSDAQKSSDMFAKCRYM
FT                   DEITGNRGVIFATGTPVSNSMTELYTMQRYLQYERLQELNMTHFDCWASRFGETVTALE
FT                   LAPEGTGYRARTRFSKFFNLPELMNLFKEVADIKTADQLNLPTPEVEYHNIVAQPTEHQ
FT                   QEMVKALSERASLVHSGTVDPSQDNMLKITSDGRKLGLDQRIVNQMLPDEPGTKVNQCV
FT                   DNIMQIWRDGKADKLTQLVFCDISTPQAKAPASKAAKTLDNPLLHALEGAVPLPEQEPV
FT                   FTVYDDIRQKLIAQGMPADQIAFIHEANTEVRKKELFSKVRTGQVRVLLGSTAKMGAGT
FT                   NVQDRLVALHDLDCPWRPGDLAQRKGRIERQGNQNPLVHVYRYVTEGTFDAYLWQTVEN
FT                   KQKFISQIMTSKSPVRSCDDVDETALSFAEIKALCAGDPRIKERMDLDVEVSRLKLMKA
FT                   DHQSKQYRLEDQLLKYFPEEIEKHKGFIKGFESDLEVLAAHPHPEDGFAGMEIRGDLLT
FT                   DKENAGAALLDACKEVKTSDPVQIGSYRGYAISVEFSAWKQEYTLLLKGQMSHRATLGI
FT                   DPRGNLTRIDNALAQMPQRLEAAKAQLDNLYQQQAAAKEEVGKPFLYEEELRSKNARLV
FT                   ELDTLLNIDGKGQAHTESVVAKSTRPSVLDTLKRPVQPRSTDKKPKQHEEVR"
FT   CDS             complement(963595..963810)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88560"
FT                   /db_xref="InterPro:IPR025468"
FT                   /db_xref="UniProtKB/TrEMBL:D4JED8"
FT                   /protein_id="CBK88560.1"
FT                   /translation="MGNFTFEEMNLMCIYNTGSRTGLIDSLREMRGELSPEETELRELT
FT                   DSALCKLQTMTDDEFAELELYPDFDQ"
FT   CDS             complement(963812..967213)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10260"
FT                   /product="DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88561"
FT                   /db_xref="GOA:D4JED9"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR025465"
FT                   /db_xref="InterPro:IPR025923"
FT                   /db_xref="UniProtKB/TrEMBL:D4JED9"
FT                   /protein_id="CBK88561.1"
FT                   /translation="MAENVFEAVKQSVSTKEAAEFYGIKVSRTGMACCPFHDDKNPSMK
FT                   VDQRFHCFGCGADGDVIDFTAKLFNLSPKEAAEKLAQDFGLIYDSQAPPRRRYVRQKTE
FT                   AQKFREDRQRCYRVLSDYYYLLKKWEADRSPSTPEEEPHPRFVEAIQKKAYVEYLLDLF
FT                   LYESEEEQKVWIAEHTTEITHLERRLKIMAENKPTNRERLREITDGIEQGIKELFESEK
FT                   YMRYLSVMSRFHRYSVNNTMLIYMQKPDATLVAGYNKWKDQFERHVKKGEHGITIIAPT
FT                   PYKKKIEEQKLDPDTKAPILDKDGKIVTEEKEIEIPMFRPVKVFDVSQTDGKPLPELAS
FT                   SLSGNVPNYEAFMEALRRSAPVPITFEAMAADTDGYFSVDHQKIAIRQGMSEVQTVSAT
FT                   VHEIAHSKLHNQKKIQIANDEQYQEIELFDKLGLFSNGRIARDNLPEGVYCYDLRGSDY
FT                   DPGDPVCVEERVVVNHAGSVLMTEPLELTEDGRLMLTEEKGLNFTGGFSTLSQFLQKQR
FT                   KDRHTEEVEAESISYAVCKYFGIETGENSFGYIASWSQGKELKELRASLETINKTSGTL
FT                   ISDIERHYKEICKERGIDPHAKVEPEPAPIEQPEDAAKVSDRQQTGDLTYYVAECMEFP
FT                   NLGEYHDNLSLEEAIRIYQEIPAERMNGIKGIGFELKDGSDYEGPFPILTGQTIDLDTI
FT                   QAIDYYRDNPLVQKTVKELAAAMPEMEVLGADANQQEALFLIDNATYLHIQSCDSGWDY
FT                   TLYDAASMKELDGGQLDMPEISRMKAVLQICDDNDLGRDSVKYAPLSMIETLQEAAYQQ
FT                   MQAEASQMAASSQLPEAQEQALDEYPMPDEQVSTPDMQEYGYFYDGMLPVTRERALELD
FT                   AAGLTVYVLHEDNTESMVFDPQEIMEHGGLFGVDREEWEKSPQFHEKVMERQEHQQERE
FT                   QAFLAQNRDCFAIYQVSRDDPQNVRFMNLDWLKSHDISIDRSSYDLIYTAPLRESGTVP
FT                   EQLEKLYEQFNLQKPADFHSPSMSVSDIVAIKQDGKVSCHYCDSVGFTQIPGFLPENPL
FT                   KNAEMAVEDDYGMIDGIINNGAKEPTVAELEQQARSGQPISLMDLAAAAHREEREKKKS
FT                   VMEQLKSQPKAEHKKIAPKKSTEREI"
FT   CDS             complement(967220..967498)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88562"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEE0"
FT                   /protein_id="CBK88562.1"
FT                   /translation="MKLSLVERETILLYNQAEPMAEVYTHDPRLMEKLELLAKKHPDQI
FT                   TRKDAHNFTVPKRCVSVREPYSAERRKAASERAKAAGYQPPMRKSDS"
FT   CDS             complement(967495..969594)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10280"
FT                   /product="DNA topoisomerase III, bacteria and conjugative
FT                   plasmid"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88563"
FT                   /db_xref="GOA:D4JEE1"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEE1"
FT                   /protein_id="CBK88563.1"
FT                   /translation="MNLVIAEKPSVAQSLAAVIGATVRKDGYLEGNGWRVSWCVGHLAG
FT                   LADADSYDQKYAKWRYDDLPILPEHWQMVVGKDKKKQFDILKKLMNAPDMTEVVNACDA
FT                   GREGEMIFRSVYELAGCKKPMKRLWISSMEDSAIREGFANLRPSADYDGLRDAALCRAK
FT                   ADWLVGINATRLFSVLYHRTLNIGRVMSPTLALIVQREAEIDTFKPIPFYTVALELPGL
FT                   TVSGERVANKAAAEQLKEACQGANVTIKKVECKEKSEKPPALYDLTTLQRDANRLLGFT
FT                   AQQTLDYLQSLYEKKLCTYPRTDSRYLTGDMADSLPVLVNLVASAMPFRKGIAITCDPH
FT                   TVINDKKVTDHHAVIPTRNLKDADLSALPAGEKAVLELVALRLMCAVAQPHIYSETVVI
FT                   AACAGGEFTTKGKTVKHPGWKALEDAYRAKMKDTEPKKEGVEKALPELTEGQTLSVSAA
FT                   IVKEGKSSPPQHFTEDTLLSAMETAGKEDMPEDAERKGLGTPATRAGILEKLVSAGFLE
FT                   RKKSRKTVQLLPSHDAVSLITVLPEQLQSPLLTAEWEYRLGEIERGQLAPEEFLAGIST
FT                   MLKDLVGTYQVIKGTEYLFTPLREVVGKCPRCGVEVAELQKGFFCQNDSCKFAIWKNNK
FT                   WWAAKKKQPTKAVVSALLNDGRVRVTGLYSEKTGKTYDATVVLEDDGQYANFKLEFDQR
FT                   KGGSR"
FT   CDS             complement(969575..970267)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88564"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEE2"
FT                   /protein_id="CBK88564.1"
FT                   /translation="MSVLIIFIKLIAVFDLLVIAVYFGGDILSTMLNKLRRTPKQDDPF
FT                   DFSLDTVTVSLSIDSIRQLYSGDAADFVKEKILPNVEKTMAVLTDQEQTAACLLLSALI
FT                   GFLAAEAPMDEQSFPMVMELLNCMEGEKEDGCRDAVDILFEDTVSNTHRHEEYYSNYQR
FT                   YQLMQVYKPRIILACRIIINDLLGKLYRYDYRFGYNLLLDEENSIEKKLHTPMREEWEV
FT                   EDYEFSDC"
FT   CDS             complement(970264..970458)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88565"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEE3"
FT                   /protein_id="CBK88565.1"
FT                   /translation="MTRFTDSPHERMMTHRPEGGKETSRPPSLPHSHPCYGCGNYGRPC
FT                   VGICHREMERWLKERKRKK"
FT   CDS             complement(970455..971219)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88566"
FT                   /db_xref="InterPro:IPR025376"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEE4"
FT                   /protein_id="CBK88566.1"
FT                   /translation="MKNKRICKTLSALCLTMVVAFGFTIPAFAQGSEQAPAAPAEDSTN
FT                   DSNVIVEEAEPAPALTPDGNAALVDDFGGNKQLITVTTKAGNYFYILIDRANEDKKTAV
FT                   HFLNQVDEADLMALMEDENVKEEPAAVCSCSTKCEAGAVNTACPVCATDKSKCTGKAPE
