spacer

EBI Dbfetch

ID   FP929038; SV 1; linear; genomic DNA; STD; PRO; 3522704 BP.
XX
AC   FP929038;
XX
PR   Project:PRJEA45861;
XX
DT   25-MAR-2010 (Rel. 104, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 2)
XX
DE   Coprococcus catus GD/7 draft genome.
XX
KW   .
XX
OS   Coprococcus catus GD/7
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae;
OC   Coprococcus.
XX
RN   [1]
RG   metaHIT consortium -- http://www.metahit.eu/
RA   Pajon A., Turner K., Parkhill J., Duncan S., Flint H.;
RT   "The genome sequence of Coprococcus catus GD/7";
RL   Unpublished.
XX
RN   [2]
RA   Pajon A.;
RT   ;
RL   Submitted (23-MAR-2010) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
XX
DR   MD5; 0c967fba0e657f97cf5f2598b9174cb7.
DR   BioSample; SAMEA2272068.
DR   EnsemblGenomes-Gn; CC1_R_34990.
DR   EnsemblGenomes-Gn; CC1_R_35000.
DR   EnsemblGenomes-Gn; CC1_T_34530.
DR   EnsemblGenomes-Gn; CC1_T_34540.
DR   EnsemblGenomes-Gn; CC1_T_34550.
DR   EnsemblGenomes-Gn; CC1_T_34560.
DR   EnsemblGenomes-Gn; CC1_T_34570.
DR   EnsemblGenomes-Gn; CC1_T_34580.
DR   EnsemblGenomes-Gn; CC1_T_34590.
DR   EnsemblGenomes-Gn; CC1_T_34600.
DR   EnsemblGenomes-Gn; CC1_T_34610.
DR   EnsemblGenomes-Gn; CC1_T_34620.
DR   EnsemblGenomes-Gn; CC1_T_34630.
DR   EnsemblGenomes-Gn; CC1_T_34640.
DR   EnsemblGenomes-Gn; CC1_T_34650.
DR   EnsemblGenomes-Gn; CC1_T_34660.
DR   EnsemblGenomes-Gn; CC1_T_34670.
DR   EnsemblGenomes-Gn; CC1_T_34680.
DR   EnsemblGenomes-Gn; CC1_T_34690.
DR   EnsemblGenomes-Gn; CC1_T_34700.
DR   EnsemblGenomes-Gn; CC1_T_34710.
DR   EnsemblGenomes-Gn; CC1_T_34720.
DR   EnsemblGenomes-Gn; CC1_T_34730.
DR   EnsemblGenomes-Gn; CC1_T_34740.
DR   EnsemblGenomes-Gn; CC1_T_34750.
DR   EnsemblGenomes-Gn; CC1_T_34760.
DR   EnsemblGenomes-Gn; CC1_T_34770.
DR   EnsemblGenomes-Gn; CC1_T_34780.
DR   EnsemblGenomes-Gn; CC1_T_34790.
DR   EnsemblGenomes-Gn; CC1_T_34800.
DR   EnsemblGenomes-Gn; CC1_T_34810.
DR   EnsemblGenomes-Gn; CC1_T_34820.
DR   EnsemblGenomes-Gn; CC1_T_34830.
DR   EnsemblGenomes-Gn; CC1_T_34840.
DR   EnsemblGenomes-Gn; CC1_T_34850.
DR   EnsemblGenomes-Gn; CC1_T_34860.
DR   EnsemblGenomes-Gn; CC1_T_34870.
DR   EnsemblGenomes-Gn; CC1_T_34880.
DR   EnsemblGenomes-Gn; CC1_T_34890.
DR   EnsemblGenomes-Gn; CC1_T_34900.
DR   EnsemblGenomes-Gn; CC1_T_34910.
DR   EnsemblGenomes-Gn; CC1_T_34920.
DR   EnsemblGenomes-Gn; CC1_T_34930.
DR   EnsemblGenomes-Gn; CC1_T_34940.
DR   EnsemblGenomes-Gn; CC1_T_34950.
DR   EnsemblGenomes-Gn; CC1_T_34960.
DR   EnsemblGenomes-Gn; CC1_T_34970.
DR   EnsemblGenomes-Gn; CC1_T_34980.
DR   EnsemblGenomes-Tr; CC1_R_34990.
DR   EnsemblGenomes-Tr; CC1_R_35000.
DR   EnsemblGenomes-Tr; CC1_T_34530.
DR   EnsemblGenomes-Tr; CC1_T_34540.
DR   EnsemblGenomes-Tr; CC1_T_34550.
DR   EnsemblGenomes-Tr; CC1_T_34560.
DR   EnsemblGenomes-Tr; CC1_T_34570.
DR   EnsemblGenomes-Tr; CC1_T_34580.
DR   EnsemblGenomes-Tr; CC1_T_34590.
DR   EnsemblGenomes-Tr; CC1_T_34600.
DR   EnsemblGenomes-Tr; CC1_T_34610.
DR   EnsemblGenomes-Tr; CC1_T_34620.
DR   EnsemblGenomes-Tr; CC1_T_34630.
DR   EnsemblGenomes-Tr; CC1_T_34640.
DR   EnsemblGenomes-Tr; CC1_T_34650.
DR   EnsemblGenomes-Tr; CC1_T_34660.
DR   EnsemblGenomes-Tr; CC1_T_34670.
DR   EnsemblGenomes-Tr; CC1_T_34680.
DR   EnsemblGenomes-Tr; CC1_T_34690.
DR   EnsemblGenomes-Tr; CC1_T_34700.
DR   EnsemblGenomes-Tr; CC1_T_34710.
DR   EnsemblGenomes-Tr; CC1_T_34720.
DR   EnsemblGenomes-Tr; CC1_T_34730.
DR   EnsemblGenomes-Tr; CC1_T_34740.
DR   EnsemblGenomes-Tr; CC1_T_34750.
DR   EnsemblGenomes-Tr; CC1_T_34760.
DR   EnsemblGenomes-Tr; CC1_T_34770.
DR   EnsemblGenomes-Tr; CC1_T_34780.
DR   EnsemblGenomes-Tr; CC1_T_34790.
DR   EnsemblGenomes-Tr; CC1_T_34800.
DR   EnsemblGenomes-Tr; CC1_T_34810.
DR   EnsemblGenomes-Tr; CC1_T_34820.
DR   EnsemblGenomes-Tr; CC1_T_34830.
DR   EnsemblGenomes-Tr; CC1_T_34840.
DR   EnsemblGenomes-Tr; CC1_T_34850.
DR   EnsemblGenomes-Tr; CC1_T_34860.
DR   EnsemblGenomes-Tr; CC1_T_34870.
DR   EnsemblGenomes-Tr; CC1_T_34880.
DR   EnsemblGenomes-Tr; CC1_T_34890.
DR   EnsemblGenomes-Tr; CC1_T_34900.
DR   EnsemblGenomes-Tr; CC1_T_34910.
DR   EnsemblGenomes-Tr; CC1_T_34920.
DR   EnsemblGenomes-Tr; CC1_T_34930.
DR   EnsemblGenomes-Tr; CC1_T_34940.
DR   EnsemblGenomes-Tr; CC1_T_34950.
DR   EnsemblGenomes-Tr; CC1_T_34960.
DR   EnsemblGenomes-Tr; CC1_T_34970.
DR   EnsemblGenomes-Tr; CC1_T_34980.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01059; mir-598.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01699; Clostridiales-1.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF02004; group-II-D1D4-5.
DR   RFAM; RF02005; group-II-D1D4-6.
XX
CC   This is a reference genome for the metaHIT project
CC   DNA source: Rowett Institute of Nutrition and Health, University of
CC   Aberdeen -- http://www.rowett.ac.uk/divisions/ghp/
CC   Sequencing technology: 454
CC   Genome coverage: 21x
CC   Annotation was added using ab initio prediction IMG/ER --
CC   http://img.jgi.doe.gov/submit (Markowitz, Szeto et al. 2007).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3522704
FT                   /organism="Coprococcus catus GD/7"
FT                   /strain="GD/7"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:717962"
FT   CDS             complement(106..549)
FT                   /transl_table=11
FT                   /locus_tag="CC1_00100"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK78991"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3S0"
FT                   /protein_id="CBK78991.1"
FT                   /translation="MRMNINHATKAGVTVHEYKVLEKRDPALEAEFDRITNEWLEGKKS
FT                   GMLQFTMGTVVLENPMDKRYFYAVNADGKMVAFIVFVPFLGKNGYMADVTRHGKDAPGG
FT                   VMETIIYDAFQIFKEEGVGYGSLGVAPLAGLDSDSKNPSVYDD"
FT   CDS             750..1793
FT                   /transl_table=11
FT                   /locus_tag="CC1_00110"
FT                   /product="Uncharacterized ABC-type transport system,
FT                   periplasmic component/surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK78992"
FT                   /db_xref="GOA:D4J3S1"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3S1"
FT                   /protein_id="CBK78992.1"
FT                   /translation="MKKLVCLGLVAALVVSLAACGSSNTKSTESKATESAAASESSADQ
FT                   AEAASGLKIALVMSGAANDQGWNQTAYEGTQKACEKYGCELAYTENVSTADIAAVFADY
FT                   AGSGYDIVIGHGYEFGDPALEVAATYPDTKFICTEADAAADNVASYVMACEQTAYVEGI
FT                   IAASMTKSGKIGAIGPIPGDSLVKIINGYEDGAKTINPDIDVQTAWTNSFVDTQLAQEA
FT                   AKAMIENGADVIKHCANACGNGAMSAAVDANIWCQGDSYDQSSLAPNNILDSAIYNLDV
FT                   VLDKAIESVVEGSFSGDVYNLGMADGAVEVLLSDNLPDDVKATAEQAIEQIKSGEVEVV
FT                   RDYTLRD"
FT   CDS             1855..3381
FT                   /transl_table=11
FT                   /locus_tag="CC1_00120"
FT                   /product="ABC-type uncharacterized transport systems,
FT                   ATPase components"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK78993"
FT                   /db_xref="GOA:D4J3S2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3S2"
FT                   /protein_id="CBK78993.1"
FT                   /translation="MPLLQMKHICKSFSGVYANEDINLTVEKGEIHALLGENGAGKTTL
FT                   MNILFGLYRADSGEIFWKDQLANFTSPKEAIAAGVGMVQQHFSLVNKMTVLDNVILNLK
FT                   GNAFVLNRAAARARLVELAEKYGLQVNPDALICELSVGEQQRVEILKALYRNVELLILD
FT                   EPTGVLTPQETTQFFDVLRNLKNEGYGIIIITHRMSEIMAISDRVTILRDGKQVADLVT
FT                   AETNPGELSAYMIGRELNESYNIEETPKAENMLVMKHVSNDHKHHGRHKIEAIDLVIRK
FT                   GEILGIAGVEGNGQKELAEVITGIQKKKSGQIILDGQDMAGKTIRERYEAGISYISEDR
FT                   LSDSLITGMNIIDNLLLRDYKKLPFAKHSIVNRSAMRKNAKEKMQQYQVRASGKSGVDT
FT                   QVRLLSGGNQQKLIIARELTDSAKLIIASQPTRGLDIGATEFVRQQLINQRNAGKAVML
FT                   ISADLEEIMALSDRIAVLFGGKIVGVLSREEATVQKIGLLMGGISEEEEK"
FT   CDS             3381..4436
FT                   /transl_table=11
FT                   /locus_tag="CC1_00130"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK78994"
FT                   /db_xref="GOA:D4J3S3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3S3"
FT                   /protein_id="CBK78994.1"
FT                   /translation="MQNEKNRTRAVTDVIIILVLTILTGTILIIACGANPADAYALFFR
FT                   GIFGTKAGFTEIFVKACPLILTGLGCAVVYRTGFFNIGAEGQFYVGAMITTIIALNLTA
FT                   VPGILRLILALAAGFVAGGLWALIAAVFKAKFNISEIIVTIMLNYIAINFLGYAVRSFL
FT                   MDPAGNVPQSAKIDEAAQLKVLIPATRFHAGILIAVACVFVVWFFLDKTTMGYELRAVG
FT                   LNKRGSACNGISVMKNIVLSAFLSGGLSAVAGGIEVLATQKKLLEGISANCGYTAVLIA
FT                   LVAFNHPIGVLIVAVLYSAMQVGASSMQRQMGVPSSIVNILIGVVVVLILARELFHKIK
FT                   IRNNKEKGGRA"
FT   CDS             4436..5377
FT                   /transl_table=11
FT                   /locus_tag="CC1_00140"
FT                   /product="Uncharacterized ABC-type transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK78995"
FT                   /db_xref="GOA:D4J3S4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3S4"
FT                   /protein_id="CBK78995.1"
FT                   /translation="MLEQILTVSFMTAFLAAAVRLAVPLMYGGIGEIIAEKSGILNIGM
FT                   EGVMLSGAFFSFAGAWFSKSLMVGLLCGILGGLAVSLLHGLLSITLIQNQSVSGLAINM
FT                   LMLGVTSFLYKLMSNGQSYQQLETFQSIALPGLSSIPLIGPAFFNCDILTYILYIFLIL
FT                   TWLFYKKTNLGLSFAAVGEHPRAAESAGIHVNQYRWIVMIFNGVLGGIGGAYLVLVQLG
FT                   VFTENMISGRGYIALATVILGRYTPFGMFGAALLFGAANALQIRLQTIGVSISPFLLAI
FT                   LPYALTLIAMLGAIGKSSEPEALSQPYVKGSR"
FT   CDS             6256..7539
FT                   /transl_table=11
FT                   /locus_tag="CC1_00160"
FT                   /product="Cytosine deaminase and related metal-dependent
FT                   hydrolases"
FT                   /EC_number="3.5.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK78996"
FT                   /db_xref="GOA:D4J3S5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3S5"
FT                   /protein_id="CBK78996.1"
FT                   /translation="MGKTDMAVKVYHGDIVYTPSADKLAVYENSYIVVDGGKVAGIYET
FT                   LPEQYANAACTDYGRKMIIPAFSDLHVHGSQYVQRGIGMDCLLSNWLNHYTFPQEAEFK
FT                   DLSYAKKCYDAFVDDMICHGTFHANVFGTIHREATDYLFRKMEEKGMYGFVGKVNMDCN
FT                   SPEFLIETTEDSLRETEIYLDSHTGSGKVKPILAPRFAPTCSEKLMTGLGMLAAKYHCG
FT                   VHTHLVESIWEAEEALRCFPGYHSDAEIYERAGLMDHGPSIFAHVIFPTEEDKRIMKEH
FT                   GSFSVHCPDATTNIIAGIMPLAAMHDEELKIAIGSDVAGGHSIAIYKQIARAVQLSKLK
FT                   EFYEPDQSQTITLTQAFYHATKEAGSVFGKVGSFEKGYQFNALVIDTMEDSWVPLTAEE
FT                   RLERFCYIGDDRNIRARFIDGEEIHFEN"
FT   CDS             7613..7825
FT                   /transl_table=11
FT                   /locus_tag="CC1_00170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK78997"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3S6"
FT                   /protein_id="CBK78997.1"
FT                   /translation="MLCFLLLSKKIRKFNLIIHALTGWGYNFDDPVGSSIAAIFIKFIC
FT                   ITNNRNIGFKVIAVIPVQKTAKGAG"
FT   CDS             8236..12252
FT                   /transl_table=11
FT                   /locus_tag="CC1_00180"
FT                   /product="CRISPR-associated endonuclease, Csn1 family"
FT                   /function="CRISPR-associated endonuclease, Csn1 family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK78998"
FT                   /db_xref="GOA:D4J3S7"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR025978"
FT                   /db_xref="InterPro:IPR028629"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3S7"
FT                   /protein_id="CBK78998.1"
FT                   /translation="MKQEYFLGLDMGTGSLGWAVTDSTYQVMRKHGKALWGTRLFESAS
FT                   TAEERRMFRTARRRLDRRNWRIQVLQEIFSEEISKVDPGFFLRMKESKYYPEDKRDAEG
FT                   NCPELPYALFVDDNYTDKNYHKDYPTIYHLRKMLMETTEIPDIRLVYLVLHHMMKHRGH
FT                   FLLSGDISQIKEFKSTFEQLIQNIQDEELEWHISLDDAAIQFVEHVLKDRNLTRSTKKS
FT                   RLIKQLNAKSACEKAILNLLSGGTVKLSDIFNNKELDESERPKVSFADSGYDDYIGIVE
FT                   AELAEQYYIIASAKAVYDWSVLVEILGNSVSISEAKIKVYQKHQADLKTLKKIVRQYMT
FT                   KEDYKRVFVDTEEKLNNYSAYIGMTKKNGKKVDLKSKQCTQADFYDFLKKNVIKVIDHK
FT                   EITQEIESEIEKENFLPKQVTKDNGVIPYQVHDYELKKILDNLGTRMPFIKENAEKIQQ
FT                   LFEFRIPYYVGPLNRVDDGKDGKFTWSVRKSDARIYPWNFTEVIDVEASAEKFIRRMTN
FT                   KCTYLVGEDVLPKDSLVYSKFMVLNELNNLRLNGEKISVELKQRIYEELFCKYRKVTRK
FT                   KLERYLVIEGIAKKGVEITGIDGDFKASLTAYHDFKERLTDVQLSQRAKEAIVLNVVLF
FT                   GDDKKLLKQRLSKMYPNLTTGQLKGICSLSYQGWGRLSKTFLEEITVPAPGTGEVWNIM
FT                   TALWQTNDNLMQLLSRNYGFTNEVEEFNTLKKETDLSYKTVDELYVSPAVKRQIWQTLK
FT                   VVKEIQKVMGNAPKRVFVEMAREKQEGKRSDSRKKQLVELYRACKNEERDWITELNAQS
FT                   DQQLRSDKLFLYYIQKGRCMYSGETIQLDELWDNTKYDIDHIYPQSKTMDDSLNNRVLV
FT                   KKNYNAIKSDTYPLSLDIQKKMMSFWKMLQQQGFITKEKYVRLVRSDELSADELAGFIE
FT                   RQIVETRQSTKAVATILKEALPDTEIVYVKAGNVSNFRQTYELLKVREMNDLHHAKDAY
FT                   LNIVVGNAYFVKFTKNAAWFIRNNPGRSYNLKRMFEFDIERSGEIAWKAGNKGSIVTVK
FT                   KVMQKNNILVTRKAYEVKGGLFDQQIMKKGKGQVPIKGNDERLADIEKYGGYNKAAGTY
FT                   FMLVKSLDKKGKEIRTIEFVPLYLKNQIEINHESAIQYLAQERGLNSPEILLSKIKIDT
FT                   LFKVDGFKMWLSGRTGNQLIFKGANQLILSHQEAAILKGVVKYVNRKNENKDAKLSERD
FT                   GMTEEKLLQLYDTFLDKLSNTVYSIRLSAQIKTLTEKRAKFIGLSNEDQCIVLNEILHM
FT                   FQCQSGSANLKLIGGPGSAGILVMNNNITACKQISVINQSPTGIYEKEIDLIKL"
FT   CDS             12249..13121
FT                   /transl_table=11
FT                   /locus_tag="CC1_00190"
FT                   /product="CRISPR-associated protein, Cas1 family"
FT                   /function="CRISPR-associated protein, Cas1 family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK78999"
FT                   /db_xref="GOA:D4J3S8"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3S8"
FT                   /protein_id="CBK78999.1"
FT                   /translation="MSWRIIVISKRAKLDLQLGKMVVRSDEITKIVLSEISTIIIESTA
FT                   VSITASLISELAKRKIKVIFCDEKRNPSCELVNYYGSHDTSNKIRKQIAWKQQTKEAIW
FT                   TEIVTDKIRKQKDLLELLRRKESALLDTYLKKITWNDGTNREGHAAKVYFNSLFGLDFT
FT                   RTEDSLINAALNYGYSVLMSAFAREIVASGYLTQLGIFHDNMFNQFNLASDLMEPFRIL
FT                   IDREVLMMTLEVFQHSEKMQLVNVLNHEVRIDGKVQYVNNAIKIYCKSVFDALSEDDSA
FT                   LIRFYKIEL"
FT   CDS             13428..14099
FT                   /transl_table=11
FT                   /locus_tag="CC1_00210"
FT                   /product="CRISPR-associated protein, Csn2 family"
FT                   /function="CRISPR-associated protein, Csn2 family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79000"
FT                   /db_xref="InterPro:IPR010146"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3S9"
FT                   /protein_id="CBK79000.1"
FT                   /translation="MKMVHSELSGEIISESAAFTEWIIESPKDFSEYLHELYCQYEKDE
FT                   GRFVLSQRDKILELSKYLEIIVNPFTVEINSRKILNKLYIKLEKVSKEEQMYEETLKLT
FT                   AYIHEYLMQLEQQTNYILSFDDNLEIPALLKAVGIKHEEMEDDFFERIIRYVKIAVEVL
FT                   STKVFVFVNIRSYLTDEQIQELIKEIRYQEAKILFMESQERACLEGGMRYIIDRDGCEI
FT                   Y"
FT   repeat_region   14293..15122
FT                   /rpt_family="CRISPR"
FT   CDS             15310..16206
FT                   /transl_table=11
FT                   /locus_tag="CC1_00220"
FT                   /product="Restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79001"
FT                   /db_xref="GOA:D4J3T0"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR025745"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3T0"
FT                   /protein_id="CBK79001.1"
FT                   /translation="MAVPKYYEMYHSFLQSLSDGEEHPYSDVKKKVIEDFKLTDIELAE
FT                   LLPSGKQPVFSNRIGWCRTYLKKAGLIESPTKAHFMITKSGREVLKSGKKITNEVLREF
FT                   PSFVKFIDGDTKKVKDTAEEKDSLNTDETPQETLERVYGELNNVLKDELLTRIHEKSPD
FT                   FFEKMVVELMEKMGYGRGQITQKSRDEGIDGMVYQDKLGFDVIYIQAKRYDLEKTVGRP
FT                   ELQKFGGAIPEKNAKGLFVTTGRFSPDAQKYANDRHIILIDGQHLAELMIEHDFGVSTE
FT                   YTYRIKRIDMDVFEEED"
FT   CDS             16248..16589
FT                   /transl_table=11
FT                   /locus_tag="CC1_00230"
FT                   /product="Arsenate reductase and related proteins,
FT                   glutaredoxin family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79002"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3T1"
FT                   /protein_id="CBK79002.1"
FT                   /translation="MNIQIFGTSKCFDSKKAMRYFKERGIKYQWIDMKEKGLSKGEYTK
FT                   VKQAVGGLDAMLNPKCKDQDTLALIRYIADEDKDEKVLENQQVLKTPIVRNGTLATVGY
FT                   QPDVWKGWK"
FT   CDS             16596..17693
FT                   /transl_table=11
FT                   /locus_tag="CC1_00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79003"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3T2"
FT                   /protein_id="CBK79003.1"
FT                   /translation="MEPYYYQQMNKQKQAVYHAILQGITALADEFQIPAIEGSELYDVF
FT                   FQLRLDHPEIFWATGFKYKYFKDSPNYIFIPEYIFEKNKIREHQRALKARVDKLIRPAK
FT                   HLSDIEKEKYIHDFVCENVRYDKLKKAYSHEIIGPLGQGVGVCEGIAKSVKILCDALNL
FT                   WCIIAICGNNPEKGIKYRHTWNIIRLDGKYYHLDATFDNSLGRSGSGAPEIRYDYFNLD
FT                   DKAVFRDHEPLIAPAPACTDNSRFYYKEKKLSFTKTEEVYKRFLQAAKKGKTLTFHWRG
FT                   GYLTREVLEELLDLMQQAGAVKNKTAVVGLNWAQAVLRLHYVESAEAGDENAEAANGAI
FT                   GKGTHKAKIDVTMEDANEGEQIETD"
FT   CDS             17987..18673
FT                   /transl_table=11
FT                   /locus_tag="CC1_00250"
FT                   /product="Bacterial SH3 domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79004"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3T3"
FT                   /protein_id="CBK79004.1"
FT                   /translation="MIKRKLALLGTAVAVSLLMTVPAFAADTKDTDTAQNAQNTQSVQE
FT                   EKTEENTEENTGYVTCSVLNVRRASSEKSDKVGTLKRGEEVKILRDEENGWYAIDFEGH
FT                   IRYVHGDYITTDQNEVNGYTASSWDGPVLTASAGTINGPSGKETYYNLNMSGVVSIMRS
FT                   LGNTDEYWVRDDGVKMLGDYVMVAANLNVHPRGSIVETSLGLGIVCDTGGFASGNSTQL
FT                   DIAVSW"
FT   CDS             18740..18835
FT                   /transl_table=11
FT                   /locus_tag="CC1_00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79005"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3T4"
FT                   /protein_id="CBK79005.1"
FT                   /translation="MIEISRRAVLFGLFYIMIKKFDDEDKEVSDD"
FT   CDS             18828..19223
FT                   /transl_table=11
FT                   /locus_tag="CC1_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79006"
FT                   /db_xref="GOA:D4J3T5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3T5"
FT                   /protein_id="CBK79006.1"
FT                   /translation="MIKIGMLLPYEDMLLIAKRVYEATDESIREALTAAADLARVAESE
FT                   KLNTAQFETVLDTSFNSIIKLNTVGNIIVINKMIENRIGKDEEEVVGLPVEEILPNVDR
FT                   SRIESILEGKVKAMFPDYLHNIIKQKI"
FT   CDS             19292..20149
FT                   /transl_table=11
FT                   /locus_tag="CC1_00280"
FT                   /product="Aldo/keto reductases, related to diketogulonate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79007"
FT                   /db_xref="GOA:D4J3T6"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3T6"
FT                   /protein_id="CBK79007.1"
FT                   /translation="MKEEYLKLNDGSRMPRLGMGTWYLGENKAARKQEIEALRAGIHAG
FT                   CSLIDTAEMYGSGKSEQLIGEAIKGIDRSSLFIVSKVYPHNAGRAHIFDALDRSLRNLR
FT                   TDYLDLYLLHWRGQVPLRETVECMEQLVKEGKIRRWGVSNFDTDDMEELFSVKNGDHCA
FT                   VNQVLYHLGSRGVEYDLMPWLEEHHVPLMAYCPLAQGGDLRRGLLNNKAVQMVAEQRHI
FT                   TAMQVLLAFVLHHENVIAIPRSGKAEHVLENCQAAEIKLTEEEYRLLDRAFPAPDHKVW
FT                   LDIV"
FT   CDS             20378..21769
FT                   /transl_table=11
FT                   /locus_tag="CC1_00290"
FT                   /product="K+ transport systems, NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79008"
FT                   /db_xref="GOA:D4J3T7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3T7"
FT                   /protein_id="CBK79008.1"
FT                   /translation="MAKDHKQGKRGLNIIIVGCGKVGASLTEQLYKEGHDITLVDRSSD
FT                   RLQALTDMYDVMGIVGNGASYKIQREAGIDTADLMIAVTDSDELNLLCCTVAKRVGDCA
FT                   AIARVRTPDYSDEVSYLKEKLGLAMIINPEMEAANEITHVLSLPAALGVNSFAHGQAQM
FT                   IRFKIPVNNRLDGQKVMAMARNISGDVLVCAVEREKQVFIPDGNFELHQGDVVSFIAAS
FT                   KAAKEFFERIGMPNKPVHNTMIIGGGKAAYYLGKMLLDMGIEVKIIEMDRKRCRELSVL
FT                   LPQATIINGDGTDEELLKEEEIAYVDSLVPLTGIDEENVLLALHAREVSDAKVITKVNR
FT                   NAFHNLIDKLDLGSVIYPKYITAEAIVAYVRAKQASMDSSNVETIYHMFDSRAEAIEFN
FT                   VSASSRVTDVPLKDLNTKDNLLIACINRYGKIIIPGGMDCIQAGDTVVIVTTHTGFQNI
FT                   EDILR"
FT   CDS             21782..23269
FT                   /transl_table=11
FT                   /locus_tag="CC1_00300"
FT                   /product="Trk-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79009"
FT                   /db_xref="GOA:D4J3T8"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3T8"
FT                   /protein_id="CBK79009.1"
FT                   /translation="MNGGMIRFILGSVLKVESVLLLFPCIVAVFYRESAGYWFLLTAVL
FT                   SFVIGYLMVRKKPANTVFYLKEGCVTTALSWIMISLVGCLPFYLSGEIPAFTDALFETI
FT                   SGFTTTGASILSDVECLSQSILFWRSFSHWIGGMGVLVFLLAIIPLSGGSHMNLMRAES
FT                   PGPSVGKLVPKVRATARILYLIYFGMTIVELIFLLIGKMPFLEAMMITFGTAGTGGFGV
FT                   RNTSIGGYSAYIQWVVAIFMILFGVNFNAYYFLLMKRFKQAFDMEEVKGYFLVIAAASA
FT                   LIFINIYDKTMTAADTIRHVVFQVGSLMTSTGYSTVDFDLWPSASKVVLIIIMFIGACA
FT                   GSTGGGIKVSRVIMMLKSVKRELNAYLHPKSVRMIKMEGKALDQGAISSVAVYFITFTL
FT                   IFAVSFLLVALEGRDLTTNFTAVLTTMNNMGPGLADVGPSKNFGGLSILSKYVLMFDML
FT                   AGRLELFPMLVLFHPVLWKETWEGGKRRRRLKRKKVS"
FT   CDS             23330..24496
FT                   /transl_table=11
FT                   /locus_tag="CC1_00310"
FT                   /product="galactokinase"
FT                   /function="galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79010"
FT                   /db_xref="GOA:D4J3T9"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022963"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3T9"
FT                   /protein_id="CBK79010.1"
FT                   /translation="MKERLLREFAERFGNAEGAQVYFAPGRVNLIGEHTDYNGGHVFPC
FT                   ALDIGTYAVVRKRQDKRLFFYSMNYPEAGIINSSLTGQLEHDDEDGWANYPKGVIWAFE
FT                   EKGMQPACGFEMMVYGNLPSGAGLSSSASLEVLTGWALRDIFEFEVSDQEIALISQHAE
FT                   NTFNGVRCGVMDQFAVAMGRAHQAIYLNTENLSYRYVPVQLQNMQLIISCTNKERGLAD
FT                   SKYNLRRMECERALADLQKVASIRQLGELSMDDFEKYQAAITDDVCRRRARHAVSENAR
FT                   TIQAVQALENNDLNRFGRLMNASHQSLRDDYEVTGDELDALVEAAWDTEGVLGSRMTGA
FT                   GFGGCTISLVRTEAVDNFIKNVGRIYRQQIGYPADFYICQIGDGPGKL"
FT   CDS             24513..25520
FT                   /transl_table=11
FT                   /locus_tag="CC1_00320"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /function="UDP-galactose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79011"
FT                   /db_xref="GOA:D4J3U0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR008089"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR025308"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3U0"
FT                   /protein_id="CBK79011.1"
FT                   /translation="MKILVSGGTGYIGSHTCVELLNKGYDVVAFDNLYNSKIDVVDRVE
FT                   KITGKKLIFYKADMLDKESMRPIFEEHKFDAVIHFAALKAVGESVQKPLAYYKNNISGS
FT                   LNLCELMNEYGCKRIIFSSSATVYGAPKTVPITEDFPLSTTNPYGSTKLMLERIFSDFC
FT                   VPDPEWSVVLLRYFNPIGAHESGLLGESPNGIPNNLMPYIAQVAAGKLECLGVFGNDYD
FT                   TPDGTGVRDYIHVVDLAKGHVNAVEKVTSSTGVNIYNLGTGIGYSVLDIVKAFEAANGI
FT                   KIPYVIKPRRAGDIAICYANPGKAKRELGWEAKYDLERMCKDSWNFTKKSLGLE"
FT   CDS             25530..25808
FT                   /transl_table=11
FT                   /locus_tag="CC1_00330"
FT                   /product="Protein of unknown function (DUF1292)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79012"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3U1"
FT                   /protein_id="CBK79012.1"
FT                   /translation="MADLITFVTETGQIIRGSVMGAFEDDLSGKNYVIYTDNSINETGN
FT                   YNIYAASYDPEQEDEQILIHAIETEAEWQRIEMMMQKLSKGPERYGE"
FT   CDS             26070..27326
FT                   /transl_table=11
FT                   /locus_tag="CC1_00340"
FT                   /product="nucleoside-binding protein"
FT                   /function="nucleoside-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79013"
FT                   /db_xref="GOA:D4J3U2"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3U2"
FT                   /protein_id="CBK79013.1"
FT                   /translation="MKKFLALVLTVVMAASLAACGNSGTKETQAPASGDSETAAESTAA
FT                   ESTGETAEKVGEGVDVKDLKVGFIFIGDENEGYTAAHYAGAKGMQEALGLSDDQIIIKW
FT                   NIPEDETCYDAAVDLADQGCNIVFANSFGHESYILQAAAEFPDVQFCHATGYQAAGSGL
FT                   ANMHNYFTSIYESRYVSGVVAGMKLNEMIADGKITEDTAKVGYVGAYPYAEVISGFTSF
FT                   FLGVRSQCPSATMEVKYTNSWASFDLEKECAESLIADKCVLISQHADTTGAPTACQAAG
FT                   VPCVGYNISMIETAPDAALTSASINWEPYYEYATKSVIDGTAIDTDWCKGFAEGADKLT
FT                   DLNDKVVAEGTAEKVKEVEDAIIDGSLHVFDTSTFTVNGKELTDADSEYISDGYFHESE
FT                   KASAPAFDFIIDGITAVTQ"
FT   CDS             27392..28942
FT                   /transl_table=11
FT                   /locus_tag="CC1_00350"
FT                   /product="nucleoside ABC transporter ATP-binding protein"
FT                   /function="nucleoside ABC transporter ATP-binding protein"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79014"
FT                   /db_xref="GOA:D4J3U3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3U3"
FT                   /protein_id="CBK79014.1"
FT                   /translation="MVEAVNAIELKNITKRFGEKVIANDSVNLTVRKGEILSLLGENGS
FT                   GKTTLMNMLSGIYFPDEGQIFVNGKEVMISSPKDAFDLGIGMIHQHFKLIEVLTAAENI
FT                   ILGLPGKMTLNMDEVIKDIQALVDKYGFELDCRKKIYEMSVSEKQTVEIVKMLYRGSDI
FT                   LILDEPTAVLTPQETEKLFAVLRNMRADGRSIIIITHKLHEVLALSDRVSVLRKGKYIG
FT                   TVNTCDATESSLTEMMVGEKVSLNIDRPEPENPREILKVSGLTCLDNEGVKSLDDVSFT
FT                   AFGGEILGVAGIAGSGQKELLEAITNLCPIAEGTISCVNEHGKEVVISGKSPEHISKES
FT                   IHIAHISFVPEDRLGMGLVASMDMTDNMMLRSYREGKGIFADRKKPRELAERLIDKLSI
FT                   VTPGVSTPVGRLSGGNVQKVLVGREIAMHPDILLVAYPVRGLDINSSYQIYNLMNEQKK
FT                   KGVAVICVIEDLDVLLEISDRILVLCGGRVTGIVDGRTATKDEIGLLMTKGQKEESHV"
FT   CDS             28935..30017
FT                   /transl_table=11
FT                   /locus_tag="CC1_00360"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /function="nucleoside ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79015"
FT                   /db_xref="GOA:D4J3U4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3U4"
FT                   /protein_id="CBK79015.1"
FT                   /translation="MFKDSSLHIAARDSIVWWKAWLIRLIAVLLSLIVCAIVIFGLTKM
FT                   NPVEVYKGIFSGAVGTSRRAWVTIRDTMVLLLIAIGLTPAFKMKFWNIGAEGQILVGGA
FT                   ATAALMIYAGDSLPTPVLMILMFVASMAAGVIWGVIPAIFKAYFNTNETLFTLMLNYVA
FT                   MQIVTFCIVYWENPAGSNTVGIINSATRAGWLPELGGLTYGWNVVIVLVFTIGMYIYMK
FT                   YSKQGYEVAVVGESQDTARYARINVKRTIIRTMGISGGICGIAGFLLVSGASHTISTST
FT                   AGGRGFTAIIVAWLSKFNAFVMILVSFFLVFMGKGAIQIASQFNLNENASDVITGIILF
FT                   FILGSEFFIRYRIAFTKAHK"
FT   CDS             30032..31012
FT                   /transl_table=11
FT                   /locus_tag="CC1_00370"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /function="nucleoside ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79016"
FT                   /db_xref="GOA:D4J3U5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3U5"
FT                   /protein_id="CBK79016.1"
FT                   /translation="MSALIVFIQKAIAQGIGMLFGATGEIITEKSGNLNLGVPGLMYMG
FT                   GIAGLMGAFIYESGAENPSGIVGVLISMLCALLASGFGALIYSVLTITLRANQNVTGLA
FT                   LTTFGVGFGNFFGGSLSQLAGGVGQISVAVTGGTYRTKIPGLSKIPVIGDVLFSYGFMT
FT                   YFGIILAILVSWFMYKSRKGLNLRAVGESPATADAAGINVTLYKYLATIIGGAISGLGG
FT                   LYFVMEYSGGTWTNNGFGDRGWLAIALVIFALWKPINAIWGSFLFGALYILYLYIPGLG
FT                   RSMQEIFKMLPYLVTIVVLIFTSFRKKKEYQPPESLGNSYFREER"
FT   CDS             31082..31951
FT                   /transl_table=11
FT                   /locus_tag="CC1_00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79017"
FT                   /db_xref="InterPro:IPR025387"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3U6"
FT                   /protein_id="CBK79017.1"
FT                   /translation="MSIDIRITQKGLLKKTLPLHVITGSDLCYGTSDGMKLKENDLSSD
FT                   EIILYHSNHISRGFSIEWTPEKKDYVDLRALSPDSREGLNDFFAAIQRIASYWKCEIEM
FT                   DGNITALSELVSLIPDMQAFNETVLESVCGDILSGKKESLTLYSVMFPVVLGVPEAEKF
FT                   RHDVDAFGRWLHEKQSVDAYYARPQFFRTEVGVVGRYVVTEDCRTIFPLKGQVPLGISD
FT                   PETGKGLKCDRYEVYFYSISQEKMLGYVPFETFIEIIKAQAERFDGANIIFEGLSMEAL
FT                   QKIVETAV"
FT   CDS             complement(32216..33112)
FT                   /transl_table=11
FT                   /locus_tag="CC1_00390"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79018"
FT                   /db_xref="GOA:D4J3U7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3U7"
FT                   /protein_id="CBK79018.1"
FT                   /translation="MELKQLEAFVAVVDYNSFSEAARHLFLTQPTVSAHVASLEKELDT
FT                   KLISRTTKKLHVTPQGYDLYDSAVSMLKIRDHILNEFVGSHKQIIELGASTIPSSYVLP
FT                   EVLSAFGQLNPDIYFHSELSDSMGIIQQVENGRLDFGLVGMTTDSSELIFIPFLEDELV
FT                   IVTPVTPHYLEISKKNVTIAAFLNEPFILREKGSGTKKAIDQYLEQQRISSGAINVVAR
FT                   MNDLEAVKRSIINGLGISILSAKSVQDLNASRQVLIFPLAHPAPTRKLYIVYKKEHALL
FT                   PHVRRFIQFVRSYYQPQ"
FT   CDS             33358..34233
FT                   /transl_table=11
FT                   /locus_tag="CC1_00400"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79019"
FT                   /db_xref="GOA:D4J3U8"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3U8"
FT                   /protein_id="CBK79019.1"
FT                   /translation="MKKLVSSVLVLCMIAVALAGCGNKSTETTKATEATASTESAVSTE
FT                   AVSETQAAEGEAATVQVYIAASLSNAMDEISANYKSVQPNVDLVFNAGSSGKLQTQIEE
FT                   GGACDVFFSAATKQMNALVEGGYVQEADVTDLLENKVQLIKPAGTETKVTGFENITDAA