FT                   PPAETSEPEKEKPAGLNPAALVLLLALLGGGGAFAYLKLVKNKPKTKGNDSLDDYDYGE
FT                   EDSEEWETEGEESEEPDADGGSTEEDDEDSVK"
FT   CDS             complement(971209..971466)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88567"
FT                   /db_xref="InterPro:IPR025464"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEE5"
FT                   /protein_id="CBK88567.1"
FT                   /translation="MAKNKIERIDQEIEKTREKIAEYQEKLKTLEAQKTEAENLEIVQM
FT                   VRALRMTPAQLNAMLSGGMNHGRDTALSESNNQEVTAYEE"
FT   CDS             complement(973224..973604)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88568"
FT                   /db_xref="InterPro:IPR024216"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEE6"
FT                   /protein_id="CBK88568.1"
FT                   /translation="MMNPNILNKNPLMFFDRAVNAQRSQLLTVMADAVSECRTAADQAA
FT                   ELNETGQVGLLRLAEVWSAIRAKEGMGGLVLKGTEAKILSDVVAQFYAFLSGCMFNDPV
FT                   GMAIYAELHYMMSSLMLGEWFE"
FT   CDS             complement(976439..977308)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88569"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEE7"
FT                   /protein_id="CBK88569.1"
FT                   /translation="MDFLLEALTNWLKEMLVGGIMSNLSGMFDSVNQQVADISVQVGQT
FT                   PQGWNGSIFNMIETLSNSIMVPIAGVILAIVMTVDLIQMIADKNNLHDVDTWMIFKWVF
FT                   KSAAAILIVTNTWNIVMGVFDMAQSVVAQAAGIINSDASIDISSVMTDLEPRLMEMDLG
FT                   PLFGLWFQSLFIGITMWALYICIFIVIYGRMIEIYLVTSVAPVPMAAMMGKEWGGMGQN
FT                   YLRSLLALGFQAFLIIVCVAIYAVLVQNIALEDDIIMAIWSCVGYTVLLCFTLFKTGSL
FT                   AKSVFQAH"
FT   CDS             complement(977378..977596)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88570"
FT                   /db_xref="InterPro:IPR024272"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEE8"
FT                   /protein_id="CBK88570.1"
FT                   /translation="MAFFEQAITVLQTLVIALGAGLGIWGVINLLEGYGNDNPGAKSQG
FT                   MKQLMAGAGVAVVGMVLVPLLSGLFSV"
FT   CDS             complement(977815..979644)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10400"
FT                   /product="Type IV secretory pathway, VirD4 components"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88571"
FT                   /db_xref="GOA:D4JEE9"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEE9"
FT                   /protein_id="CBK88571.1"
FT                   /translation="MKKTLDIKKLILLNMPYILMGLFATNFGEAWRMAQGVDASEKFLS
FT                   LVAVLPGALQSFWPSLHPLDLLVGLCCGVGLRLAVYLKSKNAKKYRHGLEYGSARWGTR
FT                   EDIAPYVDPVFQNNVILTKTESLTMNSRPKDPKTARNKNVLVIGGSGSGKTRFWLKPNL
FT                   MQMHSSYVVTDPKGTILVECGKMLQRGAPKPGKDGKPMKDKHGKVIYEPYRIKVLNTIN
FT                   FKKSMHYNPFAYIHSEKDILKLVTTLIANTKGEGKAGDDFWVKAETLLYCALIGYIHYE
FT                   APVEEQNFSTLIEFINAMEVREDDEEFKNPVDLMFDALESEKPNHFAVRQYKKYKLAAG
FT                   KTAKSILISCGARLAVFDIAELREVTSYDELELDTLGDRKTALFLIMSDTDDSFNFLIS
FT                   MCYTQLFNLLCEKADDVYGGRLPVHVRCLIDECANIGQIPKLEKLVATIRSREISACLV
FT                   LQAQSQLKAIYKDNADTIIGNMDTSIFLGGKEPTTLKELAAVLGKETIDTYNTGESRGR
FT                   ETSHSLNYQKLGKELMSQDELAVMDGGKCILQLRGVRPFLSDKYDITRHPNFKYTADAD
FT                   KRNTFDIEAFLSARLKLKPDEVCDVYEVDTEGV"
FT   CDS             complement(979641..980141)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88572"
FT                   /db_xref="InterPro:IPR024234"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEF0"
FT                   /protein_id="CBK88572.1"
FT                   /translation="MQEEVENRTLTLVVSGTKFTGRLLKAAISKYMAHCKEKKLQKQRS
FT                   RDAPVTPHGKQTVKQIIGQNQGISNIEITDPSIKEFEKIARKYGVDYAVKKDRSSSPPK
FT                   YLIFFKGRDADALTAAFTEYTNKKVKKATKTERPSVLAKLNQFKEMVKNAVVDRTKRKE
FT                   LER"
FT   CDS             complement(980228..980647)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88573"
FT                   /db_xref="InterPro:IPR025462"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEF1"
FT                   /protein_id="CBK88573.1"
FT                   /translation="MNEEKKVPFKWEYGEETISLQLGMYANNQRLYIGMITHTEDGAEA
FT                   FADMTVNLPGYSLDPGEAFISGDISKDLLRFIKENKLGKVLPYQVQSGYGKYSAVAFDL
FT                   EKLKAFDPKGVAEFREEWNLPDKKPVKKKNRGMER"
FT   CDS             complement(980660..980971)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88574"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEF2"
FT                   /protein_id="CBK88574.1"
FT                   /translation="MQEGKTIGQLMEKMRQKAGAQNYHGHDYMDLQRFAENTRHMIIFD
FT                   VLTHDSPVGWKGERTRLFLSDIGYEKALDSQANGQIKILSHAKVRNGDLFYDHKEQIR"
FT   CDS             complement(980994..981740)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10440"
FT                   /product="Prophage antirepressor"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88575"
FT                   /db_xref="GOA:D4JEF3"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEF3"
FT                   /protein_id="CBK88575.1"
FT                   /translation="MNQMEIFKNPEFGSIRVIEENGKYLFCGTDVAAALGYSNSRDAII
FT                   RHCRYVVKRDAPHPQSPDRKISMTFIPEGDLYRLIVHSKLPSAEQFEQWVFDEVLPTIR
FT                   KHGAYLTREKLWEVATSPEALMKLCSDLLAEREANISLRKENAQLEGKAAFYDLFIDLK
FT                   HSTNLRTTAKELDVPERRFVRFLIERRFVYRTASGNVLPYANVKNTGLFCVKDYCNHGH
FT                   TGSYTLVTPKGKLYFAQLREMILLVS"
FT   CDS             complement(981775..982653)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88576"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEF4"
FT                   /protein_id="CBK88576.1"
FT                   /translation="MAVYRVQRTRDYTVMSNYHLKDKGLTLKSKGLLSMILSLPEEWNY
FT                   TTRGLASICKEGVDAIGSALKELETAGYIVRRQLRGANGRITDTEYIIYEQPQPKKLDM
FT                   LPSDVVSPDTENPDTVKPDTEKPAELNIEKSNTEKSITYGSSTDSIPFRETAAARPPER
FT                   KGRDAMSVTEIENYRELILENIEYDCLKQRYPLYMDDLNEIVELLVETVCARRKTTRIS
FT                   GADFPHEIVRSRFLKLDSSHIEFVMDCLQKNTTQVRNMKQYLLAVLFNAPTTMNNHFTS
FT                   LVNHDMHAGGW"
FT   CDS             complement(982714..983217)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88577"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEF5"
FT                   /protein_id="CBK88577.1"
FT                   /translation="MFREKEICNAIRTAYLYLFPDKKERKRALSRLNMELVAQSVRYRG
FT                   ESVLAYQTAGNHECSLNYYGPELFPQRGFCIYQKTIQSHSTQVDASCIRELWLLEDGRF
FT                   VDVSCVNTKYCSAYERFSTCYRTIHHIVRERDWQDYPAEEVADAFEDISRYPFDGRPGV
FT                   FYEV"
FT   CDS             complement(983219..983488)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88578"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEF6"
FT                   /protein_id="CBK88578.1"
FT                   /translation="MRDISARELKGHNILAVERFWDNTRWMIEFSVLRPSTAYGSPGDE
FT                   MRLFLTEDGYQAALQSQKRREIKIKRYARVIEGHVLDVKKKRRK"
FT   CDS             complement(985328..986785)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10500"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88579"
FT                   /db_xref="GOA:D4JEF7"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEF7"
FT                   /protein_id="CBK88579.1"
FT                   /translation="MKCKVGKICGGCAYLSKSMEEQASIKKAQVEELAQRNHLKLRVGD
FT                   VLTAKNTTHYRNKVIVGFAKNKGKVYSGLYAAKSHRVVACQNCMMHPDIVNKIIVKIEE
FT                   LVSSMKIELYNEKTRTGLLRHVLIRYAHKTDEVMVVFVTSKKMFPSRRNLVNALVKEFK
FT                   EIKTIVQNVNPRNTSIVQQDETILLYGDGMITDELCGLKISFSNRSFYQIHSEQCEVLY
FT                   DMARKMCDLTKTDTVLDTYCGVGTIGLTLASSCKSVTGVEINPDAIENAKLNAKQNNIK
FT                   NAKFISMDSTRYMMEAKKFRNHYDVIILDPPRAGTTKDFIEASTSLQPKKILYISCDPK
FT                   TMMRDLVMFRQKGYMTNKIELVDMFPFTEHIETVVLLSHKKADSYIHIDVEFGEGEGKI
FT                   PVDSIAKRAEAYKPKEKVTYKMIKEYIEAKYGFKVHTAYIAEVKRDLGLPMYDAPNAVE
FT                   ELKQPRKHPTPEKVEAIKDALRYFAVI"
FT   CDS             complement(986775..987377)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10510"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88580"
FT                   /db_xref="GOA:D4JEF8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEF8"
FT                   /protein_id="CBK88580.1"
FT                   /translation="MVKNIIFDIGNVLATFKPKDFLMDLFKDPTLVDQFFEVFFTKLWH
FT                   EYDQGLYTKEQMVQKGLQKMPDQKEKINKMMDVWTSYVVGIQENLDLIQIYQKKGYKVF
FT                   ILSNLPEDSYIYLKEHYDFINQVDGGIYSYQHKLIKPDVKIFEALLEKYGLNANECIFI
FT                   DDTEVNIRAAETLGFYTIWLKDNTQLATLLKENLNEV"
FT   CDS             complement(987429..987989)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10520"
FT                   /product="Predicted flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88581"
FT                   /db_xref="GOA:D4JEF9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEF9"
FT                   /protein_id="CBK88581.1"
FT                   /translation="MKKILFIVGSLRRHSFNAQLAGYVEDKIKDKVEVSYLQYRDIPYM
FT                   NEDLENPEPIDIRRIKKEVMEADGVWISTPEYNGFIPGVLKNLLDWLSRRIDLQAEWNQ
FT                   TALANKPVTYSGAAGKSGSAKAQAQLEVLLPFILMDVVNKHTAKVQIKPEDHKTQILTL
FT                   NKEEEEMIDLQINDFLSHLNVQN"
FT   CDS             complement(988049..988495)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10530"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /function="Acetyltransferase, GNAT family"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88582"
FT                   /db_xref="GOA:D4JEG0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEG0"
FT                   /protein_id="CBK88582.1"
FT                   /translation="MIIRKYQSLDCEEMAQLFYGTVHTINRKDYSKEQLDVWADGKVDI
FT                   ESWNQRYLSSHTLVAIEDKRIVGFGNIDDQGYLDMLYVHKEYQNNQIATKLCDQLEKFV
FT                   TSKITTYASISAREFFEKRGYRVIRENEVIRKGITLTNYLMEKE"
FT   CDS             complement(988547..989830)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10540"
FT                   /product="Molecular chaperone, HSP90 family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88583"
FT                   /db_xref="GOA:D4JEG1"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEG1"
FT                   /protein_id="CBK88583.1"
FT                   /translation="MNVETSKIKEETKDSDKPEYETVIEDQTLNSMVPLWKRQKSKITD
FT                   EEYNQFYKDHFYDYADPKRVIHFSVEGNVSFTALLYIPSHVPQGFYHQDYKKGLQLYCR
FT                   GVFIMNHAEELLPDYLRFVKGLVDSQDLSLNISREMLQHDHQLKAIASRIEKKILSELT
FT                   NMLTKERETYEEFWKEFGLNIKFGAYNNYGMDKDKLQDLLLFYSSKDQKLVTLNEYVNR
FT                   MKEDQKDIYFVSGSDVNLIDKLPIVQTLKKKDYEVLYLTDEVDEFVMQTLMTYREKTFR
FT                   NAAQGDLDLDSEEEKQELEKAKEDNKELLKFMKESLHDQVAEVKLSNRLIDDPVCLTAG
FT                   EGLSFEMEKVFANMPKDNPMMPMKATRILEINPNHPIFETLKEAFSSNKDKVAEIADVL
FT                   YNQALLIEGFKIEDPIAYSRKICELLVK"
FT   CDS             complement(989859..990455)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10550"
FT                   /product="Molecular chaperone, HSP90 family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88584"
FT                   /db_xref="GOA:D4JEG2"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEG2"
FT                   /protein_id="CBK88584.1"
FT                   /translation="MARKKQFKAESKRLLDLMINSIYTHKEIFLRELISNASDAIDKYY
FT                   YSNAGHVDPSTFEIRIEPNKEARTLTISDTGIGMSKEELEENLGTIAKSGSLAFKEQME
FT                   NNKEHENDVDIIGQFGVGFYSAFMVAKELCVISKKDGSDEAYKWISDGDSGYTIEPAEK
FT                   ETTGTTIILTLKDDTENDDYSKYLETYTLKDLIKK"
FT   CDS             complement(990556..991143)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10560"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88585"
FT                   /db_xref="GOA:D4JEG3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEG3"
FT                   /protein_id="CBK88585.1"
FT                   /translation="MTTLDRSIEFKKVLMVITRKTIKRETPLKEGYKYTPFSKELLDSW
FT                   CRLHVKTGLFETMEQAKNKLDEMLQQDEDFFKENFLFVVNEANELVASAGLWTGKDFDG
FT                   NRLRLHYISVDPNEQHNGIAHAMISRLCIKYDSIPGKYPLYLATQSQSYGAIALYSRMG
FT                   FTPYLGEYNGCSQEKNEAAWEYTTEILREKVK"
FT   gap             991157..992079
FT                   /estimated_length=923
FT   CDS             992114..992896
FT                   /transl_table=11
FT                   /locus_tag="EC1_10570"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /function="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88586"
FT                   /db_xref="GOA:D4JEG4"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEG4"
FT                   /protein_id="CBK88586.1"
FT                   /translation="MTRKDADLSKPEEVEAFLKDKQFDICFHTAANATTAVCEENPELA
FT                   HKINVESTQKIIEACKKNQARLIFCSTEQVFNGKENHGPFNEEESVSAVTVYGKNKIEC
FT                   EDLIHEQLDDYLILRFSWMMGLSFDKVKASPSIIKNVMNALLHQTPTLFTCNERRCMTY
FT                   AKKLAQQFEKITALDTGTYHVASKNEMTTYETAVYIAKELKASDEAIAKYILPNKERYS
FT                   ERFRDYRLDSSKLENLGITFGTFEENIEEILKDFGWDR"
FT   CDS             992898..993308
FT                   /transl_table=11
FT                   /locus_tag="EC1_10580"