FT                   NLALAADTVPVGQYAREIFDNLGITDQVMAMEINECEDVSAVLAAVSEGSNEVGIVYAT
FT                   DAASVADKVDVIATANDTELKSKVIYPVGLVKNTEADDAEVAAAKAFVDYLKTPEATSV
FT                   FEKYGFTVNQ"
FT   CDS             34298..34990
FT                   /transl_table=11
FT                   /locus_tag="CC1_00410"
FT                   /product="molybdate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79020"
FT                   /db_xref="GOA:D4J3U9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3U9"
FT                   /protein_id="CBK79020.1"
FT                   /translation="MDFLASIDMSPLFISLKTAIIATVVAFFGGIACARWAMKLKPVSK
FT                   SILDGILNLPLVLPPTVAGFLLLLIFSLKRPLGIYLWEHYQFKVVLSWPGCVLAATVVA
FT                   FPLMYRNARAAFEQVDVNYIYAGRTLGLSEWTIFRKVVIPVAGPGIASGTILTFARALG
FT                   EYGATSMLAGNILGKTRTMAVAIAAEVSAQNYDVAGFWVIVLVAIAFVFIFAINIITMH
FT                   GISKIQRW"
FT   CDS             34992..36053
FT                   /transl_table=11
FT                   /locus_tag="CC1_00420"
FT                   /product="ABC-type sulfate/molybdate transport systems,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79021"
FT                   /db_xref="GOA:D4J3V0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3V0"
FT                   /protein_id="CBK79021.1"
FT                   /translation="MALSVELHKKFKGFRMDVAFEHDGGSLGILGGSGMGKSMTLKMIA
FT                   GLVKPDSGKVIVDGRTVYDSAAKIDMPARERHIGYLFQQYALFPTMTVTENIGIAMKKS
FT                   GDAKKKEIDRLLEQFALQNLGGRMPNELSGGQQQRVALARILASEPQMLLLDEPFSALD
FT                   SFLKEQLLEDMIRQLSDYAGDVIMVSHSRDEIYQFCDRLLILDQGRVIVTGDTKDIFDQ
FT                   PEYREAARLTGCKNITEAIKIAENSIEVPHWHCTLEMDETVADDIHAVGIRAHYIDVLT
FT                   EKPENMKNVIGVTVENVSELPFEWYCFFRVPNGERIWWKVAKVGEHGAAKYLPQKGDHV
FT                   YLHMPPQSVILLK"
FT   CDS             36299..37351
FT                   /transl_table=11
FT                   /locus_tag="CC1_00430"
FT                   /product="L-threonine aldolase"
FT                   /function="L-threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79022"
FT                   /db_xref="GOA:D4J3V1"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3V1"
FT                   /protein_id="CBK79022.1"
FT                   /translation="MIEFQCDYAEGAHPKILERLVETNMDQTPGYGLDPYCDEARRLIR
FT                   KACGREDIDVQFLVGGTQTNTTIICTALRPYQGVLTAASGHINVHESGAIEATGHKVLA
FT                   LPCDHAGKITAEQIKAAYEAHMNDDSSEHMVQPGMVYISNPTENGTIYYKQELEAISRV
FT                   CHECGMPLFLDGARLGYGLMAADNDVTLEDIARLCDVFYIGGTKVGALFGEAVVITNPA
FT                   ISKDFRYMIKQRGGMLAKGRLLGIQFQTLFEDGLYWQISRHAIDMAMKLKKAFQACGYG
FT                   FYVENSTNQQLPVLPDAVLEKLAGKYSYSFWEKTDESHSAVRFCTSWATKEENVDALIA
FT                   DLNQIRSQMM"
FT   CDS             37524..38927
FT                   /transl_table=11
FT                   /locus_tag="CC1_00440"
FT                   /product="Membrane proteins related to
FT                   metalloendopeptidases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79023"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3V2"
FT                   /protein_id="CBK79023.1"
FT                   /translation="MKHGLKRFTRCVLVAALSVSLAVPTMAATKAEVQSQIENLKSQQS
FT                   ELETQLASLKKNKSDTESYISELDSKIKTYLAQLEEVSAQLEQTESEISITQDNLAQAK
FT                   EDEKTQYTALKARIKAMYESGDDDYLQMLLGSGDLKTMLNNQEYISKINEYDHNLLVSL
FT                   QNIRDQIAAYEAQLEEQKELQEAQKEQYEVEKESLEKIVAQKEEELVAIGSDIDSVNYD
FT                   ISSTQEEIDAENSLLQQIIEQERKAAEEAARKKAAEEAAQKKAAEEAAAKKKAAEEAAK
FT                   YNSSSSSSSSSSSSSSSSSSSSSSSSSSDSSYDDSSSSSSDSSYDDSSSSSSSSSSSTG
FT                   MIWPVGSSSITSYFGYRSSPTAGASSYHRGLDIGASAGSSIWAAASGTVTTASYNSAMG
FT                   NYIVISHGNGVCTVYEHCSALYVSAGQSVSQGETIAAVGSTGISTGAHLHFGVTVGGDY
FT                   VNPLYYVSP"
FT   CDS             complement(39052..39789)
FT                   /transl_table=11
FT                   /locus_tag="CC1_00450"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79024"
FT                   /db_xref="GOA:D4J3V3"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3V3"
FT                   /protein_id="CBK79024.1"
FT                   /translation="MTPNKTVFITGASRGIGRAIAIRFAAAGYQLALCCRQNTQLLEDL
FT                   QQLIISQYHTDCLIFTGDTGDYHQLETMISETIARFHHIDVLVNNAGISYIGLLTDMSP
FT                   DDWQRIVNTNLTSVFNSCRLAVPGMVHEHSGKIINISSVWGCCGASCEVAYSATKGGIN
FT                   AFTQALAKELAPSNIQVNAVACGAIDTEMNAFLSEADRIALTDEIPSGRFGRPEEVAEL
FT                   VLDLAQKHSYLTGQIIRLDGGWI"
FT   CDS             complement(39806..40066)
FT                   /transl_table=11
FT                   /locus_tag="CC1_00460"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79025"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3V4"
FT                   /protein_id="CBK79025.1"
FT                   /translation="MKAEQQNIKRLLNTAKGQIDGLNKMIDDDKYCIDISNQIMATIAI
FT                   LKKVNIEILDAHLKCCVLHADDRERETKINEISEVLKKALK"
FT   CDS             40369..42939
FT                   /transl_table=11
FT                   /locus_tag="CC1_00470"
FT                   /product="copper-(or silver)-translocating P-type ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79026"
FT                   /db_xref="GOA:D4J3V5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3V5"
FT                   /protein_id="CBK79026.1"
FT                   /translation="MQQFIVTGMSCAACSARVEKAVSKVEGVTSCSVSLLTNSMGVEGT
FT                   AADQAIIQAVEAAGYGASVKGEAAEHSGASSMAAEEEMLKDHDTPVLKRRLLASLGFLI
FT                   VLMYFSMGHMMWGWPLPAFFENNHIAMGLVQLLLTGIVMVINQKFFISGFTSLAHRAPN
FT                   MDTLVALGSTAAFGYSTYALFAMTDAQVKGDMEMVMHYMHEFYFESAAMILTLITVGKM
FT                   LEARSKGKTTDALKGLMKLASKTAVVERNGQEVTVPIEQVKKGDIFLVRPGENVPVDGV
FT                   ILEGTSALNEAALTGESIPVDKKPGDVVSAATLNQSGFIRCEATRVGEDTTLSQIIQMV
FT                   SDAAATKAPIAKIADKVSGVFVPAVITIAVITMIVWLLAGESVGFALARGISVLVISCP
FT                   CALGLATPVAIMVGNGMGAKNGILFKTAVSLEETGKVQIVALDKTGTITNGEPVVTDMV
FT                   PAEGVTEESLLALAASLEKRSEHPLAKAILKYVGEQHLTVEDVSEFEALPGNGLTAVRN
FT                   GVKLAGGNYAFIRTQTEVSEDLLKQSEALAEQGKTPMFFSENGRLAGIIAVADTMKEDS
FT                   RQAVSELRNMGIRVVMLTGDNERTARAIGAQAGVDDVIAGVLPDGKESVIRKLQQYGKV
FT                   AMVGDGINDAPALTRADMGIAIGAGTDVAIDAADVVLMKSRLSDVAAAVRLSRATLKNI
FT                   HENLFWAFFYNVIGIPLAAGVWIPIFGWTLNPMFGAAAMSLSSFCVVTNALRLNLFNMH
FT                   DAKKDKKLKNPAIIKELVDNNKTNHNQENKEIGTMKKTMKIEGMMCGHCEATVKKALEG
FT                   LDGVTSAEVSHEAGTAVVELSADVADDVLKKTVEDKDYKVTAIN"
FT   CDS             43602..44690
FT                   /transl_table=11
FT                   /locus_tag="CC1_00480"
FT                   /product="transcriptional regulator, CdaR family"
FT                   /function="transcriptional regulator, CdaR family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79027"
FT                   /db_xref="GOA:D4J3V6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3V6"
FT                   /protein_id="CBK79027.1"
FT                   /translation="MISNQILQNTIEGLKAITRIDLCVMDIEGKVLAATFSNAEDYEKF
FT                   VLEFVNSPADSQVLQGFQFFKVFDEHQLEFIILARGDSDDVYMIGKVASFQIQNLLVAY
FT                   KERFDKDNFIKNLLLDNLLLVDIYNRSKKLHIDTDVRRIVLLIEVNNERDMNSLETVRS
FT                   IYTGRPKDFITAVDEKNVIVVREVKDNETYDDLCKASKVIYEMLCGENLPKARIALGTI
FT                   VQEIKDVSRSYKEARMALDVGKIFYNERNVVAYSNLGIGRLIYQLPIPLCKMFIKEIFD
FT                   SKSPEDFDEETLMTINKFFENSLNVSETSRQLYIHRNTLVYRLDKLQKSTGLDLRVFED
FT                   AITFKIALMVVKYMNYMETFDY"
FT   CDS             45396..46301
FT                   /transl_table=11
FT                   /locus_tag="CC1_00500"
FT                   /product="cell division protein FtsX"
FT                   /function="cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79028"
FT                   /db_xref="GOA:D4J3V7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3V7"
FT                   /protein_id="CBK79028.1"
FT                   /translation="MSSFLYGIKQGIKNVFRNRLFSLASIGTITACLFIFGIFYCMVMN
FT                   FQHIFSEVETTVGVTVFFNEDVEEDQILDIKSQIEQRDEVDNVHYTSPEEAWEEYKEKA
FT                   FPDTDQNILTNLDNDNPLASSASLEVYLKDAAKQQELVDYIQGIDGVRSVNASKSVADS
FT                   FASFGRLLSYVSLAIIVILVGVAVFLISNTVMIGITVRHEEIAIMKYLGATDFFVRAPF
FT                   LIEGMLIGLIGSLIPVCALKVLYEKVISFMTTEFTSLSRFMTFLPAGEIFKVLIPISLI
FT                   IGLGIGFIGSYLTLIKHIRV"
FT   CDS             46542..47831
FT                   /transl_table=11
FT                   /locus_tag="CC1_00510"
FT                   /product="C-terminal peptidase (prc)"
FT                   /EC_number="3.4.21.102"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79029"
FT                   /db_xref="GOA:D4J3V8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3V8"
FT                   /protein_id="CBK79029.1"
FT                   /translation="MENRNDRKSYYKGLLTGVILCVLIIGVLALSGCFLKDYAPSSTGQ
FT                   TTGTGDAVEASDASSSSGDVTDISGRYKEVEKKLNKLHSVLDQYYLDVSDDSDITQDDM
FT                   VEGIYKGYVDALNEPYTVYYTKEEYDQLQESTSGKYSGIGVVVSQNKETGVITVVRPFE
FT                   GSPGAEAGILKDDILYKVADKEVTGVDVTEVVTWIKGEEGSTVSIEVYRPSEDKYLTFE
FT                   VERKTIEIPMVTSKMLDNNIGYVAVYEFEETTSEQFNQAIDELTAQGMKGLIIDLRDNP
FT                   GGLVNSATAILDRILPKDQLLVYTVDKSGKKQEEYTEDDETIDVPISVLINDNSASASE
FT                   IVSGCLQDYGKAKLVGTTSFGKGIVQYVLPLGDGSAIKLTSAKYYTPNGRNIHGTGIDP
FT                   DVEVELNSDSETDTQLEKAQEIVLQEIQAE"
FT   CDS             complement(47917..49308)
FT                   /transl_table=11
FT                   /locus_tag="CC1_00520"
FT                   /product="Permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79030"
FT                   /db_xref="GOA:D4J3V9"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="InterPro:IPR029940"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3V9"
FT                   /protein_id="CBK79030.1"
FT                   /translation="MLEKIFKLSENRTDAKTEILAGITTFMTMAYILAVNPSILSATGM
FT                   DQGALFTATALISFIGTLLMAFLANYPFALAPGMGLNAYFAYTVVLGMGYSWEFALTAV
FT                   FAEGIIFILLSLTNVREAIFNAIPKNLKSAVSVGIGLFIAFVGLQNAKIVIGGSTLVQL
FT                   FSVEKYNELNGVNASFNDVGITVELALVGILITGILVIKNVKGNILWGILITWILGIIC
FT                   QFAGIYVPNPELGFYNLLPDFSNGLSIPSLSPILFKLDFHGIVSADFVVILFAFLFVDL
FT                   FDTIGTLVGVSSKAGMLDENGKLPRIKGALLADAIATTAGAALGTSTATTFVESASGVT
FT                   EGGRTGLTALTTGILFGLSLFLSPIFLAIPSFATAPALIIVGLYMLSNITNIDFADMSE
FT                   AIPCYICIIAMPFFYSISEGIALGIIAYVVLNLVTGKAKEKKLNLLLYILAIIFIVKEC
FT                   SSLFF"
FT   CDS             49557..49829
FT                   /transl_table=11
FT                   /locus_tag="CC1_00530"
FT                   /product="Helicase subunit of the DNA excision repair
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79031"
FT                   /db_xref="GOA:D4J3W0"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3W0"
FT                   /protein_id="CBK79031.1"
FT                   /translation="MDHFELVSEYAPTGDQPQAIEQLVKGFKEGNQFETLLGVTGSGKT
FT                   FTMANVIARLNKPTLILAHNKTLAAQLYGEMKEFFPNNAVEYFVS"
FT   CDS             49876..50679
FT                   /transl_table=11
FT                   /locus_tag="CC1_00540"
FT                   /product="TIR domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79032"
FT                   /db_xref="GOA:D4J3W1"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3W1"
FT                   /protein_id="CBK79032.1"
FT                   /translation="MERGYVWQAEYGRRTTLIPVLKQLIKEQDASSLEMLAIFVNNNPY
FT                   NLEFFIAVIYDVPQKNHVEKMIELFENENLILRNDLTTLLLTQELGNRRFNSCAFADAQ
FT                   EVDLRFESMFFFPEIEILEEKGYCMRPFGKEKQVFISHSSKDKKDVESIIPYLNGQELP
FT                   VWFDKYSISVGDSITESVQMGIEESDMVIFWVTDNFLVSNWCKVEMTAYVKKLIEEKIR
FT                   MIIVLDDGIGIKKLPLFLRDIKHIRKENRTAIEVAEEIVKSIKRG"
FT   CDS             50759..51805
FT                   /transl_table=11
FT                   /locus_tag="CC1_00550"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79033"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3W2"
FT                   /protein_id="CBK79033.1"
FT                   /translation="MDNVQNEIFYKKVIELFQNARKNLSAAVNMTMVYSYFEAGRMIVE
FT                   KEQDGKERAAYGKYILKELSQRLTKKFGRGYSYDNLKLMRKFYLVYSKDSIGETAFPQS
FT                   EKLPVTKEGRKFYLSWSHYLVLMRINKIEERHFYEIEAYKNRWSKDELTRQYGSSLYER
FT                   LALSRNKEEVMRLATEGQMIEKPEDIFKDPYILEFTGLPELVTYSETELENKIIDNLQK
FT                   FLLELGRGFTFVGRQVRLTFEEEHFRVDLVFYNRLLRCFVLFDLKIGQLKHQDIGQMQM
FT                   YVNYYDRKVKLDDENSTIGIIICKDKKDAIVEMTLPKDNNQIFASKYETVLPSKEELKT
FT                   LLEDKNLE"
FT   CDS             51827..53818
FT                   /transl_table=11
FT                   /locus_tag="CC1_00560"
FT                   /product="excinuclease ABC, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79034"
FT                   /db_xref="GOA:D4J3W3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3W3"
FT                   /protein_id="CBK79034.1"
FT                   /translation="MDHFELVSEYAPTGDQPQAIEQLVKGFKEGNQFETLLGVTGSGKT
FT                   FTMANVIAQLNKPTLILAHNKTLAAQLYGEMKEFFPNNAVEYFVSYYDYYQPEAYVPSS
FT                   DTYIEKDSAINDEIDKLRHSATAALSERRDVIIVSSVSCIYGLGSPIDYQEMVISLRPG
FT                   MLKDRDEVIRKLIDIQYVRNDMDFKRGTFRVRGDVVEIFPANATDTAVRVEFFGDEIDR
FT                   ITEFDALTGNVKARLEHVAIFPASHYVVAPEKMEKAISAIEEELKERVEWFKHEDKLLE
FT                   AQRIAERTKFDIEMMRETGFCSGIENYSRHLSGLKPGEPPHTLLDYFPDDFLMIVDESH
FT                   ITIPQVRGMYAGDQSRKTTLVDYGFRLPSAKDNRPLNFDEFESHISQMLFVSATPNVYE
FT                   GEHELLRAEQVIRPTGLLDPEISVRPVEGQIDDLISEVNKEIEHGHKVLITTLTKRMAE
FT                   DLTDYMKELGIRVRYLHSDIDTLERSEIVRNLRLNVFDVLVGINLLREGLDIPEITLVA
FT                   ILDADKEGFLRSETSLIQTIGRAARNTEGHVIMYADRITDSMDKAITETNRRRAIQQAY
FT                   NEAHGITPKTIQKAVRDLISISEAADKSEDNFVKDAESMSYKELNAAIRKLTKQMHSAA
FT                   AELDFEKAAMLRDKIMELKKMLHEIEED"
FT   CDS             53833..56682
FT                   /transl_table=11
FT                   /locus_tag="CC1_00570"
FT                   /product="excinuclease ABC, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79035"
FT                   /db_xref="GOA:D4J3W4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3W4"
FT                   /protein_id="CBK79035.1"
FT                   /translation="MSELTQKDYIDIKGAREHNLKGIDVKIPRNKMVVLTGLSGSGKSS
FT                   LAFDTIYAEGQRRYMESLSSYARQFLGQMEKPNVESISGLSPAISIDQKSTNRNPRSTV
FT                   GTVTEIYDYYRLLYARIGTPHCPKCGKEIKKQTVDQMVDAVMALPERTKLQLLAPVVRG
FT                   RKGEHVKIFDQARKSGYVRVMVDGHQYELSEEIKLEKNKKHNISIVVDRLMVREGIEKR
FT                   LTDSLEITLKLAEGLAVVDLPDQEESMTFSQSFSCPDCGISFEEIEPRSFSFNNPFGAC
FT                   PVCHGLGYKMEFSPELMIPDTSLSISQGAIAVMGWQSAADASSFTHAILTALAEAYHFD
FT                   LDTPFRDYPQKIKDVILHGTGGQEVRVHYRGQRGEGVYDVAFEGLIKNVERRYRETGSE
FT                   LTKQEYENFMTITPCKECGGRRLKKESLAVTIGGKNISELTEMSITDLNAFMEQLELTK
FT                   QQHLIGDQVIKEIRARLGFLIDVGLDYLMLSRATATLSGGEAQRIRLATQIGSGLVGVA
FT                   YILDEPSIGLHQRDNDKLLKTLKNLRDLGNTLIVVEHDEDTMLEADWIVDIGPGAGEHG
FT                   GYLVAEGTAQDIMKCEKSVTGAYLSGRIRIPVPSQRRQPTGFLHIIGAAENNLKHINVD
FT                   IPLGVMTCVTGVSGSGKSSIVNEILYKRLARDLNHARTIHPGKHDDILGLEQLDKVINI
FT                   DQSPIGRTPRSNPATYTGVFDLIRDLFASSVDAKERGYKKGRFSFNVKGGRCEACAGDG
FT                   IIKIEMHFLADIYVPCEVCHGKRYNRETLEVKYKGKNIYEVLDMTVEEAVKFFENVPSI
FT                   RRKLETLNDVGLSYIKLGQPSTTLSGGEAQRIKLATELSKRSTGRTIYILDEPTTGLHF
FT                   ADVHKLTEILRRLAEGGNTVVVIEHNLDVIKTADYIIDVGPEGGARGGTIVACGTPEEI
FT                   AENPNSYTGIYVRKFLQQD"
FT   CDS             complement(56871..60161)
FT                   /transl_table=11
FT                   /locus_tag="CC1_00580"
FT                   /product="Superfamily II DNA/RNA helicases, SNF2 family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79036"
FT                   /db_xref="GOA:D4J3W5"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013663"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3W5"
FT                   /protein_id="CBK79036.1"
FT                   /translation="MAITRMTVIKAASDADYRKGQDIFLIDKRIRNFETDINTLTHTPM
FT                   ITATVLDADGTEHETQVSIDEEESQIIGSLCSCPDFYQAQGICCHCVAILLKYISRRHI
FT                   QASFPAKNQNRISQNLIETYIQQSSGIHYTAESSDVKGQIELEPILHKQYKKLSVDFKV
FT                   GTHKKYVIKDLLEFARLVREHELFQYGKNLKFFHEPEAFTPESRKLLSFIMQRIEEYEY
FT                   HFRYVQDSTYRFQTIKPLRELPLSPTAIDTFLNLMLGRTLQFRLADQTQTIRVLDCDPL
FT                   LTLSLKSEDNSTYKLTIDNCLILSGASTFWILKDKTLYRCSENFRKDMQPYLTELNRQK
FT                   TQEMILSEKQLRPFYGSVLKRLQAHTDFQTNGIDLSGYEPPEAHFSIYLDHPSDQIFSC
FT                   SAYAQYNEETFSLATPISPEDGFRDATMENKVLTAIQSYFHPVMASEDEKAPEVDGDFI
FT                   IDHDDTASFLFLEQGLPHFYELAEVFISSNMKRVRILSAPKAAVGVSVSHGLLTLDIRS
FT                   DHLPYDELAGILNSYRRRQKYYKLKSGEFLKLENNSLSVLSELADGLRLSEKDIANGQM
FT                   TVPLYRASYIDAVLTSHNSDMQSHRDRYFKSLIRDMKSVADSDYEVPDAMKPILRDYQK
FT                   TGYRWLCTIAHLGFGGILADDMGLGKTLQIITLLEHTRLTAAERTDGGHPVSLIICPSS
FT                   LVYNWDSEIEHFAPALKTLLITGTAQERQDLLTHAADYDVLITSYDMLKRDITYYDALH
FT                   FQYQIIDEAQYIKNHRTQAARSVCSIHSVTRFALTGTPIENRLSELWSIFEYLMPGYLY
FT                   PYAHFRSELEQPIVESKDPIATTRLQQLVRPFIMRRLKTDVLKELPDKLEHAVYAQMTE
FT                   EQQKLYVANAVQLQKELESQNDSMFKASKIQILAELTKLRQLCCDPALIYKNYHGGSAK
FT                   LDTCIQLIQNARAGGHKILLFSQFTSMLDIIEHRLKLEHILYYRLDGSTKSEQRTRLVN
FT                   AFNENAIPVFLISLKAGGTGLNLTGADIVIHYDPWWNAAAQNQATDRAHRIGQTHTVTV
FT                   YKLIARHTIEEKILELQENKKALSDQILSEEGVTASQLTKEELLQILQ"
FT   CDS             60409..60759
FT                   /transl_table=11
FT                   /locus_tag="CC1_00590"
FT                   /product="Pyruvate formate lyase."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79037"
FT                   /db_xref="GOA:D4J3W6"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3W6"
FT                   /protein_id="CBK79037.1"
FT                   /translation="MNERVKRMKESLRISKYPLCVEFFRLANESLEQTGGEPMLLRRSK
FT                   LHAHILDNCTIFIEDDDLLCGSGASKPFGLEMSYEYGVWTKDEVESLKSEIYTITPEDE
FT                   EELYEERCNHGM"
FT   CDS             60749..61204
FT                   /transl_table=11
FT                   /locus_tag="CC1_00600"
FT                   /product="Predicted acyl-CoA transferases/carnitine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79038"
FT                   /db_xref="GOA:D4J3W7"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3W7"
FT                   /protein_id="CBK79038.1"
FT                   /translation="MACKGPLTGYKVLDMTQFESGTVCTETLAWLGAEVLKVERPVKGE
FT                   LGRYSQANPVVDSYGFVVMNMNKKSITCNAKTPEGLQLLKDLTAKCDVIVENMGPGSMD
FT                   KLGLTYEACKAINPQIIYASLKGFAQDGPHMVVIARGIYTRMLISSF"
FT   CDS             complement(61188..62477)
FT                   /transl_table=11
FT                   /locus_tag="CC1_00610"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79039"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3W8"
FT                   /protein_id="CBK79039.1"
FT                   /translation="MNKLKRYIIFLVGLFVNSLGVSLITKANLGTSPISSIPYVLSLNF
FT                   PLTLGNFTIIFSILLIILQLFILRKNFKLEHLLQIPISILFGYFIDLTMLLFSFVNPTA
FT                   YIAKLIYLLIGCVILGFGVYMEVLADVAMLPGESFVRAIVQTWHREFGSTKVCFDVSMA
FT                   VIAAALSFILAHRLDGVREGTVIAALLVGFLARQFGRLLAFVKPMLFPEDYKTSEGKVD
FT                   QTTPASNNSDYVSVITIGRQYGSGGSELGQILADKLGYAFYDKEIIEMTAGTTGYSSNY
FT                   VGEHQESLTNSLIYDLVNHMYTFPETESPKDKIFDAQSKVIKEIAEKGHCVIVGRCADQ
FT                   ILKDRTDCLNIFLHAPLKNRIKRVMGKKNLTEKDAKQLILREERRRADNYHYYTRQIWG
FT                   ASANYHLSLDTSLGYDYVLDVIIQTAKKMK"
FT   CDS             complement(62470..62910)
FT                   /transl_table=11
FT                   /locus_tag="CC1_00620"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79040"
FT                   /db_xref="GOA:D4J3W9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3W9"
FT                   /protein_id="CBK79040.1"
FT                   /translation="MSDYSFHYLSMAIHSMVQKNFMERVKPSGLTLGQPKILDYLKDHN
FT                   GANQKEIAAACHIEPGSLTSVLNRMEEKGLIERRILDGNRRTFYIFMTEEGARLKDVVE
FT                   ANFLTIEEKVFKDIPKEEQDAFMQTFSKIYENLSNKGETINE"
FT   CDS             63146..64501
FT                   /transl_table=11
FT                   /locus_tag="CC1_00630"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79041"
FT                   /db_xref="GOA:D4J3X0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3X0"
FT                   /protein_id="CBK79041.1"
FT                   /translation="MSRSYEIDMCHGPLFGKIIRFSIPLMLSGILQLLFNAADIIVVGR
FT                   FVGPTALAAVGSTSSLINLLINLFIGFSVGANVLVARFHGAGRDDEVNETVHTAITLSM
FT                   VSGIFLLILGVTVTRTLLIWMGSPDDVLDQSSLYLKIYFLAMPATLLYNFGSSILRAVG
FT                   DTKRPLFYLVTAGVINVCFNLFFVIVCHLGVAGVGLATVIAEYISAALIIRCLMRSQGC
FT                   CHLDLHQLGIVKGKLRQIMQIGLPAGMQGVVFSLSNVLIQSSINSFGSTAMAGNTASMN
FT                   IENFIYISMNTFQQTAMSFTSQNYGAGEEKRIHKVLFICQGLVISVGLIFGVGAWLAGD
FT                   KLLSIYSSDLNVIQFGKNRMAVICTTYFLCGIMDTMVGALRGVGYSLMPMIVSLIGACG
FT                   LRIVWIFTAFQIHRSLWMLYISYPITWIITGGVHILCYIFVRRKQLQTVKNL"
FT   CDS             64806..66116
FT                   /transl_table=11
FT                   /locus_tag="CC1_00640"
FT                   /product="H+/gluconate symporter and related permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79042"
FT                   /db_xref="GOA:D4J3X1"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3X1"
FT                   /protein_id="CBK79042.1"
FT                   /translation="MNFGILVLLIAIILFALLAFKQLSALILAPVVTIFVLICSGIPIM
FT                   EGLQDMFMPAAADYVSKYFLTFFVGALFGAVYQFTGAAESIARFIGGLCHGKFVAPIIM
FT                   CITGILTFGGVSGFVVFFVIYPIALNLFKESNLTRRLIPAAISAGCWTWSMSAPGSPSI
FT                   QNVIAIKSLGTLSTAAFVPSLIVSIIEFLLIFVWLEYRARKFTKNGYYFDDARLKTQLS
FT                   AEDLNIQGREDLPHWVIAFIPIILILVLFNGFHLDVVPSVFAGVALAAILMFKFVKGGI
FT                   EQWVKVFNKGAADSGVAILNTAIVVGFGGVVKNTQGFADLVTALKGMSMPPLVFVMITV
FT                   AICAGACGSASGGMGVAFNALTDTYLALGAKLPYIHRIATIAAGTLDTLPHQGAQITLL
FT                   GICKLTHKEAYFDIAITQIIIPFITCGLFIVLAQMGL"
FT   CDS             66278..67840
FT                   /transl_table=11
FT                   /locus_tag="CC1_00650"
FT                   /product="Predicted metal-dependent hydrolase with the
FT                   TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79043"
FT                   /db_xref="GOA:D4J3X2"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3X2"
FT                   /protein_id="CBK79043.1"
FT                   /translation="MKVYEGAILTCDANDQVARYLVEDGGRILYVGDELPERYISVRHE
FT                   RLGKKALIPAFTDSHIHFASFSTFHAGLNVMNAASNKEILSMLSDFAKKSDQKMLIGFG
FT                   ASPYSVKERRLVNRNELDRVCPDKPVFMVKYDGHACVVNTKLYEQVKDKVSGLRGCHVD
FT                   TGEMNQEAFFAISDYVTNSISVPQLLKNMQKAIDYMASKGIGMIHTVSGVGFVRDLDVD
FT                   LERWFGRGLNNGMQLRVFFQTMDVKKVQKRHLPRVGGCFATALDGCFGSQDAALCVPYE
FT                   NSDSKGVLYYSDAQVAEFCKKANRAGLQIEMHAIGDAAFDQATRALKAALDDYPREDHR
FT                   HAIIHACLPTKEGIDICEKYHILLPVQSAFIDWPQEPDEYLEDILGERSQRLNPLRTFT
FT                   EHGIMMSAGSDGPCTDPDPIEWMYRACNHSVPEESLTVQEALKMCTYNGYYTTFDEKER
FT                   GSLETGKIADMVILSENPYEKDVKELRDIHVKQLLLQGRPYKPLKGSAIGQVLKGMRSR
FT                   SKI"
FT   CDS             67841..68533
FT                   /transl_table=11
FT                   /locus_tag="CC1_00660"
FT                   /product="conserved hypothetical protein TIGR00104"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79044"
FT                   /db_xref="InterPro:IPR001378"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3X3"
FT                   /protein_id="CBK79044.1"
FT                   /translation="MDNLTLKVIARIYTDFGEKFGVPRQSGLVPELTGKIIFEPEYRAP
FT                   EALSGIEGYSWLWLLWGFSKSPRNKWSPAVRPPRLGGNKKVGVFATRSPFRPNPVGMSS
FT                   VKIEDIQLQTDEGPVIIVSGIDMMNGTPIYDIKPYLPHVDCHPEALGGFSGQFKDYRLK
FT                   VSCASEFLMLFPSDKREALLGVLAQDPRPAYQNDPERVYGVNFAGRNVQFKVDGDRLTV
FT                   CSVDGCTV"
FT   CDS             68648..69778
FT                   /transl_table=11
FT                   /locus_tag="CC1_00670"
FT                   /product="Uncharacterised protein family (UPF0153)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79045"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3X4"
FT                   /protein_id="CBK79045.1"
FT                   /translation="MEYVYPDYYRQFTCIGGECPDTCCAGWEIVIDDKSLEKYRAYPGG
FT                   FGNRLRNSINFKRKSFKQYDRRCAFLNEENLCDIYTEAGKKLFCKTCRQYPRHEEEYEN
FT                   VRELSLSLSCPEAARMILSQDRLNLIYDEKKGHSEDYGDFDELLFSQLLDGRDAFWKLI
FT                   ENERVSIAVRMMQMLSMGHHLQKNISEGQLFGLEHIYEHYLSDGAAGRMQAYLKDRWEK
FT                   PGSRYHVMKEMFACLHKLEVLSADWPKKVRHYEKVLFGGGRKQYEALHQYRMSDKIAEQ
FT                   LLSYFIYVYFAGAVYDGMPYSKVKLAVISTMLIEDMVYAKAAKKGQLSFEAIADAAHSY
FT                   AREVEHSDLNLQRLSIMFRHQKCFHIGRLCGALLEW"
FT   CDS             complement(70100..71143)
FT                   /transl_table=11
FT                   /locus_tag="CC1_00680"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /function="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79046"
FT                   /db_xref="GOA:D4J3X5"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3X5"
FT                   /protein_id="CBK79046.1"
FT                   /translation="MNHEQMQMEFVRKLPIPQEIKKQFPISEKIAQHKAERDEAIRRVF
FT                   TGESDKFLLIIGPCSADSEEPVMEYIHRLARVQEKVADKIIMIPRIYTNKPRTTGKGYK
FT                   GMLHQPDPEKQPDLLEGLIAIRKLHARAIEETGLTCADEMLYPENHRYLSDLLSYVAVG
FT                   ARSVEDQIHRLTGSGVGIPCGMKNPMSGDISVMLNSIEAAQSPQMFVYRGWEVKTPGNP
FT                   LAHAILRGAVNEHGNNIPNYHFENLSQLYDSYAEKGLENMGCIIDTNHSNSSKQYMAQI
FT                   RIANEVMHSRRHSDDIKKLVKGFMIESYLEDGSQKIGEGVFGKSITDPCLGWEKTEALI
FT                   YSIAEQL"
FT   CDS             71448..72758
FT                   /transl_table=11
FT                   /locus_tag="CC1_00690"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79047"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3X6"
FT                   /protein_id="CBK79047.1"
FT                   /translation="MYKIVSKLLMYGDMPKDSILMQLSDIFKQMDQDTQSRDELVTRIF
FT                   TQVKHLLQVATDYGFDKNLWHNYLTYLLITDENPFSLTCEKVGANDGSVNFFAKGDFKA
FT                   FKALFDFDFSEIEERLGIDCFTRLSQYKAIGKKELMYNKNVSEKVQVLSERLEKTANED
FT                   EFFDVVTDFYKAYGVGMFGLNKAFRIASRTENHVEFCPINNMDTVMLDDLVGYEIQKKK
FT                   LVDNTEAFVQGRKANNVLLFGDSGTGKSTSIKAIVNAYYDQGLRMIEIYKHQFRDLSNV
FT                   IAQIKNRNYRFIIYMDDLSFEEHEIEYKFLKAVIEGGVETKPENILIYATSNRRHLIKE
FT                   TWNDRNDMEYENDLHRSDTMEEKLSLVNRFGVQISYSKPSKKEFNEIVIELARRVGLTM
FT                   TDEELCAEANKWEMRHGGISGRTAQQFINYLQGTVEI"
FT   CDS             72760..74841
FT                   /transl_table=11
FT                   /locus_tag="CC1_00700"
FT                   /product="ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79048"
FT                   /db_xref="GOA:D4J3X7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3X7"
FT                   /protein_id="CBK79048.1"
FT                   /translation="MLYRITDGTLAIGGENLLEHFDFEIKGRERIAITGPNGSGKTTFL
FT                   RLIAGELFLERDDRRQGEGIYLARNVTIGMLRQQIFENTAHTVQEEMMVLCPSRDTWDR
FT                   ERFEFEQEYDRIFTGFGFAKEDKEKLLSDFSGGEQTKIAMVRLLLEKPDILLLDEPTNH
FT                   LDMESVRWLENYLQNYSGAVVMVSHDRYFIDETAEIVYELTDKKLVRYVGNYTQFRQQK
FT                   LKNLAIWKKQYEQQQAELERLNQLIERFKHKPKKAAFARSKKKLIERMEKLPTPPTLAE
FT                   HIFTGELVPAVKGGKWVTEAEELKIGYDGKAIAELSLRIRRGQKIGIIGPNGAGKTTFL
FT                   KTVAGLLAPVKGKCQLGFHIEPGYFDQQSAALTSDKKVLEHFHDLFPAMPEKDVRNELA
FT                   AWLFEGADVQKTVSDLSGGEKARLVLAEILEKRPNFLMLDEPTNHMDIPARETLESAFR
FT                   VYKGTMLFISHDRYFIEQVADALLIFENGQVSYYPFGYRHYMERLERMKQYRAADVSEE
FT                   DAAVVLGQMSAEDQALIAGLKNVPKGATLLGHELSTDQAFLDWQLRLAAEAMADAAEKV
FT                   ENYYHSVKKTKQDEWEKWIEQVCDDEVGSSDVKELTSVDENLYPESVGSQVDDVLEQWY
FT                   KSCLDWYDIWEEMHPQVLEHKEEYPDAELTMKLHEAEEAVKNEKAWLSLDELKNQVEQ"
FT   CDS             74939..75970
FT                   /transl_table=11
FT                   /locus_tag="CC1_00710"
FT                   /product="Stage V sporulation protein AD (SpoVAD)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79049"
FT                   /db_xref="GOA:D4J3X8"
FT                   /db_xref="InterPro:IPR010894"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3X8"
FT                   /protein_id="CBK79049.1"
FT                   /translation="MIQKMGNNSMLFEKPPVILAASSVVGEKEGQGPLGQYFDHVEKDP
FT                   KFGMETWEQAESTMQLMAAEKVIKKAGLSKEQLDFLFAGDLLGQLIATSFGLMELERPV
FT                   FGVYGACSTIGESLLLASMALCGGAGNYALTVTSSHFAGAEKQFRFPLPYGNQRPLSAT
FT                   WTVVGSGAVIVAAEDKKGKAMAKITGGTPGRIIDFGVKDSMNMGACMAPAACDTICQHL
FT                   KDFNRQPTDYDAIITGDLGKVGHQILLKLVAEHGYDISDRHLDCGMLIFDPESQDTHAG
FT                   GSGCGCSAVTLAAYLLPKINRGEWQRILFVPTGALLSTVSFNEGQSVPGIAHGVVIENI
FT                   KRN"
FT   CDS             76223..76774
FT                   /transl_table=11
FT                   /locus_tag="CC1_00720"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79050"
FT                   /db_xref="GOA:D4J3X9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3X9"
FT                   /protein_id="CBK79050.1"
FT                   /translation="MDITEDNYVAGLQAKNEKALKFFIEHDGWIVKSIVHKMMAKYQDK
FT                   QEECMNDIFLAVWRNVDRYTGEKASFRTWLTAVAKYQVLSHIRDIKYHDYVSLDDVEPV
FT                   GDSDVKSRLFDEEEMLEFQKLLEILSEEDRQIFTALFWHEKSYEEVGQEMNMPVDRVYS
FT                   RVSRGKKKLKKNNRWLGGSI"
FT   CDS             76771..78144
FT                   /transl_table=11
FT                   /locus_tag="CC1_00730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79051"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Y0"
FT                   /protein_id="CBK79051.1"
FT                   /translation="MKNIYDLLNQAEDNEDILSENERMEMTDIEKRRIYNRILLDSEEE
FT                   QEEQSCDEQKKYQDNEKAQQVEGGRNIESEDHKNRQEQAKKGRKAKKLLTAAACMAVIC
FT                   AVGFTAGAAVKEYLYKNTQSDYREKLDSTDSEAAADNTADNVIVDTADNTAENAIDGVD
FT                   IRMTEVRMQEDSLTFDCTFTFDGDISEMQKEMEQWAITEGRNAIGDQLFDNAEVYVDGI
FT                   NVLDDDFNYVISQTEAFVIGQNVSFEENKMHIGFLIYQLTEGEDHTIQFCFNGLNMSDH
FT                   TLEGSWKYTYEAKADAYEAELEWQDISIEAENQEEKITLNRYALTPNGPKIDATVEEKK