FT                   /product="C_GCAxxG_C_C family probable redox protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88587"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEG5"
FT                   /protein_id="CBK88587.1"
FT                   /translation="MTEFQTVVEKYYTSGYNCSETLIRAANEYYHLDLHDEDMKMIAGF
FT                   GGGMFVGSTCGALVGSVAALSKMVIKTKAHDQLGEIRPYTQKCVRNFKEELGNMDCAHV
FT                   KPIHHTKETKCLNTCLLAAKALEKTILETVGE"
FT   gap             993377..993777
FT                   /estimated_length=401
FT   CDS             994605..994925
FT                   /transl_table=11
FT                   /locus_tag="EC1_10600"
FT                   /product="Phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88588"
FT                   /db_xref="GOA:D4JEG6"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEG6"
FT                   /protein_id="CBK88588.1"
FT                   /translation="MGTSKNPIGYGKELESFDKNLKTLINQLTQNDLLIVTADHGNDPT
FT                   HKGSDHTKEIVPLMIYSKHFKESKQLEDQNNFATIGATILDNFGFSMPDNTIGTSILSQ
FT                   LL"
FT   CDS             994977..995843
FT                   /transl_table=11
FT                   /locus_tag="EC1_10610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88589"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEG7"
FT                   /protein_id="CBK88589.1"
FT                   /translation="MKIAYLIHYMKKNYDEITENLDTILEAGDDCYVIVNDDDLRDELM
FT                   LAYGNEPSMHLVHKQEAALPGDLSLPRGMIISIADALEEEKENGFKYDAFINLTDGMIP
FT                   ITKKKDLEDYLNKYPEQDIYYVEKTSEEDPELMTRFEEYAFFTNSMDFQKSKIIQGMNK
FT                   FTAGVIHNFKQKKLDDVLVLSYPWFVLRHESAAALAENLAYCSNNFKMCMYPEELAIAT
FT                   MLKKFSPATHHNENIWRVNEDGIYKFKEPILNVSREVLNDKNAFFAAKIHSDENFDIYQ
FT                   DYFDIYE"
FT   CDS             complement(995864..997777)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10620"
FT                   /product="aconitase"
FT                   /function="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88590"
FT                   /db_xref="GOA:D4JEG8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006250"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEG8"
FT                   /protein_id="CBK88590.1"
FT                   /translation="MNLTQKIIKEHLIKGTLEPGSPIEIKMDQTLTQDATGTMAYMQLE
FT                   AMGIKRVKTEISVSYVDHNTLQNGYMNADDHAYLQSVAAKYGVYFSRPGNGICHQVHLE
FT                   RFAKPSKTLIGSDSHTPTSGAMGCLAIGAGGLDVAKAMAGIGYRLTMPKIVQVNLHGKL
FT                   SHGVSSKDIILELLKRLSVKGGVSKVFEYTGEGVKGLSVYQRATITNMGAELGATTSIF
FT                   PSDEITLAFLKQQNREEDYIELKADEDATYDEYIDIELSSLRPMAACPDSPDAIKNISE
FT                   LKGIKIDQVAIGSCTNSGYEDLMKAATILKGKTIAPNVSLVVSPGSRQVMMKLIQNGAL
FT                   ATFIQAGARILECACGPCIGMGQSPKSDGISLRTFNRNFYGRSGTLSAGIYLVSPEVAA
FT                   ASAIEGKFVDPTELDYDDTFEKEPVYIDDSMIIAPVENTDDIEIIRGPNIKPLPINDRM
FT                   DQIIDKKVIVKLPNNITTDHIAPAGAEVLPYRSNIEKLSTFVFKNNKPHFAEICKENHG
FT                   GIIVAGENYGQGSSREHAALAPMYLQIKAVIAKSFARIHLANLINFGILPLVFKDKEDY
FT                   DFIDEMDELIIEDTSKLYETDEIKVYDKTKDKYFTALTSLSNEDVDILMAGGALNYIKD
FT                   QQ"
FT   CDS             997870..998910
FT                   /transl_table=11
FT                   /locus_tag="EC1_10630"
FT                   /product="Citrate synthase"
FT                   /EC_number="2.3.3.5"
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88591"
FT                   /db_xref="GOA:D4JEG9"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016141"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEG9"
FT                   /protein_id="CBK88591.1"
FT                   /translation="MKTLKTIYMESEKENYIDASLYPRYRVKAGLRNDNGTGVKVGLTK
FT                   ICDVVGYQYIHGKKINVDGKLIYRGYSVQDLINDPNFAQLGNYERIAFLLIYGKLPNAE
FT                   ELFLFTQELLKKRNLCNIDPKYQTTSILNGVQIEVLKLYGQDPNPDSDTLEERMLKGLS
FT                   ILAQIPLITFSFFTGQQICEYPLPNKSLAENILVMARGSNIYTHQEARVMDTLLVLHAD
FT                   HGGGNNSTFANVVISSTGTDIYSCISAAIGSLKGPRHGGASTKVYQQMKEILKVTKHSR
FT                   DPELMKNIAYQLLNKDFFDKSGLIYGIGHAIYTISDPRCQCIKAECKKLAKEKGSVGYF
FT                   LYLGGL"
FT   gap             999287..999461
FT                   /estimated_length=175
FT   CDS             complement(1000351..1000647)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88592"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEH0"
FT                   /protein_id="CBK88592.1"
FT                   /translation="MEAYSIEDKGDGICFHVYCYNVMPSVKIDYKTGDAVIENSNIDTQ
FT                   TQKDYILNIKSKKIHLPECNGVQTMSDKNKKEVHASIDELQQEGYSICSNCIH"
FT   CDS             complement(1000622..1001209)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88593"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEH1"
FT                   /protein_id="CBK88593.1"
FT                   /translation="MKKLIITIFTAVSMVLCLSGCSSAEQTTSIQSVSVEDIPAYTNSP
FT                   YVVINENVPDFDLSKKQDSYQIYSDLDDLGRTLDAEACLSKDMMPTEERNSISSIHPSG
FT                   WHSIQDDSIPGGSLYNRCHLIAYQLTGVNDERNLITGTRYLNVEGMLPFEEMVADYIRE
FT                   TDNHVLYRVTPYYEGDNLVASGVFYGSLLNRR"
FT   gap             1001576..1002633
FT                   /estimated_length=1058
FT   CDS             complement(1003439..1003801)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88594"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEH2"
FT                   /protein_id="CBK88594.1"
FT                   /translation="MPVKKTTQVTKEDKTVKAPAKKAATKTTTVKKTAAKKKETSVEKE
FT                   TKTVKQTPTAKTTKTSKKTAAANKEVKAPAKKTASKKASEVVSKKVEQKKEMPKKEAPK
FT                   KETVKKDESKENLQRL"
FT   CDS             1003984..1005117
FT                   /transl_table=11
FT                   /locus_tag="EC1_10720"
FT                   /product="Trypsin-like serine proteases, typically
FT                   periplasmic, contain C-terminal PDZ domain"
FT                   /EC_number="1.3.1.74"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88595"
FT                   /db_xref="GOA:D4JEH3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEH3"
FT                   /protein_id="CBK88595.1"
FT                   /translation="MNQNSQTPPEFQKKKNSINPKYIAGAAAFVVAAGAFGFGGAMLAN
FT                   NMTGPSGVTINQQSGNSSAAAINDVSDIAAKCGPSVVEITTQGVASSGGLLQQQYITQG
FT                   AGSGVIMSEDGYIITNHHVIENATAIAVRTTDGQEYSAEIIGSDSQTDLAVLKINATGL
FT                   SPATFGDSDSLEVGDAAIAIGNPLGELGGTVTTGIISALDRQITIDDTTMTLLQTDAAI
FT                   NPGNSGGGLFDASGNLIGIVNAKESSTGVEGLGFAIPINGAIDIINELIEHGSVTSRPA
FT                   LNVSLYDYSGQSYYSQGNMEAGCYIVQVVEGGAADQAGLQVNDRIVKFDGQDITSSSEV
FT                   KAILNEHKIGDTVTMVIERDGQQQEVNITLQSQSQQQ"
FT   gap             1005794..1006650
FT                   /estimated_length=857
FT   CDS             1006832..1007071
FT                   /transl_table=11
FT                   /locus_tag="EC1_10740"
FT                   /product="Aldo/keto reductases, related to diketogulonate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88596"
FT                   /db_xref="GOA:D4JEH4"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEH4"
FT                   /protein_id="CBK88596.1"
FT                   /translation="MENQKIKEIAQKYNKSPAQILLRWNIQQNIIPIPKSKNPARLEEN
FT                   FFVFDFTLEDKNMQILNSMNENHRTRYNPLTFDF"
FT   CDS             complement(1007901..1008395)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10760"
FT                   /product="Deoxycytidylate deaminase"
FT                   /EC_number="3.5.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88597"
FT                   /db_xref="GOA:D4JEH5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEH5"
FT                   /protein_id="CBK88597.1"
FT                   /translation="MKRTDVLSWDEYFMSMAHLSAKRSKDPSTQVGACIVNSQKRVVGL
FT                   GYNGFPKGCDDNEFPWARDGEFLDTKYPYVVHAELNAILNSIQDLNGCTIYVSLFPCNE
FT                   CAKAIIQSGIKCVVYESDKYAGTEANIASKKMFRDAGVELVQLTYEITVDVNVKKSVQN
FT                   L"
FT   CDS             complement(1008392..1009309)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10770"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /function="ribosomal large subunit pseudouridine synthase
FT                   D"
FT                   /EC_number="5.4.99.12"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88598"
FT                   /db_xref="GOA:D4JEH6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEH6"
FT                   /protein_id="CBK88598.1"
FT                   /translation="METREFIIDDENAKIRVDKAVASLLDFSRKRVKDILDEGNILVNG
FT                   SPCKASYILQEGDHLLVNIPEVQSLEVLPENIPLNIVYEDDDVIVINKPKGMVVHPAFG
FT                   HVSGTLVNALMYHCKDLSGINGVMRPGIVHRIDKDTSGLLVVCKNDKAHLALSEQLSNK
FT                   TCHREYLAIVHHPFSHEHGTINAPIGRDEKDRQKMAVTANNSKEAITHFTVLENFKDYA
FT                   LVRCRLETGRTHQIRVHMQYIKHPIAGDPKYGHRKTIDTNGQLLHACKLEFIHPTTKEY
FT                   MSFEAEPDQTFKNILEKLRKGDSV"
FT   CDS             complement(1009285..1009788)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10780"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88599"
FT                   /db_xref="GOA:D4JEH7"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEH7"
FT                   /protein_id="CBK88599.1"
FT                   /translation="MKKKIGTYIVSLIIIVLTLGYDQWTKHIVEQSIQLNERIEVIKNF
FT                   FYLTYVQNTGAGFSLFEGFGMTFFAIVTIVALILIGYIYFMVNDYRYQLALALVFSGAI
FT                   GNFIDRLVLGYVRDFFSVYIFGSPFPVFNVADICITIGFAILLIIYIYDEYKEKKRWKQ
FT                   GNLS"
FT   CDS             complement(1009801..1011393)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10790"
FT                   /product="Predicted unusual protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88600"
FT                   /db_xref="GOA:D4JEH8"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEH8"
FT                   /protein_id="CBK88600.1"
FT                   /translation="MEQKILSSRARFAQILSILHKHHIEKGIDPVKFREILEDLGPTFV
FT                   KIGQIMSTRQDMFSERYCKELMKLRSSVTPMDFDTVQTILNEAYQKSWTEIYESIDMEP
FT                   LGSASIAQVHFAQLKNGQSVVLKIQRPYIYERMERDVSLLRKAVKVLNLSDIVSSVIDL
FT                   NMVIDEFWTAAKQEMDFTNEAMFAKRFKRLFKDCNFVYAPKIYDEYTTHQVLVMEYIEG
FT                   IEISDIEKLDSEGYDRVEIADKLAYNYISQVIEYGFFHADPHSGNLRIRDDKIVWIDFG
FT                   MMGILERRDRELMKDAVRALALRDTTKLVDTILTLGIVNQEIDYPAFTNEIERFMNQYL
FT                   NLSFSEMDLGVMVQDVFTICHHYHIALPKGISMLARSMMTIEATLNDLDPSCNMMKIIA
FT                   NHKATLTHVDLGKEAKKIASKSIDAFVKGLDLSVQSSDVLKMVQRGQVKVNLNLMGSEQ
FT                   PIAKIDRMINRLIICILIAALLMASSLICTTDMDPKILGIPALGFVGFMSALAMSIWLF
FT                   FKMLQLHRRNKSF"
FT   gap             1011419..1011940
FT                   /estimated_length=522
FT   CDS             complement(1012182..1012730)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88601"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEH9"
FT                   /protein_id="CBK88601.1"
FT                   /translation="MRKIMILFVASIVIVLSGCFVFAAEVSHIDVIETVEKSKSKTESI
FT                   VINEKTKNVVLDTSLYDQSNYSIVNDIYIVESRQDSTLAPNEVVLEYNDKFATEVSELG
FT                   DTTTIKFSSELTWIDINGNSLSNFQDYLDAWKNKTVTRKSIDPEYFNIKVRYGSNVRIL
FT                   DSDSLEYQNEYLDTGEQYY"
FT   CDS             complement(1012730..1013662)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10820"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88602"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEI0"
FT                   /protein_id="CBK88602.1"
FT                   /translation="MNKQEFLNQLEKKLDRINETERKDILMEYGTYIDDKMATGVSEED
FT                   AVFGFGDVDELAEEILDAYKINTDNVQTKVDKTLDKVYVRSESLLNRLGNLSVNDFFHI
FT                   VFDAFVLLIILFIGKVLIVDLLGNLFISLLFSFSGGYLYFIENLLEFLWAVVYFLAGVF
FT                   FFFSVMSRRINRYKNKASIRQVGVMEDIKNTWNQESRTLVNGNDDNEEKLPPLPKDRAP
FT                   LYHQRMKTPPINNEGTHILAKILIVMVAIPVVIALISFSVIFFAMIFVSITEQATSIGL
FT                   YLIFLGLICGSISILWFLIHVWPKKRGDD"
FT   CDS             complement(1013655..1013975)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10830"
FT                   /product="transcriptional regulator, PadR family"
FT                   /function="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88603"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEI1"
FT                   /protein_id="CBK88603.1"
FT                   /translation="MNTQFKKGVLELIVLQSISHKDLYGYQLVTKISEVVDVNEGTIYP
FT                   LLKRLLNDHLLESYLKESTEGPPRKYYHITAAGISKYQELLKEWNEFSKRVSDFLEEEN
FT                   NE"
FT   CDS             complement(1013959..1014387)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88604"
FT                   /db_xref="GOA:D4JEI2"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEI2"
FT                   /protein_id="CBK88604.1"
FT                   /translation="MNPRAVIYCSKHGSTKQIAKMIADKYNLPLINIMHINGYSFQEVP
FT                   VIFCGWIKKGKIQGLVKAENLFSCIEIVAVGSMPSNESSRLKLKYENNIDKQIFTYVQS
FT                   KPYIEPTLKEKIWISLFEPTLQKRFIRKEIKIEHEYTI"
FT   CDS             complement(1014476..1014607)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88605"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEI3"
FT                   /protein_id="CBK88605.1"