FT                   GTDSIYEEDGYTKLDFTRIVAWDDLGNYYLMYGRSKDYNIDDSTIPYHQRFTIYDGSNG
FT                   SLDGQENRDYKLVWDENASTVTFAMEKKTDKWDAETGKFVGADYEFVSEPYTVELVKN"
FT   CDS             complement(78263..78685)
FT                   /transl_table=11
FT                   /locus_tag="CC1_00740"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79052"
FT                   /db_xref="GOA:D4J3Y1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Y1"
FT                   /protein_id="CBK79052.1"
FT                   /translation="MELNQCINYLLTTSQHRVFQEVSKRLEIFDVTPIQYGVLYCLWKG
FT                   DKTTPKEIASELKLENSTISGILDRMEKKDLLKRQVSTEDRRYIEVVLTEKGAALEEPV
FT                   LETIDTANADILADIPEEEQQILKRNLRLLAGLEED"
FT   CDS             78856..79062
FT                   /transl_table=11
FT                   /locus_tag="CC1_00750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79053"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Y2"
FT                   /protein_id="CBK79053.1"
FT                   /translation="MGAFKSWFAATKLIPSTSIERKKLNHFQILAIYTKLDCDFCDKII
FT                   QKWIDKMKKRYYNKLIHKQLAYQ"
FT   CDS             79113..79889
FT                   /transl_table=11
FT                   /locus_tag="CC1_00760"
FT                   /product="Enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.55"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79054"
FT                   /db_xref="GOA:D4J3Y3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Y3"
FT                   /protein_id="CBK79054.1"
FT                   /translation="MNNLLMEVENEVAVVTINRPKSLNALNSETLAELDQCFGEIAERK
FT                   DIRVVILTGSGTKAFVAGADISEMVNATPAEGRKMGLLAKEAFLKLETMPQVTIAAVNG
FT                   YALGGGCEISMACDIRVASDNAKFGQPETGLGILPGFGGTQRLPRLVGKGRAKELIFTC
FT                   DQIDAQEAYRIGLANKVVPQEELLDTCKAMAKKIMSKGSYAVSLAKQAINTGMDTDLAS
FT                   GLTLEANLFGLSFSTDDKKEGMTAFLEKRKANLTDF"
FT   CDS             80118..81434
FT                   /transl_table=11
FT                   /locus_tag="CC1_00770"
FT                   /product="H+/gluconate symporter and related permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79055"
FT                   /db_xref="GOA:D4J3Y4"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Y4"
FT                   /protein_id="CBK79055.1"
FT                   /translation="MNIHILVLIIAIALFGVLAFKQMSALILAPLVTIFVILCSGLPIL
FT                   DSLKGLFMPAATDYITKYFLTFFVGALFGAVYQYTGAAESIARAIAGLCHGKFVAPIIM
FT                   CITGILTFGGVSGFVVFFVIYPIALNLFKEGNLTRRLIPAAISAGCWTWSMSAPGSPSI
FT                   QNVIAMDSLGTPSTAAFVPSLLTAIVMFALIFVWLEVRARSFTKKGIVFDDPSLKYQLS
FT                   PEELPNPDEEKDLPNVIVAILPIILILVLFNNPMHPFPVETSVFAGVALATILMFKRIK
FT                   GVNAWIGVFNKGAADSGVAILNTAIVVGFGGVVQNTQGFNDLVTALKNMSMQPLVFVMI
FT                   TVAICAGACGSASGGMGVAFNALKDTYIQMGVSLPYVHRIAAIAAGTLDTLPHQGAQIT
FT                   LLGICKLTHKEAYWDIAVTQIFIPFICCGVFILLAQLGL"
FT   CDS             complement(81574..82506)
FT                   /transl_table=11
FT                   /locus_tag="CC1_00780"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="5.4.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79056"
FT                   /db_xref="GOA:D4J3Y5"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Y5"
FT                   /protein_id="CBK79056.1"
FT                   /translation="MWQLSYTIEPEADGLSVNAYARNIAGLSRAFLRSVKFRENGILIN
FT                   GQRVTTRGVLHAGDSLVFNMPNDRTQKVVPAEGPVSIVFENEDIVLVNKPARLVIHPCH
FT                   GHYSDTLLSYLAWYYRLLPEQPLLCPIGRLDKDTSGLILIAKNKYAAQQLERQRANHTL
FT                   SRVYLALAEGHWTNQSKSGLIDRPIEKVPECFNRYQVADTGRPSRTEYEVLSEFTYEET
FT                   PFSLVRLKLQTGRTHQIRVHMASLSHPLLGDSIYGHEGFLGFDRAALHSFEITCQLPGH
FT                   QDLAVFSSEMPEDFQKMIVESKKLSSTLI"
FT   gap             82758..84012
FT                   /estimated_length=1255
FT   CDS             84372..85091
FT                   /transl_table=11
FT                   /locus_tag="CC1_00790"
FT                   /product="purine-nucleoside phosphorylase"
FT                   /function="purine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79057"
FT                   /db_xref="GOA:D4J3Y6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Y6"
FT                   /protein_id="CBK79057.1"
FT                   /translation="MATPHNRAANGEIAKTVLMPGDPLRAKWIAETYLADVQLVSDVRN
FT                   VYCYTGQYKGVTVSVMASGMGMPSIGIYSYELYKFYDVENIIRIGSAGAYTDKLKVLDV
FT                   VLADAVWSESTYGQAQSLDMKNWQYPSEELNRQIKDTALKMNKKLVSGPIHSSDVFYHE
FT                   ADANDVLRKMVDEEGLLCVEMESFALFHNAEVLGRNAACLLTISDSLVTGEELDADTRA
FT                   TAFAEMVELALEAAIAV"
FT   CDS             85182..86975
FT                   /transl_table=11
FT                   /locus_tag="CC1_00810"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79058"
FT                   /db_xref="GOA:D4J3Y7"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Y7"
FT                   /protein_id="CBK79058.1"
FT                   /translation="MTVREKLAALREKMTAYKMDMYLIGSEDFHGSEYVGEHFKCRAFI
FT                   SGFTGSAGTILVTQDFAGLWTDGRYFLQAEAQLADTGIELFKMGNEGVPTIEDYIVSHI
FT                   EKGQCLGFDGRTVNARNGQDYVRRLSEKGASVNGRYDLVDEIWTERPALSAEPAWLLDI
FT                   AYAGQSREDRIALIRQKMAEKKADWFVLTSLDDIAWLLNFRGNDVQDNPVVLAYLMMSD
FT                   DSLRLYTNAADFKEADRKTLENAGVEFFEYNGIYEDVAKLTENQTVIYDGSALNYAILE
FT                   RMPESAKKVDEQNLTLLPKAIKNPVEVANIRQAHIKDGIALTKFMYWLKKNIGKVPMTE
FT                   ISAAEKMESFRKEQEGYLEPSFEPISGYAEHGAIVHYSATPETDAKLAPKGLLLMDTGG
FT                   QYLEGTTDITRTFVLGELTEEEKKFFTLVLRGNLNLAGARFLHGCKGYNLDYLAREPLW
FT                   QIGMDYNHGTGHGVGYLLNVHESPNGFRWKMLPNRNEGCILEEGMLTSDEPGVYLTDKF
FT                   GVRHENLMVCMKGEKNEYGQFMYFDTVTLVPFDLDGVDPSLMTERERQLLNDYHQKIYE
FT                   VIGPHLNEEEQAWLKEATRAI"
FT   CDS             87022..89328
FT                   /transl_table=11
FT                   /locus_tag="CC1_00820"
FT                   /product="Beta-galactosidase/beta-glucuronidase"
FT                   /EC_number="3.2.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79059"
FT                   /db_xref="GOA:D4J3Y8"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013812"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Y8"
FT                   /protein_id="CBK79059.1"
FT                   /translation="MQRIYINDNWYFARNYTEDLLNPEADLSELRKVRIPHSVCELSYS
FT                   NFDEMSVQQLCGYRRSLIVEDAWRGGHLILTFEGAAHEAAVYVNGKLAVKHYGGYTAFS
FT                   VDIVPFLVDGREQVITVRLDSREKLNQPPFGSVTESLTYGGIYRDVYLDVKDEYYIEDI
FT                   YTATPDVRTDEKILKAQIKLNAYTEGLRLAAHLDTWTEIPLEGEDLQHWDLKTADVHFR
FT                   TSCLTYTVPEAMLWDVDMPILYVLTVELLKDGQCVDMKKVRVGFREAVFDGEGFWLNGR
FT                   ILKLCGFSRYQSWPYVGYAMPKSPQQLDADLLKFELGANAVRTMQGPQSQYFMDRCDEI
FT                   GLLVIPEIPGWQFIGDTRWKKIAVRNVREMVMQYRNHPSVILWDTRISDSDDEDALYYK
FT                   TSRLARELDVYRQTGGERDFAGSHFYEDVYLYDDMSEDAASASISSENIIQDLSKTCLL
FT                   SGHRSLNVQVNGGAGIDDWLCQTMRQASVWRAVESNDSFAGSLAPVMTDYPVSRKYSGS
FT                   DGICSRGLMDAFRNPKMAAAFFKSQREDEPVCAAVLPMDDRLMVMTNADHILLYCDEKL
FT                   IGEFYPDETVFRDLVHPPIFVEHLSEIVRTGEKPKEQKGTSNRVFLKKESEKDQELFVQ
FT                   QKSELAFSRRYAVTWRIEAIKDDTVVAGTSITPTPEVRLQITTDRQHMMEESSYDAATV
FT                   HIEAVGESGQHLYGYETPLVLKTEGDIELIGPSVIVMKNGFAGTYVRSIGKAGSGRLMI
FT                   QDGHGEAVVEFSVEV"
FT   CDS             89332..89970
FT                   /transl_table=11
FT                   /locus_tag="CC1_00830"
FT                   /product="Phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79060"
FT                   /db_xref="GOA:D4J3Y9"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Y9"
FT                   /protein_id="CBK79060.1"
FT                   /translation="MNIYFANYDRNGMTAVEESKYQHAVGRQLLKTALLRAGVSKDFLS
FT                   KEESLIFAYGPSGKPLFHDLPDVHFNISHTGGLVVCAVGNIPIGIDAERIRPYPKSVLR
FT                   KMTDRERLYIQKSDRQDEAFMRVWTMKEAMIKLTGEGLAAFERTECVPGEVLHMYSKRT
FT                   VCDEAAVSGALSDIHCRQLVWQGQYVITAVENTNKNQDCIFSKKVYNRL"
FT   CDS             89993..91174
FT                   /transl_table=11
FT                   /locus_tag="CC1_00840"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79061"
FT                   /db_xref="GOA:D4J3Z0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Z0"
FT                   /protein_id="CBK79061.1"
FT                   /translation="MEFNFASRLDSFEEGIFATLNDKKNELVKAGRKVYNMSVGTPDFK
FT                   PAQHIMDVVSEAASKPENYKYALADLPELLDAVSNHYAERYGVKGIRHEEIMSIYGSQE
FT                   GMAHIAMAICDPGDVVLVPNPGYPVFTAGPFLCGAKVETYDLHPENNFLIEFDKIPEEQ
FT                   ARRAKMMIVSYPLNPVCVTAPDSFYEELITFAKKYNIIILHDNAYSDIIYGGRVGKSFL
FT                   SFRGAKDVGVEFYSLSKSYNYTGARMSFVVGNQAVIDKFKNVRSQIDYGIFLPVQYGAI
FT                   AALTGPQDAVKAQCEEYDRRNHALSEGLTSIGWKVPLSQGTMFSWAQIPEGFANSNEFV
FT                   MELMEKTGLIVTPGSSFGSLGEGFVRFALVLDVPTIQEAVRSVKESGILNSRM"
FT   CDS             91181..91684
FT                   /transl_table=11
FT                   /locus_tag="CC1_00850"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79062"
FT                   /db_xref="GOA:D4J3Z1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Z1"
FT                   /protein_id="CBK79062.1"
FT                   /translation="MYDELSEADIQKMKEEIEHRKVVVRKEALAAVKEAREQGDLSENF
FT                   EYQAAKREKNRNESRIRYLERMVKTAKVIKDHSKDDEVGLNNTVTVYFEDEDEEETYRI
FT                   VTTVREDVLHGLISIDSPVGKALLGHRVGDTVHVQVNDKYGYDVEIRKIDKTTDETDDK
FT                   IRDF"
FT   gap             91753..91972
FT                   /estimated_length=220
FT   CDS             92119..92481
FT                   /transl_table=11
FT                   /locus_tag="CC1_00860"
FT                   /product="SpoVA protein."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79063"
FT                   /db_xref="InterPro:IPR005562"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Z2"
FT                   /protein_id="CBK79063.1"
FT                   /translation="MLVDYLRVFITGGVICALVQLLMEKTKMMPGRIMVLLVCSGAILG
FT                   MLGIYKPIVDFGQAGATVPLLGFGYNLWKGVKEAVDNQGFFGLFTGGFTASAVGISGSL
FT                   VFAFLASLVCNSKIKK"
FT   CDS             complement(92631..95258)
FT                   /transl_table=11
FT                   /locus_tag="CC1_00870"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.-"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79064"
FT                   /db_xref="GOA:D4J3Z3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011816"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Z3"
FT                   /protein_id="CBK79064.1"
FT                   /translation="MDYSKQNNEKKRKKIRSNAAKSKKKITFNIFRFTMLAILLIVIVG
FT                   IAAAIGGFKGVIDSAPDITASNVMPSKLKSVMYYPDGQEAIELVGAQSNRTIVSIDDIP
FT                   KCLSNAFVAIEDNRFYEHNGIDPKGIVRALFVGLSHGGNFSEGASTITQQLIKLTIFNG
FT                   GAETDTIQRFKRKFQEWYLALKLEKEMSKDEIMEAYLNTINLGRGAYGVEAAAERYFNK
FT                   KCSDLTVSESAVIAAIAQSPSYNNPIDYPDINAQRRDKILNNMLTLGLITQQQYDEAKA
FT                   DDVYSRITEVNKTTKSKDIIYTWFEDAAIDQVLNDLQEKLGYTSAEANNALYSGGLQIY
FT                   LTQSRHIQDIVDSYYNDDDNFPSTEYRLHWALTYKDKDGETVNIDENSLQSYYGADDCD
FT                   LLYDNEDQAKQSISEFLEAKGITDDDIIAQSFDMTVQVQSSFVLMDQSTGYVLALSGGR
FT                   GEKKTSRSFNRATQSTRQPGSVFKTIAVFLPALDSCGLSLASTKEDEPYTTPDGYQPFN
FT                   TNANSYQGTTTIREAITYSMNVVTTKWLVEDVTPKLGIEYLENLGITTMDEDRDAYAPL
FT                   GLGGISNGVTNLELTGAYAAIANGGVYTEPILYSKILDKDGNVLLDNVPEKHTAMKDST
FT                   AWLLTSAMEDVVSKGTGTSAQISNYGIAEAGKTGTTDDYKDLWFVGYTPYYTAGIWFGY
FT                   DDSTLMRYRLGRNYNAHKVLWKNIMNEVLEGYEDRDFVMPSDVEKIRVCSSTGLLASYG
FT                   CNVITEYFAKDTAPTEYCSKHSYRYYENSYDDDSSSSSSSGSNSSNTTSGDNSGNANSG
FT                   ADNSGGNNSGGDNSGGGNSGGDNSGGDNSGSDNSGGDNSGGGNSGSDNSGGDNSGGDNT
FT                   GAEQ"
FT   CDS             95402..96073
FT                   /transl_table=11
FT                   /locus_tag="CC1_00880"
FT                   /product="conserved hypothetical protein TIGR00257"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79065"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Z4"
FT                   /protein_id="CBK79065.1"
FT                   /translation="MAEINKVNNYKTVYRGGTAEIVEKKSRFIAHSAHVESEEEALAFI
FT                   EQIKKQYWDARHNCHAFSVGVTNETARCSDDGEPAQTAGKPMLDVLMGQQLKNTVVVVT
FT                   RYFGGTLLGTGGLVRAYSAAVQEGLKESLIIEKFLCRRVRMSMDYTMLGKMQYLAAKLN
FT                   LMILDTLYTEGVEMQLLVPDTQYAAFIKEVTEASNGKVVPESEGLCYGADVEGKIEIFD
FT                   A"
FT   CDS             96182..97375
FT                   /transl_table=11
FT                   /locus_tag="CC1_00890"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79066"
FT                   /db_xref="GOA:D4J3Z5"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Z5"
FT                   /protein_id="CBK79066.1"
FT                   /translation="MKKSLKLGAACLGVALLLCACGKGSANSTDTAAGSETESAAQSAS
FT                   ESASETETETEDTNAYAYDYDVESLVKLGDYKGLTYTETDTSVSDEEVESQINSTLTAH
FT                   ATPEQIKDRAVEDGDTVNIDYEGKIDGETFEGGTASGASLTIGSDSFIDGFEDGLIGVK
FT                   PGEKKTLNLKFPDDYKTNPDLAGKAVVFDVTVNYIEGDDIVPELTDDFVKGLSITDVST
FT                   VDEYRAYVKSQLQTNKESEAESSKQKELLQQAVDNAEIKEIPEELVTEYSAQYTSYYQQ
FT                   YASYFGMEFSDFLTQYMNQTEDDFNKDAADYGKQVAGNMLVVCAIAKAEKIDPDALYDE
FT                   KVAQYAKQSGYSDVATLEKDYSQKYLRQVIINEEVLNVLEENAVAVAPTETESEASK"
FT   CDS             97548..97679
FT                   /transl_table=11
FT                   /locus_tag="CC1_00900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79067"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Z6"
FT                   /protein_id="CBK79067.1"
FT                   /translation="MDFMSVFLPVLILGVVIVAVLVVVATVASAVSAAAVEDDEEDE"
FT   CDS             97690..97890
FT                   /transl_table=11
FT                   /locus_tag="CC1_00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79068"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Z7"
FT                   /protein_id="CBK79068.1"
FT                   /translation="MNANDEGMYVFEQHPRIFCVILGVPGKQSDVSGNQSGNGKSGPFW
FT                   IRFPGVCFSHQLQSANAAWGG"
FT   CDS             complement(97925..98140)
FT                   /transl_table=11
FT                   /locus_tag="CC1_00920"
FT                   /product="Small, acid-soluble spore proteins, alpha/beta
FT                   type."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79069"
FT                   /db_xref="GOA:D4J3Z8"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Z8"
FT                   /protein_id="CBK79069.1"
FT                   /translation="MTNNSSSTMEVPQAKDAMDKFKMEVASEIGVNLKQGYNGDLTSAQ
FT                   AGSIGGEMVRRMIKRQEEQMANGGMQ"
FT   CDS             98293..98784
FT                   /transl_table=11
FT                   /locus_tag="CC1_00930"
FT                   /product="adenylate cyclase"
FT                   /function="adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79070"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="UniProtKB/TrEMBL:D4J3Z9"
FT                   /protein_id="CBK79070.1"
FT                   /translation="MEIERKFLIQKMPEHPEQYKSHLIEQAYLNVRPVVRVRREDENYY
FT                   MTYKGGGMMAREEYNLPLDADSYAHLLQKADGNIITKRRYLIPFHAYTIELDVFEGLFE
FT                   GIVVAEVEFPSIEEAESFAAPEWFGEDVTYDGRYHNSAMSRMKVEEIVEIQSLFASEGK
FT                   "
FT   gap             98817..99946
FT                   /estimated_length=1130
FT   CDS             99964..100833
FT                   /transl_table=11
FT                   /locus_tag="CC1_00940"
FT                   /product="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79071"
FT                   /db_xref="GOA:D4J400"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4J400"
FT                   /protein_id="CBK79071.1"
FT                   /translation="MNTKNKAIVCILISAFGFSIMNLCVKLSGDLPSIEKSFFRNLVAA
FT                   IIAFILLYRSKAGFSCKKENLPALILRAVLGTIGIFCNFYALSHMVLSDASMLNKLSPF
FT                   FTLIFSYIFLKEKLSPFQCIAIVIAFIGSLFIIKPSFDLTATFPALCGFIGGVCAGGAY
FT                   TCVRYLGIKGEKGPFIVFFFSAFSCLAALPYMIFFFEPMTLQQFLILIGAGAGAAVGQF
FT                   GITAAYKYAPAREISIYDYTLVIFAAIWSFLFFGELPDWLSILGYVLIFGMSALMFLYN
FT                   NRHAESAK"
FT   CDS             101010..102209
FT                   /transl_table=11
FT                   /locus_tag="CC1_00950"
FT                   /product="Predicted AAA-ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79072"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J401"
FT                   /protein_id="CBK79072.1"
FT                   /translation="MGSYLNPGNFSFRGSLRSKIYVDKSKLIAKTNEVLCTEQKYICVS
FT                   RPRRFGKSMAANMLAAYYDRSENTEDLFQNLAISREKSYEENLNQYDVIKINMQEFLSM
FT                   AGTIEKMLEMLKDYLVVDFEEAYPEVRFRDKNNLIQTMKDVFSYTKCPFVILIDEWDCL
FT                   FREYKQDKEAQKKYLDFLRAWLKDKDYIAMAYMTGILPIKKYGSHSALNMFTEYSMTDP
FT                   GELAEYFGFTELEVSAICEKYGMSFEEAKTWYDGYQLVAHRQWKDECYSMYNPKSVVEA
FT                   MLRHKFGTYWNQTETYEALKIYIQMDMDGLKASVIRMLTGDSVSINTGTFSNDMTTFAT
FT                   KDDVLTLLVHLGYLTYNSIDGTVSIPNKEVSQEYINAISTMNWHGVADSVEASRKLLAF
FT                   "
FT   CDS             102366..103712
FT                   /transl_table=11
FT                   /locus_tag="CC1_00960"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79073"
FT                   /db_xref="GOA:D4J402"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D4J402"
FT                   /protein_id="CBK79073.1"
FT                   /translation="MKEDINIMSVQVEKLEHNMAKLTITVPAETFNKAITQAYKKMKNQ
FT                   ISIPGFRKGKVPQAMVEKMYGAGMFYEDAANIVIPEEYDKALAEVKDIKITSQPAIDVT
FT                   QMEKGKDFIFTAEVATKPEVTLGQYKGIEVPENKVEVTDEEIEAELKKVQEQNAREITV
FT                   DRPAENGDTVVIDFEGSVDGEVFEGGTAENHPLVLGSGSFIPGFEDQLVGATADSDVEV
FT                   NVTFPEDYQAKDLAGKAAVFKVKVHEIKKKELPEINDEFAQDVSEFDTLDEYKEDVKKG
FT                   IAEQKEKAVRQEKQEKIIRQIVENAEMDIPDPMVITQTRQMMDQFAQQMQSNGLSMAQY
FT                   YQFTGLTPDGLLEQMKPQAQKNIENRLVLEAIAAAEGITASEEEVEKEFANIAERYGLT
FT                   VDKVKEIFADEETENIKSDIAAQKALDMITEAAVEVPVTEVEATVEDAE"
FT   CDS             103856..104440
FT                   /transl_table=11
FT                   /locus_tag="CC1_00970"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79074"
FT                   /db_xref="GOA:D4J403"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4J403"
FT                   /protein_id="CBK79074.1"
FT                   /translation="MSLVPTVIEQSSRGERAFDIYSRLLKDRIIFLGEEVTDVSANLIV
FT                   SQLLFLESEDPGKDIQMYINSPGGSVSAGMAIYDTMQFIKCDVSTICMGMAASMGAFLL
FT                   AGGTPGKRLALPHSTIMIHQPSGGAQGQATEIQIVADRIQYTKRMLNELLAANTHQPLE
FT                   KIAADTERDYYMSAEEAKNYGLIDAVVTKRA"
FT   CDS             104469..105767
FT                   /transl_table=11
FT                   /locus_tag="CC1_00980"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /function="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79075"
FT                   /db_xref="GOA:D4J404"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J404"
FT                   /protein_id="CBK79075.1"
FT                   /translation="MASRIDDKKQPRCSFCNKTQDQVRKLIAGPNAFICDECVDICMEI
FT                   IEDEMEEDQNDADFNLLKPVEIKNFLDQYVIGQEQAKKVLSVAVYNHYKRIASNAGNDV
FT                   ELQKSNIIMVGPTGSGKTLLAQTLAKILNVPFAIADATALTEAGYVGEDVENILLKLIQ
FT                   AADYDIEKAERGIIYIDEIDKITKKSENVSITRDVSGEGVQQALLKILEGTVASVPPQG
FT                   GRKHPHQEFLQIDTTNILFICGGAFDGLDKIVESRTGGQSIGFNADIHVKEEEQNVSEL
FT                   MKQALPQDFVKYGLIPEFVGRVPVSVSLDLLDEDALVRVLTEPKSAIIKQYKKLFQLDG
FT                   VDLEFEDEAVHEIAHRSFMRNTGARGLRSIVENVLMDTMFTLPSDETVEKCIITKAVVD
FT                   GQAAPELVHGEPQLPSKKGQTKKSSRKNSGEIA"
FT   CDS             105902..108241
FT                   /transl_table=11
FT                   /locus_tag="CC1_00990"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_00990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79076"
FT                   /db_xref="GOA:D4J405"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:D4J405"
FT                   /protein_id="CBK79076.1"
FT                   /translation="MSDINCRMPAVALRGLVCLPDMILHFDVSRKKSIAALEAAMVKDQ
FT                   MVFLVAQKDPDEEDPKQEDLYTAGAMAKVKQIVKMPENMVRVVAEGKFRAELDEMISVS
FT                   PYLLTDVIIHDREEKVENESEAEAMRRVLEEIVQKFIDAGAKFGPEITRQMEQAEDIVK
FT                   LTNQLCANMPMRWQDRQTLAEKMDFRERYEELCRIMEKEYDVLLINQDIQNKVKSRLEK
FT                   NQRDYVLREQMKLIREELGDDMQSEIDEYEKKLEELKAPDVVKEKLEKEISRFKASAGN
FT                   SAETGVLRTYIDTLFEMPWSKTSRDNKNIDKAAKILREDHYGLEKVKERILEFLSVRLL
FT                   TKKGDSPILCLVGPPGTGKTSIARSIARALNKKYVRISLGGVHDEAEIRGHRRTYIGAM
FT                   PGRIASGLSHAGVKNPVMLLDEIDKVSTDYKGDTFSALLEVLDSEQNSKFRDNYLELPL
FT                   DLSDVLFIATANSLSTIPRPLLDRMEIIEINTYTQNEKLHIAKEHLIEKQMKANGIKAK
FT                   QLTISDKAIEDIILYYTRESGVRGLERCLGDICRKTARMILQDGKKNVKVTEKNLEHFL
FT                   GTKKYDYEMANAKNEIGIVRGLAWTSVGGDTLSIEVNVMPGKGKFELTGHLGDVMKESA
FT                   MAAISYIRSVSDQFNIDREFFEKNDIHIHIPEGAVPKDGPSAGVTMATAMLSAITGTPV
FT                   RADVAMTGEITLRGRVLPIGGLREKSIAAKVAGIHTVIVPEKNRRDIRELDKEITKDMK
FT                   FVYASTMADILPVALESMPKAQAANS"
FT   CDS             108263..108877
FT                   /transl_table=11
FT                   /locus_tag="CC1_01000"
FT                   /product="ribosome biogenesis GTP-binding protein
FT                   YsxC/EngB"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79077"
FT                   /db_xref="GOA:D4J406"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:D4J406"
FT                   /protein_id="CBK79077.1"
FT                   /translation="MVIKNVNLETVCGITSTLPENQHPEVAFSGKSNVGKSSLINGLMN
FT                   RKAYARVSQQPGKTQTINYYNVNDEIYIVDLPGYGFANVSQAVKAKWGKMIENYLRKSR
FT                   QLRMVFLLVDIRHEPSANDKHMYSWIIENGFYPAIIATKLDKIKRSQVQKQLKLIREGL
FT                   NVAEGTPIVPYSAVTKQGRDEIWELIETYAMTPEETLNEDE"
FT   CDS             109015..110616
FT                   /transl_table=11
FT                   /locus_tag="CC1_01010"
FT                   /product="Predicted exonuclease of the beta-lactamase fold
FT                   involved in RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79078"
FT                   /db_xref="GOA:D4J407"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="UniProtKB/TrEMBL:D4J407"
FT                   /protein_id="CBK79078.1"
FT                   /translation="MKLFFSGAAHEVTGSKHYLEAAGKKILIDCGMEQGKNLYENQEIP
FT                   VPASDVDYVFLTHAHIDHSGMLPLLYNQGFKGSVYTTEATQQLCQIMLLDSAHIQEFEA
FT                   EWKNRKGKRAGIPPVVPIYTTEDAVGILQYFVPCRYEEKIQVCEGIEIRFVDAGHLLGS
FT                   ASIEVWVTEQGVTKKLVFSGDIGNTNQPIIKNPHYIKDADYVIMESTYGDRSHGPRPDY
FT                   IKELTAIIQRTFDRGGNVVIPSFAVGRTQEMLYFIRQIKAEGLVKNHDNFEVYVDSPLA
FT                   VEATNVFNRNVPGYYDDDAMALIKQGINPISFPGLKTAVTSDDSIAINVSTTPKVIISA
FT                   SGMCDAGRIRHHLKHNLWRPECTILFVGYQSVGTLGRNLVEGATEVKLFGETIEVQAEI
FT                   TSLAGVSGHADCEGLMKWIGAFEKKPKRVFVVHGEDTVTDVFAARIKDELGIDAVAPYT
FT                   GAEYDLLTNECLQAPEPVRVTPKKAMQRKAATVFERLLNAGRRLMLVIRHNEGGTNKDL
FT                   TRFTNEINNLCDKWDR"
FT   CDS             110699..111754
FT                   /transl_table=11
FT                   /locus_tag="CC1_01020"
FT                   /product="stage III sporulation protein AA"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79079"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014217"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J408"
FT                   /protein_id="CBK79079.1"
FT                   /translation="MDRKEQLMKIFSVRIREILTALPVHIGRLQEIRLRAGRPLMILYD
FT                   NKEYLAGSEGNIVTESSEAYHVSAQEIQETMTYLSHYSIYAYEEEIRQGFLTIQGGHRV
FT                   GIAGKVLSDGNGIRSIRPITFLNVRLAHEVRGCADELMPWLYEEGRPCSTLILSPPGCG
FT                   KTTMLRDVIRQFSNGCGQEAGRRVGVVDERSEIAACYRGIPQNDMGIRTDVLDGCAKHM
FT                   GMQMMLRSMTPEILAVDEIGSRTDKEAIDAVMNCGCCLLATAHGASMEKMQMRPALRQM
FT                   AEEKIFERYVILSRKNTVGKVEAILNADMDFLYQNHRGDLCHDRMRRSRTGYGRLLEEA
FT                   LCTAGTDAAVT"
FT   CDS             111738..112154
FT                   /transl_table=11
FT                   /locus_tag="CC1_01030"
FT                   /product="Stage III sporulation protein AB (spore_III_AB)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79080"
FT                   /db_xref="InterPro:IPR014198"
FT                   /db_xref="UniProtKB/TrEMBL:D4J409"
FT                   /protein_id="CBK79080.1"
FT                   /translation="MQRSLRMLHGEIRYTGAELPEAIDQIALRQEKPFSDFYHGLSEQM
FT                   RRMDGQSLKTLWQTEIEKCLNNTYLTKEDKQIFLESGSQLGYLDRQMQLSSLEACMAQI
FT                   EDNQNMIRKNMKEKQKLSVALGLLSGFFIIILLI"
FT   CDS             112174..112368
FT                   /transl_table=11
FT                   /locus_tag="CC1_01040"
FT                   /product="stage III sporulation protein AC"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79081"
FT                   /db_xref="InterPro:IPR009570"
FT                   /db_xref="InterPro:IPR025664"
FT                   /db_xref="UniProtKB/TrEMBL:D4J410"
FT                   /protein_id="CBK79081.1"
FT                   /translation="MTVNVIFKIAAVGILISVLNQILKHSGRDDQAFLTSLAGLILVLM
FT                   WIIPYIYELFQTIQQLFAL"
FT   CDS             112380..112769
FT                   /transl_table=11
FT                   /locus_tag="CC1_01050"
FT                   /product="Stage III sporulation protein AC/AD protein
FT                   family."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79082"
FT                   /db_xref="InterPro:IPR025664"
FT                   /db_xref="UniProtKB/TrEMBL:D4J411"
FT                   /protein_id="CBK79082.1"
FT                   /translation="MEVIKAAVMGIAAAMLALYMKSVRPEYSSMISISAGIFIFGFALI
FT                   CLQKITGSIQTLGEYLAVSPVYIRILLRITGIAYICDFASCICKDAGYQAIAAQIELLG
FT                   KLTIVVMSLPVLQTLMSAITEFIGA"
FT   CDS             112770..114065
FT                   /transl_table=11
FT                   /locus_tag="CC1_01060"
FT                   /product="Stage III sporulation protein AE (spore_III_AE)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79083"
FT                   /db_xref="InterPro:IPR014194"
FT                   /db_xref="UniProtKB/TrEMBL:D4J412"
FT                   /protein_id="CBK79083.1"
FT                   /translation="MERWPKIKMWKYILRKKMLYGIGFVCVLIGMTVTGVCIKPAKEVQ
FT                   ASISHEAVKDIRSDAPGGGEGVSEQPEGENTDDKDDPLDMLGDLSEIEAAVSEAMTVRS
FT                   SVSFKAILKQLMTGSLSEAGQLLFQMIREQVAGGIYENQQLLFKIACFAVIGAIFTNFA
FT                   MAFSKEQVAETGFYLTYTLLMTLMMTSFMMTSAIVRDVLHSLTEFMKVLLPTFCTALTF
FT                   TTGSLLSGAYYELMMIAIAAADWLMSSLIMKMIQVYVLTALVNHISKEDYLSKLSELLA
FT                   LLIRWSIRTVVGVILGINILQTMLLPAIDRAKETVAYKLISAVPGVGTAMNTAVGAVIG
FT                   SGVLIRNVLGMGSLLIILLICAVPVVRVCMVLLSYKIVQAVIQPVTEKRLLEGMDAMTQ
FT                   GVGMLLHVLVSCVLMFILSLAVVCNAAAVVAV"
FT   CDS             114065..114607
FT                   /transl_table=11
FT                   /locus_tag="CC1_01070"
FT                   /product="Stage III sporulation protein AF (Spore_III_AF)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79084"
FT                   /db_xref="InterPro:IPR014245"
FT                   /db_xref="UniProtKB/TrEMBL:D4J413"
FT                   /protein_id="CBK79084.1"
FT                   /translation="MEGADMEQLLVWVKKLAVFMILCSYMEHLLPAQYKRYFHMCTGLI
FT                   LILMITSPLRQVLQGNIGSEVSCLLENLRTGSQVYQMKGEDGKRYQTYYMKQYKAAMTE
FT                   QIRNLADMSGLRAEEIRLSVNEDVSSDSYGCPTEVSMHVLSEDGMEADNGSKKQFRQLL
FT                   SQQLGMAESQIHFGYSG"
FT   CDS             114622..115224
FT                   /transl_table=11
FT                   /locus_tag="CC1_01080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79085"
FT                   /db_xref="UniProtKB/TrEMBL:D4J414"
FT                   /protein_id="CBK79085.1"
FT                   /translation="MADFKAFWQRFKSGENGGKGQKDRFMLLALVGLLILVAVWPVGGK
FT                   SGKTSGQTEASVEKKQETSYNYADQYAAVMESRLKSMLESVEGAGEVKVMITLKNNGEQ
FT                   VVEKDRTYSENKTGQGEQSGQTTTNNNISRSESTVYSSSNGGSPYVVKQMEPEIEGVLV
FT                   AAQGGGDETVVNEITYAVQVLFDVPVHKIKVVKMSSR"
FT   CDS             115989..116375
FT                   /transl_table=11
FT                   /locus_tag="CC1_01100"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79086"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:D4J415"
FT                   /protein_id="CBK79086.1"
FT                   /translation="MANERENNTNYTIYENGPLGEVQIANEVVAIIAGIAATEVDGVAA
FT                   MAGDVQKELVSKLGMKVLSKGVRIAFEDSGIRVDLSIILEYGCSIPEVTAAVQERVKSS
FT                   IETMTGLKVVDVNIRVADVKIDNE"
FT   CDS             116466..116861
FT                   /transl_table=11
FT                   /locus_tag="CC1_01110"
FT                   /product="transcription antitermination factor NusB"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79087"
FT                   /db_xref="GOA:D4J416"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="UniProtKB/TrEMBL:D4J416"
FT                   /protein_id="CBK79087.1"
FT                   /translation="MGRRELREHIFRLLFRRDFFPEEEMKEQEAFYIEYLADPEQKEVD
FT                   YIVQKTEKIMAMIPELDTMVNEHSVGWQTERMGKVDLTIIRLAVYEMKYDDDIPVSVAI
FT                   NEAVELAKRYGSENSPAFINGVLAKMI"
FT   CDS             116866..118077
FT                   /transl_table=11
FT                   /locus_tag="CC1_01120"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79088"
FT                   /db_xref="GOA:D4J417"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:D4J417"
FT                   /protein_id="CBK79088.1"
FT                   /translation="MNRKQVYSVSSVNQYIKSLFMDDFALNHIYVRGEVSNCKYHSSGH
FT                   IYFTLKDRGGAIACVMFAGNRKGLNFRMSEGMAVIVYGSVSVYERDGKYQLYAREIIQE
FT                   GAGRLYEAYEALKKKLLAEGLFDDEHKQKIPKYPKRLGVVTARTGAAVQDIINVSLRRN
FT                   PWLQIVFCPSAVQGDGAAQSVVRGIHALEAAGVDVMIVGRGGGSIEDLWAFNEEIVARA
FT                   VYECSVPVISAVGHETDTTIIDFVSDLRAPTPSAAAELAVPDMRVILGQIQGYEESLSH
FT                   AMEQAVLRNRQRVENYQRIFRHLNPQSRLNDRRQRLMEIEERLRIGMNRKLDAAKSELA
FT                   IRTQKLEGVSPLRQLERGYAYVSDEEGHGITSAGQVTKGQLLLLDVRDGRIESEVTAVK
FT                   KRTS"
FT   CDS             118094..118300
FT                   /transl_table=11
FT                   /locus_tag="CC1_01130"
FT                   /product="Exonuclease VII small subunit."
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79089"
FT                   /db_xref="GOA:D4J418"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="UniProtKB/TrEMBL:D4J418"
FT                   /protein_id="CBK79089.1"
FT                   /translation="MAKAKSLETAFEELDALAAKMEDRDLPLEEAFKLYQEGVKLLKYC
FT                   NGAIDKVEKKIIEIHGNEDEEDE"
FT   CDS             118316..119227
FT                   /transl_table=11
FT                   /locus_tag="CC1_01140"
FT                   /product="Geranylgeranyl pyrophosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79090"
FT                   /db_xref="GOA:D4J419"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniProtKB/TrEMBL:D4J419"
FT                   /protein_id="CBK79090.1"
FT                   /translation="MQLEQELKEKTADIEKLLERMLPEEAGLQKTIFSAMRYSLMAGGK
FT                   RIRPLLIAETYRFFGGTDMALAEPFMAAIEMIHTYSLIHDDLPALDNDDYRRGRLTSHK
FT                   VYGEAMAILAGDALLNYAFETASKAMDHARDDEELLRVMKAFRILSSKPGINGMIGGQV
FT                   VDVELTGKPIPEKTLRFIFELKTGALIEAAMMIGAQLAGASDEQIAAVEKAAGDIGMAF
FT                   QIQDDVLDVIGNEALLGKPVHSDEKNEKTTWVTVYGLEQAKKDVAEYSEEAMAILAQMT
FT                   GVTEPEKSFLYDFVEYLIHRNK"
FT   CDS             119252..121126
FT                   /transl_table=11
FT                   /locus_tag="CC1_01150"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /function="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79091"
FT                   /db_xref="GOA:D4J420"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4J420"
FT                   /protein_id="CBK79091.1"
FT                   /translation="MSEYLDRINEANDIKKIEPEAYDALASEIRSFIIESVSEHGGHLA
FT                   SNLGVVELTMALHLCMNFPNDKLIWDVGHQAYTHKLLTGRKEDFSGLRTFGGMSGFPKH
FT                   KESPCDAFDTGHSSTSISAALGYARARDLKGEDRTVVAVIGDGSLTGGMAYEALNNVSH
FT                   LKSNMIIVLNDNKMSISENVGGLSKHLTALRTRESYMDFKMDVEKKLKQIPHVGDSVAR
FT                   SVKKSKDSIRQLFVKGGFFEDFGIKYIGPIDGHDIKEMVRVLNALKRLNEPVVMHVVTQ
FT                   KGRGYVPAEKNPSAFHGVGSFDIATGESLAGKSLTYTSVFSKTICRLGKAHPNVVTICA
FT                   AMPDGTGLTAFKKYFPDRFFDVGIAEQHAVTFAAGLAAGGMHPFVAVYSSFLQRAYDQI
FT                   IHDVCIQNLPVVFCVDRAGLVGADGETHQGIFDLSYLSMIPNMTVCAPKNKYELYDMLY
FT                   FAYQYHGPIAIRYPRGSAYEGFKNMRPPIEYGKSELMFEGEKIALVAVGSMVQTAVEVR
FT                   EKLLDKGINATVVNARFVCPLDTECLDRLSRDHHWIVTMEENVLKGGFGEACGDYLLAK
FT                   HEDVRLLHVGVPDVYVEHGGVDQLKKTLHMDADSIVERICSAMSDAED"
FT   CDS             121187..122002
FT                   /transl_table=11
FT                   /locus_tag="CC1_01160"
FT                   /product="hemolysin TlyA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79092"
FT                   /db_xref="GOA:D4J421"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J421"
FT                   /protein_id="CBK79092.1"
FT                   /translation="MKERLDVLLVKRNLAESREKAKAIIMSGNVFVNGNREDKAGTTFD
FT                   EEKAQIEIKGHTLPYVSRGGLKLEKAIEVFGVDVKGKVCMDIGASTGGFTDCMLQNGAD
FT                   HVYSIDVGRGQLAWKLRQDPRVICMEKTNIRYVTSEQIPEKIDFASVDVSFISLKKVLG
FT                   PARELLQDDARMVCLIKPQFEAGREKVGKKGVVRDKAVHLEVIEMILQFVTSIHFEILN
FT                   LDYSPIKGPEGNIEYLVYIRKRPEDYPLGAWTVNPAEVVDRAHEGLAKG"
FT   CDS             122034..122897
FT                   /transl_table=11
FT                   /locus_tag="CC1_01170"
FT                   /product="Predicted sugar kinase"
FT                   /EC_number="2.7.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79093"
FT                   /db_xref="GOA:D4J422"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D4J422"
FT                   /protein_id="CBK79093.1"
FT                   /translation="MKKFALLTNYSKDKRLVYTRMIKTYITENGGSYWIPRYISEPDKD
FT                   GDQRYDFSDMPEDIECVLVLGGDGTLLQAARELFQRHIPLLGINLGTLGFLTSAEKSEL
FT                   PKCLDSVLDDSCSIDERMMLEGVAYHGSEKIQMNIALNDVIIARAGFSRLVELKIYVNG
FT                   ELLSIYNADGIIVSTPTGSTGYSLSAGGPIIFPQTDVIVITPICPHSLQARSLVVSGED
FT                   RIMIEIGRRRKTQKEEAMVTFDGRSAQELETGDRIEIYKAQETTQLIRLKGRSFYQVLQ
FT                   NKIGTA"
FT   CDS             122913..123365
FT                   /transl_table=11
FT                   /locus_tag="CC1_01180"
FT                   /product="transcriptional regulator, ArgR family"
FT                   /function="transcriptional regulator, ArgR family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79094"
FT                   /db_xref="GOA:D4J423"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:D4J423"
FT                   /protein_id="CBK79094.1"
FT                   /translation="MKLKRHEKIIELVNKYEIETQEELASLLNQAGFRVTQATISRDIR
FT                   ELRLSKVNSHDGKQKYAIMSVKERGLNDKLSKVLKEGYISSMEASNLMVVKTATGMAMA
FT                   VATALDAMELPGFAGCIAGDDTVMCALHSGADVEMLLNRINKVVNQ"
FT   CDS             123382..125058
FT                   /transl_table=11
FT                   /locus_tag="CC1_01190"
FT                   /product="DNA replication and repair protein RecN"
FT                   /function="DNA replication and repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79095"
FT                   /db_xref="GOA:D4J424"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J424"
FT                   /protein_id="CBK79095.1"
FT                   /translation="MLQNIHVKNMALIDEADVDFGGHLNILTGETGAGKSIIIGSISTA
FT                   LGGKVSRDVIRKDAEYALVELNFKVNSPQILAELEKMEIPVDGDEVVISRRITGSRSVA
FT                   RINGELVSLPVLRQAAALLIDIHGQHEHQSLLHKDKHLAILDQFSREEMASVKDALKDS
FT                   YREYMILKKEMDGAITDEGKRLSEISFLQYQIEEIENANLQDGEEEQLDKAFRKMSHAR
FT                   QMMESVAAAHGMTGYEGASSAGDLVGRALRELSSVEKYDEAIGGLISMLTDIDGLLNDF
FT                   NRELADYESGLTFDESVYHETEDRLNLIQRLKTKYGSSIAEILAHQAECQEELEKLDDY
FT                   ENYLSGLRMKLDQAEKELKDLSDKLTTIRRANAAVLQERIKAALIDLNFLDVRFEIHCE
FT                   PLGHYTENGQDSIEFMISTNPGETVKPLGKVASGGELSRIMLAVKSVLADADAIETLIF
FT                   DEIDTGISGRTAQKVSEKMAVIARKHQVICITHLPQIAAMADDHYVIEKSAMGQRTITE
FT                   IYHLSDDASVGEIARLLGGVEITDAVMQNAREMKNLAQSKK"
FT   CDS             125251..126321
FT                   /transl_table=11
FT                   /locus_tag="CC1_01200"
FT                   /product="stage IV sporulation protein B"
FT                   /EC_number="3.4.21.116"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79096"
FT                   /db_xref="GOA:D4J425"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008763"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR014219"
FT                   /db_xref="UniProtKB/TrEMBL:D4J425"
FT                   /protein_id="CBK79096.1"
FT                   /translation="MRKYRAWLTAALMINLVVLFGFVMNWYQTRKNEVDQRLTKVSADV
FT                   AMRQYVMPVGMPVGLYIHTKGVMVLGTGKVTNLEDDVLEPAKTVFREGDYILSINGTTL
FT                   RNTSQAMSLIQSCKGKMLSFEVLRDGKKIMLTMKPVETAEDRYKIGVWLRDDTQGIGTI
FT                   TYIDADQNFAALGHGITDVDTGILMDISHGMVYQSNILSIVKGSQGTPGEIVGTIDYQK
FT                   KNRIGTINDNSSCGIFGTVDRDYLAYDPEKAVPVADPEEVTEGPVQIVCTMNGETNRYA
FT                   AEIRKIDKNNKDHKNFVLQITDEQLLEKTNGILQGMSGSPVIQNGKLVGAVTHVFVNEP
FT                   TKGYGIFAENMQNAEE"
FT   CDS             126447..128036
FT                   /transl_table=11
FT                   /locus_tag="CC1_01210"
FT                   /product="NhaP-type Na+/H+ and K+/H+ antiporters with a
FT                   unique C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79097"
FT                   /db_xref="GOA:D4J426"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="UniProtKB/TrEMBL:D4J426"
FT                   /protein_id="CBK79097.1"
FT                   /translation="MAQNLILVAIVLFLCLMAEKLSGKVGMPALILFMGVGMLFGSDGI
FT                   LRIAFDDYGLAQNICLIALCFIMFYGGFNMKWSAARPVAVKAICLSTIGVVVTAGLTAV
FT                   FCLVVLKFDFVDAFLMGTVLSSTDAASVFSVLRTKKLNLKDGTASILEMESGSNDPVAY
FT                   LLTMIGIMMKTGGSLSSLPYMIFAQVVFGLAIGAAAASLGILLLKKGTMQAAGMDMILV
FT                   IALVMSAFGLSEAIGGNAFLTVYLMGILLGNSNIRGKETLIPFFDGMTGLAQIVLFFLL
FT                   GLLSFPHKLPQIFFVSLAIAIVLTVIIRPVTVFLIMKPFKCSSRQCLMISWAGLRGAAS
FT                   IVFAIMVIAASSSSSDTLFHTVFMVALLSVAIQGTLLPFVAEKLKMVDDSCDVRMTFND
FT                   YKEASEITMMQMEIPEGHNWENRLVKDVSMPTGSLAVMIKRHGETLIPGGDTRILAGDT
FT                   IVLSVPAYESGGQEHLEEQEITPKHRWCNKTIAELMLPHGTLIVLVRRDNENIIPNGQT
FT                   EILEGDHVVIYR"
FT   CDS             128080..128697
FT                   /transl_table=11
FT                   /locus_tag="CC1_01220"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79098"
FT                   /db_xref="GOA:D4J427"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4J427"
FT                   /protein_id="CBK79098.1"
FT                   /translation="MIKNIVFDMGNVLVAYDGRKVCKHYIKNKKDRKRVFTAIFQSPEW
FT                   VYLDMGMIPEEQAVDQMCARLPKRLHEAARLCMRDWHLYNMKPIKAMIPVIQDLKARGF
FT                   KLYICSNASLRLPMCYQELLPEVDSFDGILFSAEEKLLKPQKEIYERLFEKFNIKPEEC
FT                   YFIDDLQLNIDGAAACGMKGYCFADGNVEKLQKALESLNKDS"
FT   CDS             complement(129067..130290)
FT                   /transl_table=11
FT                   /locus_tag="CC1_01230"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79099"
FT                   /db_xref="GOA:D4J428"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="UniProtKB/TrEMBL:D4J428"
FT                   /protein_id="CBK79099.1"
FT                   /translation="MTLYDELVARGLIAQVTDEEEIKELINNGKATFYIGFDPTADSLH
FT                   VGHFMALCLMKRLQMAGNRPIALIGGGTAMIGDPSGRTDMRQMMTPETIQHNVDCFKKQ
FT                   MSRFIDFSDGKALMVNNADWLMNLNYIELLRDVGAHFSVNRMLTAECYKQRMERGLSFL
FT                   EFNYMIMQSYDFYELFQRYGCNLQFGGDDQWSNMLGGTELIRRKLGKNASAMTITLLLN
FT                   SEGKKMGKTQSGAVWLDPNKTSPFDFYQYWRNVGDADVLKCLRMLTFLPLEQIDEMDKW
FT                   EGSQLNQAKEILAFELTKLVHGEEEATKAQESARALFSAGSAADMPTTTLTEADLRDGS
FT                   VDILGILVAAGLCPTRSEARRNVQQGGVTVNGEKVTDFKAAYTPEDIMKEDFVVRRGKK
FT                   KYSKIVFE"
FT   CDS             complement(130679..131761)
FT                   /transl_table=11
FT                   /locus_tag="CC1_01240"
FT                   /product="Sugar diacid utilization regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79100"
FT                   /db_xref="GOA:D4J429"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:D4J429"
FT                   /protein_id="CBK79100.1"
FT                   /translation="MFKIDRTLAAQVVNTVKDVCGRDVNFINQYGIIFASTDPERVGTF
FT                   HEIGHQAALTGETIEVRADDNFHGTRMGINLPVYYNQTFMAVIGITGQPDEVRKYAHLA
FT                   ERITHLLIRERELNTISRNQADKRHFAMEALIHQTSANMDYLNACLKECGINITQKYRI
FT                   LLIRAAAESPSDNLSLLEQKIHQFFEMLSIRLYTFYYPNEYTAVVLPSQLEHNAYILER
FT                   FAKDHQTSLKMTVGKMTSVYQLCDSYQTAVTAMKHFTAQAEGYIFFDDLGLELIFSGLN
FT                   PLEKAEFLTKTLSNLDENERHLLTAYFENDMSLSGTSRQLFIHKNTLQYKLNHIFKKSG
FT                   LNPRAFRDAVMLYLGLNLAK"
FT   CDS             132059..133204
FT                   /transl_table=11
FT                   /locus_tag="CC1_01250"
FT                   /product="glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79101"
FT                   /db_xref="GOA:D4J430"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="UniProtKB/TrEMBL:D4J430"
FT                   /protein_id="CBK79101.1"
FT                   /translation="MRAVIAIDSLKGSLSSIEAGQAIAEGIRKADAKADVVIRPLADGG
FT                   EGTVEALVCGMNGTLQHVKVTGPLGESVVCEYGIIAETKTAVIEMSGAAGITLVPDAKK
FT                   NPLYTTTYGVGEVIRDAIEKGCRRFIVGIGGSATNDGGIGMLQALGYGFLNKDGQQVPF
FT                   GAIGLKELETITDTYVLPELAECEFKIACDVTNPLCGENGCSAVYGPQKGANPSMIMEM
FT                   DKWLRYYAALAREKFPKANPNESGTGAAGGLGFAFLTFTNAVLESGIKIVLEETKLESY
FT                   VKGADVVVTGEGRLDFQTAMGKAPVGVAGLAKKFDIPVLAFAGSVTKDATECNKNGIDA
FT                   FFPILRGISTLEEAMKPENAKQNLTDTAEQAFRLFNICRQA"
FT   CDS             133544..134482
FT                   /transl_table=11
FT                   /locus_tag="CC1_01260"
FT                   /product="Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79102"
FT                   /db_xref="GOA:D4J431"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4J431"
FT                   /protein_id="CBK79102.1"
FT                   /translation="MEKTVLVVIPAEERHKEKLERAGKGCRFVYETPQTATEEMIEAAD
FT                   VIIGNVKPDRLHEPERLQWLQLNSAGADAYVKPGILRSTTMLTSATGAYGKAVAEHSFA
FT                   MLLMLQKKLNLYRDAQTKNEWSDFGTVTSITDATVLVVGLGDIGLHFARLASALGARVI
FT                   GLKRSMGPCPEGVHELHTMDELDNLLPKVDVVASFVPSTATTYHMYTKERLMAMKDTAI
FT                   FLNSGRGDAVASEVLYEALSKGWIASAGIDVTEPEPLSADSPLWQLPNLMMTPHISGQF
FT                   HLPETFERIVDIAAANLEAYLKEQPLKNRIQ"
FT   CDS             complement(135827..137578)
FT                   /transl_table=11
FT                   /locus_tag="CC1_01280"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /function="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79103"
FT                   /db_xref="GOA:D4J432"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D4J432"
FT                   /protein_id="CBK79103.1"
FT                   /translation="MTTPNIYRSRILNEISESDVGKTIRVAGWVENIRDHGGVSFIDLR
FT                   DMYGVLQVVLRDTSLLDGITKENCISIEGVIDHRDEETYNPKIPTGTIELEAHSIDMLG
FT                   KVYHQLPFEIMTSKEIREDVRLKYRYLDLRNQKVKDNIIFRSQVISFLRQKMTEMGFLE
FT                   IQTPILCASSPEGARDYIVPSRKFKGRFYALPQAPQQYKQLLMVSGFDKYFQIAPCFRD
FT                   EDARADRSPGEFYQLDFEMSFATQEEVFRVGEEVLTATFEKFAPEGASVTAAPYPVISY
FT                   KDAMLQFGSDKPDLRNPLRIMDVTEFFQRCTFKPFLKRTVRAIRVHADMSKGFHEKLLK
FT                   FATSIGMGGLGYLEVMEDKSYKGPIDKFIPDDMKQEFAELTGLEVGDTIFFIADKEERA
FT                   NLFAGQLRNELGERLDLIEKNAFRFCFVNDFPMYEYNKDEKKMDFTHNPFSMPQGGLEA
FT                   LNTMNPEDILAYQYDIVCNGVELSSGAVRNHDLDIMVKAFEIAGYSEEDLKTKFGALYN
FT                   AFQFGAPPHAGMAPGVDRMIMLLRNEDNIREVIAFPMNGNAQDLMCGAPGVVTETQLRE
FT                   AHIKVRD"
FT   CDS             complement(138271..139626)
FT                   /transl_table=11
FT                   /locus_tag="CC1_01290"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79104"
FT                   /db_xref="GOA:D4J433"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4J433"
FT                   /protein_id="CBK79104.1"
FT                   /translation="MQKENKGSIDLTRGSIPGGILAFAIPLFLGQLLQQLYNMVDAWVI
FT                   GNFADNDAFAAVSSTGTVVFLIIGFFSGIATGGGVVISRYFGARDEDNVSKAVHTNFLM
FT                   GLIASAIGTVAGLILAPHLLVWLGTPDSVMPHALRYLQIYFGGVSTVILYNICMSIMRA
FT                   LGDSIHPLYYLLFSSIVNIGLDLLFVAHPAFHWGVTGAAAATVISQGLSVILCLFRMCR
FT                   IKDYTRLDFKKLHYHSHMMKKVLYQGLPAGIQNAVITVGNLVIQKNINSFGAYAMSGMG
FT                   AYSKIEGFVFLPIMSMAMALPTFVSQNLGARQYHRAKKGAVFGILFGMITAEVTGLLIY
FT                   FFIPYALKIFGSTQEAVAYGTIHAHIVSLFFFLLAFSHCSAGVMRGCGYAVVPMAGMLL
FT                   FWCGLRIVYVTTALRFFPVFQMISWAYPLTWGCSTILFLIFLFKADWQHHLD"
FT   CDS             139919..140719
FT                   /transl_table=11
FT                   /locus_tag="CC1_01300"
FT                   /product="sporulation transcription factor Spo0A"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79105"
FT                   /db_xref="GOA:D4J434"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012052"
FT                   /db_xref="InterPro:IPR014879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4J434"
FT                   /protein_id="CBK79105.1"
FT                   /translation="MTKINVAIVDDNEKMVSLLDAILQTDKNIEVIGRGDDGVQALDII
FT                   KNQEPDVVLLDLIMPKLDGLEVMQQVNKDMSLKKRPAFIVISAIGKENITENAFNLGAM
FT                   YYIMKPFENDMILRRIHQVTERQILQPVHTQKSRQTDYTTEYREKNLETDVTNIIHEIG
FT                   VPAHIKGYQYLRDAIIMSVDNREVINSITKVLYPTIAKMNKTTPSRVERAIRHAIEVAW
FT                   SRGKMDTIDELFGYTIHTGKGKPTNSEFIALIADKIRLEYKNRS"
FT   CDS             140824..142272
FT                   /transl_table=11
FT                   /locus_tag="CC1_01310"
FT                   /product="glycogen synthase (ADP-glucose)"
FT                   /function="glycogen synthase (ADP-glucose)"
FT                   /EC_number="2.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79106"
FT                   /db_xref="GOA:D4J435"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:D4J435"
FT                   /protein_id="CBK79106.1"
FT                   /translation="MKKVLFAASEAVPFIKTGGLADVVGSLPKAYNRDEFDVRVVLPKY
FT                   RVIPEHFQQQMEYMTNFYINMSGRMIYVGVFQMMLDGVTFYFIDNEYYFSGDRIYEDGL
FT                   WDLEKFAYFSKAALTMLCVIDFRPDIIHCHDWQTGLMPVYLKNEFWDSSSYSDFYQNMK
FT                   AVMTIHNLKFQGTWNIDDMMRITGLPGYLFTSDKLEAYGAGNYLKGGLVYADWITTVSG
FT                   VYANEIKYPFYGEGLDGLMRARSNNLSGIVNGIDYDEYNPETDPMLVHNYSPYNFRTEK
FT                   VHNKTALQQELGMQIDGGKFMIGLVSRLTDQKGMDLIDCVMEQICAEDVQFVILGTGDP
FT                   RYENMFRYYEWKYKDRVSASICYDNTRSHRIYGACDAFLMPSLFEPCGLSQLMSLRYGT
FT                   LPIVRETGGLKETVEPYNEYTGSGTGFSFANYNAHEMLHVIEYAKSVYYGDREAWNRIV
FT                   DRAMAADFSWGNSARKYEDLYRSL"
FT   CDS             complement(142520..143044)
FT                   /transl_table=11
FT                   /locus_tag="CC1_01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79107"
FT                   /db_xref="InterPro:IPR025374"
FT                   /db_xref="UniProtKB/TrEMBL:D4J436"
FT                   /protein_id="CBK79107.1"
FT                   /translation="MNQDTLMLYKLMVLYMLNKVDFPLTNSQISEFILDKGYTNYFTLQ
FT                   QALHDLSDTELIRTEHIHNNSYYSMNQSGEETLEFFGHKIPAEIKTEIDQFFNEHKYHL
FT                   RSENEVTADYYEDKKDCYIVRCEIHDKKELLVGITLNVTDEAQATAICDNWRNLHGDVY
FT                   DYLIHTLMIRH"
FT   gap             144396..144637
FT                   /estimated_length=242
FT   CDS             complement(144693..146021)
FT                   /transl_table=11
FT                   /locus_tag="CC1_01340"
FT                   /product="Glutamate dehydrogenase/leucine dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79108"
FT                   /db_xref="GOA:D4J437"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4J437"
FT                   /protein_id="CBK79108.1"
FT                   /translation="MSYSDEIIEKVKAKNPNEPEFIQAVTEVMNSLRLVVDNDPKYQNE
FT                   ALLERIVEPERIIMFRVPWVDDEGKVQVNRGFRVQFNSAIGPYKGGLRFHPSVNLSIIK
FT                   FLGFEQIFKNSLTGLPIGGGKGGSDFDPKGKSDREVMAFCQSFMTELCKHIGADTDVPA
FT                   GDIGVGGREIGYMYGQYKRIRNVSEGVLTGKGLTYGGSLARTEATGYGLVYLVEELLKC
FT                   KGDTIEGKTVAVSGAGNVAIYAIQKAQQLGAKVVTCSDSTGWVYDPEGIDVAALKEIKE
FT                   VQRARLTEYKKYRPQSEYHEGRGVWQIPVDIALPCATQNELFLEDAKQLVANGCKVVAE
FT                   GANMPTTLDATEYLQEHIYFVPGKASNAGGVATSALEMCQNSMRYSWTFEEVDAKLKDI
FT                   MVNIFHNIDNAAKEYGVENNYVAGANIAGFKKVADAMLAHGIV"
FT   CDS             146600..148381
FT                   /transl_table=11
FT                   /locus_tag="CC1_01350"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79109"
FT                   /db_xref="GOA:D4J438"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J438"
FT                   /protein_id="CBK79109.1"
FT                   /translation="MAEQEKKMSVAQMREILKAQGVRNTSVMRKAELQKLMAEMGLLED
FT                   QSEVLEKDKEQPTASVEKGPEHEVKSENKKPYVFRGRTSRAEYAERTGRAERTERPERT
FT                   GRTERTERSERTERTERTERPERSERTERTERSERQTYTNGGLYSGRRNTYGQRSENYQ
FT                   RNENSQRNENGQRGENYQRNDSYQRGDSYQRVDVYQKNEYIQSNEESEIPGYGQLDSGM
FT                   MANGILEVIPEGFGFIRCENYMPGNNDVYVSPAQIRRFNLRTGDIICGNIKVKTEKEKF
FT                   SALLYIRTVNGMPPYEAQRRGKFENMTPVFPDSRINLETPNAPVSMRIMNLVSPIGRGQ
FT                   RGMIVSPPKTGKTTLLKQVAKAIHTNYPDMQMIILLIDERPEEVTDIKEYIEGNNVEVI
FT                   YSTFDETPEHHKRVSEMVLERAKRLVEHKKDVVILLDSITRLARAYNLTVPPSGRTLSG
FT                   GLDPAALHMPKKFFGAARNMREGGSLTVLATALVETGSKMDDVVFEEFKGTGNMELVLD
FT                   RKLSEKRIFPAINIPRSGTRREELLLSKEELEGMYVMRKALGGMKSEEALEQILDMFMH
FT                   TKDNTEFVNMIRHTKMW"
FT   CDS             148550..148756
FT                   /transl_table=11
FT                   /locus_tag="CC1_01360"
FT                   /product="LSU ribosomal protein L31P"
FT                   /function="LSU ribosomal protein L31P"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79110"
FT                   /db_xref="GOA:D4J439"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="UniProtKB/TrEMBL:D4J439"
FT                   /protein_id="CBK79110.1"
FT                   /translation="MREGIHPKYYQAKVTCNCGNEFVTGSTKPEIHVEICSKCHSFYTG
FT                   QQKAASARGRIDKFNRKYGIKQA"
FT   CDS             148943..149908
FT                   /transl_table=11
FT                   /locus_tag="CC1_01370"
FT                   /product="Predicted metal-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79111"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:D4J440"
FT                   /protein_id="CBK79111.1"
FT                   /translation="MRYATIGGQAVIEGVMMRNGNDYAVAVRKPDQTIEVKKDQYIGLN
FT                   ARWHMKKIPIIRGVLSFIDSLVLGMSTLTYSASFFEDEEEAEKAKEKDSKSDAVFMGLT
FT                   VALSVVIAVALFMLTPFFISSLFGKVIKSPMALAVIEGLIRIAIFFIYIVAISQMKDIQ
FT                   RVFMYHGAEHKTINCIEHGVELTPENAAKYSRLHKRCGTSFLLIVMVVSIICFMFIRVD
FT                   NMALKIVLRVILVPVIAGVSFEIIQWAGRSESCLVNIVSKPGLMLQKLTTREPDLEMLE
FT                   VAIASIEAIYDWRQFQAENRAAADGNSQKTDRSNAGVSQP"
FT   CDS             149905..150774
FT                   /transl_table=11
FT                   /locus_tag="CC1_01380"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79112"
FT                   /db_xref="GOA:D4J441"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J441"
FT                   /protein_id="CBK79112.1"
FT                   /translation="MMQWSYDTLLKWGTDELTVHSVDNASVDAWYLLEHIYGISRVDFL
FT                   IRRNDPFDEAQMKQSADYQALIRRRSEGYPVQYLMGSTEFMGLPFFVNESVLIPRQDTE
FT                   VLVETALAMMKPECRLLDMCTGSGCILLSLAKLGTVAEGVGVDISEGALKVAERNRENL
FT                   GLSQVKLVHSDLFGSVEGVFDMIVSNPPYIPTNDIEDLMREVKDHEPHLALDGSRDGLL
FT                   FYRKLAEESGRYLVPGGSLLFEIGYDQGKAVSQLLDQAGFKDIHVKKDLAGLDRVVYAV
FT                   KAAEDGGK"
FT   CDS             150777..151850
FT                   /transl_table=11
FT                   /locus_tag="CC1_01390"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /function="bacterial peptide chain release factor 1
FT                   (bRF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79113"
FT                   /db_xref="GOA:D4J442"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:D4J442"
FT                   /protein_id="CBK79113.1"
FT                   /translation="MFDRLDDILIRYQQIMEELNDPDVVNDQKHFRKLMKEQSDLQPLV
FT                   EKYTEYKNTKQTIEDSLEMLEVEDDEEMKEMLKEELSEAKSNIAKIEQELKVLLIPKDP
FT                   MDEKNVIVEIRAGAGGDEAALFAAELFRMYSKYAESKRWKIEMMDVSENGIGGFKECVF
FT                   MVSGDHVYSRMKFESGVHRVQRVPETESGGRIHTSTVTVAIMPEAEEVDVEIDMNDVRI
FT                   DVMRASGNGGQCVNTTDSAVRLTHNPTGIVIYSQTEKSQLQNKEKAFRLLRSKLLEIEI
FT                   EKKHAEEAALRKNQVGTGDRSEKIRTYNFPQGRCTEHRIKLTLYRLGDIMNGDLDEIID
FT                   SLIAADQAAKLANMEDE"
FT   CDS             152150..154753
FT                   /transl_table=11
FT                   /locus_tag="CC1_01400"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79114"
FT                   /db_xref="GOA:D4J443"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:D4J443"
FT                   /protein_id="CBK79114.1"
FT                   /translation="MKEWYQMREDEVLEALGSDANGLSSEKAEALLKAHGENVLRETKK
FT                   KSVWRVFAEQFADLLVIILIIAAIISMISGNVESTIVIFAVITMNAILGTVQHEKAEKS
FT                   LASLKTLSAPTAKVLRGGVKGEIPSAQVVKGDILLLEAGDMVTADGRILESYSLQVNES
FT                   SLTGESTNVEKKTVVLEGEKALGDRINMVYSGSLVTGGRAVVLVTATGMETEIGKIAAL
FT                   MNATKEKRTPLQVSLDKFGSQLAIVIMIISAVVFVLSLYRRMPVLNALMFAVALAVAAI
FT                   PEALSSIVTIVQAMGTQKMAKEHAIIKDLKAVESLGCVSVICSDKTGTLTQNKMTVQQV
FT                   YINHQTMEADALDLKQQSHRYLLYDAILTNDSAIVEGQSIGDPTEVALLEMGRKADIKE
FT                   DILKEMMPRMEEIPFDSDRKLMSTKYRLHGVPTILVKGALDILLKRTDRIRIGDEVRPI
FT                   TEQDVKEILDKNQAFSEQGLRVLAFAYKEAQANQQLTLDEEDHLIFMGLVSMIDPPREE
FT                   SREAVSEAKRAGIRPVMITGDHKITATAIAEQIGIFGEGDMAVTGPELDEMSDAELDEN
FT                   IEKISVYARVSPENKIRIVDAWQRKGAVTAMTGDGVNDAPALKKADIGVAMGITGTEVS
FT                   KDAASMILTDDNFATIIKAVANGRNVYRNIKNAVKFLLSGNMAGIMAVLYTSLAALPVP
FT                   FQPVHLLFINLLTDSLPAIAIGMEKAEKDLLSEPPRDPKQGILTKDLMTALFVQGGLIA
FT                   VCTMIAFHIGLSTDSATASSMAFATLTLARLFHGFNCRSRHSIFKIGLTSNIYSIGAFF
FT                   GGVLLLALVIFVPVMRTLFSVSPLSGYQIGMIAMLAFIPTVIIQLYKVMKEHVHA"
FT   CDS             complement(154744..155853)
FT                   /transl_table=11
FT                   /locus_tag="CC1_01410"
FT                   /product="Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79115"
FT                   /db_xref="GOA:D4J444"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4J444"
FT                   /protein_id="CBK79115.1"
FT                   /translation="MVEQLYHNPDIYRIYVPLPDNPLKYLNCYILVSDGETLIIDTGFN
FT                   RPECKQALFDGLDELQVDFAHTKLFLTHLHGDHSGLTEELTARGVPVFMNAIDYDYLCQ
FT                   ELASGGWQAMEQIFLSEGFPMKEIEKQKKGNQARLYSPHHPFPASKVSDNDLLTVGGIT
FT                   LRCIHTPGHTPGHTCLYIEDKEILFSGDHILFDITPNISVWRNIPYSLAAYLESLQKIK
FT                   GLKVSHTFPGHREFHGDIHDRINALTLHHHARLKEILDAIDHHPDCTAYETAGRISWSA
FT                   RGRAWNDFSPNQKWFAMGETLAHIKWLSDKGAISSTRPLSLNMPTIQNTPAKETAENRY
FT                   RALCHSSDLFFYSRRFSDDAFCEHVTHYA"
FT   CDS             156087..156755
FT                   /transl_table=11
FT                   /locus_tag="CC1_01420"
FT                   /product="Uncharacterised protein family (UPF0153)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79116"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D4J445"
FT                   /protein_id="CBK79116.1"
FT                   /translation="MERNIDLNEISDGRFYTANDMVRADCQGCEGCSVCCHGMGKSILL
FT                   DPLDVHRICTYFRIPFEALLADHVELNVVDGMILPNLKMVGEDEHCIFLNQEGRCGIHK
FT                   IRPGFCRLFPLGRLYEDRSFKYILQTKECVKTDRQKIKVRKWLDIPELDQYEKFVNDWH
FT                   YFLKDVAASLKKENASDGTIKQINIYVLKEFYMRGFGEEVSFYAQFEQRLKEVKAVLLK
FT                   "
FT   CDS             156897..157163
FT                   /transl_table=11
FT                   /locus_tag="CC1_01430"
FT                   /product="Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79117"
FT                   /db_xref="GOA:D4J446"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="UniProtKB/TrEMBL:D4J446"
FT                   /protein_id="CBK79117.1"
FT                   /translation="MKQFSVAVNKIEDGILHVRSAGLIMKEASQFASDVKVTKDEKTVN
FT                   GKDILEWMGLKLAVGDVITVNIEGPDEEAAADSFEVFLNRQFS"
FT   CDS             157317..158144
FT                   /transl_table=11
FT                   /locus_tag="CC1_01440"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79118"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:D4J447"
FT                   /protein_id="CBK79118.1"
FT                   /translation="MSTSGQKRIESTIDTAIDCDEDEVMELAMQAGELLLENGAEIFRV
FT                   EETMDRICRHYGVESASQFILMNYILATAGEGHGHVFAKVRHIPVNGSHLDKVAAVNQL
FT                   SREIAEGKYTVSEAYQALETIRRMPDKRKSVLILASGVASGAFCCLFGGNLMDCLAAAI
FT                   AGFLIYVYILYISGPHLSKIVGNVGGGAFVTLVCNLLYMAGIGDHLNFMIIGSMMPLVP
FT                   GVAFTIAIRDAADGDYISGTVRMIDALLVFICIAIGVGMGIAVLNPLTGGAAL"
FT   CDS             158141..158572
FT                   /transl_table=11
FT                   /locus_tag="CC1_01450"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79119"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D4J448"
FT                   /protein_id="CBK79119.1"
FT                   /translation="MMIQIIAAVIATVGFSVLFGVPSKYYPYCGVIGGAGWLVYLLTLE
FT                   HFSTAGASLAATMVVIFLSRLAAVRKKCPVTIFLIAGIFPLVPGAGVYWTAYYIVTDQL
FT                   RLAAETGYTAVKVAVAIVLGIVFIFELPQGLFVRLAGNK"
FT   CDS             158666..159298
FT                   /transl_table=11
FT                   /locus_tag="CC1_01460"
FT                   /product="Predicted EndoIII-related endonuclease"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79120"
FT                   /db_xref="GOA:D4J449"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D4J449"
FT                   /protein_id="CBK79120.1"
FT                   /translation="MTKEELTLEVIRRLKVAYPLAECTLDYDQAWKLLVSVRLAAQCTD
FT                   ARVNVVVEGLYEKYPDVASLAAADVTDIEEIVRPCGLGKSKARDISACMKILHEQYHDK
FT                   VPDDFNALLKLPGVGRKSANLIMGDVFGKPAIVTDTHCIRLVNRIGIVDGIKDPKKVEM
FT                   ALWKLVPPEEGSDFCHRLVEHGREVCTARTKPYCDKCCLADICARNI"
FT   CDS             159399..160223
FT                   /transl_table=11
FT                   /locus_tag="CC1_01470"
FT                   /product="Activator of 2-hydroxyglutaryl-CoA dehydratase
FT                   (HSP70-class ATPase domain)"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79121"
FT                   /db_xref="GOA:D4J450"
FT                   /db_xref="InterPro:IPR004567"
FT                   /db_xref="UniProtKB/TrEMBL:D4J450"
FT                   /protein_id="CBK79121.1"
FT                   /translation="MGIVLGIDIGSSATKIVAMDESKTILNSLKVSASDPVTAMYGAVG
FT                   KILCEERMQIADVEAVMLTGMGASYVEGDVYGLPTTKVTEFDALGTGGLYLTGLEETVV
FT                   GSIGTGTVFVHAGPDGIQHIGGSAVGGGTLVGLSSRLFGIRDVEVIADMAEQGNLKNVD
FT                   WGIAELSRDQMETLPDYATSSNLGKMKSTATDEDVALGLMNMIFQTAGTLAVFACRNVN
FT                   LKRAVIGGSTATLNQARIMLGQVGELYDINFIIPKEAAFMTAIGAALLFQSK"
FT   CDS             160301..161086
FT                   /transl_table=11
FT                   /locus_tag="CC1_01480"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79122"
FT                   /db_xref="GOA:D4J451"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4J451"
FT                   /protein_id="CBK79122.1"
FT                   /translation="MSNCVKIIVGTMAKGKDIMLRIAVIDDEEYYSELIRQTVCNWLME
FT                   KGCQGEIDCFDHADDFKTKIENGRCYDIYFMDIEMPDVSGMELASYVRMKYDSPFIVFV
FT                   TAHMEYSVKCYRYHAWQYITKDSIRTLIPETMDSLIQHLQAHKSNYYMIEGANDLIRIA
FT                   YDQIQYLCKEGKYTLFHTDKTEVFRERRALSKVIEDMQQVDDAFIMTDKSYGVNIRHVL
FT                   RLKDHMLTMRNGDSVPVSLPRYQQVKKAISDYWGRRAWK"
FT   CDS             161077..162402
FT                   /transl_table=11
FT                   /locus_tag="CC1_01490"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79123"
FT                   /db_xref="GOA:D4J452"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D4J452"
FT                   /protein_id="CBK79123.1"
FT                   /translation="MEIAGITLRVLEIITVVLCGIRLAVPPGHFRWEKLWTKVLYWILI
FT                   IFWIAFNTGNIHFFKFSSLQETIVNIGVFITLCIFFDTYFWQLFVQFFIYNYTVYIFRV