FT                   /translation="MDKYTPEQARRLRGISQAKMASLLGMSENTYIIYKISCLGSFF"
FT   CDS             1014753..1015469
FT                   /transl_table=11
FT                   /locus_tag="EC1_10860"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88606"
FT                   /db_xref="GOA:D4JEI4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEI4"
FT                   /protein_id="CBK88606.1"
FT                   /translation="MPEKNIIDMELYVSIGKQIKEGRTRKGISLDTLSDLIGGIKTKST
FT                   LKRYEDGNSRIEMDVLKMICDQIGLDYLDVISKARESLNKDQVETLSKVNIIFDDYFPL
FT                   HYCTNLSAGSPTELLEAEPDAVVYVPIKFQNRKKRLHAFQVNGTSMNNVIQDGSIVVAE
FT                   EVPDTVLKEGTIVVAWLNGDATVKRLYPGDSQVTLMPDSTDKGHQPIIINTDEDQIYIL
FT                   GRVIWHMNPDNISDLY"
FT   gap             1016223..1016471
FT                   /estimated_length=249
FT   CDS             1016854..1016931
FT                   /transl_table=11
FT                   /locus_tag="EC1_10890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88607"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEI5"
FT                   /protein_id="CBK88607.1"
FT                   /translation="MIEIKDVPEAEQYRESLMLRKAMNK"
FT   CDS             1017006..1017101
FT                   /transl_table=11
FT                   /locus_tag="EC1_10900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88608"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEI6"
FT                   /protein_id="CBK88608.1"
FT                   /translation="MKKLLIVVTCVPLAFSLVACGESNSSETSGK"
FT   CDS             1017548..1018243
FT                   /transl_table=11
FT                   /locus_tag="EC1_10920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88609"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEI7"
FT                   /protein_id="CBK88609.1"
FT                   /translation="MKRIILNDGIENIFRDDSFTFTPLESLDQITINYTDLKSIKIDGT
FT                   EIIARVINENGTVSTYTIPFDEQFKKEASALIKVINRNVLNNTTPPPVVDDESVEEPEK
FT                   EVFKEKHTAAFILLVISAILSIGYAVYMFYIFYTAATTPVDTGNAWADAGAELGTYIAL
FT                   RAMLPFFICEVIAAVANFIGALSKNWIVAFIAAGLYLLSIILFPSAFLNVGVQLILCII
FT                   AGVLILTKK"
FT   CDS             1018402..1018761
FT                   /transl_table=11
FT                   /locus_tag="EC1_10930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88610"
FT                   /db_xref="GOA:D4JEI8"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEI8"
FT                   /protein_id="CBK88610.1"
FT                   /translation="MAIYSRMHNGKKQWQYRTYYKAIDGSRKQKNSKWFDTKKEAVLEE
FT                   SVFIQRKKDEPYCNLTFKEVCDLWMEQNYRRLKPTTCYTKKVYINMLSPFHDIKIENIK
FT                   SVDVDTFFESKKSKS"
FT   CDS             1018857..1019489
FT                   /transl_table=11
FT                   /locus_tag="EC1_10940"
FT                   /product="Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88611"
FT                   /db_xref="GOA:D4JEI9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEI9"
FT                   /protein_id="CBK88611.1"
FT                   /translation="MYPLQKPQEKPSTGLEIVTPKEFKLFYKAMCDYRNGLWKEYANVF
FT                   WFLYMTGTRISEALSITFKDFDGKFIHINKQYFQKLKSWQTPKTKNSIRKIAIDQKTID
FT                   IIKEQYDKYSVMPRFDDSWFIFGGLKQLEPESLRRSKNIICDQLNINRFKIHSLRHSHV
FT                   SNLIEAGINPYKISKRLGHSSIQITLDIYGHLVDTDERDILNAISDF"
FT   gap             1019596..1020299
FT                   /estimated_length=704
FT   CDS             complement(1020301..1021743)
FT                   /transl_table=11
FT                   /locus_tag="EC1_10950"
FT                   /product="Leucine Rich Repeat."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88612"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEJ0"
FT                   /protein_id="CBK88612.1"
FT                   /translation="MLIPDENLGYVVSRTLRVKPHELTPELMTKITRLEAPNHEIRSLE
FT                   GLQFAENLEYMDVSNNQIETLDPIRDLRNLEILDVSSNQLRDIQALHGFRQLRKLNISR
FT                   NNLYTMDVSSIAAMIDLESLNLEKAKVDSLEYLERCKKLQEVSINTENGPFSYAILGTL
FT                   KQLKKLNMRGMRLFNIEDLTYLSSVEVLNLSTNLMSDLSPLLSMESLTELNLSNCPYIS
FT                   DYSVLTQFPNLKKLNISFNKTKDFSFLKNLSSLEELAMEQTGFSDMTLLNQMSNLRKLD
FT                   VSKNELNNVHKFKNASNLVEFRARFCQLTDIDFLKKAKKLVTLDLFSNRIQDISLLKGA
FT                   NEMVELNVGRNAIKDITCLKDMKQLEILSLENNNVTDITPLKELENLCDVDLYNNIITD
FT                   LRPLTNLKLISYLRLDHNAITDLSPLANLRFLRSLTLKANYITDVSPLKDLTLLEALRL
FT                   DDNPIEDTSVLESMEFYEKYTK"
FT   gap             1021950..1022775
FT                   /estimated_length=826
FT   CDS             1022777..1023067
FT                   /transl_table=11
FT                   /locus_tag="EC1_10960"
FT                   /product="Predicted hydrolases of the HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88613"
FT                   /db_xref="GOA:D4JEJ1"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEJ1"
FT                   /protein_id="CBK88613.1"
FT                   /translation="MFTSPFYFEFTAKGIDKAKALDAILRPIHIKPEEVIAFGDGQNDI
FT                   SILTYSGHGIAMENAVDELKEVADEITLSNENDGIAHTLYEKIPALKEIIV"
FT   CDS             1023085..1023549
FT                   /transl_table=11
FT                   /locus_tag="EC1_10970"
FT                   /product="HD domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_10970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88614"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEJ2"
FT                   /protein_id="CBK88614.1"
FT                   /translation="MRRYELVKDYVYSKFAEIQYEPLRIAAISHTASVDTCITFLAISR
FT                   GIKPEKAKIAALFHDYAQFIDNCPHTQHAKLSSIYAHKYLSETKMFKVNEIDDICFAIG
FT                   QHSKKEIYDSPLCELLKDADVLARFLENPDMELKGIRKQRLLDACADIQN"
FT   gap             1024459..1025143
FT                   /estimated_length=685
FT   CDS             complement(1026015..1027418)
FT                   /transl_table=11
FT                   /locus_tag="EC1_11020"
FT                   /product="Iron-regulated ABC transporter membrane component
FT                   SufB"
FT                   /function="Iron-regulated ABC transporter membrane
FT                   component SufB"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88615"
FT                   /db_xref="GOA:D4JEJ3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEJ3"
FT                   /protein_id="CBK88615.1"
FT                   /translation="MSDSKNLDLKNEYEYGFHDEDVSVYKTEKGLNEETVRMISKIKNE
FT                   PEWMLDLRLKAYHSFVEQKNPNWGPDLSQINFDDYTYYIKPSDRQQQNWEEVPETIRNT