FT                   LYIFILCYLEHIHMQNYITVADGLGWHWIQMCGMAVTIGASLCLCYYMHGEPLIHRQYK
FT                   KDYKYLAVFVVFEIIIGESLFNNDVAGDFIRGEYILFSMIVFVCLFSLLSAIIFYKGYK
FT                   DMRYQQQISDMNFEMLKRQYETIQKMYTEKRTMLHDSVHQDVLILECLENGKYREAQTY
FT                   FEKKLAVTKKKSKNRYTGIEVLNLMLNYEIEQAEEKAIRVKCAVEAYLCPVDETELCII
FT                   IGNLFDNAIEAVKDLPDEQRQIDFVIQNPNGIFRIEISNPYEGERRKIEHHYLTTKKEN
FT                   TEMHGLGLMSVQKIVEKYDGLIEINDVDSLFKVDVTFYDEEV"
FT   CDS             162407..162544
FT                   /transl_table=11
FT                   /locus_tag="CC1_01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79124"
FT                   /db_xref="UniProtKB/TrEMBL:D4J453"
FT                   /protein_id="CBK79124.1"
FT                   /translation="MQELELTKSILEELKYIEELQQNVKESESDDITGHMGGSYTLLCC
FT                   "
FT   CDS             162636..165566
FT                   /transl_table=11
FT                   /locus_tag="CC1_01510"
FT                   /product="Lantibiotic modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79125"
FT                   /db_xref="GOA:D4J454"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017146"
FT                   /db_xref="InterPro:IPR025410"
FT                   /db_xref="UniProtKB/TrEMBL:D4J454"
FT                   /protein_id="CBK79125.1"
FT                   /translation="MDIRELIKIINQNEEAKQFWKKFLNKDILDELLKYPELLSMQDVK
FT                   RAKIAKEEKEFFLKCIFSVSTENGIKFEKEERVFDSFYEKLGQYIKIVLKQKLIASLTE
FT                   NMIDSLVKQIVQRVFWIPFRCLIADMHEKKDAGQLNGHSSAEEYDDYVSKYLLNERECG
FT                   EFLKKYPVMTDLLIRKIGDYINYVNEIFHHFYQDRETISKEFHIEQNAMKITKISFNQD
FT                   EEHFPERMVARVRLKGGQKIYYKPHSLLLTERYQKIENWLWEKMGLEESRHLVVSGDDY
FT                   GWEQEVTEAACKCTKEIKEFYYRCGAECCLTYVLGMTDIHMDNVIAHGKYPVIIDTEFM
FT                   FDRRIEAGIQGKNLQQNLMDTVIHTGFVPNGMGTLHINVSVLNTCDEQRLSVKMPMVIN
FT                   KGTSEMNISYHYPKLSHKKNMPIYEGKYISFENYMNEFISGFRRAYDCIKADPEVLVGM
FT                   CQPIMKKSVRYLFRNTQEYYMYITSFNFPELMRNQAKRQLSLWHMNRGLHCNETYRVKI
FT                   LTYEMQCVYDGIVPIFYADGKNLLMGDDEYIENYFQRDNEQQLKLRVEKLSDWDKDFQT
FT                   KVIQSALLMYDKKKENWNGQLGQPQSKIGELTAERIAKWVFNAAVLTGDKMEWTSVIYG
FT                   KDGWTKAGKADIYLYNGLSGIFLFFEAMWQKKHENFYHSVVEQLKKQLCEHTDILIQNG
FT                   SNHQSDRMGLFDGEASVAFTYWIMYKLTAEESYIVYAKKQCQFVLDNDYQVTSDDLIQG
FT                   RAGIIILLLLMYKTTQDKMYLDIAQKVGTNLVESIQSKNCLAGMAHGYSGMAVAMALLG
FT                   RYTGEGNYKEIVLELCRKEDQLFDCSMNNWLDIREGREHPRNTVAWCHGSAGILLARAL
FT                   IHKISGLTMDQLFKDIPLNQVIDQMCQTEKTDWCLCHGQAGLLIVERYIRHVFGYEEEK
FT                   WYENAAKYLDKRLSIEDVLNYGIMQGLAGIGIFLLFWEWERDKDTK"
FT   CDS             165665..165781
FT                   /transl_table=11
FT                   /locus_tag="CC1_01520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79126"
FT                   /db_xref="UniProtKB/TrEMBL:D4J455"
FT                   /protein_id="CBK79126.1"
FT                   /translation="MKKKSKLMAAVFALILGVSTVMPGMQAQASDMNRFPVI"
FT   CDS             165813..167213
FT                   /transl_table=11
FT                   /locus_tag="CC1_01530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79127"
FT                   /db_xref="UniProtKB/TrEMBL:D4J456"
FT                   /protein_id="CBK79127.1"
FT                   /translation="MNLTRYACFGVLMVLILTGCQATPNQDVIANKNDQQVNQNESGTS
FT                   IEESNSVEESADDGTVVSEAISETFSSDDGNVTISVQTDAVKVHSVPIVQAEAKDISVD
FT                   DVKRWAKAFYGTEDVYEATKQMTKSEIEEAILWRQQKINDRESLIEEGYSEADADTMIE
FT                   YYKEQIESLKASYQKAPDDDERKKTDWAFHPLSYYDDDSMENNGDTSNTDKTQTLKVQG
FT                   ESDGQKAYVSASNRETADYQLHSLMFYWNDEEEGWMAGGSSSVNQEEAIRITDEKLKAL
FT                   VDGKWKVNTVWSNGNQWHIQYVPVINELPCLYSDINYTSDDAYAANLEYEQIDFTLTDD
FT                   KIVAVEWESPMKITSTDSQPAEILPFDDIYTAFKNYMQVKCTLNSLGLASEDETEGTEQ
FT                   AFANVNDISQMYCRVKVKNAENTFQYVPVYVFSGYVSQGDYKEDDWVNHFCVVNATDGT
FT                   IINTWLGY"
FT   CDS             169138..170550
FT                   /transl_table=11
FT                   /locus_tag="CC1_01560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79128"
FT                   /db_xref="UniProtKB/TrEMBL:D4J457"
FT                   /protein_id="CBK79128.1"
FT                   /translation="MKIRKYACIAISAALLMTGCQATPDQDIVANKNDNQASQNETSQS
FT                   VDDTIAIDENADGKVVSEAISDSFDSTEGDVTIKVQADQVRAKNVPVLQAEAQSVSADD
FT                   VKRWCNVFFGTEDVYEYRDEMTKSDIEKAILWRQQKISDRDGLLAEGYTEDEIDSTIEL
FT                   YQEEINNLKSNYDSAPEKYEGTKTDWEFHPASYWMKDETNGDEEDWSKEDKTESLEVRG
FT                   DYEGKGAHISASNRQDADYQVHDMFFVLNDEVDINYNADPVISREEAIQMTSEKLKALT
FT                   DKEWQVDSVDNNGNQWRIKYVPVINNLPCLLTDLSYDSTDAYAANLIYEMLEFEIIDGQ
FT                   ITSVEWDSPMEITSTDSQPAEMLPFDDIYTAFKNYMQVKCTMTSLGMASDDEMEDETTT
FT                   ETEKVCANVNDIRQMYCRVKVKNSDQAFEYVPVYVFSGYASQGDYKEDGWVNHFCVVNA
FT                   TDGTIINTWLGY"
FT   CDS             170571..171380
FT                   /transl_table=11
FT                   /locus_tag="CC1_01570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79129"
FT                   /db_xref="UniProtKB/TrEMBL:D4J458"
FT                   /protein_id="CBK79129.1"
FT                   /translation="MLAYDKKQIGRIHRILIPAVIFTAAVLLGRMDTIMADFGQSEPLA
FT                   AGKALSFAFESLTTGNALLVAPVICAFPYGAACIDEVKSGMFKNVLYRTDKASYIHSKA
FT                   AACMLSGAVTLMGAALLVILVSAVLLMPLETASGTANAAQAADIADTAGAAGEIAQSYE
FT                   IQQLIGLVFRYGCFGAVWSLVGMLLSLGTFNRLMAWIGPFIVDYLLEILYERYFDGLKL
FT                   FYPKEWLVMSWSWPLKDWGICLWLLLLAGMIYLVVRRTGMRCLERVV"
FT   CDS             172272..172940
FT                   /transl_table=11
FT                   /locus_tag="CC1_01590"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79130"
FT                   /db_xref="GOA:D4J459"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J459"
FT                   /protein_id="CBK79130.1"
FT                   /translation="MRDVIRVMDVSKSFGEETVLHHISYDFKEGRIYGIVGNNGSGKTV
FT                   LMKCICGFLIPDSGEITVNYKRIGKDMDFPQDTGIIIETPGFLPNLTGMRNLELLASLR
FT                   KKIDKKAVAEAIRAVGLDPEMKKPVSKYSLGMRQRLGIAQALMEDPSLLILDEPFNGLD
FT                   KHGVSQMHELILAQKKKGKTILLSSHSQKDIDVLCDVVCEMDGGVMHCIRDRMEDTYAG
FT                   "
FT   CDS             172930..173604
FT                   /transl_table=11
FT                   /locus_tag="CC1_01600"
FT                   /product="Predicted ATPase involved in cell division"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79131"
FT                   /db_xref="GOA:D4J460"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J460"
FT                   /protein_id="CBK79131.1"
FT                   /translation="MQDDREDKAGVQDADNCLCRLKDIVKWYPPDRLVLDQFSLEIGRG
FT                   ERVMIRGNAGSGRTTLIRILDQKIKPNEGTLLCRGSIAAIYETTGILESMTLGEQIALP
FT                   LLCQGYSRREAMDHALEWLKKIGEEIRGYHKEDRITAYDRALIAVGQAVLQNPDLIAAD
FT                   TFMTDLNRAEQARILKILDEASKARACLLMADEIPCGFPCDRILELRKPMDRQPADNMS
FT                   WT"
FT   CDS             175170..176438
FT                   /transl_table=11
FT                   /locus_tag="CC1_01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79132"
FT                   /db_xref="UniProtKB/TrEMBL:D4J461"
FT                   /protein_id="CBK79132.1"
FT                   /translation="MSRNKKGRWWYLAFKTLSLREILLPVIGFAISFVWIWNAAGQYLN
FT                   LFKELQKPVVIQAEMSQNLSSDMRTSILSMQGVEALTPYSEQTAVMQWEDYRGEVSVYY
FT                   VESDYMKWLSGQAVTAGVPFSGGMPYGIVSEKALENLKKKTEEQSRITSMQLESESAAD
FT                   ENRVIDRSSQKDKKKQGLALEKADLLKDFTLDDSQSVRLYGIDQNEQLPGIYLSDQWAD
FT                   TSDERGFTVSGGGMSADPEGSDMPADPGDLDMSAESAGKDSMNSKKSASTSNNSNSSKI
FT                   TERTGTDRSDSTAVDEGHRVSVKLMIAVKNGFNVSPVIKELEQFQISAQSDVTDVIRQT
FT                   NEKNISRLETGAMIFICAIFMMQMSERVWKILHVRWLEDIRRFGAEKKGDRKLLHRRRL
FT                   MIAGMGLIGSFAWQWISMLYGWL"
FT   CDS             178606..180792
FT                   /transl_table=11
FT                   /locus_tag="CC1_01650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79133"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="UniProtKB/TrEMBL:D4J462"
FT                   /protein_id="CBK79133.1"
FT                   /translation="MRRRMIVLLVVMLVSGALMGMSGTDDTGLKLSVKKVSKADEGREI
FT                   YTGQESVSLVLAWNEHAEGTAASDVQWIMCRGRDHLGYQKEEKRQTEGRGTMTYVPDLS
FT                   VFADGEVTFSFWAVDQAGNTGEEAQIVLMKDSTCPVITGRLDTKGRRVGDFYSDSCQVS
FT                   IFVQDENFDFSYRPSVQTENEDGYSFSGWRRNGDKAEGVMTFDGEGTYQLTFSCRDLAG
FT                   NEAETLVVPEFTIDRTAPEVSVKFNESDSHHETYYNQVRKALITVNEQWFRPEDGRITV
FT                   VSGGEEKNVTEIDWVKTDQGYQSEILFERDGMNALTIEWSDPAGNQAKRYQSGAFVLDT
FT                   VKPELSIKGVEAYSSNNGKVEPVIDIYDVNLDEGEVTVALDELTGKKVEMPEVERQETD
FT                   THHLQLAMGDFGSGMDGIYRLSVHAADLAGNDDEAELFFTVNRNGSYYAFDQKTEAMVQ
FT                   KVFISSPEKVVIYENNMDWLTDSSVILSCNGSLRELKPEKDYTIEAVGNETSRKQYTYT
FT                   IDEKCFSREGTYSLYLDSKDRASNYSSAEQQAQTIGFIVDRTAPRISIINLEEQQYYHG
FT                   TSHNFQVTVDDNTQLSCVKYYLDGRLEEQFSKDEIEEAERLLELQTGASDEYQTIRIVA
FT                   EDKAGNTADSGEWHVLVNTSDRTRKFKKHTEQSRTQWRQNSAEPEKQQANDRQAAGLIA
FT                   GIACVILVGGCVWYRHEQKKKVSIRRLPDTDDRK"
FT   CDS             complement(180758..182101)
FT                   /transl_table=11
FT                   /locus_tag="CC1_01660"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79134"
FT                   /db_xref="GOA:D4J463"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4J463"
FT                   /protein_id="CBK79134.1"
FT                   /translation="MTAADTSYMKEKPVLSLLLSMGIPMMLSMLINSLYNIVDSIFVAR
FT                   MSEDAMMAISLVYPVQNLLHSIAVGFGVGTNAVIAIFLGSRKGDAASSAASQGILLNLC
FT                   HGLLFMVFGILFMRPFLNMFTSNETVIAYGMQYGIIVLCFSMIHTTELSFEKIFQSVGR
FT                   MKTSMISLGSSCMINIILDPLLIFGIGPFPEMGIRGAALATGIGQTTGLCIYLLTSRIK
FT                   PLNLQFKMQYFKPDKNICRRLYGIGIPATLNMALPSFLISALNILLGTFSDTQVLVLGI
FT                   YYKLQSFLYLPANGMIQGMRPIMSYNYGARESSRVRSIYQTALYIIILILLAGTVLCLA
FT                   VPDQLIHLFSDNTETIVAGRRALRIICIGFAVSAVSVVTEGALEAMGKGIHSLLISCMR
FT                   YIVLILPLAFIFSHFFGVNGVWHAFWITEVITAVTSGLIFYRQYRAIA"
FT   CDS             182488..184632
FT                   /transl_table=11
FT                   /locus_tag="CC1_01680"
FT                   /product="DNA topoisomerase III, bacteria and conjugative
FT                   plasmid"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79135"
FT                   /db_xref="GOA:D4J464"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="UniProtKB/TrEMBL:D4J464"
FT                   /protein_id="CBK79135.1"
FT                   /translation="MKTLVIAEKPSVGRDIARVLQCTRNSQGALEGEKYIVTWALGHLV
FT                   TLADPEGYDAKYKSWRGEDLPMMPQHFKLVVIKQTHRQFQIVKNQLLRKDVGTIVIATD
FT                   AGREGELVARWILKIAGNKKPVKRLWISSVTDKAIREGFKNLKDGRAYLNLYAAAEARA
FT                   EADWLVGMNGTRALTCRYNAQLSCGRVQTPTLALIASREQEIKSFVPKKYYTLTTVSHG
FT                   MTWNWQDGKSGSNRSFDRGRIQSIAEKAEKDEMVITDVQRTVKKSYSPGLYDLTELQRD
FT                   ANKRFGYSAKETLNIMQRLYENHKVLTYPRTDSRYIGKDVAETLKERLQACAVGPYRKV
FT                   AGKLLLQPIRMDKRFVDDSKVSDHHAIIPTEQFVQLDHMSSEERKIYDLVVRRFLAVLY
FT                   PPCEYEQIKLTGSCAGEKWTAGSRMMKEAGWQQAYESEWEEEDDDSLMTVTSMPKLEKG
FT                   RKDTVMRPKVSEGQTKPPAYYNEGTLLTAMEKGNLGTVATRADIIDKLFNSFLMEKKDK
FT                   DIRVTSKGRQLLGLVPEDLKKPELTADWEKKLLAISEGRLKKDVFISEIRGYTEEIVKE
FT                   IAGGEGQFRHENLTNHLCPNCGKRMLSVQGKNSKMLVCQDRSCGYRESIARKTNARCPK
FT                   CHKKMEMYGKGDAQTFVCTCGYKEKLSAFQNRRKKEGAGVSKRDVQQYMKRQQKEANEP
FT                   INNAFAAAFAKLNLETKEGE"
FT   CDS             184632..185825
FT                   /transl_table=11
FT                   /locus_tag="CC1_01690"
FT                   /product="Biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79136"
FT                   /db_xref="GOA:D4J465"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniProtKB/TrEMBL:D4J465"
FT                   /protein_id="CBK79136.1"
FT                   /translation="MNFVFVSPQFPASYWNFCNRLKQRGVTVLGLSDAPYDSLPEQVKN
FT                   SLTEYYRVDSMEDYDQMVRAMGYFTHQYGKIDWLESNNEYWLTQDARLRTDFNITTGMK
FT                   SEQVANVRRKSAMKAFYKKAGVPTARYHMVSSLEEGLAFAEKVGYPVFVKPDAGMGAEE
FT                   SYKLSNPDEMRYFYETKSDVDYIMEEFITGDIWSYDGISDSKGDIIFETTVSWPRSVAD
FT                   IVNNKDHLSYYTANMLPEDLRRAGRATVKAFDVRSRFFHLEFFRLLDDKEGLGKKGDIV
FT                   ALEVNMRPAGGWTPDMYNYANSVDVYSIWADMVVYDKTYVDLNQRKYFAVYAGRRNGKN
FT                   YIHTPEEIRERYHDQIVMDEDIPEIISGAMGDHMWTARLDTEEQKDEFIDFVQATWQ"
FT   CDS             185841..186197
FT                   /transl_table=11
FT                   /locus_tag="CC1_01700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79137"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:D4J466"
FT                   /protein_id="CBK79137.1"
FT                   /translation="MPFIRTTTNVNLAVDQEKRLRTGTAELVRDILNKDPIRMMTAYEG
FT                   NIHLCRGGDDRRNVPTAFVECKFFGGGGYEVFEAFDKAMHELYRNVLSIQPQDLYIKYE
FT                   VIYGWGEPAKIFKI"
FT   CDS             186229..187092
FT                   /transl_table=11
FT                   /locus_tag="CC1_01710"
FT                   /product="Predicted esterase of the alpha-beta hydrolase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79138"
FT                   /db_xref="GOA:D4J467"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D4J467"
FT                   /protein_id="CBK79138.1"
FT                   /translation="MLDINVKDVSLVLEGGTFRTVFTMGILDAFLDEGIMMPHISGVSA
FT                   GITYAGSYISQQKGRNIQILKKYRHDKRYMGVRNFLTDRSIFGLKFAYDTLVNELEPMD
FT                   WEIFRAYKGTMAVGVTNARTGQINYMDGLRMDKSCRMLQATCAIPLLFPAIEMDGQYYY
FT                   DGGVCEPITIHKAEADGYRRHIIILTRDKTYVKEKSQSNEFAAKVLKRRFPNMVRPLLE
FT                   RHDYYNEEVAYCNELEAKGQALLFRPDYPLVSMEKNIDKLQEGYDMGYRQAMARMVEIK
FT                   AFCGLN"
FT   CDS             187156..187992
FT                   /transl_table=11
FT                   /locus_tag="CC1_01720"
FT                   /product="Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79139"
FT                   /db_xref="GOA:D4J468"
FT                   /db_xref="InterPro:IPR022302"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4J468"
FT                   /protein_id="CBK79139.1"
FT                   /translation="MRIGLISDLHIDINKDYPIVELTAETAAEQMTDVLVIAGDISETQ
FT                   NQTLQAIERLQSLCEFPVYYVPGNHDMWNKNCPECTTEEIDRIYREDLRCLSGKPVILE
FT                   KDGRQLALVGDVGWYDYSMASPEYSRDVLDGMMMDGRTWQDKLYNQWTEDNQKQMFRCL
FT                   KQLEKQLKDCGSLPVLAVTHMLPVKDFCVPEKPDGIKWGFFNAFLGSTALEELYKKYPV
FT                   RYAVCGHVHYRSTVERDGIRHICPCLGYHTEWPLYHLADDRAQTHIRDALYILETP"
FT   CDS             complement(188849..189874)
FT                   /transl_table=11
FT                   /locus_tag="CC1_01740"
FT                   /product="Cellulase M and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79140"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D4J469"
FT                   /protein_id="CBK79140.1"
FT                   /translation="MNEIDFILEQLKGLTAIDSPTGFTEYAAEHVMNVYKKMGYAPVQT
FT                   AKGGIFIDLGGKNEEDAILLTAHMDTLGAMVHTVKSNGRLKLTPLGGLNPNNTEGENCR
FT                   IYTRSGRIYDGTFQLIDASIHVNGEYNDTKRSFDTMEVVLDEDVYNKEGVEALGIRTGD
FT                   IVCFDPRTRITDSGYIKSRFLDDKLSVAILMGYANYLQEQDIVPERRIYQHISVFEEVG
FT                   HGCSYLPAPVSEVLAVDMGCVGEGLNCTERQVSICAKDSHGPYHYATVSALVAAAEEQG
FT                   IDFAIDIYPHYGSDADAALDAGYDIRHALIGAGVYASHGYERSHIEGVRNTFELLKAYL
FT                   D"
FT   CDS             190256..191131
FT                   /transl_table=11
FT                   /locus_tag="CC1_01760"
FT                   /product="methionine aminopeptidase, type I"
FT                   /function="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79141"
FT                   /db_xref="GOA:D4J470"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:D4J470"
FT                   /protein_id="CBK79141.1"
FT                   /translation="MHVKIGRNDPCWCGSMKKYKNCHQSFDEKIEELRSQGHIVPDHSL
FT                   IKTPEQIAGIKESAKINIAVLDEVASKIKEGMTTEEIDKIVYDTTTKMGGIPAPLNYEG
FT                   FPKSVCTSINEEVCHGIPSPKVVLKDGDIINVDVSTIYKGYYSDSSRMFCIGNVSDEKR
FT                   KLVQVVKECVELGLEQVKPWGFLGDMSQAVYDHAVANGYQVVRNIGGHGVGLEFHEDPW
FT                   VGYIYKKGTQMVMAPGMMFTIEPMVNMGTHKISVDKKNGWTVYTNDKKPSAQWEIQVLV
FT                   TEDGHEVIAY"
FT   CDS             191150..191608
FT                   /transl_table=11
FT                   /locus_tag="CC1_01770"
FT                   /product="Lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79142"
FT                   /db_xref="GOA:D4J471"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:D4J471"
FT                   /protein_id="CBK79142.1"
FT                   /translation="MLWILIAAAVCAGDLLVKHYIDTHKEENCHEPVVGGHIIITRFHN
FT                   PGAMLGWMKDKPKMLMGVTILGIGVLAGGLMGSLYKKKSVSIRLGLALLLGGAASNAYD
FT                   RIMKKEVTDYFRISIGSKRLERIIFNIGDMAIFIGGILTAIGEIKESF"
FT   CDS             complement(191734..193383)
FT                   /transl_table=11
FT                   /locus_tag="CC1_01780"
FT                   /product="CTP synthase"
FT                   /function="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79143"
FT                   /db_xref="GOA:D4J472"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4J472"
FT                   /protein_id="CBK79143.1"
FT                   /translation="MAVKYVFVTGGVVSGLGKGITAASLGRLLKSRGYFVTMQKFDPYL
FT                   NIDPGTMNPYQHGEVFVTDDGTETDLDLGHYERFIDCSLNSRSNVTSGKVYWDVLSGER
FT                   RGDYGGSTVQVIPHITNAIKSRFYRNPASRETEIAIIEVGGTVGDIESQPFLESIRQFQ
FT                   HEIGRENCMLIHVTLIPYIKSSGEMKTKPTQNTVKDLQALGLQPDVIVCRSELPLDDGI
FT                   KDKISLFCNVDVHNVIENLDVDVLYEAPLALEKEKLAQVVCKRLGIDCPEPDLDDWKAM
FT                   IHAWKNPTRKVRIALVGKYVQLHDAYISVVESLKHAACANGAEVEIQWVDSELVSSFNV
FT                   ADILKDADGILVPGGFGDRGIEGKITAIEYARTHNVPFLGLCLGMQMAIVEFARHVLGY
FT                   TDAHSSELNPNTTHPVIHIMPDQHNVTDLGGTLRLGAYKCVLDENSKAYALYGEKVIEE
FT                   RHRHRYEVNNEYRNVLTENGMQLCGISPDGRIVEMIELKDHPWFIATQAHPEFKSRPNK
FT                   PHPLFKGFIEAALKYEDILQAEAEAESPADAE"
FT   CDS             193688..195721
FT                   /transl_table=11
FT                   /locus_tag="CC1_01790"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79144"
FT                   /db_xref="GOA:D4J473"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J473"
FT                   /protein_id="CBK79144.1"
FT                   /translation="MDNQKMNNNRPDQDPEGGNNKKDDMNKKSLLVMVVLAIAVMIIAQ
FT                   MLSGKIASASQKEVTYTEFMQDVKDGKVTKVELDSDRIYYEVKNQKNVKYYTGNVQDER
FT                   LYEELDNAGVTYSRKVIDTTTYVMSSILSFVLPTVLMVAVMMIFYRFAFKGGGGVMGVG
FT                   KSNAKLYVQDKTGVTFQDVAGQEESKESLREIVDFLHNPEKYTKIGAKLPKGALLVGPP
FT                   GTGKTLLAKAVAGEAGVPFFSLSGSDFVEMFVGVGASRVRDLFKQAQQNAPCIIFIDEL
FT                   DAIGKSRDSRFGGNDEREQTLNQLLAEMDGFDSSKGIIILAATNRPEILDKALLRPGRF
FT                   DRRIIVERPDLKGRIDVLKVHAKNVCMDETVDFKEIALATSGAVGSDLANIINEAALLA
FT                   VRNGRNAVSQSDLFESVEVVIAGKAKKDRVLSAEERRIVSYHEVGHALVAALQKNTEPV
FT                   QKITIIPRTMGALGYVMQVPEEEKYLMSEKQIREELVTMLAGRAAESIVFDSVTTGASN
FT                   DIEQATKLARAMITQYGMSEKFGLIGLTTVEDQYLGGRATLNCGEATAAEIDQEVMKIL
FT                   KDAYDQALALLADNRDCLDKIAAFLIERETITGKEFMKIFREVKGIPDPETEQAEANVS
FT                   NPAENDSQPDGQDEPALLEAKTDNGASSESDINVSLETKAED"
FT   CDS             195862..197700
FT                   /transl_table=11
FT                   /locus_tag="CC1_01800"
FT                   /product="excinuclease ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79145"
FT                   /db_xref="GOA:D4J474"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027299"
FT                   /db_xref="UniProtKB/TrEMBL:D4J474"
FT                   /protein_id="CBK79145.1"
FT                   /translation="MFDIQEELKKLPAKPGVYIMHDVHDDIIYVGKAIILKNRVRQYFQ
FT                   SSRNHTPKIRQMVSHVARFEYIITDSELEALVLECNLIKEHRPKYNTMLKDDKTYPYIK
FT                   VTVGEAFPRIMLVRSMKKDKAKYFGPYTSSQSVRDIIDLSQKIYKIRSCNRSLPKETGN
FT                   DRPCLYYHMGQCQAPCQGYISQEEYHENVHQMLHFLGGNFEPVIQMLTDKMYAASEKMD
FT                   FEKAASYRDLLNSVKQIDQKQKITSSEMDDKDVIAFARDKDEAVVQVFFVRHGRLIGRE
FT                   HFYVSGVANDTESQVLTAFVKQYYASSPFVPSTLMLQYPLDDREVILEWLSGRKGHKVR
FT                   EVVPQRGQKERLVELAAENARNVLTKDREKIRLEEARTTGAVRDLAEMLGLPAGIRRME
FT                   AFDISNISGVETVGSMIVYENGKPKRNAYRKFKIRTVKGQDDYRCMEEVLTRRFQHGLE
FT                   ETVSGEEGKFSDFPDVLMMDGGKGQVNVALKVLNQLHLKIPVCGMVKDDHHRTRGLYYQ
FT                   QVELPIDTHSEMFKLITRMQDEAHRFAIEYHRQLRSKTQVRSVLDEIPGIGPARRKALM
FT                   KYFGSIEKIREADEEELMKAESMNAGSARAVYAYFH"
FT   CDS             197777..198733
FT                   /transl_table=11
FT                   /locus_tag="CC1_01810"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /function="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.11.-"
FT                   /EC_number="2.7.4.-"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79146"
FT                   /db_xref="GOA:D4J475"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D4J475"
FT                   /protein_id="CBK79146.1"
FT                   /translation="MYNTSKGNYSVKLNKVIEKFNLKNLTPEVDTKKIVIRQTDVNRPA
FT                   LQFAGYFEYFDYSRIQLIGKVEYSYLKMHDDDYIREMTEKIFKAGIPCMIFCRGLEPRP
FT                   LFMELGNKYGVPVLSTDDGTSSFFSELNRFLKIELAPRISIHGVLVDVFGEGVLITGES
FT                   GIGKSEAALELVKRGHRLVSDDVVEIKKTNNDELIGTAPDITRYFIELRGIGIIDVKTL
FT                   YGVQSVEESQSISLIIKLEEWDREREYDRLGLEEQYEEILGNKVVCHSIPIRPGRNLAI
FT                   IVETAAINHRQKQMGYNAAHELYRRVTGNLQKKREED"
FT   CDS             198733..199680
FT                   /transl_table=11
FT                   /locus_tag="CC1_01820"
FT                   /product="glucokinase"
FT                   /function="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79147"
FT                   /db_xref="GOA:D4J476"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:D4J476"
FT                   /protein_id="CBK79147.1"
FT                   /translation="MDQFCFGVDLGGTTVKIGLFTVDGMLQEKWEIPTRTENQGAAILG
FT                   DIAASIQNKVDVRHLTKEQVTGIGIGVPGPVLNENRVQGCVNLGWGNVCVADELSALTG
FT                   MKVKAANDANVAALGEQWQGGGKGYQNIVMFTLGTGVGGGIIQNGQIVSGANGAAGEIG
FT                   HMVITEPENVVGTCGCGHQGCLEQIASATGIVNLAKRQLTECDEASILRQYAPLTAKDV
FT                   LDAAKAGDALACRVAEQMMQALGRAAAYIACVMNPDVFVIGGGVSRAGEYLTEGIRRYY
FT                   QQYAFHASAETPFVLASLGNDAGMTGAAGMVCNF"
FT   CDS             199727..200644
FT                   /transl_table=11
FT                   /locus_tag="CC1_01830"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /function="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.1.1.158"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79148"
FT                   /db_xref="GOA:D4J477"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D4J477"
FT                   /protein_id="CBK79148.1"
FT                   /translation="MDFYHRLLEAAGSDHVLRDEPMAVHTTFRIGGPADYFVEPADASA
FT                   LAKGIALCREVDVDYFVTGNGSNLLVGDGGYRGVIFHICHTMDHIQYEEQEGELLVEAG
FT                   AGVMLSRLARQVSSMGYTGFEYATGIPGTLGGGVTMNAGAYGGEISDNILWAELMDETG
FT                   AILKLEKEHLKLSYRHSVMMEHPLVVLRAGFSFKKGDAAAISDRVTELSRLRREKQPLE
FT                   YPSAGSTFKRPEGYFAGKLIQDCGLKGFRVGDAVVSEKHSGFVINAGQATAADVMALIR
FT                   YVQQEVEEKFHVRIEPEVRLLGEF"
FT   CDS             200658..201542
FT                   /transl_table=11
FT                   /locus_tag="CC1_01840"
FT                   /product="Predicted P-loop-containing kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79149"
FT                   /db_xref="GOA:D4J478"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J478"
FT                   /protein_id="CBK79149.1"
FT                   /translation="MRFVIVTGMSGAGKSSVLKMLEDAGYFCVDNLPVPLVLKFAEISW
FT                   HEENMMSKVALGIDIRSRNHLNMLEDVLKSVRDEGYDYEILFMDCKDDKLIKRYKETRR
FT                   NHPLAAGGRIETAIAEERQRLSFLKKQSDYIIDTSNLLIRDLKKEIQHIFVEDKDYSNF
FT                   YITLLSFGFKYGIPADADLVFDVRFLPNPYYVDELKHQTGNDKPVYDYVMKSEDAGIFL
FT                   KQLYDMLVFLIPRYIAEGKNQLVVAIGCTGGKHRSVTITNALYEKMKDLEYSIKAEHRD
FT                   VDRDGQHKSSQVR"
FT   CDS             201547..202503
FT                   /transl_table=11
FT                   /locus_tag="CC1_01850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79150"
FT                   /db_xref="GOA:D4J479"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:D4J479"
FT                   /protein_id="CBK79150.1"
FT                   /translation="MSFSSKVKEELSKECNSPRHCCIAETAAIISMCGKVIFDEKDHVR
FT                   IEIHTENVTVARKYFTLLKKTYNINTDISIRHSSSLNKNRSYVLSVNDDETARKILMTC
FT                   RLMKPFGVIEEDFSISDSLIIQRECCKRAFIRGAFLAAGSVSDPVKTYHFEIVCLSEAK
FT                   AKQLQMIMETFNINARVIKRRKYFVVYVKDSSQVVDLLNIMGAYNALMDMENVRIVKDM
FT                   RNNVNRKVNCETANINKTVSAAVKQIEDIRFIQMSSAFDELPESLQEMAELRVRYPEAT
FT                   LAELGQLLDTPVGKSGVNHRLKKISLFADELRERHHQ"
FT   CDS             202533..202790
FT                   /transl_table=11
FT                   /locus_tag="CC1_01860"
FT                   /product="Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79151"
FT                   /db_xref="GOA:D4J480"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="UniProtKB/TrEMBL:D4J480"
FT                   /protein_id="CBK79151.1"
FT                   /translation="MISKNITINIPTDMEARPVALLVQVASQFESNIYVEVEDKKVNAK
FT                   SIMGMMTLSIAPGEEVTIITKGVDEEEAMNKIEEYLTTSK"
FT   CDS             202976..206446
FT                   /transl_table=11
FT                   /locus_tag="CC1_01870"
FT                   /product="DNA polymerase III catalytic subunit, DnaE type"
FT                   /function="DNA polymerase III catalytic subunit, DnaE type"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79152"
FT                   /db_xref="GOA:D4J481"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="UniProtKB/TrEMBL:D4J481"
FT                   /protein_id="CBK79152.1"
FT                   /translation="MDFTHLHVHTEYSLLDGSNKIKELIARVKELGMDSVAITDHGVMY
FT                   GVIDFYKEAQKQGIHPVIGCEVYVAPGSRFDKSGNMSSNRYHHLVLLAENDTGYHNLMK
FT                   IVSKGFTEGFYYKPRVDKELLKEYHEGIIALSACLAGEIPDALRKGLYQTALNAAQEMS
FT                   EIFGEDHFYLELQDHGIPDQKTVNQGLLRLAKDTGLELVATNDIHYTLAEDAQAHDVLL
FT                   CIQTGKKVADTDRMRYEGGQYYVKSPEEMASLFPYAREAIENTHKIAMRCHVDIEFGHY
FT                   KLPEFPVPEGYDSWEYLQKLVWDGFYERYPQADEKLKERVSYELNTIKTMGFVDYFLIV
FT                   WDFIHYAKEHDIMVGPGRGSAAGSIVSYCLDITTLDPIRYNLLFERFLNPNRVTMPDID
FT                   VDFCFERRQEVIDYVVRKYGKERVVQIVTFGTMAARGVIRDVGRVLDLPYAICDSVAKM
FT                   IPNELGITIDKALKMNPELKKLYDGDDSIHNLIDMARRLEGLPRHTSMHAAGVVISPKA
FT                   VDEFVPLSRGADDVITTQYTMTTLEELGLLKMDFLGLRTLTVIRNAVKLINADGRHHVD
FT                   MHEIDYNDKAVFDMIGTGKTDGIFQLESSGMKSFMKELKPHNLEDIIAGISLYRPGPMD
FT                   FIPRYIKGKNEPASITYECPQLEEILEPTYGCIVYQEQVMQIVMKLAGYDLGRSDLVRR
FT                   AMSKKKADVMAKERQYFVYGNDELGVPGCIANGIDEATANRIFDEMTDFAKYAFNKSHA
FT                   AAYTIVSYQTAWLKYYYPVEFMAALMTSVIDNSVKVAEYIMTCRQMGIKILPPDINHGV
FT                   SSFSVDNGRILYGLSAVKSIGRPVVAAIEQERTLAGPFTSLKNFIERMSGKEVNKRSIE
FT                   NFIKAGAFDSFGATRRQQMMVYAQIMDQVAQDRKKNISGQMTLFDFMDEEEKQAFEIRY
FT                   PNVGEYDKGTLLSFEKEVLGVYISGHPLDDVAESWRRNVTAVTSDFYVNEESGMPNVVD
FT                   QSLVVIGGMVTGKTVKSTKNNKMMAFIQLEDLLGTVEVIIFPNDYEKYQAELTEEAKLY
FT                   IKGRVSASEDQQAKLIAEKIIPFDKVPKEVWLQYPDKNSFIGQQETLYKTLAGHSGNDR
FT                   VIIFCKVEKAIKKLPVSWNIKAEEEILDQLGTVLGKENVKVRETVLKSF"
FT   CDS             206516..207490
FT                   /transl_table=11
FT                   /locus_tag="CC1_01880"
FT                   /product="6-phosphofructokinase"
FT                   /function="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79153"
FT                   /db_xref="GOA:D4J482"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniProtKB/TrEMBL:D4J482"
FT                   /protein_id="CBK79153.1"
FT                   /translation="MNDGVKTIGVLTSGGDAPGMNAAVRAVVRTAIAYGCQVKGIQKGY
FT                   SGLLEEEIIDLYAGSVSDIINRGGTFLYTARCEEFRTEEGQRKGAEICRKHGIDSVVVI
FT                   GGDGSFQGARKLAAHGINTIGVPGTIDLDIACTDYTIGFDTAVNTAMEAIDKVRDTSTS
FT                   HERCSIIEVMGRNAGYIALWCGIANGAEDILLPELYNYDEEALIDHIIANRRRGKKHHI
FT                   IINAEGVGHSTSMAKRIEAATGIETRATILGHLQRGGSPTAKDRVMASVMGAYAVDALM
FT                   GGKSNRVVAYKDGKYVDYDIEEALAMQKELDPFQYSVAKILAR"
FT   CDS             207709..208491
FT                   /transl_table=11
FT                   /locus_tag="CC1_01890"
FT                   /product="rRNA methylases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79154"
FT                   /db_xref="GOA:D4J483"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D4J483"
FT                   /protein_id="CBK79154.1"
FT                   /translation="MITSVSNPQMKRIKELLNKSKQRRKEKCFVAEGIRMVAETPADRL
FT                   EKVYVSESFYRHPPELRGLDLSKALIVDDQVFRQVSDTQTPQGIMAVVRQQENSLDAIM
FT                   KQPDALLLFLENIQDPGNLGTMMRTAEGAGVTGIIMSRETTDIYNPKTIRATMGSLYRM
FT                   PFVYVDDFCETIRMAKAQGIRLYAAHLKGKHTYDGEDYRQPSGFLIGNEGNGLTQEAAD
FT                   SATDYIRIPMGGQLESLNAAVAAAVLMYEANRQRREQL"
FT   CDS             209117..210043
FT                   /transl_table=11
FT                   /locus_tag="CC1_01910"
FT                   /product="Membrane protease subunits, stomatin/prohibitin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79155"
FT                   /db_xref="GOA:D4J484"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="UniProtKB/TrEMBL:D4J484"
FT                   /protein_id="CBK79155.1"
FT                   /translation="MILVIVLIIILLLILASCLKIVPQAHAYVIERLGAYQGTWSVGFH
FT                   IKMPIIDKVAKKVILKEQVVDFAPQPVITKDNVTMRIDTVVFYQITDPKLYCYGVQNPI
FT                   MAIENLTATTLRNIIGDLELDETLTSREIINAKMRSTLDEATDPWGIKVNRVELKNIIP
FT                   PSAIQDAMEKQMKAERERRESILIAEGEKRSAILKAEGHKESVILQAEADKQSAILHAE
FT                   AVKEAKIREAEGEAQAILKIQQANADGIKFIREAGADSAVLQLKSLEAFAKAADGKATK
FT                   IIIPSDIQGIAGLATSIAEVVKEADAK"
FT   CDS             210268..210927
FT                   /transl_table=11
FT                   /locus_tag="CC1_01920"
FT                   /product="PAP2 superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79156"
FT                   /db_xref="GOA:D4J485"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:D4J485"
FT                   /protein_id="CBK79156.1"
FT                   /translation="MRRLRQWTLKHPLQFVSAFMLVYFTWFSLLEKYAQPVLMIHSKLD
FT                   EKIPFCEYFIVPYLLWFVWIAGTFVYFYIKSRDDFYHACRYMFTGMIVCLIIYTLIPNG
FT                   LNLRPEITNNNIFSRLVDMIWTVDTATNVCPSIHVFNSIAINTVIQHSNAFKHKKLVHV
FT                   GSYILALAICMSTVFLKQHSVVDVFWACVLGLVLYPLSYKSAFDDSRESEYNVKAS"
FT   CDS             211073..212050
FT                   /transl_table=11
FT                   /locus_tag="CC1_01930"
FT                   /product="birA, biotin-[acetyl-CoA-carboxylase] ligase
FT                   region"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79157"
FT                   /db_xref="GOA:D4J486"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="UniProtKB/TrEMBL:D4J486"
FT                   /protein_id="CBK79157.1"
FT                   /translation="MKEKILKCLREAEDYVSGQELCQMFDVSRTAIWKVMNQLKEEGYV
FT                   IDAVKNKGYRLVQTPDLVTAEEVESLLETSWAARPVVYEEEQASTNQTAKMLAEQGASH
FT                   GTLVVAERQVSGRGRRGRPWHSPKGSGIWMSILLRPQIHPMSASMLTLVAAMAVYDAIS
FT                   SRVEGCAIKWPNDIVIDGRKVCGILTEMSSELDNIHYVVIGIGINVNTDDFPVDIASVA
FT                   TSMHVITGAYYKRAEIIADIWKAFEKYYDFFVQTENLVLMVDTYNQRLVNMDRRVMIEE
FT                   RGHRYEGTARGIDAEGGLLVERDDGTTTSVISGEVSVRGILGYV"
FT   CDS             212112..212459
FT                   /transl_table=11
FT                   /locus_tag="CC1_01940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79158"
FT                   /db_xref="UniProtKB/TrEMBL:D4J487"
FT                   /protein_id="CBK79158.1"
FT                   /translation="MFQDKMVLCASSAYEKKFYLNENFEGLPQHVKDELKIMCVLFTED
FT                   VGGVLSLEFDENGNLELNTSADEGDLLYDEIGSVLKIKQMQQEKQELFESLETYYKVFF
FT                   LGEDIEDDNGD"
FT   CDS             212443..213243
FT                   /transl_table=11
FT                   /locus_tag="CC1_01950"
FT                   /product="pantothenate kinase"
FT                   /function="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79159"
FT                   /db_xref="GOA:D4J488"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D4J488"
FT                   /protein_id="CBK79159.1"
FT                   /translation="MIMAIDVSNTNITLGTFKGEKLLKIYRVTTKVPRTSDEYGVLLRD
FT                   LVRLSNASHHDIEGIIIASVVPNVMYSLTNACIKYFHVHPVIVGPGVKTGVKVGAENPK
FT                   EAGSDLIVNAAAVKELYGVPAIVIDYGTATSYQLVLEDGKLDSVVIAPGIQTSVQALTS
FT                   DAARIPEVEIRKPKTILTKDTTECIQAGIVYGTIGETEYIVRKMKEESGLENIKVVATG
FT                   GFGKVIADETDVIDIYDNMLTLQGLRIIYYKNATAGRKSRKIQT"
FT   CDS             213291..214307
FT                   /transl_table=11
FT                   /locus_tag="CC1_01960"
FT                   /product="tRNA-U20-dihydrouridine synthase"
FT                   /function="tRNA-U20-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79160"
FT                   /db_xref="GOA:D4J489"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="UniProtKB/TrEMBL:D4J489"
FT                   /protein_id="CBK79160.1"
FT                   /translation="MMMKPLQIGNLCIDRPVILAPMAGVTDLPFRVLCREQGCGMVCTE
FT                   MVSAKAITYKNKNTFFLMETVPQERPVSLQLFGSDPDIMAEAARMIADRDFDVLDVNMG
FT                   CPVPKVVNNGEGSALMKQPELAGRIVRSLVETIDKPVTVKIRKGFDDDHINAVEMAKIV
FT                   EANGAAAVAVHGRTREQYYSGKADWQIIRRVKEAVKIPVIGNGDVFTPQDAKRMIEETG
FT                   CDAIMAARGARGNPWLFRDIIDYLEKGILHEKPSLKEMTDMMLRHAEMHIRYKGEYQGI
FT                   REMRKHVAWYTAGYHGSARMRQAVNEVESYESLKQLLADWLAYSEGGMKAHDKNNGS"
FT   CDS             214534..215016
FT                   /transl_table=11
FT                   /locus_tag="CC1_01970"
FT                   /product="transcription elongation factor GreA"
FT                   /function="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79161"
FT                   /db_xref="GOA:D4J490"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="UniProtKB/TrEMBL:D4J490"
FT                   /protein_id="CBK79161.1"
FT                   /translation="MAETKKNIMTFAGLRALEDELFDLKVYKRKEVAQKIKEAREQGDL
FT                   SENAEYDAAKDEQRDIEARIEELEKLLKNVEVVGQDEVDADTVGIGSRVKLYDVEMDEE
FT                   VEYTIVGSTEADALNGKISNESPVGAALIGSKVGETIVVETISGDLEFKILEIARA"
FT   CDS             217323..217700
FT                   /transl_table=11
FT                   /locus_tag="CC1_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_01990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79162"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="UniProtKB/TrEMBL:D4J491"
FT                   /protein_id="CBK79162.1"
FT                   /translation="MGLFGKSKKERETEYMSRLDVPSCLKEDFELIIDDIFTIMGVGTV
FT                   ATGNILTGMCREGENACIYKANGDILETRITTVDVHTKERKANGCGYKTEHVELGLRGI
FT                   SKEQLEKGDKVLVKNANMYGM"
FT   CDS             217848..219233
FT                   /transl_table=11
FT                   /locus_tag="CC1_02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79163"
FT                   /db_xref="InterPro:IPR025487"
FT                   /db_xref="UniProtKB/TrEMBL:D4J492"
FT                   /protein_id="CBK79163.1"
FT                   /translation="MNNSLAEVRPELVPEWSEKNLPLKPDEITFGSNKKVWWRGACGHE
FT                   WQTSVKARSNGEKCPICSGARVIAGINDLATLEPLLVKQWSKKNKIKPTEVSIGSHKKV
FT                   IWRCEKGHEWEAAVKSRTINKTGCPYCSHNKVLAGFNDLATLLPDIAAEWSDRNCPTLP
FT                   TQVTVFANRKAWWKCKDCGREWNTLISTRSGGSKCPYCSGYIFLKGFNDLQTTHPEIAS
FT                   EWSEKNLPLKPDEVNAKSRKNVWWRCSKCGNEWKSVINARVKGTVCPVCAEREVIAGYN
FT                   DLATTDGQLLSEWDYEQNKLKPTEVSRTSAKRAWWKCRHGHSWSMKINERTILKKGCRI
FT                   CEQEYLSLFPALAVSYYSNRKGLKAELGSDRLLGVPLETYIPSEKLAIESGSADENIEI
FT                   MKAYMCKQRGIRLIKLPMKGTELDYANNLKKAFQSVHIFISSDTEEDVEIIKNTFERWR
FT                   DSQ"
FT   CDS             219230..219409
FT                   /transl_table=11
FT                   /locus_tag="CC1_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79164"
FT                   /db_xref="UniProtKB/TrEMBL:D4J493"
FT                   /protein_id="CBK79164.1"
FT                   /translation="MREKTYHLYLNEEERSRVIQSLIELKNNLAAQGRYTDAVDDVLCK
FT                   VLEAKKKKLKIEYI"
FT   gap             219698..220154
FT                   /estimated_length=457
FT   CDS             220172..220597
FT                   /transl_table=11
FT                   /locus_tag="CC1_02030"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79165"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J494"
FT                   /protein_id="CBK79165.1"
FT                   /translation="MPSLGMVTLNALSAADSVIIPVQAQYLPAKGMTQLVQTISKVKKY
FT                   INPDIKIDGMLLTLVDSRTNLAKSTVEALRANFGNQIRMYRTQIPIAVKAAETSSKGKS
FT                   IYAYEPNSTVSKAYAEFTKEVLADGRKKERLHSHEAR"
FT   CDS             220554..221498
FT                   /transl_table=11
FT                   /locus_tag="CC1_02040"
FT                   /product="ParB-like partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79166"
FT                   /db_xref="GOA:D4J495"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="UniProtKB/TrEMBL:D4J495"
FT                   /protein_id="CBK79166.1"
FT                   /translation="MAGRKSDFTLTKLDDLFTTQAQRDEEQLSKIRDIPLELIDDFPDH
FT                   PFKVRDDEDMMQLVESVKERGVITPATVRQKEDGRYELVSGHRRKRACELAGFETLRSE
FT                   IVDLNRDEATILMVESNFQRSEILPSEKAFAYKMRLEALSRQGKRTDLTSNPLGRKSDG
FT                   KETAQIIGEQSGDSQTQVRRYIRLTNLVPELLEFVDEGRIKMRPAVELSYLDEDCQRDV
FT                   VDEIDLNDATPSHDQTIRMRKLFNEGNLTTEAIHAVMSEEKPNQKEKIVLRGDRVRQLI
FT                   PKNIPVSQTEDFVCKALEYYNKFLRNRAERDSR"
FT   CDS             221784..226034
FT                   /transl_table=11
FT                   /locus_tag="CC1_02050"
FT                   /product="Cna protein B-type domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79167"
FT                   /db_xref="GOA:D4J496"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR008970"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="UniProtKB/TrEMBL:D4J496"
FT                   /protein_id="CBK79167.1"
FT                   /translation="MIKSKFKRVTSLFLATLMCVTTFAGIGSTTAYAASGEKADVYMVD
FT                   FPRDGDANYDGVWGHSNLTLKNGWHTGRSNFTNLKAIGSYSGNVAYCIEPGISLKVGQT
FT                   MNKYDENYFNNLAANGVISGDEIRLFVGRILQYGYRGTISTSWRSQNEAAANSIAQAYA
FT                   TQLLIWETVIGERDVNFNHVAASGCSNVKDVINAKHPLRNKIFSYYNSMVQSVQNHATI
FT                   PSFCNKSSGSAKTIELEWNGSKYTTTLTDSNNVLSKYNFKASISGVSFSVNGNKLTVSM
FT                   DTAPSKEFTITATKKNAVRRGVVVWSEGKHGQNSSVQDVVSYAQEVSDSINGYVKMKVS
FT                   YGSCQIVKTSEDGKVDGINFTITGNGINQTVTTANGGKFQIDNLMPGIYTVTEQAYDKY
FT                   EPQETHRVTVVAGQVAKVNFNNKLKRGDLQVVKSSEDNLVEGVKFHLYGTSLSGAAVDQ
FT                   YAVTDQNGVATFKDVLISGSEPYTLEEVDTAIRYVVPKNQTAPVKWKEVTTRNFNNILK
FT                   KFTVTVTKSDAEKGEAQGNAKLSGAVYGIYKGETLVDKYVTDENGQFTTKEYVCDTDWT
FT                   IREITPSEGYLLDKTIHEVGADPKLYEVEHNLTSNDVTEQVIKGNVAIIKHTDDGETKI
FT                   ETPEKGASFEIYLKSAGSYDAANKDERDTIVCDENGFGQTKDMPYGIYTVHQTSGWEGR
FT                   EMMDDFDVFISQNAQTYRYLINNRNFESFVNVIKVDAESGKSIPYAGAGFKIYDPQGNQ
FT                   VKMTFTYPTPTTIDVFYTDANGSLVTPEKLDYGKGYSIVEVQAPYGYVLDDTPVYFDIT
FT                   EENSTEEGGVTVVKVNKPNMAQKGTITVEKTGEVFSGVNVSGSEDSDVIYQPVYEVAGL
FT                   EGAVYEVRAAEDISTPDGTLRYSKGEVVDTITTSSDGFVKSKELYLGKYEVKEITAPDG
FT                   MVVSGETHTVELTYAGQNISVTETSTSFYNERQKVQVSLAKVIEKDKTFGIGDNGEIKN
FT                   ISFGLYATEDIVSASGTVIPADGLIEIISVNENGTAVMKSDLPFGKYYVKEIATDEHYV
FT                   LSDTKYPVVFEYAGQDTATVEIKVNDGKEIKNELIYGSVSGKKIDENGEALEGAVIGIF
FT                   KAEETEFTKDTALMTTTSAKDGSFSFAKVPYGKWIVREIEQPKGFVLDKKAYEVNISKA
FT                   EQVIEIEIVNEYVHGNIRLTKVDAEYPDNKLTGATFEVYKDTNENGKIDDGDELIGNLE
FT                   ETETGIYEMKELLYGKYIVRETKAPEGFLLDKGEYSVFIEKDETTYSVENKAGVGFINE
FT                   AMRGTLKIVKTSSDGKVKGFAFRVTGANGYDMTFETDKNGEIVIEGLRIGEYTVSEVAN
FT                   NASAAYITPADQNVTIKLDETAVVKMHNELRDTPKTGDDTNMKLWYVLAGLSAVGIAVT
FT                   SVVAHKKKKKESNE"
FT   CDS             226034..226123
FT                   /transl_table=11
FT                   /locus_tag="CC1_02060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79168"
FT                   /db_xref="UniProtKB/TrEMBL:D4J497"
FT                   /protein_id="CBK79168.1"
FT                   /translation="MEAKTIIAIALVAVIVGGFIFLQVKNRKK"
FT   CDS             226196..226492
FT                   /transl_table=11
FT                   /locus_tag="CC1_02070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79169"
FT                   /db_xref="UniProtKB/TrEMBL:D4J498"
FT                   /protein_id="CBK79169.1"
FT                   /translation="MKQQKTVESRVLEILKECPMSRYDDMLLILHYYNQYGYIPAGNLP
FT                   LEDIVFNYRAYGLPCFETIRRARQRVQSLFPEYSRNPQKEEQSGSISIVINIS"
FT   CDS             226746..227045
FT                   /transl_table=11
FT                   /locus_tag="CC1_02090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79170"
FT                   /db_xref="UniProtKB/TrEMBL:D4J499"
FT                   /protein_id="CBK79170.1"
FT                   /translation="MKQQENRAEPQEKQIRFIDSHYNLKFYIPDGGKIRITFRDGHTAD
FT                   RVCKYIDDYHLYVGNCCYHICEFAEKMELSGSKVEPVNQSEPSKNKTRNREKQR"
FT   CDS             227061..230291
FT                   /transl_table=11
FT                   /locus_tag="CC1_02100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79171"
FT                   /db_xref="GOA:D4J4A0"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4A0"
FT                   /protein_id="CBK79171.1"
FT                   /translation="MARKYDLISELYNRTCKTVVSNPQNWQAFLASACRNYKLRYDEQL
FT                   LVYAQRPDATAVLEIEQWNKIFGRWVNRGARGIAVFADENRSRQRLTHYFDISDTHESR
FT                   YSRTVPIWDMRQEYEADVIETLESTFGEIENKSSLAEAIMGAARNAAEDNIPDYLQDLY
FT                   YATEGSSFEEVEEDIVAFIYKNVVTNSVAYMMMSRLGVDTDGYFELDDFRDVTNFNTQE
FT                   TLNALGFATSDIAEMGLTEISKTITALNRQNRIIVGQDRNEYNKVENNDERSLDNERTD
FT                   LHDGGRLQPSESETSTAAGSDVGQIRSDEERVSEGTSQSPLLQSPDEGRTDTALGGSGT
FT                   ESQQDGGNNPEADGTERGSDRTDESGGYDEMGSSDELPSQLGTGNRESGSDIRLEYYDR
FT                   THEDKSLPFFGRDEVINEILRTTPHLSASLEEIKDYYEHNPDNKDRTEYIKSIFNNDYT
FT                   ELTLEDGRTVGYKTFENVLHLWEGKYDSRTAQSFYDWAVIARHFEAMRLLGELSDSIKP
FT                   LPSMDGQMTFILDGRAEEKKTSAFVFSQEIIDAVLANGSGFSEGKMRIYEQFEKSLSAK
FT                   ENADFLKNEYGWGGSYPVIIGAGIDESHDGKGITITKGIGKENPHITLSWSQVEKRIGE
FT                   LIRMDRYLNPKEKERYPQWLESQEERRAKIEEMKRNREILSNAPPEQEVEPAEKEPEEA
FT                   EQPQDVQYEYHLGDKVYIGASEYEILSVDDERVMLYDYDMPLFNKEFSRTEFDRKVREN
FT                   PMNEHLIVKEEPAEERNETEEVQTNMGSMPIEDYREIVASQSGFDSYDEMYKQGYRIGN
FT                   GYDKEPESVVPAWEQKKKVKGFDLHPDVPMADRHTFNLRENEVETVGKKERFRRNIMAI
FT                   QLLKKCQEENRFATPEEQIVLSKYVGWGGLSEAFDENNSAWATEYLELSSVLTPGEYAS
FT                   ARESTLTAFYTPSEVITAIYKAMEQMGFKEGNLLEPSCGIGNFIGMLPDAMQDSKIYGV
FT                   ELDTISAGIAQQLYQKTTIAAQGFEETNLPDSFFDGVVGNVPFGDFKVSDKRYDKHLLI
FT                   RKTVLKIRRSSLKQRSRKSKSRLQRRKN"
FT   CDS             230446..230682
FT                   /transl_table=11
FT                   /locus_tag="CC1_02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79172"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4A1"
FT                   /protein_id="CBK79172.1"
FT                   /translation="MPFIAPELIIQAKQMDLLTYLKNYEPYELVKFSGNTYCTRTHDSL
FT                   KISNGKWIWWSRGIGGRSALDYLINGNAQSRGD"
FT   CDS             230654..231670
FT                   /transl_table=11
FT                   /locus_tag="CC1_02130"
FT                   /product="Type IV secretory pathway, VirD4 components"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79173"
FT                   /db_xref="GOA:D4J4A2"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4A2"
FT                   /protein_id="CBK79173.1"
FT                   /translation="MEMLRAGAIEDEDDPSPSPLDNLFSDLMIDNPDHIALKYYHSYHS
FT                   GSSKTLKSIQITLAARLEKFNLESLAALTSADELDLQSLGEKKVALFALIPDNDSSFNF
FT                   LVSILYTQLFQQLFYAADHIHGGCLPMPVHFMMDEFANVSLPDDFDKILSVMRSRGVSV
FT                   SIILQNLAQLKALFEKQWESIVGNCDEFLYLGGNEQSTHKYVSELLGKETIDTNTFGKS
FT                   TGRSGNYSTNYQISGRELLTPDEVRMLDNQYAILFIRGERPIMDFKYDIMKHPNVALTT
FT                   DGKASPYKHGEVTKDIASIAIWDIDPATLPEKEMEETNWELLSEEEMEALFINNQTN"
FT   CDS             231690..232052
FT                   /transl_table=11
FT                   /locus_tag="CC1_02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79174"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4A3"
FT                   /protein_id="CBK79174.1"
FT                   /translation="MTIFKKKATDIQETKKLPMTGKVKKGFRAYCTMVIVGALALGMTT
FT                   TAFAANDPLTVVNNLSDFIFGLIRAIGMILLGFGIVQVGLSLKSHDPSQRANGFLTLAG
FT                   GVIITFAKEILTLITG"
FT   CDS             232126..232368
FT                   /transl_table=11
FT                   /locus_tag="CC1_02150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79175"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4A4"
FT                   /protein_id="CBK79175.1"
FT                   /translation="MSDNWVVQNLENALETWNEKLSEIWTLITTTPQNFKGGNIWKVIV
FT                   DINGAVQAIGLALLVLFFVIGMVKTCGSFTDVNFC"
FT   CDS             232793..233833
FT                   /transl_table=11
FT                   /locus_tag="CC1_02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79176"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4A5"
FT                   /protein_id="CBK79176.1"
FT                   /translation="MQKLNMVDADTLLYQPLDKPRFVVDGLIPTGLILFCGSQKIGKSW
FT                   LMLKLCLCVSAGLPFWEMETRAGDVLYLCLEDTFFRIQDRLFRLTDEADSRLHFAVASC
FT                   KLTDGLIVQLEDYLKEYPDSRLIVIDTLQKVRTASKDNAYASDYGDISQIKEFADRHSL
FT                   AVIVVHHIRKQNDSDVFNKVSGTTGLTGSADATFVLEKETRASDTARLYCVGRDIEYQE
FT                   FVLRFRECSWEMVERKGQEQLARESIPPVLFRLVEFMQDKENWCGTATELLAAMKETDT
FT                   PPTVITKWLNEYRTTFLADNHIGYAYRRKKEGRLIALTKQPGDSDDGGDGDVGIPLASV
FT                   TDTTAK"
FT   CDS             234260..235225
FT                   /transl_table=11
FT                   /locus_tag="CC1_02170"
FT                   /product="Plasmid recombination enzyme."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79177"
FT                   /db_xref="GOA:D4J4A6"
FT                   /db_xref="InterPro:IPR001668"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4A6"
FT                   /protein_id="CBK79177.1"
FT                   /translation="MPYAILRFQKRKAGSVAACERHNERKKEAYKSNPDIDMECSKYNY
FT                   HLVPPPRYTYKKEINRMVQEAGCKVRKDSVMMVETLITASPEFMNSLPPEEQKAYFAMA
FT                   LDFIAERVGKQNILSAVVHMDEKTPHMHLCFVPITPEGKLSAKYFLGNQKSLSEWQTAY
FT                   HERMSARWNELERGQSSMITGRKHIPTWLFKLGGRLDKQYEEIVAALSDINAFNAGKKR
FT                   DKALSLLSAWLPEAEKFSREIGKQSAYIDSLKKKIGQESDYAGQLRDEKYAEELKVQKA
FT                   NQKIFELQRTNQQLERLLRKIPPEVLEELQKSNRNRSRER"
FT   CDS             236133..236357
FT                   /transl_table=11
FT                   /locus_tag="CC1_02190"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79178"
FT                   /db_xref="GOA:D4J4A7"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4A7"
FT                   /protein_id="CBK79178.1"
FT                   /translation="MKEIQYEIVKEIAVLSTSDSGYTKEINLIAWNGNEPKYDIRSFSP
FT                   AREKCGKGITLTRAEAEKLLAALKKELKQ"
FT   CDS             236380..236571
FT                   /transl_table=11
FT                   /locus_tag="CC1_02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79179"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4A8"
FT                   /protein_id="CBK79179.1"
FT                   /translation="MAKTAIRPKIIVQAAYTGGADMRELFISLLVNEVRRGKSSPRTFE
FT                   IFKLPQYNEGSTDTKEAS"
FT   CDS             236572..238260
FT                   /transl_table=11
FT                   /locus_tag="CC1_02210"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79180"
FT                   /db_xref="GOA:D4J4A9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025378"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4A9"
FT                   /protein_id="CBK79180.1"
FT                   /translation="MAMLRAALYCRLSKDDMLQGDSESIKTQKAMLTQYAKEHSFLVVE
FT                   IYVDDGYSGLNFDRPSFNRMLDDIEAGKIDVVITKDLSRLGRDHLKVGHFTEIYFPMKN
FT                   VRYIAVNDGVDTANKNNDIAALKNVMNEFYSRDNSRKIRSSIRARAKAGLYRSSFNPIG
FT                   YRKSPDNHNKLMVDEETAWIVKRIFELANAGMGTHKIAAVFREEQVPCPSWWLHSRGEK
FT                   DYSKRFENPENKYEWSHTVIRNIISNPLYLGHCVMCKTESIFKVNASKKVPKEDWITVK
FT                   NTHEPLVTQEVFDGANEKILSRRRDTADNFVSPFAGLVKCGTCGKALGLRYWTRKRHRI
FT                   YVCTTYAHDTKACTDHRIFYEDLYKAVLADIQYHARLAYEDREKAVALAVKMNAKADGS
FT                   KGKNNADRLKAAKKRYEEVTRLFDRLYEDSVSGRISHDNFNRLMDKYQTEQEQLLGQIQ
FT                   ALEAAMQEVKDNQQNAVRWAELMAQYVGIQELTAENLNLLVERIEVYDRTETNAGAEQM
FT                   IKICYRFGGYIGERVFSAKVLKHPCRKNACPLKERKGYGKISLVS"
FT   CDS             238235..238402
FT                   /transl_table=11
FT                   /locus_tag="CC1_02220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79181"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4B0"
FT                   /protein_id="CBK79181.1"
FT                   /translation="MGKYHLYLSEEERQLVLHALIDFRNKLLAAGRYTDCVGELLIKVM
FT                   YAKAKRVKIR"
FT   CDS             238417..238791
FT                   /transl_table=11
FT                   /locus_tag="CC1_02230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79182"
FT                   /db_xref="InterPro:IPR026989"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4B1"
FT                   /protein_id="CBK79182.1"
FT                   /translation="MTKSIFEQLGGTYEQQGDYLLPCLTVPAENEQPIGVWGQRHLRYL
FT                   KEYRRATYITLLTSGRLNAYLADIDKQAQERMERLTEQMKRAQGITEQLKAENALEWVQ
FT                   RMNNIRACAREIVEREIIYT"
FT   CDS             241463..241936
FT                   /transl_table=11
FT                   /locus_tag="CC1_02270"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79183"
FT                   /db_xref="GOA:D4J4B2"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4B2"
FT                   /protein_id="CBK79183.1"
FT                   /translation="MAIPKRSYWLREVVTEAGTSYHISFRDGQGKIQKLCVSYDFYMAF
FT                   RRLELDERKIEGWDYRHREFSEIMEETLNWRAVRQPKSIEEVILEEERAELLQRIISKL
FT                   PEMQRRRFLLHYEYEMTYKEIGKIEHCSQQSVGRAVTAAREKIKAEMKKYLNA"
FT   CDS             242685..243662
FT                   /transl_table=11
FT                   /locus_tag="CC1_02290"
FT                   /product="CHAP domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79184"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4B3"
FT                   /protein_id="CBK79184.1"
FT                   /translation="MIVVLFGAAVAMFGGGSDSNSYTPVSAEVEAYEPIIQKYAKEYGI
FT                   PEYVELIKAVMMQESGGRGLDPMQAAEGSFNTRYPHEPNGIKDPEYSIQCGVQELKAAL
FT                   TSAEVESPIDMEHIKLALQGYNFGNGYISWAKTKYGGYSYANAVEFSTQQAQRLGWDSY
FT                   GDTQYPAHVLRYYPYGRAFTAGGNQAIVEVALTQLGNQGGQPYWSWYGFNSRVEWCACF
FT                   VSWCADQCGYIESGLVPKFAGCVDGANWFKSNGKWQDRTYEPKVGDIIFFDWEGDGTTD
FT                   HVGIVEKCENGTVYTVEGNSGDACKQRQYAVGSSNIYGYGIPAY"
FT   CDS             complement(243727..244179)
FT                   /transl_table=11
FT                   /locus_tag="CC1_02300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79185"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4B4"
FT                   /protein_id="CBK79185.1"
FT                   /translation="MDEQKIIFSNRFEKEKFEDYKTDLGTDSSVTPDFTEADDFLKFIQ
FT                   KNRRSVPSKERIADKDKFIKTVYELSNSFEIDADLIEFAEGYIANIYVDYACYTGYIKK
FT                   LLAILFILADDISFLDGSKENADMLFSFTYHTHHIFLNNRETTDFS"
FT   CDS             244405..244668
FT                   /transl_table=11
FT                   /locus_tag="CC1_02310"
FT                   /product="Predicted transcriptional regulator with
FT                   C-terminal CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79186"
FT                   /db_xref="GOA:D4J4B5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4B5"
FT                   /protein_id="CBK79186.1"
FT                   /translation="MKLDTIGKNIRKFRLARKLRQEDLAEKTDLTTNYIGMVERGEKIP
FT                   SLETFIKIVNALGVSSDMVLTDVLETGYMKFRQQATQTMVGY"
FT   CDS             245278..245745
FT                   /transl_table=11
FT                   /locus_tag="CC1_02330"
FT                   /product="Domain of unknown function (DUF3387)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79187"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4B6"
FT                   /protein_id="CBK79187.1"
FT                   /translation="MELTKCKLGELITQRREKNDGSDLPICGVSKDGLIPPKQKDADTS
FT                   IYNVFYRDDFIFNPARMELNSIAINDMYDRAICSSLYEVFYVHRTDLLLPHYLELIIRQ
FT                   NSFKNMGIDYEEKAFYDILKAVSKKFEFEYPDDKMIELSKRIKLIVDDKSR"
FT   CDS             245729..246283
FT                   /transl_table=11
FT                   /locus_tag="CC1_02340"
FT                   /product="Restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79188"
FT                   /db_xref="GOA:D4J4B7"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4B7"
FT                   /protein_id="CBK79188.1"
FT                   /translation="MISHAKNKSKNKPVETLEVEDEENESTDDELLDDFKVKLQSAIAN
FT                   MSPAKFEQFSRALLTKMGVEFTNKGVQVSNDGGIDGYGYHVDADDFRTTRVVIQCKRFN
FT                   SNPVSEPDINQFLGAMNKYQADYGVFITNSRFTNKAREAAREGTPITLIDGNDLIRLVI
FT                   KYELYITPVTTYVLDGFYTED"
FT   CDS             246334..247026
FT                   /transl_table=11
FT                   /locus_tag="CC1_02350"
FT                   /product="Nucleotidyltransferase/DNA polymerase involved in
FT                   DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79189"
FT                   /db_xref="GOA:D4J4B8"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4B8"
FT                   /protein_id="CBK79189.1"
FT                   /translation="MMAKQKTYIAIDLKSFYASVECKERNRDPLTTNLVVADKSRTEKT
FT                   ICLAVSPSLKSYGIPGRPRLFEVVQKVKEANNNRRWKAPNRTFTGSSDDSTELNANPAL
FT                   EIDYIVAPPRMAYYLEYSTKIYSVYLKYIAPEDIFPYSIDEVFIDATNYLNTYQMTARE
FT                   LAMTMIQDVLKTTGITATAGIGTNMYLCKIAMDIVAKHIEPDKDGVRIAELDEMSYRRQ
FT                   LWNHRPLR"
FT   gap             247835..249136
FT                   /estimated_length=1302
FT   CDS             complement(249161..249637)
FT                   /transl_table=11
FT                   /locus_tag="CC1_02370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79190"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4B9"
FT                   /protein_id="CBK79190.1"
FT                   /translation="MANEDKKDFNAMLMDSKDMPKVQIITDEKSIEKYGGDKMYFAPPI
FT                   DYDKVMRLVPCGKLLTVGTIREFFAKQNGADFTEPITAGIFVSIVAWASYQRAEDKTPY
FT                   WRTLKAKGELNAKYPGGVEAQKEMLEKEGHIVIQKGKTNIKYYVKDYEKALFTL"
FT   CDS             complement(249758..250570)
FT                   /transl_table=11
FT                   /locus_tag="CC1_02380"
FT                   /product="Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79191"
FT                   /db_xref="GOA:D4J4C0"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4C0"
FT                   /protein_id="CBK79191.1"
FT                   /translation="MKEKTYQTRCGTIHYWTSISSLNAITLVFLPGLTADHRLFDKQIL
FT                   FFEKKYNIVVWDAPAHATSWPFRFDFDLFDKAKWLNEILNQEEINKPVIVGQSMGGYVG
FT                   QAYAQLYPNQLKGFVSIDSAPLQRKYVTAVEIWLLKRMEPVYAHYPWKWLLKSGTEGVA
FT                   TSVYGRNLMREMMQVYDGNQKRYAQIAGHGFRILAEAMEKNLPYELKCPALLICGTQDH
FT                   AGSCIRYNKAWHRNTKIPLTWIEGAGHNSNTDKPEQINSLIEEFVTNI"
FT   gap             250940..251727
FT                   /estimated_length=788
FT   CDS             251866..252579
FT                   /transl_table=11
FT                   /locus_tag="CC1_02400"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79192"
FT                   /db_xref="GOA:D4J4C1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4C1"
FT                   /protein_id="CBK79192.1"
FT                   /translation="MEMMLQTQNLCKYFRQQKAVNNVSLNIEKEQIYGLLGPNGAGKST
FT                   TLKMLTGMMKPTAGKIYFDGKLLDRKDLSKIGALIENPPIYENLSARENLKVRQLLLGT
FT                   DENRIDEVLQIVSLTNTGKKKAGQFSLGMKQRLGIAMALLGEPELLILDEPTNGLDPIG
FT                   IEELRELIRSFPEQGITVILSSHILSEVQLLADKVGIISGGILGYEGALKQGDNLEDLF
FT                   MNVVRKNQKAGEIHG"
FT   CDS             252572..253303
FT                   /transl_table=11
FT                   /locus_tag="CC1_02410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79193"
FT                   /db_xref="InterPro:IPR021205"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4C2"
FT                   /protein_id="CBK79193.1"
FT                   /translation="MVNIIKAEHQKAKRTMRKKFIWGFPLLTFVMAFIFTLGMTNAYAE
FT                   SVWNWWYTLLLPGMIALFCYLSVAQEKKIKYYHLMTIPTDRRKLLLGKIIYIGYMILFS
FT                   NVIVFAGATLGGFLLTTHVPVGGALIAVLFLTVSELWEIPVALFLSERFGMIVNLFVCL
FT                   FITVSGVVISQTRIWYVLVSAIPMRMMCPLLHVLPNGLAAEAGNPLLDTGVIVPGMCLS
FT                   IIWFVFVTVLFLKWFERREVK"
FT   CDS             253305..254045
FT                   /transl_table=11
FT                   /locus_tag="CC1_02420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79194"
FT                   /db_xref="InterPro:IPR022294"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4C3"
FT                   /protein_id="CBK79194.1"
FT                   /translation="MIGRALNADLRKMKGTSVILAHLLIPIITSVIFLIYYFFSPWNEN
FT                   MKVIAFYQAIGAGLPVLIGIFTASVMEQEQNAGDFQNLLSLPDKPAAFLSKLLMLLVLC
FT                   LCSILLTAIIFGIGFGRIASSDIEIMKGCIFAALLLWGSSVPLYLWQLILAFQFGKGVS
FT                   IGAGIISGLISALMLTGLGDYVWKYVFVCWTGRVPYTYLQSVLGETSVGEWLSFIPGCL
FT                   IFTGISMVYYFWWVNHWEGNRISE"
FT   CDS             254060..254722
FT                   /transl_table=11
FT                   /locus_tag="CC1_02430"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79195"
FT                   /db_xref="GOA:D4J4C4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4C4"
FT                   /protein_id="CBK79195.1"
FT                   /translation="MAKILAVDDEPAILEMIESILNKDGHLVTKVSNPLKINMEELHRY
FT                   DLILLDIMMPGIDGFELCKRIRALVDCPILFLTAKTEENSLVNGLSLGADDYISKPFGV
FT                   MELRARINAHLRREHREHSVRMVLGRVCIQMSQKKLLMDDKELPFTKAEYEICEFLAKN
FT                   RGQVFSKEQILEAVFGFDNESNDSTIITHIKNIRAKFADYDYMPIKTVWGIGYKWEE"
FT   CDS             254710..256086
FT                   /transl_table=11
FT                   /locus_tag="CC1_02440"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79196"
FT                   /db_xref="GOA:D4J4C5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008358"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4C5"
FT                   /protein_id="CBK79196.1"
FT                   /translation="MGRVKRSNALSRIFMRYVLVMLGSLVGLVIVAWLLLCLLISVGCI
FT                   YPANYAEQKINEAYDTILRADKVTAEMIPALCDYVIFSENGEKIGGDLSEQYEQIAWNV
FT                   AKYGNASGKYFYKVIVRENEYVVLQYRLTPQYHSAFLREHFIEPQNVMSIMSVIGAVAI
FT                   IIIPSIRFGKRIKKQMQPVLDAIGQIKDQNLEYETSCSGIKEFDDCLSAIDDMRDALRE
FT                   SLEKQWKTEQEKKQQMSALAHDIKTPLTIVRGNAELLSETELTTEQKKNIIYVLNGTTQ
FT                   IQSYVKQLIDVTKSWNCSDVTYTTVRLEDFFADIKEQALGLAETCHQKINWKAEQCDKK
FT                   VTIAYDPMFRAVMNVIQNAVEHTKENGIIYIGAKEQDGQLTFIVENSGSGFTKEALLHG
FT                   TEQFFMDDTSRNGEAHYGIGLFFAKSVAEKYGGGIKLSNSENTGGARVEIFFLSSQETS
FT                   "
FT   CDS             256211..256366
FT                   /transl_table=11
FT                   /locus_tag="CC1_02450"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79197"
FT                   /db_xref="GOA:D4J4C6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4C6"
FT                   /protein_id="CBK79197.1"
FT                   /translation="MIADKIKNARTIKKLTQEQVAEDLNVSRQTISNWENGKSLLDIVS
FT                   IISLMK"
FT   gap             256457..257189
FT                   /estimated_length=733
FT   CDS             complement(257200..257430)
FT                   /transl_table=11
FT                   /locus_tag="CC1_02460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79198"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4C7"
FT                   /protein_id="CBK79198.1"
FT                   /translation="MLRKLNCFLNIVIGSFIGVFIGFGIYKFWHFKTYPNLYAMQSAPW