FT                   FDRLGIPEAEQKYLAGVSTQYESEVVYHNMLEEVEEKGVIFLDTDTALKTCPDIFKEYF
FT                   GKIVPYTDNKYAALNTAVWSGGSFIYVPKGVKLEKPLQSYFRINSMQMGQFERTLIIVD
FT                   EGADVHYVEGCTAPIYSKDSLHAAVVEIYVHKNAKCRYSTVQNWSSNILNLVTKRAKVF
FT                   ENGHMEWIDGNVGSHINMKYPACILAEPYAKGTTISIAVASKNQIQDAGSKMIHLADHT
FT                   TSTIVSKSIARNGGEVNYRGWVNHSPKAAHAKSKVECDTLILDKVSRSDTIPLNIFKND
FT                   TSQIEHEATVSNISEEQLFYLMSRGLSREKATEMIIMGFLEPFTRELPMEYAVELNQLL
FT                   KLDMSDSIG"
FT   CDS             complement(1027411..1027854)
FT                   /transl_table=11
FT                   /locus_tag="EC1_11030"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88616"
FT                   /db_xref="GOA:D4JEJ4"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEJ4"
FT                   /protein_id="CBK88616.1"
FT                   /translation="MALDPTILRDIIMDHYEYPRNKELTEKDGYMSRHMASDSCIDDIT
FT                   VQSKIENGIIEDVRFDGVACTISTASTSIMTELVKDKSIEEAKEIIDNYFKMIDQQEYD
FT                   EDLLEEAVAFSGVGKQANRINCATIGWKALRDMINESEEKDHE"
FT   gap             1028480..1028759
FT                   /estimated_length=280
FT   CDS             complement(1029266..1030081)
FT                   /transl_table=11
FT                   /locus_tag="EC1_11060"
FT                   /product="FeS assembly ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88617"
FT                   /db_xref="GOA:D4JEJ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEJ5"
FT                   /protein_id="CBK88617.1"
FT                   /translation="MSELVIKDLHVSVEDKEILKGLDLTIKSKERHALMGPNGNGKSTL
FT                   LAAIMGNPKYTVTEGSIELDGQDVLNMEVDERSKAGLFLGMQYPSVVSGVTNSDFLRSA
FT                   INARQEKPISLFKFIKEMDKAIEQLQMKPDLAHRFLNDGFSGGEKKRNEIVQMMMLKPS
FT                   IAMLDEIDSGLDVDALRIVSDAIIKTQEETDMGLLIVSHYARFYEYLKPTHAHVLLDGK
FT                   IVVSGQADLVDKVDQEGYEWIEKEFGVFANKEDKKQPISLGSCAVKKVA"
FT   CDS             1030213..1031232
FT                   /transl_table=11
FT                   /locus_tag="EC1_11070"
FT                   /product="PPIC-type PPIASE domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88618"
FT                   /db_xref="GOA:D4JEJ6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEJ6"
FT                   /protein_id="CBK88618.1"
FT                   /translation="MGEFLRNNWFVVVIAVILISFIGYFIFDANRYNVSGKTMDGKEVV
FT                   ASIDGTDVTADDLYNELESFDSTLLYNMYRNAVINQTIETTDSLREDASTLESTIRTNA
FT                   QSNSTDYEASLAAELASYGYKSIDDLDDYCLTSVKEKEMNKAYVDEHFDEYKEAVESVS
FT                   PRTVSIISMSVTDADELTDDEQKKKDNIDQALEDGSFADAATAFSEDETTAANDGFYGY
FT                   IDSNSSSSSTTLDSSVISAALELEKGQTSDWITVTDSTTGAISLYKVHVDETDIEKIHE
FT                   SKNEDVTDQLLYAFLQNNQGLSVTIVEENAKNLDIKFNDEDVQKKIEDYISTQKGENE"
FT   CDS             1031232..1032143
FT                   /transl_table=11
FT                   /locus_tag="EC1_11080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88619"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEJ7"
FT                   /protein_id="CBK88619.1"
FT                   /translation="MKRKALLLLGTALLLTGCGGAQSTVSDSSESIMTIGDTTYTKGDL
FT                   YDLLKAASGGNMSVELIRQAILDEEIGRGDEIKQAAQDSYAELESNTPDIEDQLISAGY
FT                   EGKDDYIDKVLIPNAQYEKLTEKYFDDAKSDIRSEYKPSVVKIIQCDDEKTAQKALEAV
FT                   QDGTELDKVYEEYSSDSASYSNEEVLITTQSTDLPTRLINTMYKQEDAGVADEVFKSES
FT                   GSGTTTAYVAILVDNDYENIKDQIIENLSSSSDFSTQCLVYYLNKYNFTVHDQTVFDYL
FT                   RENNPEYLVEFPELSKTDESQS"
FT   CDS             complement(1032155..1032427)
FT                   /transl_table=11
FT                   /locus_tag="EC1_11090"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88620"
FT                   /db_xref="InterPro:IPR025233"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEJ8"
FT                   /protein_id="CBK88620.1"
FT                   /translation="MRELLPLGSVVSLYNGTKKLMVIGRIQKAVESDEVYDYSACLWPQ
FT                   GYINKDYVYLFNQEDIRCLYHIGHQDTEEFNFRFILDEEMKKIEK"
FT   CDS             complement(1032439..1033224)
FT                   /transl_table=11
FT                   /locus_tag="EC1_11100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88621"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEJ9"
FT                   /protein_id="CBK88621.1"
FT                   /translation="MFINTDSYRMLGLRFQALRNDSIHGNYSRQILIQNKLKALQSYFI
FT                   ETANLFEEHESGNTSLFTNGQLRTSHYENINIPAILTKQDKKSYFGFGAQYNIKEATLG
FT                   YHNDLIDASLRMNIGDAKANVDAEFSLWKDKKWDPRFEAELDADVALASANLQAKVGGS
FT                   KLNATVDARGAVGALYADATCVLSMEEQTIKAGVGACALRGEASIAFNIFGVKVTLTGQ
FT                   GSLGSAEANFEYSHRNREWIIGSKLGFIAGLGFKIRVNY"
FT   CDS             complement(1033205..1033390)
FT                   /transl_table=11
FT                   /locus_tag="EC1_11110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88622"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEK0"
FT                   /protein_id="CBK88622.1"
FT                   /translation="MDSSLMYYQNLKQSLNDLKSKIADTVSDVNERSYVLQAIDELCLL
FT                   CDQQIQEINIHVHQHR"
FT   CDS             complement(1033383..1033679)
FT                   /transl_table=11
FT                   /locus_tag="EC1_11120"
FT                   /product="Proteins of 100 residues with WXG."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88623"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEK1"
FT                   /protein_id="CBK88623.1"
FT                   /translation="MNNVQISSDDVLQYANQLSMMEQEILQIFQEIKAKMTYVETIWSS
FT                   PASKNLMNQFQRMYPVFDQYVQALGEYALYLNQTASSYAENEANLTAAMSANG"
FT   CDS             complement(1033691..1033984)
FT                   /transl_table=11
FT                   /locus_tag="EC1_11130"
FT                   /product="Proteins of 100 residues with WXG."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88624"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEK2"
FT                   /protein_id="CBK88624.1"
FT                   /translation="MQIRVDYEQVHQSASMIKQKAAQYDETIQKIYSRMYQMQSVWQGS
FT                   DNQAFIDKLEQFKPQLNRMTEIIEQYALYLQKSADNYQALLQDRIMKAKNLA"
FT   gap             1034160..1035757
FT                   /estimated_length=1598
FT   gap             1037173..1037769
FT                   /estimated_length=597
FT   CDS             complement(1037775..1039616)
FT                   /transl_table=11
FT                   /locus_tag="EC1_11170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88625"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEK3"