FT                   YTELLLDGALVAVLVVVCIILKLIIWRKLKP"
FT   CDS             258074..259006
FT                   /transl_table=11
FT                   /locus_tag="CC1_02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79199"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4C8"
FT                   /protein_id="CBK79199.1"
FT                   /translation="MLTSVFGISIKYEAWNHQDSLPVYIAGSYDFHTAYIGNRRCIMLA
FT                   PTEELATLPALKKQITKIQQIDNVPVVFELATVSNYRRKSLIENNIPFITDKQVFLPFI
FT                   GTMLSDEKEPQKLTGKFVYSTQQLFLFYLYSKKKRLYISEAGKVLPFTAMTLTRAVKQL
FT                   EATDLFLVAKDGVNKFIESKYKRDELFEKAKVYLTTPVRKTGYIDKTQVTENMVFAGET
FT                   ALSEKTMLNPSRVVTYAISEKDYDKTLLTDELIDPDKQIRLELWAYNPKQFSEDNSADD
FT                   ISIVLSFADTNDERIEEAVDELQERRLKE"
FT   CDS             259006..259773
FT                   /transl_table=11
FT                   /locus_tag="CC1_02490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79200"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4C9"
FT                   /protein_id="CBK79200.1"
FT                   /translation="MVSGFTKFKERFQGFENQYVIIGGTACDLIMENEELPFRATKDVD
FT                   IVLIVESITAEFGRQFWEYVKEAGYEHLNKSTGNAQFYRFTSPKSKEYPYMIEIFSRNP
FT                   DFIILEDDAVLTPLPIDNEISSLSAILLNEAYYELLKTGQMKVEGIPVLSPTCLIPFKA
FT                   KAWLDLKERKLNGEQVDSKNIKKHKNDVFRLAQLITVNTRQVLSSEIAEDMKKFLSEIA
FT                   DETVDLKSLGIRGTDKQKIIDMLYLCYNLNDNT"
FT   CDS             259861..260298
FT                   /transl_table=11
FT                   /locus_tag="CC1_02500"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79201"
FT                   /db_xref="GOA:D4J4D0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4D0"
FT                   /protein_id="CBK79201.1"
FT                   /translation="MEMNGGFLVTKIKQLGDRIFEKILSEKNIDAFNGAQGRILYVLWQ
FT                   KDGISIRSLSTKCGLAITSLTTMLERMENQGLISRVQSETDKRKTLLFLTEKAHALKGE
FT                   YDSVSDEMGSIYYKGFSEEEITRFEECLDRIRKNLEEWQKS"
FT   CDS             260295..260984
FT                   /transl_table=11
FT                   /locus_tag="CC1_02510"
FT                   /product="Bacteriophage protein gp37"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79202"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4D1"
FT                   /protein_id="CBK79202.1"
FT                   /translation="MSICIKDQIQNMNIVIGCTVGCTYCYARNNVKRWHMIDDFADPEF
FT                   FPGKLKMMEKKRPQNFLLTGMSDLFGWKPEWRDEVFTKIRENPQHQFLFLTKRPDLLDF
FT                   DTDLENAWFGVTVTRKAERWRIDALRKNVRAKHYHVTFEPLFDDPGTVDLSGINWIVVG
FT                   TMTGAQSRKIHTEPEWAWSLTDQAHKLGIPVFMKEDLVPIIGDENMIQEMPEEFNKVLE
FT                   VQKSWKK"
FT   CDS             260972..261880
FT                   /transl_table=11
FT                   /locus_tag="CC1_02520"
FT                   /product="DNA repair photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79203"
FT                   /db_xref="GOA:D4J4D2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4D2"
FT                   /protein_id="CBK79203.1"
FT                   /translation="MEEVINGILIREVETKNIMTKSSLPVGGYSVNPYVGCTHACKYCY
FT                   ASFMKRFTGHKEEWGTFLDVKHWPEIKNPKKYAGQRVVIGSVTDGYNPQEEQFGNTRKL
FT                   LEQLIGSDADILICTKSDLVVRDIDLLKKLGRVTVSWSINTLDENFKNDMDSASSIEHR
FT                   IAAMKQVYEAGIRTVCFVSPVFPGITNFEAIFERVKDQCDLFWLENLNLRGGFKKTIMD
FT                   YIAGKYPDLVPLYDEIYNKHNRSYFEALEVKAEKMAKKYDCAFVDNEMPYGRVPQGHPV
FT                   IVDYFYHEEIRGTENTGKRNR"
FT   gap             262014..262849
FT                   /estimated_length=836
FT   CDS             262918..263520
FT                   /transl_table=11
FT                   /locus_tag="CC1_02530"
FT                   /product="Peptidase E"
FT                   /EC_number="3.4.13.21"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79204"
FT                   /db_xref="GOA:D4J4D3"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4D3"
FT                   /protein_id="CBK79204.1"
FT                   /translation="MKLFLCSHFSSVGSLIKEEIENKKVAFIPTASLREGYTGYVGSAR
FT                   KLFKKLGAIVTEIDISTEAYSTIQSVFEEADVIYFTGGNSFFLMDQLRKTGTDGLLKKE
FT                   LANGKLMIGESAGAIICAPSIQYIEQMDEKPEDYSQEDDAGIDLIDFYVLPHYLTAPFK
FT                   KVTEKIMTEFSDLNLCPINNRQGIVIDGEDSKVICKD"
FT   CDS             263593..263916
FT                   /transl_table=11
FT                   /locus_tag="CC1_02540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79205"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4D4"
FT                   /protein_id="CBK79205.1"
FT                   /translation="MKIEGNQKELDAMVEFHKGNRVEGLRLQEEFAAEFRKEYKDKDHC
FT                   PCLKACRYHGNCKECVAIHRAHQEHVPNCMRPLINKKLKLMSELTEHTLANEIEAPHEI
FT                   LRK"
FT   CDS             264188..264748
FT                   /transl_table=11
FT                   /locus_tag="CC1_02560"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79206"
FT                   /db_xref="GOA:D4J4D5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4D5"
FT                   /protein_id="CBK79206.1"
FT                   /translation="MEHGASSVVGVDISHKMLEVAKEKTHFPQVEYKCCAIEDVEFPEE
FT                   SFDVILSSLAFHYVADYEILVKKIYRILKSGGKLVFTVEHPVFTAYGTQDWYYNEKGEI
FT                   LHFPVDNYYYEGKRTAVFLGEKVTKYHRTLTTYLNTLLSNGFIINHIVEPQPPEYMMDI
FT                   PGMQDEMRRPMMLIVSANKKVDR"
FT   CDS             264786..265280
FT                   /transl_table=11
FT                   /locus_tag="CC1_02570"
FT                   /product="metal dependent phosphohydrolase"
FT                   /function="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79207"
FT                   /db_xref="GOA:D4J4D6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4D6"
FT                   /protein_id="CBK79207.1"
FT                   /translation="MFKEKIIIEMKEVFKEIPFGIEHTLKVLKNAEDIMKGENIGEEEK
FT                   EFISIIAILHDIGAVEAQKKYGSIDGVYQEEEGPEVAKEILKKVGYNKNIDRICFIIGN
FT                   HHTPSKINGFDFQIQWEADLLENLTVMDKEKEQEKIKKCIDENFKTNTGKRIAYNRFIL
FT                   D"
FT   CDS             265503..265709
FT                   /transl_table=11
FT                   /locus_tag="CC1_02580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79208"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4D7"
FT                   /protein_id="CBK79208.1"
FT                   /translation="MAKEISSSLFHICVSSNNCRDLVSYMHQTYEYDGQKYHDVTYLGE
FT                   FEDDEGSHNDLELLDYRLRHFKK"
FT   CDS             266074..267267
FT                   /transl_table=11
FT                   /locus_tag="CC1_02590"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79209"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4D8"
FT                   /protein_id="CBK79209.1"
FT                   /translation="MQLIVRKEYLNELIELYGTPDIKVITGIRRSGKSVLLQEFVSYLK
FT                   SLEEAVNIVMINLQELEFDHLLEYHALHKYILDQYKEGMTNVLLIDEVQLCPQFELAIN
FT                   SIYTKGIYDIYITGSNAFLLSSDLATLFTGRTMEIKVYPFSFAEYLTYYGITDRYDEAF
FT                   DQYVRTGGMPGSYVYKTEDRQYDYVRDVYSTILIRDLVEKYKIRNKSEFTNISEFMMDN
FT                   IGNLLSPNNISKTLKNDQSEITRKTVSKYIGYLENAFLFYEAKRYDLKGKKYLANNSKY
FT                   YLCDTSFRYAVNGTRNMDFGRVYENIVYLELRRRGYEVYVGKLYKKEVDFVAKKREAQI
FT                   YIQVSDNISDEKTFEREYSPLLAIRDAYPKMIIARTHHETYDYKGVQVVDICRWLRG"
FT   CDS             267352..268041
FT                   /transl_table=11
FT                   /locus_tag="CC1_02600"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79210"
FT                   /db_xref="GOA:D4J4D9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4D9"
FT                   /protein_id="CBK79210.1"
FT                   /translation="MPGILVVEDDENLNRGITFSLKKSGYEVFSAESVKKAKRIASDNN
FT                   VDVTICDVNLPDGNGLEFVRWMRCNYNTYIICLTALDQEMDQVMGYEAGADDYITKPFS
FT                   LSVLLLKIEAHFRRRQEKTEAGKMISGDIVFIAGEMKVLIKSREISLTKTELKMLTFFL
FT                   QNPKQILSKTQILENVFDLEGDFVDENTIAVNIRRLREKIEDNPAAPVYIKNIRGLGYI
FT                   WNQEVRQ"
FT   CDS             269396..270070
FT                   /transl_table=11
FT                   /locus_tag="CC1_02620"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79211"
FT                   /db_xref="GOA:D4J4E0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4E0"
FT                   /protein_id="CBK79211.1"
FT                   /translation="MSVILETKQLCKFYGAGENQVKAVNQVDIQIERGEFVAIVGKSGS
FT                   GKSTLLHMLGGLDTPTKGRVTLAGKDLYRMKEDALAVFRRRKIGFVFQAFNLVSSVNVW
FT                   ENIVLPLGLDGRKVDEAYVNDIIATLGIENRICNLPNQLSGGQQQRVAIARALVNRPEI
FT                   IFADEPTGNLDSKTSDEVIALLKMTAKKYGQTIVMITHDDEIAQVADRILVIEDGQVVD
FT                   FN"
FT   gap             270984..271397
FT                   /estimated_length=414
FT   CDS             272976..273122
FT                   /transl_table=11
FT                   /locus_tag="CC1_02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79212"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4E1"
FT                   /protein_id="CBK79212.1"
FT                   /translation="MKGIKIELLGIAIISLGIAVTTNNFWGYVLGALGFGVAVIDCFLK
FT                   DNH"
FT   gap             273381..273994
FT                   /estimated_length=614
FT   CDS             274253..274612
FT                   /transl_table=11
FT                   /locus_tag="CC1_02670"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /function="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79213"
FT                   /db_xref="GOA:D4J4E2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4E2"
FT                   /protein_id="CBK79213.1"
FT                   /translation="MSKTSYICNCDVIHEDIVNDVKSKMQPKDDYIQLASLFKLFGDGT
FT                   RVQILHALEQSEMCVCDLAVLLGVTKSAISHQLKALRLANLVKFRKEAQIVYYSLADDH
FT                   VKEIIDKGFEHLWQK"
FT   CDS             274672..276795
FT                   /transl_table=11
FT                   /locus_tag="CC1_02680"
FT                   /product="heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79214"
FT                   /db_xref="GOA:D4J4E3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4E3"
FT                   /protein_id="CBK79214.1"
FT                   /translation="MKRIFLLKGLDCPNCSAKIEKEIGELDGVQSSVVNLMKQTLTINV
FT                   TQTSADTIASQIETIVHSHEPDVEVSEIVQESYIPEKKQEANESYNNEDKKLTVRFAIG
FT                   AAIYAIGMALTVFAKVPLPIELAFLIVSYVILGGDVVWQAVRNISKGRVFDEHFLMSVS
FT                   TIGAFVIGEYPEAVAVMLFYQVGEFFQSLAVKRSRKSISDLMDIRPDSATVRRNGELIT
FT                   ISPENVSIGEIIIVKPGEKIPLDGVVLDGDSMLDTRALTGESVPRSVHKGDEALSGCMN
FT                   QTGVLMIKTTKAFGESTASKIIDLVENASSRKAPTENFITTFARYYTPVVVTLAAFLAI
FT                   LPPIILGGGWTEWIRRGFVFLVVSCPCALVISIPLTFFGGIGAASKRGVLVKGSNYLEA
FT                   LNNVSVIVFDKTGTLTKGVFNVTDILPANGFSKEQVLEYAAEAESFSNHPIAKSILAAY
FT                   GKEMDQSVISDYKEISGYGISVMAGEKKVFAGNTKLMDTECIEYTTGEKAGTKVYLAVD
FT                   GQYVGCILITDEVKPDSKKAISDLKHIGVEKTVMLTGDDEKIGKSVAEELQLDEYYAQL
FT                   LPDQKVEKVELLDGKKRPGSKLAFVGDGINDAPVLARADVGIAMGGLGSDAAIEAADVV
FT                   LMTDEPSKLVDAIEVAKATKQIVMQNIVIALGIKSVFLILGALGIAGMWEAVFGDVGVT
FT                   IIAVLNAMRILKK"
FT   CDS             277341..277880
FT                   /transl_table=11
FT                   /locus_tag="CC1_02700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79215"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4E4"
FT                   /protein_id="CBK79215.1"
FT                   /translation="MRKWNTILSVLMLLIFMIHGIMGSFMLNGVGSSAGKLLAWIGVGI
FT                   LVVHTVIGVILTVQSLQTAKQSGKMYLKQNVIFWARRASGMAILILLLFHIGLFGKVQN
FT                   GTYILFPFTTVKMVTQLLFVAAIFVHIFINIRPLLVSLGIISYKERRSDIYLILSVLLL
FT                   FIAGAVIFYYIGWQYL"
FT   CDS             277877..279421
FT                   /transl_table=11
FT                   /locus_tag="CC1_02710"
FT                   /product="Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79216"
FT                   /db_xref="GOA:D4J4E5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4E5"
FT                   /protein_id="CBK79216.1"
FT                   /translation="MSKTIIIIGAGLAGLSAALQAAENGCNVKLVSSLPSERAQSVMAE
FT                   GGINAALNTKDENDSPEEHFTDTIKAACGLADPNAVWGMTQAAPELVHWLLKLGVKFNM
FT                   SGYDDVDLRNFGGQKKKRTAFAQSDTGKQIMTAMIDAVRRKEASGMVERFSHHSFLTLR
FT                   LCGNICCGCVIRDEYSQETVELPGDAVIVATGGMHGLFGNTTGSLSNTGEVTAELFRLG
FT                   VPLANGEMIQYHPTTVKCGGKRMLISEAARGEGGRLFAMKDGKQWYFMEEKYPELGNLM
FT                   PRDITAREIWKVSHESEVFLDMTEISEEIISNKLSGLADDCMTYLHKDIRKEPVSVLPG
FT                   IHYFMGGILVDEQHRTPIQNLYAAGECCAQYHGANRLGGNSLLGALYGGRVAAKSACEQ
FT                   ADVVELSCATQIDVPPASQISEIKQLNKVMQETMGVVRNENTLLNGIQTVQALTGNLPL
FT                   LGMAVLKSALARKESRGAHWREDYPKSNDDDYLKTTVARFNGKQIQISFVPVPERR"
FT   CDS             complement(280440..280709)
FT                   /transl_table=11
FT                   /locus_tag="CC1_02730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79217"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4E6"
FT                   /protein_id="CBK79217.1"
FT                   /translation="MRTIFAEYNPNRNSIDVYTSVGYMLRIDCWEAEKDLKTTSGSDCA
FT                   LNALAIDDPLEYARLYLDGNLQMWVDAEDSLDIFLNFKQIQQFK"
FT   gap             280971..281875
FT                   /estimated_length=905
FT   CDS             282003..282632
FT                   /transl_table=11
FT                   /locus_tag="CC1_02740"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79218"
FT                   /db_xref="GOA:D4J4E7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4E7"
FT                   /protein_id="CBK79218.1"
FT                   /translation="MIASGILYALETEGYETNHATGIKDAGSLIEHYNFDLAIIDMQLP
FT                   DGTGFDVSEIFKNNATSVIFLTVVDDENTIVRAFDEGAQDYIVKPFRIRELLARVRRIL
FT                   SVNIKNGEKDNIIYMGHAAIHTDEAKVYVNDKIIELTALEYRLLLIFASNKGILLTRQQ
FT                   ILDKIWDADGNFVEDNTLTVYVKRLREKLGEAIHIETVRGMGYRVD"
FT   CDS             283546..284226
FT                   /transl_table=11
FT                   /locus_tag="CC1_02760"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79219"
FT                   /db_xref="GOA:D4J4E8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4E8"
FT                   /protein_id="CBK79219.1"
FT                   /translation="MAVLEVKELTKKYGEGESEVIALDHVSFSVERGEFVAIIGASGSG
FT                   KSTLMNMIGGIDYPTSGSIIIDGNEIQAMSEDELAIFRRRNLGIVYQFYNLIPTLTAEE
FT                   NIALPWKLDGRKENKERLSEIVNMLGLEKRAKHLPGQMSGGQQQRVSIGRALINEPAFI
FT                   LADEPTGNLDSKTSREILDILKFTNQKYKQTILLVTHDEKIALQANRIITIGDGKIIKD
FT                   EVMK"
FT   CDS             284226..286214
FT                   /transl_table=11
FT                   /locus_tag="CC1_02770"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79220"
FT                   /db_xref="GOA:D4J4E9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4E9"
FT                   /protein_id="CBK79220.1"
FT                   /translation="MKITAQLALSQMKVNKKRTIAGIFAIALATSLITTVMCFVTSANK
FT                   MLTDFLGSDYGEYGGAYSLMLAIPALLLGLLIAAMSITVISNIFSASANKRIQEFGILK
FT                   CVGATGRQIRASVIYESLWLSLTAIPLGLIAGTILGYISVKFTGHFISDINDAAKEIIM
FT                   RPFTFSLPFHISVWTYLFAGVFSFCIVLFSAYRPAKKVGKFTAIQCVKGIGAGTVLKEI
FT                   QVKDSFIQKIFGCESAIAYKNMKRNRYGYKATIRALSLGILLFLLTGGLSGQAKEFQEW
FT                   MTPKSKEMMVDYSSNYDIEVNAKTGKEERKISRPVTSDQYNEITQKLEKYGIDVYGVGA
FT                   DTFTYNALLDKNTLTEDMLQVPKFSDDNGETRTEIVSVDDELYKKLCDRAGAEYGSILL
FT                   LNTYQYNDNGEYTSIKPFKDDVTQISLINAANEKNTLTIGGILEQSDLKEYGFGEETPY
FT                   PVRIVVPDADARYFDWFSMPSDEDDYTEYARSVMDEYFPIVAEDSYVEQGYTVRIARTD
FT                   AMIKMLNIAIVLAEIVMYGFVILLLLMGFTSVISTLTTNIRIRSREFAVLKSVGMTNKS
FT                   LCRMLYSESIFCVLNALVPGVILGIAIPFLINLSIRKAFPVLYHIPWAALFGGIFVLIG
FT                   IVFFITRTEIHKLRDKSIIDEIRMDIV"
FT   CDS             complement(286578..286835)
FT                   /transl_table=11
FT                   /locus_tag="CC1_02780"
FT                   /product="Phage integrase, N-terminal SAM-like domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79221"
FT                   /db_xref="GOA:D4J4F0"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4F0"
FT                   /protein_id="CBK79221.1"
FT                   /translation="MYEKYFNKLREECLIRNRSSRTADTYINNIRHFMKWTGYKSMEDL
FT                   SLQDARSFILEKRNSGLSSATCNFYNSSICFLYKHILHIP"
FT   CDS             288678..289928
FT                   /transl_table=11
FT                   /locus_tag="CC1_02800"
FT                   /product="Hemolysins and related proteins containing CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79222"
FT                   /db_xref="GOA:D4J4F1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4F1"
FT                   /protein_id="CBK79222.1"
FT                   /translation="MNYFGSIFAMVVCIAMSAYFSATETAFSSLNKTRLKVLADNGNKR
FT                   AALALKLSEDYNKLITTILIGNNIVNIMVASIGTLLFVELYGDIGATVSTVVVTIVVLI
FT                   FGEITPKSVAKDTPERFALFSAPFIRLWICVLMPLNFLFSQWKKLVSRFFKTDDDAKMS
FT                   HEELLLFMEDMEQDGGIDENEGELLRNALEFRDLTAAEILTHRIDLEAVEIDESHEKIA
FT                   RAFTQSRCSRLLVYRDTIDQIVGVLHQKDFYINGKMTDQPITEIMTEPLFVYQHTKIRD
FT                   ILKMLQHQKSHVAVVVDDFGGTLGIVTMEDILEELVGEIWDEHDEVEEDFEKLDENTYR
FT                   VDCSVSLEDFMEFFDVRLESDSVSVGGWVMEQLNRVPARGDFFAVQNLEITVSDLSAYR
FT                   VSFITVRQCDVCLDCAQ"
FT   CDS             290051..291235
FT                   /transl_table=11
FT                   /locus_tag="CC1_02810"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79223"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4F2"
FT                   /protein_id="CBK79223.1"
FT                   /translation="MEKKSQNPSGNKNETPAPQGTKWPDEAIIRYIIRAFLLLIVFAWA
FT                   LVNLDAVLRFLGKVLELFNPFLIGGVIAFLINVVLRPLECCWNRVCRKAPAKLTRPVCL
FT                   TASTVLVLGILFAVVFMMIPSLRESVDEFIQNIPVYVEGIGRWGDGVAQFAAKYNIVLP
FT                   EYAIDSDLLIEKVTALISDEESGILTVTWGAAASVLSVLVEVLLGLVFALYLLAKKEVV
FT                   AAHLKKFVVTVLPQKKAQCLLSIASLTNQTFTNFVSGQLTEAVIIGVLCFFGMLILGLP
FT                   YAGAISAFVAVTALVPIFGAWIGGGLGAFLILLAEPGKALWFILFLLVLQQVEGNLIYP
FT                   KVVGKSVGLPGMLVLMAVTIGGEAFGILGMLFSVPVCAVLFSLYLEFMKKAGTL"
FT   CDS             291550..292119
FT                   /transl_table=11
FT                   /locus_tag="CC1_02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79224"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4F3"
FT                   /protein_id="CBK79224.1"
FT                   /translation="MWQIVLGSLGFLLYFIYDINSIRKKNVIFQKFFAVGTVFVVVSLL
FT                   MELLLLWGQCQHRIGRMIGFGTGAVGFFALLIYTLFFALPFEETYCEDNKLRAAYTEGM
FT                   YGVCRHPGVLWFAGAYLCMWGMFGGWKQGIYFLLMIFWNYLYIIFQDLWTFPQTFFNYK
FT                   EYQKNTPFLIPNRDSIRVCLYSIRKQ"
FT   CDS             292140..293759
FT                   /transl_table=11
FT                   /locus_tag="CC1_02830"
FT                   /product="GH3 auxin-responsive promoter."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79225"
FT                   /db_xref="InterPro:IPR004993"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4F4"
FT                   /protein_id="CBK79225.1"
FT                   /translation="MNLEEKLKKQQYKEIWQQYCGFLDLSMDGYMKIQRRLMEEQIRLW
FT                   SNCGLGQSILKGKYPKNLDEFRKMVPLTTYEDYADVLLSKQPDMLPGNPVIWIQTTWEG
FT                   GKHPIKVAPYTRSMLDTYRNNVTACLILSTSKEKGSFDVAATDKFLYALAPLPFATGLF
FT                   PLALGEEINIEFLPAVKDAVNMSFSERNKLGFKMAMKKDLGFFFGLGSVAYAVSLSLSS
FT                   MTSGGGGIKLSELMKCKAHMILRLLQAKHRCKKENRPLLPKDLFHLKGFMVAGTDNLCY
FT                   KDDLEALWGIRPMELFAGTEPSIMGTETWTRKGMYFFPDTAFYEFITEKDMMKNHEDPS
FT                   YIPPTYLMDEVRPGEKYELVFTILKGGAFARYRCGDMYRCVGLENRDDETRIPRFEYVD
FT                   RVPWIIDIAGFTRISENGIRSVIGLSKLPITNWVATKEYNEHNRPYLHMYVELERDAML
FT                   NTAMSATILKDLLSTYFKYIDQDYRDLKKILGMDPLQVTIFTCGTFAAYEKKTGKKIHQ
FT                   MSPSHYDLKELLDVQECLNRVR"
FT   CDS             293792..296323
FT                   /transl_table=11
FT                   /locus_tag="CC1_02840"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /function="diguanylate cyclase with GAF sensor"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79226"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4F5"
FT                   /protein_id="CBK79226.1"
FT                   /translation="MGTYGYISIIAMLCYGFMLLMFLAAKRNKIINSFLVVLLGLLFWT
FT                   GGSAFMRAQFWPGCEFWFQVSLLGILLLPYAYCRFILAFGGKKNGAPGKIYLAVMLLCF
FT                   WLNVQYGIFLESPNVVDKNGISTFVYEIKPAIVVFFIPAGIFLLYLFKVLVRICNENPN
FT                   IKVQYEPVMLGVLALFLGNAFLGIPLFSGFPIDILSGVVNVFLLFYALIRRRLFRLQML
FT                   ASTSLCYGVGFLFSILVFLNIVPSLQKIFHIQLDKNMTVYTLIFSIVFLAIYTFFTFLW
FT                   RLLIRSVFIREENHQAEKIREFNSAISKTLDLQEILDRTIRVMKELMDVGNIYICMQNV
FT                   PGEPYRGVASDQPLSDLAFALEEENPMIQWLKEHEEPIVYKDFRYSVEYKSMWEEEKHQ
FT                   LDKHHTRYCVGLKDGDNLVGVVLITDSSAKKRVVYDEVELISNITSVASIAIKNARLYE
FT                   NACLEARTDEMTGLLNRKYFYEVLNEEFEKNKEASLALAIINVDDFKLYNQLYGVKEGD
FT                   LCLQRIAGIIKSSVGDSGYTARYGGKEFAVLLPRYDLFSARNLVESISKQIFVMNNRRT
FT                   DMKLKAVTVSAGISAAPYAAKNVKELMENVDLAVYHVKHSGKNGIQVFDTMFRNNKNEN
FT                   TTSREHIYREYESTIYALTAAIDAKDHYTFSHSTNVAYYATALATTLGMNEDMVEIIRQ
FT                   AALLHDVGKIGIPEYILNKAERLTDEEYETIKGHVEASIDIIRHLPSLDYVIPAVIGHH
FT                   ERYDGKGYPRRIAGEDIPLTARILCVADSFDAMTSKRCYKKAFPLDVAREKLLQDAGKQ
FT                   FDPNLVVRFVECLDNGTISLVKAETDENMPY"
FT   CDS             complement(297692..299638)
FT                   /transl_table=11
FT                   /locus_tag="CC1_02860"
FT                   /product="NADH:flavin oxidoreductases, Old Yellow Enzyme
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79227"
FT                   /db_xref="GOA:D4J4F6"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4F6"
FT                   /protein_id="CBK79227.1"
FT                   /translation="MNQYYPHLFEPFTIKKTTFRNHIFSAPNMMCHMDANGFPTDYMIA
FT                   YYAEKAKGGAAVVTVGDTPVDHEHAPSNPRSFNLSYEALPFISELAMAIKSHGALASLE
FT                   LNHGGLYNPPEAMGGRNPIGPVSFVRSWDGVEVIGMDEAMMNTVADHFADAAELLKIAG
FT                   FDMCLLHGGHGWLLDQFISPLFNTRTDEYGGPLENRAKFPLMVIDRVRERVGDDFLIEY
FT                   RMSGSEEIEGGLTAEEAIEFAKMIDGKVDIIHVSAALDTEEAQAVHTHPTIFLPHGVNV
FT                   HYAAEIKKHVKSPVVTIGSISDPEMAEQILAEGRADIIGMTRALIADPYWPEKARLGQS
FT                   ADINPCLRCLDCLTGMHTGQHFQCAVNPWTGREFRMRNYVQPAKEKKNVLIIGGGPGGM
FT                   KAAITAASRGHKVTLAEKTDTLGGLLKFTDYDSLKVDLMRYKNHLIHMTQSMPIEIEYN
FT                   TEVTSEYVAKKQPDAIIIATGSTPITPRIPGIDLPSVKHATTVYTDLSIVGDSVVVIGG
FT                   GLVGCETGLFLAELGKAVTIVEMQDEIAPEANWMHKEGMMQAFAKQNITTVTGRKVVSI
FT                   SENGVTVADKNNETTVIASDSVVYAIGMRPNNHLVDELRDSAPFVRAVGDCVRARKVSP
FT                   AIYEAYYAAVDLA"
FT   CDS             300952..301968
FT                   /transl_table=11
FT                   /locus_tag="CC1_02880"
FT                   /product="Prolyl oligopeptidase family."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4F7"
FT                   /protein_id="CBK79228.1"
FT                   /translation="MKGRKIKKECNLRQIGNMALIVGVFAIFLVGICFVRFSKAYVNAF
FT                   IGNYTGIEEVLATMKGGAATDAAKRELLACQNDYDAWKEQHQGERVTLQTEDNIRLSGL
FT                   LYDQGGKETVVYLHNIGSAAGEDFYYAPWYWEKGYNILMPDNRAHGESEGNCVSYGVYE
FT                   TEDVNQWLQLICEKYGDDSQIIVHGDTLGAAAALMASANYPEQVAFTVAESPVANLYDA
FT                   AAYMMKNQFSSIPFFLWIGDWYCNKAYGFHLKDVDMCDAVQQSDTPLLILSGLEDTVVD
FT                   PENAVAIQAASGADCQIFGIEDGTHGLLYAKHSDEIKQSIDRFIGEYINNQQQLVVK"
FT   CDS             302792..303457
FT                   /transl_table=11
FT                   /locus_tag="CC1_02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79229"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4F8"
FT                   /protein_id="CBK79229.1"
FT                   /translation="MTEEKMRQQLEQKLCKLEAQEACRNLMGRYSYYRTAFQNKEMVEL
FT                   WAKRDDAKLVTPWGSYQGHSGIEACYLKDIGDRSDAKVFEAIKGAVIMHEVDTEVIEVA
FT                   EDLKTAKAVFLSQGHDTYVDRTDNETVHAKWAWEKYSVDFIMEDGEWKIWHMTIYPLFQ
FT                   SEYGEGWADNPTYVSEAFAFPNAGPEKTNWHYDRNELYPANEPAIPEPYVTYEKSSAK"
FT   CDS             303478..304128
FT                   /transl_table=11
FT                   /locus_tag="CC1_02910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79230"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4F9"
FT                   /protein_id="CBK79230.1"
FT                   /translation="MNDYEALLHQAKRLEALQEIRNLMGRYSYLHSAFRNKEYAELWAK
FT                   RDDDRLVMPFGKFVGWEAVRHCYVDLHGDRSNPADLDELRGLMMIHLMNTEIIEVAADG
FT                   KTAKGVWLSPGTETAPQTGKEKGAWCWGKYEVEFIKEDGIWKFWHMILYPLFLSPYNRS
FT                   WGQPAPEKMLGQIQLEDPMCQPLDAPMWEYGPDAEYPYDEPAMPDPYDHYKGL"
FT   CDS             304176..305507
FT                   /transl_table=11
FT                   /locus_tag="CC1_02920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79231"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4G0"
FT                   /protein_id="CBK79231.1"
FT                   /translation="MLTSIPVSTAILVVSIVLFVVMCYKGVHTATAALIASAIMAFGTT
FT                   DGWVTTMTTTWVSGVGTFATQFALAFMSAGIFSYLMRETKCGEAIGQTFIKYVGGDNAP
FT                   FILAIVAAILQLAGIQTYIFIVAAMAFGLMKAANLPIYIGYAAVVAVPPIVSFTLPGVT
FT                   AMPNVLPTSFLGTTTWAAPGLSIAISVLGILMAVFYLRYLIKQARRKGIGYTTDASKEY
FT                   GASKEFGDIPTPPFWKAILPIILVIALTSFFQLAMHISAVNALIFGMWITAGVTAILHF
FT                   DVVVHKITIPRALSQGTTEMFPFIMMSGCVFGFGLVAQKAACMDYLIQKIMSINVNPYL
FT                   TAWLSVCLIAALCADGISGMTMWLGTFGAQFAAMPGVDPGALHRILVASSTTFDSLPHS
FT                   PMLAQGMGVFKTDFKESYKYSFVLTVLFPVIFSLVGVVIAIIFY"
FT   CDS             307511..308245
FT                   /transl_table=11
FT                   /locus_tag="CC1_02940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79232"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4G1"
FT                   /protein_id="CBK79232.1"
FT                   /translation="MGKTYSTEELVSRWEDQRYMKNLMGKYANCMILNREHEIFDRFWS
FT                   KKTENLCLSFNDGAYKGAEAIRAYYEAEYRRNDLVAHLLQKRFPEKLGSLSDEELYGIG
FT                   PFKVKPMSCPIIEIAEDHQTAKGLWYCQGAYNKVEGCGPVARWTWGYFAVDFTYEDDAW
FT                   KIFNLMYVNDVDCICGQSWGKEEKPYPPLPEFQPLEEFKYPEYSVKKTIRPLYAPDRVL
FT                   TKAPEIPVPYRTFAETFSYGIS"
FT   CDS             308264..309052
FT                   /transl_table=11
FT                   /locus_tag="CC1_02950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79233"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4G2"
FT                   /protein_id="CBK79233.1"
FT                   /translation="MANSRQYTDEELIQRVWDVEEIKKLIHKRVIYITNEMRKEELNDL
FT                   WVQDPNHQKTASFGRNTGYYTGMDAIRDYYVVHHQKEREEQLKQLHAANPAIADVPQNL
FT                   HIGCLSSHPVSTGLVELAGDGKTAKGLWYAIAQETEAQPDGTGKALWMPEKIAVDFVKE
FT                   EDGWKIWHIVVSTDLVSEAGEDYSEQEVYHNYETNPVDVEFGTPTIAKLIHNTDFNWWD
FT                   NYPPMPEAYETFSDAVSYGPEGYVRPALYGLDSKEGRNFR"
FT   CDS             309049..309804
FT                   /transl_table=11
FT                   /locus_tag="CC1_02960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79234"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4G3"
FT                   /protein_id="CBK79234.1"
FT                   /translation="MKSKLSLHERIRNANASQEVEKVKARHTYLHGRADATGEWADIWS
FT                   RDPNCSWAHIFGRMRGFDQVWYGSVAQYDKMSFENAIELMKIYPETAGKDPRPLMEASV
FT                   HTLVTDIIEVAEDGMSARGSFITPGVIHSTLTADQKKYCNVLWERYGSDFVCEDGKWKY
FT                   LHEQVCPDILSRMDCLNWAAEEYARITAPEEKEAPPVTLGEAPPVTDPGPLHLPYSVLG
FT                   KPQNTVPWPEPYHTLDDENTYTSFVKHQE"
FT   CDS             309807..310727
FT                   /transl_table=11
FT                   /locus_tag="CC1_02970"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79235"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016732"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4G4"
FT                   /protein_id="CBK79235.1"
FT                   /translation="MNFDTFVSKELCPEDYQILLPYFKMRYSHTCENILVSNFMWKDYY
FT                   NTRYIRDAHGLIWIMDVDGQPGTMVPLCAPEDLKHYFEVAQAYFNECLGTKMILYLADK
FT                   EAVDLLQLDTTRYDVKADRRYFDYVYDARKLMSFIGKAYHKKKNHVNAFMKNYDGRYEY
FT                   RSLERDSKYHDEIMTFLKKWETERNIEDAYHRIDYELNGIDYLLTNCRYLDYKMGGIYI
FT                   DGKLEAFSLGVYGKAERMAVIHVEKANPEIRGLYPFICQQFLLHEFPDALLVNREDDIG
FT                   LEGLRKSKLSYNPIYLEEKYEIRQK"
FT   gap             310774..311252
FT                   /estimated_length=479
FT   CDS             311417..311518
FT                   /transl_table=11
FT                   /locus_tag="CC1_02980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79236"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4G5"
FT                   /protein_id="CBK79236.1"
FT                   /translation="MKGFNTSDGYMGLVGGKYILFASEDDYYEYMND"
FT   CDS             311676..312206
FT                   /transl_table=11
FT                   /locus_tag="CC1_02990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_02990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79237"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4G6"
FT                   /protein_id="CBK79237.1"
FT                   /translation="MKNDTRKTVRGLLIAGVVVMAVSIMWPSLAEKYGTSKQTASNVLQ
FT                   SETSSSYSSSSASTSTSASKSTSASTSTASATYSHSAGGGGGSTGSFVNGASGTSSGSY
FT                   SSSGSSSGSSSYKKNSGYTSSYDRQKKYDPYDAYDYDDADDFADDWAEEFGDGDYDDGY
FT                   DDAYDYWEDEMED"
FT   CDS             312270..312926
FT                   /transl_table=11
FT                   /locus_tag="CC1_03000"
FT                   /product="Inhibitor of the KinA pathway to sporulation,
FT                   predicted exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79238"
FT                   /db_xref="GOA:D4J4G7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4G7"
FT                   /protein_id="CBK79238.1"
FT                   /translation="MFYLVIDLEMCRVPRDYRNKAYHYAYETIQIGAVLLNEEFKQVGT
FT                   IREYVHPEHGVIDPFIEKLTGIKNSQVKKAPCIGEALVHMIDWIGDREYKVYTWSESDR
FT                   NQLLHEITAKQITDESVDAFMMEDRWVDYQMVFSQRFQLTRRISLEEALGRADIDPKGK
FT                   FHDGMDDAVNTGLLIEKLEMNPDYQLVSYEMPEKPSEHLGSTLGELFAGLNLKLA"
FT   CDS             312946..313170
FT                   /transl_table=11
FT                   /locus_tag="CC1_03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79239"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4G8"