FT                   /protein_id="CBK88625.1"
FT                   /translation="MIEYMFYSTIALSYIELDKDTLIEPDDVYVTLDSSIDIEKSSFWY
FT                   QGEEIRPQNGKIFFHVYEEDESIFRYILKDGNGNVLEDSSKTITLDSINPEIEVKVNDH
FT                   LIEDTLYLVDKTPLSITCTDTHLDNFDVYVDDVLMEEDDQFEVEPGARQIKIVASDSFG
FT                   HETIRLIDVKRINVPVIDVNQDYDAYTLDPSFHFDFNEVIKESFSLIMYVDGIKTREFD
FT                   CKDLEELEIKLDKTGDYLFQLVLPQALYLNFQIEDHDQYLIHFSNDELYLNMIPDTCQT
FT                   NETVFVNMNWNPRYVKNTYLEIWNGRYWIRRDIIDQIVFAAIPGQSIQYYARAYVEDMF
FT                   SRRVEKEVSVLVDCQPPEISLQGNGQILKENELNILEKDTIIKYLSSEKTKVTMKFKIN
FT                   DQEMQNITLNQAFSQLKKDDVLYVDILAKDEVGNLSSKTYLIKKEPIVLTNPIITTSYE
FT                   TSSFYPFNQDIAHIDHIWKVDESNNLIQHETVKKYNDMTKPTIRFIRKNDNTIRIILMK
FT                   GAEYSNDRFQKIMIDDKPIDLSLLKKDKFGNYYYDHVSHTSHCTIKAIATDASGNKTSL
FT                   QEEFTFSLYQWLIPACLITFVTLLSLIVYQIRKRIYG"
FT   CDS             complement(1039619..1041031)
FT                   /transl_table=11
FT                   /locus_tag="EC1_11180"
FT                   /product="Protein kinase domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88626"
FT                   /db_xref="GOA:D4JEK4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEK4"
FT                   /protein_id="CBK88626.1"
FT                   /translation="MILNDRYLIQEQIQKSPWINVYVVEDQLTSKLYIAKEVLKEANPI
FT                   LIHQFHVEVDVLSQLEHKHFPSIIDVFETRNSMILIETYFKGIDLGQWLLKHDKISQKL
FT                   KKKWILDCIDMLQHIHEKGFLYIDLKPENLIIVDEEIYLIDFNACLEKTSHQAILASKV
FT                   NMAPEFLETGYLDQTSDIYGMGGILLALYSRGPCRKLAQKCRDTLPSKRIRSMKQLKRC
FT                   FLLCCRAKYILSIIICILLSVFLFSLLFRYTLATPLSKYLDTKNSSDLISAYQFTLNQA
FT                   EGTYQQKVQDTLYLWIDNGWISTSVLEDEKVARFLLKQAIQSQNISWCSYILNLLNDDV
FT                   KDQLIDLVLLTNVYIEQTQNIQYEHIHRFLNDLKTKTLSTSQKMENMFLILNVINECEI
FT                   ILKQQDLDILYKLQSNLSDQQNEILRSLANAYLSYGLIIQDEDLEFKIPSFYTELFKDD
FT                   LEKLEIIQFLGG"
FT   CDS             complement(1041034..1041999)
FT                   /transl_table=11
FT                   /locus_tag="EC1_11190"
FT                   /product="FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88627"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEK5"
FT                   /protein_id="CBK88627.1"
FT                   /translation="MQDWVDVIEKNDQRMKLRLKSNKLLDVSLFERFEHDDLCLRCVLN
FT                   DTASATITYAIQDFLSLDDFLDQYTFKKEEGYTFLENLFTSAVAVNRNKPVLVDPEFIF
FT                   VSNVGDRFAFVGIPLVIDEWLIQKDVWIEIVKYLINHFKSEHAYEINGFLIKFVESSEF
FT                   SLPNLILAIKALHDSYYPKKLFHFKRNNSFVLKRPLIPNTIIKECVQEYGHLPQEEKTQ
FT                   LIGSFDEYKAYLSDGTTNYPLIGETVLIGRSMACDIRIESLEISLKHAKLTRVDDRWYI
FT                   QDLKSKNKTYLNEKLVQRKMRLKDGMVISFSQKQFTFHEK"
FT   gap             1042027..1042261
FT                   /estimated_length=235
FT   CDS             1042275..1042826
FT                   /transl_table=11
FT                   /locus_tag="EC1_11200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88628"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEK6"
FT                   /protein_id="CBK88628.1"
FT                   /translation="MKFKKSYVYLHFLIINPLLNILPFFWIDVSYDNQSYIGNQLGHTI
FT                   YLVLWAISSALGFYFYSKHIWNKYRIYYHKHLHKIVCLAMCISCIIPYSNTLAFWINDL
FT                   HVWIAVAAVFLFILEWIRAYFDPACYVDTSLQKHLQYLFLLFSICTLVLFGLGHVTSLS
FT                   EILFSTLINLYLGIWYVKNA"
FT   CDS             complement(1042841..1043527)
FT                   /transl_table=11
FT                   /locus_tag="EC1_11210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88629"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEK7"
FT                   /protein_id="CBK88629.1"
FT                   /translation="MIATLAFLFYMFLFNILLRYRASCLIPITSLLYDKCDPEACASAI
FT                   IYYSTKNGKVKLKSQTLFAQCLIYLDDPQLAQDILINYPRKDAASSLSYWSLMANIYYL
FT                   MKDEDGLNRCKEEAQKIQLGFGQTGVMIQNEELASIQNKIDLMNGEFSTCKKYYLDSLN
FT                   KARFTFQQVDSCYYIALISFVEQDYPLANMYFDRVINLGNKMCYVSKAKHYQSKMENMN
FT                   LDINEG"
FT   CDS             complement(1043524..1044087)
FT                   /transl_table=11
FT                   /locus_tag="EC1_11220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88630"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEK8"
FT                   /protein_id="CBK88630.1"
FT                   /translation="MWKYRCKTHLLSLLGAFIVGCVVTAIFFFTNTETYLQILPADVYK
FT                   FISENIWLTCAAGGLSFAGVINIILIAQILMSLYNLNPFIFIILIMFAAEPLVILGIVL
FT                   VVPAIIVCIYGMVSLNKERGKEMKAHNFSQDEELVRMYKLHHKLDENVKSLAENCRKNV
FT                   NKMTYLYILGIVALFCVYSLFRIS"
FT   gap             1044180..1044394
FT                   /estimated_length=215
FT   CDS             complement(1044860..1046755)
FT                   /transl_table=11
FT                   /locus_tag="EC1_11250"
FT                   /product="Cna protein B-type domain."
FT                   /db_xref="EnsemblGenomes-Gn:EC1_11250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK88631"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR008970"
FT                   /db_xref="UniProtKB/TrEMBL:D4JEK9"
FT                   /protein_id="CBK88631.1"
FT                   /translation="MYLWIRTEIDGGWDYPLVFYDRYLQTQRNITSIRIDNFSINGQNA
FT                   YCVEPNVEIYPSIAMEILDGQAALNALHTAGYSDSQINEMALISSLGYGYANDFSEEMN
FT                   AATQVRIWQVHFGDVISNIPADIQARIDVINERIRKMNTSLSFENQTVELNGYGEKYAV
FT                   TLEDTNGILSDYVLNSSIAGVHVDKNGNTLRLWVEKGSAESGTITFDGLYSRNEANNNC
FT                   IAYFNPQNQTLASFGKTTPRQASFNYRVKETEGRIQVNKIGEALKSATVTTEEKKTKTA
FT                   FEYEEIGLENTQFEVIAAEDIKDPAGDIVYKQDEKVDTITTDQTGVALTKDLPFGKYIL
FT                   KEVQATVGYVQNKDPIEVELQISEDGQTVVQKDIKNERVKIALDLEKVSASTKKPLQNA
FT                   LYGLYLKEDLNGVDGIVLPKDTLVETSYSNEDGKIVFDGDFPLALYELKEIEPCPGYAL
FT                   NTEIIEIDARNPKDTDTIHIEKVLENDFNTISICVNKVDQNNNMIKNNRFEFGLYKDKE
FT                   CKELIESKINEDNAGYVQFNDLDVGTYYIKEITAPKGYKLSDEVVCVQVKEYGQVLINE
FT                   QEVKTDEERVYSLSYKNERIPEIQTGLQNNTTLFVVLIAISGATILIYLVRKYKA"
FT   gap             1046930..1047918
FT                   /estimated_length=989
FT   tRNA            complement(1048001..1048088)
FT                   /locus_tag="EC1_T_21520"
FT   CDS             complement(1048188..1048757)
FT                   /transl_table=11
FT                   /locus_tag="EC1_11260"
FT                   /product="ribosome biogenesis GTP-binding protein
FT                   YsxC/EngB"
FT                   /db_xref="EnsemblGenomes-Gn:EC1_