FT                   /protein_id="CBK79239.1"
FT                   /translation="MLMLTAVVSFLVLSFAAACRGDFSGFGMIAEGILYIAGILLMCWL
FT                   FTQPVLLGILIVIGIVIAYASYRNKKEIE"
FT   CDS             313194..313394
FT                   /transl_table=11
FT                   /locus_tag="CC1_03020"
FT                   /product="HIRAN domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79240"
FT                   /db_xref="GOA:D4J4G9"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4G9"
FT                   /protein_id="CBK79240.1"
FT                   /translation="MAKIYFTLTGTRHYYGSDFLKSGMKIQLEKEPDNKYDPEAIQVKL
FT                   KGMGKNCCLVNNLQSVWLLLL"
FT   CDS             313391..316153
FT                   /transl_table=11
FT                   /locus_tag="CC1_03030"
FT                   /product="DNA or RNA helicases of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79241"
FT                   /db_xref="GOA:D4J4H0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4H0"
FT                   /protein_id="CBK79241.1"
FT                   /translation="MSGITPLLQTLKELEQRGISGRILTTDYLTFSEPKALRKLSGFSN
FT                   LQLKMYMTDRSNSGFHTKGYIFKKDEMYRIIVGSSNMTLSALTTNEEWNTRIVSAEQGE
FT                   YAKNVLVEFEKLWDADQALTFENFIEFYTDIYTKNKIIQRQKELVRQEQMPSLEAFRLQ
FT                   PNSMQVGFIRNLQKIYDAGEKRALLISATGTGKTYASAFAMRELGFQRILFLVHRGQIA
FT                   KQAKNSFKKVFAGTRSMGLVTGNYQNYDSDVIFATIQTFSKEDVLSKYSRTAFDAIVID
FT                   EAHHSAANSYKKVMDYFTPRLWLGMTATPDKRDDNMEGRNIYEIFNHQIAYEIRLQDAM
FT                   KEDLLCPFHYFAITDLEVIADSGKSMEEKIENFRYLTSDERVGNVMKQAEFFGYDGDRV
FT                   KGLIFCSRIDEAKELSRKFNEKGWRTLVLSGGDSESTRAAAVERLAGDDSENALDYILS
FT                   VDIFSEGVDVPEINQVIMLRPTESPIVFIQQLGRGLRKAEKKEYVVVLDFIGNYKNNFM
FT                   IPIALFGDRSYNKDNIRRYVTEGGRVIPGASTIHFDEVSRKRIFQAIDNANFSDIKLIR
FT                   ENYTNLKDKLGHIPALADFDKYGEMDVLRIFDNNSLGSYYKFLVKYEKEYTIRLSKEEE
FT                   KVIEFVSKKLASGKRIHELELLNRLMHYQHGIMGILKQSLNEKYHCLMDSICEKNLVNI
FT                   MTNEFPTSMAKKTYAQCVFLEREGRDYGISDSFSKMLKNPDFYLMLQELVDFGITRYQE
FT                   NYSSRYQDTNLVLYKKYTYEDACRLLGWEHNEVPLNIGGYKYDRKTKTFPVFINYDKRE
FT                   DISDTTKYEDHFVSSSHLIAISKSGRTMESEDVQNFLKARERDIDVQLFVRKNKDDKIS
FT                   KEFYYLGRMTATGCAKEFVMPNTDKTAVEIEWVLDTPVREDIYEYIVNG"
FT   CDS             316191..316577
FT                   /transl_table=11
FT                   /locus_tag="CC1_03040"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79242"
FT                   /db_xref="GOA:D4J4H1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4H1"
FT                   /protein_id="CBK79242.1"
FT                   /translation="MKTIRVVAAIIIEKEKVFATQRGYGEFKDGWEFPGGKIELGEIPE
FT                   AAIVREIKEELDTEIEVVKLLDTVEYDYPQFHLSMDCFICKIKSGDLVLKEHEAAKWLT
FT                   KENLDSVDWLPADLSLIEKIRNEI"
FT   CDS             316696..317553
FT                   /transl_table=11
FT                   /locus_tag="CC1_03050"
FT                   /product="conserved hypothetical protein (putative
FT                   transposase or invertase)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79243"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4H2"
FT                   /protein_id="CBK79243.1"
FT                   /translation="MSKTFQELTIKDPFMFAAAMSNEEQCKTFLSIVLGMEILHVSVVT
FT                   EKTISYHPEYHGVRLEVLAIENNTKRRFNVEMQVKDNKNLSKRSRYYHAQLDMNALLTG
FT                   IDYNELPDTYVIFICDYDPLGDELYRYTIVNRCDENGKVISDGNHTIWLSSKGNNASDE
FT                   PKELVDFLEYVENPDDSKETEEDSFLKSLKAQIAEIKKDRDWETRYMLFKEMMEDERAA
FT                   GRAEGISVGIISSILTILSSKGKVDASLQEFVSNQRDEKILKQWLTMAASSDSVAEFEQ
FT                   KIKK"
FT   CDS             317588..317659
FT                   /transl_table=11
FT                   /locus_tag="CC1_03060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79244"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4H3"
FT                   /protein_id="CBK79244.1"
FT                   /translation="MIENKKYKQKVSIEEEESCLYKR"
FT   CDS             317730..318317
FT                   /transl_table=11
FT                   /locus_tag="CC1_03070"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79245"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4H4"
FT                   /protein_id="CBK79245.1"
FT                   /translation="MNLNIFDRYLLIINIIALVIYGIKVLVYKHQTRDWFEKLCMFIAL
FT                   LGGSAGILLMIILFDRKTVKENMMSRVFTLCMLVIQAILLLIVKGYHGDQIHIDFWDYL
FT                   MKHRILLIYLAVVNILTIIVFGVDKMHAKSNRQRVRIVTLLGLAFIGGSVGALIGMYGF
FT                   HHKTKKAYFTVGVPLILLMQVVILFYVMNMGM"
FT   CDS             318321..319031
FT                   /transl_table=11
FT                   /locus_tag="CC1_03080"
FT                   /product="sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79246"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4H5"
FT                   /protein_id="CBK79246.1"
FT                   /translation="MKYTNVTEGEFVGRNNRFTAEVLIGGVQETVHVKNTGRMKELLFP
FT                   GARVTLTCSDNPNRKTKYDLISVYKESLGWVNIDSQAPNKVVGEWLAGRDYTFIKPEYK
FT                   YGDSRLDFYMEKQDEKYLMEVKGCTLEIDGIGYFPDAPSERAVRHLHELMNAVKQGYHC
FT                   ILAFVIAMPGVMVVRPNMTTHPAFGQALSEAMAAGVEVWYLPCEITADSIQIKGRKRKY
FT                   YTVQDGLYPHMVIQ"
FT   CDS             319072..319401
FT                   /transl_table=11
FT                   /locus_tag="CC1_03090"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79247"
FT                   /db_xref="GOA:D4J4H6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4H6"
FT                   /protein_id="CBK79247.1"
FT                   /translation="MQPIYLSIQQEETGAQIRKLMMKNGYTVRDVQGAMGFENPQAVYK
FT                   WISGKSLPSLDNFLILSRLLHASIEDILVVDGDIVMSALFETIEDAVSESGELAYVISL
FT                   LKGFY"
FT   CDS             319483..320319
FT                   /transl_table=11
FT                   /locus_tag="CC1_03100"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79248"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4H7"
FT                   /protein_id="CBK79248.1"
FT                   /translation="MRIENLQNDNRKFIKSIGNFHVLEYMQDASVSPMNAMNEYFMSKM
FT                   NVRRRQVVIDIDKNHSAIIQAGAMQWMGGHVEATSGVKGIGDLFGKAIKGAVTKETAVK
FT                   PEYVGEGCLVLEPTYKYIILVDMAKWGATGMTIEDGMFLACDANVKNKVVARKNISSAV
FT                   LGGEDLFNLSLQGDGVAALESNVPEEELIEVVLENDELKIDGNLAVCWSSNLDFTVERT
FT                   TKTLVGSAVSGEGLVNVYRGTGRVLMCPVAPTSSLFEAANTMSAKAAAKNSNTFGK"
FT   CDS             320355..321383
FT                   /transl_table=11
FT                   /locus_tag="CC1_03110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79249"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4H8"
FT                   /protein_id="CBK79249.1"
FT                   /translation="MISRRWEKLHMPKGTNQKFKLYRLAQIMMKKTDEEHYITMPEIKE
FT                   ALAEYDITADRKSLYNDLRDLEILGIEVEGEQDGNRYRYHVVNRPFELPELKLLVDAIQ
FT                   SSKFITEKKSNSLIKKLETMVSEYDAQKLQRQVYVSGRIKAMNESIYYTVDAIHNAISE
FT                   NKKIRFQYFQWNVKKEPQLRHGGAWYHISPWGLSWDDENYYLVGFDSEAGLIKHFRVDK
FT                   MLRIALSNETREGREHFKKLDMADYARKSFGMFGGEEETVKLQVSNGLAGVIIDRFGKD
FT                   VMMIPVDEDHFNVSVDVHVSRQFLGWVFSLGESVRILGPEAVVDQMKAETQRLIGQYDI
FT                   IQ"
FT   CDS             321846..323303
FT                   /transl_table=11
FT                   /locus_tag="CC1_03120"
FT                   /product="arginine decarboxylase"
FT                   /function="arginine decarboxylase"
FT                   /EC_number="4.1.1.18"
FT                   /EC_number="4.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79250"
FT                   /db_xref="GOA:D4J4H9"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4H9"
FT                   /protein_id="CBK79250.1"
FT                   /translation="MNRNKQMHAPVYEALERLKRRRVVPFDVPGHKRGRGNPELVELLG
FT                   EKCVSLDVNSMKPLDNLCHPVSVIKEAEELAAEAFRAAHAFFMVGGTTSSVQSMVLSCC
FT                   KAGDKIILPRNVHKSVINALVLCGAIPVYVNPEVDNKLGISLGMQVAEVEKAIKENPEA
FT                   VAVLVNNPTYYGICSDLRTIVQVAHAHKMLVLVDEAHGTHLYFGENLPVCAMDAGADMA
FT                   SVSMHKSGGSLTQSSLLLTGKNVNWEYVSQIINLTQTTSASYLLISSLDISRRNLALRG
FT                   KESFEKVSRMAEYAREEINSIGGFYAYGKDMINGGSIYDFDVTKLSVYTRDIGLAGIEV
FT                   YDLLRDEYDIQIELGDIANILAYISIGDRIQDIERLVGALADIKRLYAKNPEQMPNAEY
FT                   IKPTVCVSPQTAFYGEKKSVPIRETEGMICSEFVMCYPPGIPILAPGEMITREIIDYII
FT                   YAKEKGCSMQGMQDPAVESLFVLTGKY"
FT   CDS             323321..324184
FT                   /transl_table=11
FT                   /locus_tag="CC1_03130"
FT                   /product="spermidine synthase"
FT                   /function="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79251"
FT                   /db_xref="GOA:D4J4I0"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4I0"
FT                   /protein_id="CBK79251.1"
FT                   /translation="MELWFSDYHTEKVKVSVKVQKQLFGLQTEFQRIDVFDSDEFGRFL
FT                   SADGSIVFSEKDEFIYDEMIVHVPMAVHPHVKNVLVIGGGDGGVARELGYYEEIEKIDV
FT                   VEPDRVFVEVCKEFFPDNACGLGDKRVSIYYEDGLKFLRLRQNEYDLIINDAIDPLGHN
FT                   AGLFTKEFYGNCYRALKEDGIMVYQHGSPFYDEDEESCRVMHRKASHSFPISRVYQAHI
FT                   PTCSSGYWLFGFASKKYHPLEHLDAKRWKERHIKTWYYTTNLHKGAFMLPRYVEDMLEE
FT                   EEDRKK"
FT   CDS             324259..325518
FT                   /transl_table=11
FT                   /locus_tag="CC1_03140"
FT                   /product="carboxynorspermidine dehydrogenase"
FT                   /function="carboxynorspermidine dehydrogenase"
FT                   /EC_number="1.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79252"
FT                   /db_xref="GOA:D4J4I1"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4I1"
FT                   /protein_id="CBK79252.1"
FT                   /translation="MGRLLIIGCGGVAGVAIHKCCQNSKTFSEICIASRTKSKCDDLKE
FT                   KLEKTTETKITTAQVDADNVDELIALIKDYQPDAVLNVALPYQDLTIMDACLACKVDYI
FT                   DTANYEPEDTDDPQWRTIYEKRCKDEGFTAYFDYSWQWAYQDRFKEAGITALLGSGFDP
FT                   GVTSVFTAYALKHYFDEIDTIDILDCNGGDHGYPFATNFNPEINLREVSANGSYWENGH
FT                   WVETEPMEIKREYDFPQVGQKDMYLLHHEEIESLAKNVPGVKRIRFFMTFGQSYLTHMK
FT                   CLENVGMLSTSPIMYEGREIVPIQFLKALLPDPASLGPRTVGKTNIGCIFTGKKDGKEK
FT                   TIYIYNVCDHQECYKEVGSQAISYTTGVPAMIGAALVLDKVWDKDGVFNIEEFDPDPFM
FT                   DMLNQYGLPWVVDENPQTVE"
FT   CDS             325515..326639
FT                   /transl_table=11
FT                   /locus_tag="CC1_03150"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /function="carboxynorspermidine decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79253"
FT                   /db_xref="GOA:D4J4I2"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4I2"
FT                   /protein_id="CBK79253.1"
FT                   /translation="MMFEGLPTPCYVVDEGRIRHNLEILQQLEKDTGCHVLLAQKAFSM
FT                   YSLYPMIGRYISGTTASGLYEARLGYEEMGKENHVFAPAYKEADMQELVTICDHIIFNS
FT                   FAQYEKYKDICQAKGVSVGIRVNPQCSTQEGHDIYDPCGYASRLGVTKAQFPEVLPEGI
FT                   EGLHFHTLCEQNADDLVTTFQAFEEKFGKYLHCIKWLNLGGGHHITRKDYQYETLVKLI
FT                   RYIRDTYHMTVYLEPGEAVALNAGYMVTEVMDIVHNDMDILILDVSAACHMPDVLEMPY
FT                   RPPLSGGYEANQKPYTYRLSSMTCLAGDVIGDYSFEKPVQIGDRLVFEDMAIYSMVKNN
FT                   TFNGMPLPGIALLRENGNTEMVRKFGYQDFKMRL"
FT   CDS             326678..327844
FT                   /transl_table=11
FT                   /locus_tag="CC1_03160"
FT                   /product="agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79254"
FT                   /db_xref="GOA:D4J4I3"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4I3"
FT                   /protein_id="CBK79254.1"
FT                   /translation="MKSIKTIPSADGYHMPAEYACHKGCILIWPQRPGSWKKNPEAAER
FT                   AFCAVMQAIAESEAVYLACGKAALPRAKAFADAHNRQFQREISEKKHFPVVVFEVETDD
FT                   AWARDIGPTFVVKNDTVRGISWTFNAWGGEEDGLYASWQKDDAFAEAFAKREGYVCYDA
FT                   SPFVLEGGSIHSDGEGTVMVTESCLLSRGRNPQLSKAEIEEKLRQFLGAEKVLWLPRGI
FT                   YNDETNEHVDNVCAFIRPGEVVLAWTDREDDPQYPLSLACLRYLESQTDARGRRIKVHK
FT                   LPIPDVPVCVTKEDLEGYAFEDGEDTREEGERLAASYVNFYFSNGAVVMPAFGGENIKS
FT                   DQRAAEIMEKLCPERKVITVDARDILTGGGNIHCITQQIPFGKAEQGE"
FT   CDS             327851..328726
FT                   /transl_table=11
FT                   /locus_tag="CC1_03170"
FT                   /product="N-carbamoylputrescine amidase"
FT                   /EC_number="3.5.1.53"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79255"
FT                   /db_xref="GOA:D4J4I4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4I4"
FT                   /protein_id="CBK79255.1"
FT                   /translation="MRNVKIAAIQMQCSTNLQANLEKAEKMVRQAAGDGAQIILLPELF
FT                   EREYFCQQRRYDFYHLAKPVKENDAVQMGMRLAKELNVVLPISFYEQDINTLYNSIACI
FT                   DADGTLSGVYRKTHIPDDHYYQEKFYFTPGNTGFKVFDTRYGKIGIGICWDQWFPETAR
FT                   CMALMGAEILLYPTAIGSEPILECDSMPHWRRCMQGHAAANLMPVIAANRIGREEVTPS
FT                   PENGGQRSALVFYGSSFMTDETGGLKACASRDQEEILTGVYDLDDLADKRLEWGLFRDR
FT                   RPEMYLKITQ"
FT   CDS             328906..329166
FT                   /transl_table=11
FT                   /locus_tag="CC1_03180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79256"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4I5"
FT                   /protein_id="CBK79256.1"
FT                   /translation="MNELYEAIEKKIKASGYPRAISGADVYDDICDQIEGKENGEYILL
FT                   SKFDEDVVFEYHITIQDENFNLGILTMKTPEGVFKADFDAE"
FT   CDS             329206..330861
FT                   /transl_table=11
FT                   /locus_tag="CC1_03190"
FT                   /product="transporter, NhaC family (TC 2.A.35)"
FT                   /function="transporter, NhaC family (TC 2.A.35)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79257"
FT                   /db_xref="GOA:D4J4I6"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4I6"
FT                   /protein_id="CBK79257.1"
FT                   /translation="MKTKRKRIGMLAFIVMIAVLMIVTMQTPGTIADSENYQCQTYATV
FT                   FALLPPVIAIGLALITKEVYTSLLAGIIAGGLLYSNFNLELMLNTIFYQGEGGMVMKLS
FT                   DSWNVGILVFLVMLGILVALLNKAGGSAAFGEWTTKHIKTRVGAQIAVIALGIMIFVDD
FT                   YFNCLTVGSVMRPVTDRHQVSRAKLAYIIDATAAPVCIIAPISSWAAAVTSSVPEEAGI
FT                   NGFSVFIQTIPYNLYAILTLCMLLAVTILKVDFGPMKKHEMNAFKGDLFTTPGRPYESD
FT                   EEAISNDKAHVMDLVLPVAVLIVSCIVAMIYTGGFFDGASFVDAFADSDASVGLVLGGS
FT                   VALVFTFIYFMMRDVLSFKEFTDCIPEGFKAMVAPILILSMAWTLSGMTNLLGAKIFVA
FT                   ELVAGSALSMQGFLPMIIFLVAAFLAFATGTSWGTFSILIPIVIGVFPEGQMMVISIAS
FT                   CLAGAVCGDHCSPISDTTIMASAGAHCEHVNHVSTQLPYVLLVAVVCMVGYFLIGVFRA
FT                   VGLASIAWLALPICIIILLAILLIIRAKGTKEAA"
FT   CDS             330864..331286
FT                   /transl_table=11
FT                   /locus_tag="CC1_03200"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79258"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4I7"
FT                   /protein_id="CBK79258.1"
FT                   /translation="MRIVVSACLLGENCKYSGGNNENKAVLNFVKDHELIPVCPEVLGG
FT                   LPVPRMPAEIVNGVVRCRDGRSVDDAFRSGAAKALTIALKEKADLAILQSRSPSCGVKA
FT                   VYDGTFSGKIIPGEGVFAAFLRENGIRAIDAADIDV"
FT   CDS             331340..332341
FT                   /transl_table=11
FT                   /locus_tag="CC1_03210"
FT                   /product="Exopolyphosphatase-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79259"
FT                   /db_xref="GOA:D4J4I8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4I8"
FT                   /protein_id="CBK79259.1"
FT                   /translation="MAFDFNEQFEKMMREYDVTEVVLLGHMNPDGDAAGSVMGLAHYIK
FT                   VNYPQYTAWPFLSDKLDKGPKKQVMEDEIFAPFERPKLASERYAVIVCDTATLKRLIGM
FT                   KYYQRAVVSMIIDHHASNEGYGIINDIKVSESCAYNVFEILDKEMLKKAASAPHPNGAD
FT                   YLYMGILHDTSRFSRSDAKIEAAGSKLLAMGADHRYVMRTMQDKTLDDLIRQGEILRRV
FT                   KRVMEGKVAYVYMSYQEAKKLHISYEDIHPISGMLRDCEDIEMGFSMYEEAPNIWRCSF
FT                   RSDGQWINVNEMMKSFGGGGHAAAAGLRRETDQPEVLLEQLLAQIESIQSLG"
FT   CDS             332634..333872
FT                   /transl_table=11
FT                   /locus_tag="CC1_03220"
FT                   /product="diaminobutyrate aminotransferase apoenzyme"
FT                   /function="diaminobutyrate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.76"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79260"
FT                   /db_xref="GOA:D4J4I9"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR012773"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4I9"
FT                   /protein_id="CBK79260.1"
FT                   /translation="MNIFEKRESVVRSYCRKYPVVFKKALNAEMFSEDGERYVDFLAVA
FT                   GSMNYGHNNPEIKKAVLDYLADDNIINALDMYTSAKEEFLTEFERLILNPRKLDYKVMC
FT                   CGPTGTNAVEAALKLARKNKKRTNVIAFAGAFHGMSLGSLALTTDKTSREGGSVPLTNV
FT                   TFVPYDGTFDSLAYLRWVLEDDHSGVDKPAAIILETVQAEGGINPASVEWLRGIRQICD
FT                   ENDILMIVDDIQVGNGRAGYFFSFERAGIVPDMVVMSKSISGFGMPMALLLIKPELDIF
FT                   KPAEHNGTFRGNQLSFIGGTAGIRYFTEHKLDEEVRRKGQIIEQFIQKEILPMDARLVH
FT                   RGIGMIWGIDFNGIAPEKAIEVIHKAFDNHLILEVAGRHDGVVKIMPPLTIEDDTLMEG
FT                   LQIVKKSIAEVLN"
FT   CDS             complement(333977..334624)
FT                   /transl_table=11
FT                   /locus_tag="CC1_03230"
FT                   /product="3-Cys thioredoxin peroxidase"
FT                   /function="3-Cys thioredoxin peroxidase"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79261"
FT                   /db_xref="GOA:D4J4J0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4J0"
FT                   /protein_id="CBK79261.1"
FT                   /translation="MPLIGDHAPEFHAMTTQGKIDFPADYKGSWVVLFSHPADFTPVCT
FT                   TEFIALSRMNETFESLNTKLIGLSIDSLHSHLGWIKSIEALNFNNEGKVKIPFPIIADI
FT                   SMNVARKYGMLQTVANTQTVRAVFIIDPEGMIRTILYYPMSTGRNIPEIIRILQSLQLN
FT                   DKTHYSTPANWQPGDAVVMGAPLTIEEAQERLESSDNTIEHLDWYLTMKKMK"
FT   CDS             334893..336050
FT                   /transl_table=11
FT                   /locus_tag="CC1_03240"
FT                   /product="exonuclease SbcD"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79262"
FT                   /db_xref="GOA:D4J4J1"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4J1"
FT                   /protein_id="CBK79262.1"
FT                   /translation="MKFFHLSDLHIGLKLMNRDLREEQMDILRQVTDLAREEQPDAVVI
FT                   AGDIYDKAVPAAEAVEVFDSFITELKRAVPEAEMMLISGNHDSGLRLNCFREILDEQKV
FT                   HMIGLPPRREEEYIEKVTLQDEFGPVNFYLLPFVKPSMVKQIVGVDENGNNLSYDATLH
FT                   KLIAREEVNTAERNVLVSHQFYLPVGENAESVERMDSEIRTVGNIDAVASDVLEAFDYA
FT                   ALGHIHKPMKVGSKLYRYCGTPLACSVSEAGQQKGVIMVEIGEKDPKTSVKITVLPLKP
FT                   LREVRIIKGSLEDVLVQACEDFVTVILTDRVDLDIMDMQDRIRMAFPYLLEIRREVLRK
FT                   ADYSEKLMAEKEQDPFELCCSFLKDLDDEEKTILRDVIHTVQGVK"
FT   CDS             336051..339299
FT                   /transl_table=11
FT                   /locus_tag="CC1_03250"
FT                   /product="ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79263"
FT                   /db_xref="GOA:D4J4J2"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027050"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4J2"
FT                   /protein_id="CBK79263.1"
FT                   /translation="MKPIQLTMQAFGSYGKKTVIDFTKPDQNLFLITGDTGSGKTTIFD
FT                   AIVFALYGEASSVVNRKNGAELQSQFAAASVEPFVELIFSEKEGSEDVHYTVRRVPKHV
FT                   RPLKRGTGLKEESGSVSLIMSDGTEYPSKETDKKLEEIVGLTKNQFMQVAMIAQGEFMA
FT                   LLRAKSDDKKVIFRKLFNTELYQNIVDELAKRRKDKDRKIAQIKTACQTEVGHILVPKL
FT                   VTADGAETDQEQNGAADQIADECRDANKLQELKERILKSERLSLPDMEALLQTLVSVSE
FT                   WTKDKMQQSESETSQLYEVYLLKRDAVTKAGQLMERYKELEDADKELGECEAIKPLAQE
FT                   WQQCMRQIEDAYDILTLWKQYQEVSGQLEIARQALAANEQALPDQKMACEQAAVQLQQA
FT                   KKVQEQALMDFSEVKTHVENDLEAFSKMAEAKRKVLNAQTKVDEAGKQARIAEESLSDL
FT                   ESNEKQWQTQAELLSDTDSRMIILQGKQRDIAGIGADFESWKDEEKDCFSQQRCAEEAD
FT                   KVYADAKDRFNKENTAYIQAYNDFLDAQAGFLAEKLQRGEPCPVCGSTIHPHPHQAEKS
FT                   ALTKEELNTLSENVRELQEGQAAAAKKAGEAKAMLDAKKKNCIQTWEKLLQKVIAYSRE
FT                   EMGELDSERIQSLIETWKKALKDEEKQLHEDEKQLQQLKKRLTKAVKDKEELTAQKNKA
FT                   EKMSADAKAELAAAQAELKSTFISTYYKSEEEANQSMEQAERRKKDAEKQYQSCDEVDK
FT                   KVRSDKEKTELKIAQHRRDIPNLQDKSEKRKVVYTQLMEEKQLTESQWKCVIDSYDKAD
FT                   RQQFEEKIRQYQRKLSAAGKQKAVAEKAIDGRVKPDMEQLCSEQNVAEAAWKKEQALYE
FT                   RYAEMYKTNHRVCEALMPKMAERSKIMEEHRRLDDLYNLLAGKVTGARMDIETYVQRYY
FT                   LERILYAANRRFGEMSAGQFELRMCDITKAGEGRNRGLDLMVYSNVTGKEREVRTLSGG
FT                   ESFMAALSLALGMADQIQQSSSAIHLDMMFIDEGFGSLDSQSRDQAVRVLQQMAGGSKL
FT                   IGIISHVSELKQEIEDQLIVSKDEEGSSARWQIS"
FT   CDS             339563..341503
FT                   /transl_table=11
FT                   /locus_tag="CC1_03260"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79264"
FT                   /db_xref="GOA:D4J4J3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4J3"
FT                   /protein_id="CBK79264.1"
FT                   /translation="MDAGIKETKEQALKEMELFKTVFDGARLLDMHALQLIGKGLGSYS
FT                   LTESEQKFDFWEKEHPCNNDSCIVLQALRDKDVHTKLEFIGSQLYEVTARYMEVEGEPY
FT                   VLELVKRMDDNYMIDENQREKLLRHFGGYHEQLYKDALTGAYNRRYFEEKIRKSTVSAG
FT                   VAMIDLDDFKLYNDSFGHDTGDVVLITFVNIIKNCTRKTDMLIRYGGDEFLLIMPGIKE
FT                   ENFKNKLLQILEEVHRADVPGHGGLRLSASIGGVLSNGSVIEDAIGRADKLMYQAKNRK
FT                   NMVVTEDNLVANDIKKGMLCDREKIRQLILIVDDSELNRTLLSEMLKDDFRILEASNGR
FT                   ECLDALEQYGMGISLVLLDINMPVMDGFEVLVQMNRNHWIEDIPVVMISSDDTESNIKR
FT                   AYDMGVSDYIRRPFDAQVVFRRVFNTIKLYAKQRRLITLVTDQIDEKEKNNQIMIRILS
FT                   QIVEFRNGESGLHVEHINILTGLLLERLVQKTDHYDLTWSDQYMITLASALHDIGKIGI
FT                   DDKILNKPGRLTKEEFEIMKSHTLIGASILENLGLYQEEPLIKTAYQICRWHHERYDGK
FT                   GYPDGLRGDEIPISAQVVSVADVYDALVNERVYKKAITHEKAIEMILNGECGVFNPILL
FT                   ECLVDIKDKIY"
FT   CDS             341527..341874
FT                   /transl_table=11
FT                   /locus_tag="CC1_03270"
FT                   /product="Hpt domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79265"
FT                   /db_xref="GOA:D4J4J4"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4J4"
FT                   /protein_id="CBK79265.1"
FT                   /translation="MTIKEAYESIESNYDNVLKRLGSEGMIKRFAVKFIDDPTFGELKN
FT                   ALAAGDGESAFRAAHTMKGICLNLGFDKLYEVSAALTEQLRGCKIAGSEVMYQQVVEQY
FT                   DRLIAAIKAID"
FT   CDS             complement(341984..342979)
FT                   /transl_table=11
FT                   /locus_tag="CC1_03280"
FT                   /product="Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79266"
FT                   /db_xref="GOA:D4J4J5"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4J5"
FT                   /protein_id="CBK79266.1"
FT                   /translation="MRRNIKGLYTELAFEDGAALVDESIVREQLRQKRLKRQRARKKAR
FT                   RRALRRRIILLFLVVVVVCSGGLMVYEQFLSHQVVLRNRVYQNPLKYYQIQDSISLSGG
FT                   DYELSEGYEGLKTAKVIQTLGLGNAVGMNGALYTSEIADTVADFQAQHGLDATGTVDLT
FT                   TWLAMGLSEEDWYTLGAYVSPLRIDNTSSRTACIEAMISRAYDYLGDNYIIGASGAPGL
FT                   GIDCSGLIMQALYAAGIDMSPINPVRHASPGYEYESANIWASSKFKHVDYKERKRGDII
FT                   IYCNEKGTVIHSAIYLGDDKVIEAWPNQVTESAVLNYQHSLVKGVVRPFV"
FT   CDS             343454..343741
FT                   /transl_table=11
FT                   /locus_tag="CC1_03290"
FT                   /product="glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, C subunit"
FT                   /EC_number="6.3.5.6"
FT                   /EC_number="6.3.5.7"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79267"
FT                   /db_xref="GOA:D4J4J6"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4J6"
FT                   /protein_id="CBK79267.1"
FT                   /translation="MAITDETIEYVAALAKLDLTDEEKERAKKDLGNIIGYVDTMNQLD
FT                   TTGIEPMSHVFAYHNVFREDLVTNGPDRDNILANAPEEKDGGFKVPRTVE"
FT   CDS             343757..345229
FT                   /transl_table=11
FT                   /locus_tag="CC1_03300"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /function="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.6"
FT                   /EC_number="6.3.5.7"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79268"
FT                   /db_xref="GOA:D4J4J7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4J7"
FT                   /protein_id="CBK79268.1"
FT                   /translation="MEITALTALELGKRIKAGEVTVEEAVKAQLEKIKERDSVYNCYVT
FT                   VMEEEALKRAAEVQKQIDAGELKDSPLAGVPVAIKDNICTKGVLTTCSSKILNNFKPPY
FT                   DATVIEKLEAAGAVIIGKLNMDEFAMGSTTETSYFGPTKNPWNIERVPGGSSGGAAAAV
FT                   AAEEVWYALGSDTGGSIRQPSSFCGVTGLKPTYGSVSRYGLIAYASSLDQIGPIARNVS
FT                   DCAAVFEAIAGYDVKDSTSVKMDDYHFTEALVDDVKGLRIGIPKGYLGEGLDPEVKEAV
FT                   LAAAKTLEAKGAIVEMFDMDMVDYAIPAYYVIASAEASSNLSRFDGVKYGYRTPDFEDL
FT                   QDVYKKTRDEGFGMEVKRRMMIGAFVLSSGYYDAYYIKALQVKALIKKGFDDAFAKYDI
FT                   ILGPTAPTTALKMGENLSDPLKMYLGDIYTVSVNLAGLPGISLPCGIDSSGLPIGVQMI
FT                   GQAFSEKTLIRAAYSLEQTRSYERPACVKGEN"
FT   CDS             345232..346665
FT                   /transl_table=11
FT                   /locus_tag="CC1_03310"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /function="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.6"
FT                   /EC_number="6.3.5.7"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79269"
FT                   /db_xref="GOA:D4J4J8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4J8"
FT                   /protein_id="CBK79269.1"
FT                   /translation="MREYETVIGLEVHCELATKTKIFCGCTTEFGGEPNTHVCPVCAGM
FT                   PGTLPVLNKQVVAYALSAGVALNCDITQYSKFDRKNYFYPDLPKAYQISQLYLPICRNG
FT                   HVDIEVDGVKKSIGIHEIHMEEDAGKLIHDEWEDCTIVDYNRCGVPLIEIVSEPDMRSA
FT                   DEVIAYLEKLRMILQYLGVSDCKMQEGSLRADINLSVREAGSDKLGTRTEMKNMNSFKA
FT                   IARAIEGEMNRQIELLEDGKSVTQETRRWDDNKCASYAMRSKEDAQDYRYFPDPDLPPV
FT                   SISDAWLERVKAAQPEMRDAKLARYVEEYGLTEHDAAILTESRKMADIFEAAAAICKKP
FT                   KEVSNWLIVDTMRLLKVHEMDAADLKFSPDHLAKLIELIDAGTINRPTARDVFEKVFAE
FT                   NVDPEAYVEANGLKIEADDGALKGVIEGIVAANPQSVADYHAGKKKAIGFLVGQTMKAM
FT                   KGKADPGTVNKILAEILNQ"
FT   CDS             346692..347360
FT                   /transl_table=11
FT                   /locus_tag="CC1_03320"
FT                   /product="Predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79270"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4J9"
FT                   /protein_id="CBK79270.1"
FT                   /translation="MGNFFSTDGPLFEGMAYIINIIYVSVLWILFSVPIITIGASSTAL
FT                   YYTVTKVIRHGRSYIFREFWQSFKSNLKQSTAVWLIYLVMMGILLVDIRVMGAFGTAVS
FT                   QTLQFVFVIGICMVSAVMVYALAYIARFTQNVRHILTNSVLMAIRHLPKTLLLVVILAA
FT                   AVLGCYLFGLGIVFIPAVAALVDSLILESIFVQYMSKEDREKEALRNHPEQYEYYNRKE
FT                   "
FT   CDS             347700..348407
FT                   /transl_table=11
FT                   /locus_tag="CC1_03330"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /function="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79271"
FT                   /db_xref="GOA:D4J4K0"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4K0"
FT                   /protein_id="CBK79271.1"
FT                   /translation="MEKKELLYEGKAKKVYTTENPDVLIVDYKDDATAFNGVKKGTIVG
FT                   KGVVNNRMTNHIFKMLEEKGIPTHFIEELSDRETAVKKVEIVPLEVIVRNVAAGSFSKK
FT                   LGIEEGFRLLSPTLEFSYKNDELGDPMINDYYAVAIGAATREEIDKITELVFKINEILV
FT                   DYFKSIKVDLIDFKVEFGRYKGQIILADEISPDTCRFWDSETHEKLDKDRFRRDLGHVE
FT                   EAYEEIYRRIGLA"
FT   CDS             348373..349878
FT                   /transl_table=11
FT                   /locus_tag="CC1_03340"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79272"
FT                   /db_xref="GOA:D4J4K1"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4K1"
FT                   /protein_id="CBK79272.1"
FT                   /translation="MRRFTEESVWRKSVDQEDIVEKQLQNKGRSECGTDIKDELHEECG
FT                   VFGAYNLKGEDIANWVYYGLFSLQHRGQESCGIAVSENRDIRYYKDMGLVSEVFTPENL
FT                   DKLHGDIAVGHVRYSTAGSSVRANAQPLVTKYIKGTLAIVHNGNLVNAVDLREELEKNG
FT                   AIFQTTIDSEVIAYLVAKERVTSRSVEEAVAKAMQYIKGAYSLLVMSPRKITAARDPFG
FT                   FKPLCLGKRDDTYVVASETCALDTVGAEFIRDLEPGEIITITEDGVKSNRQYCNMVKPA
FT                   RCIFEYIYFARPDSVIDDVSVFASRIMAGRILAQSHPVEADMVVGVPESGNAAAMGYSL
FT                   ESGIPYGQAFVKNTYVGRTFIKPKQSMREQSVKIKLNVLKENVKGKRIIMVDDSIVRGT
FT                   TSANIVTMLRNAGATEVHVRISSPPFKFPCYFGTDIPSGDQLIANHHTIDEIRQLLGAD
FT                   SLGYLDCDRMNEMVKDLEYCDACFTGNYPVDPPTRDIRGDMEV"
FT   gap             350392..350735
FT                   /estimated_length=344
FT   CDS             350878..352311
FT                   /transl_table=11
FT                   /locus_tag="CC1_03350"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79273"
FT                   /db_xref="GOA:D4J4K2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4K2"
FT                   /protein_id="CBK79273.1"
FT                   /translation="MNHEIYQSPLSERYASKEMQYVFSPEMKFKTWRRLWIALAETEQE
FT                   LGLDITDEQIAELKAAKDDINYDVAKKREKEVRHDVMSHVYAYGQQCPKAKGIIHLGAT
FT                   SCYVGDNTDVIIMREALYIVRKKLINVIAELKDFAMKYRNMPTLAFTHFQPAQPTTVGK
FT                   RAALWLNELIMDLDDVNYIISQLKLLGSKGTTGTQASFLELFDGDHEKCKEADKRIAQK
FT                   MGFEACFPVSGQTYSRKLDTRVVNVLSGIAQSAHKFSNDIRLLQHLKEIEEPFEKHQIG
FT                   SSAMAYKRNPMRSERIASLSRYVMVDVLNPAITAATQWFERTLDDSANKRLSVPEAFLA
FT                   IDGILDLYLNVVDGLVVYPKVIEQHLMNELPFMATENIMMDAVKAGGDRQELHEKIRQH
FT                   SMAAGRVVKEEGKPNDLLERIAADPSFGMTMDQLKAIMKPENFVGRAPQQVEEFVEEVI
FT                   QPILDANKELLGVKAEINV"
FT   gap             352315..352836
FT                   /estimated_length=522
FT   CDS             353448..354269
FT                   /transl_table=11
FT                   /locus_tag="CC1_03370"
FT                   /product="Uncharacterized proteins of the AP superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79274"
FT                   /db_xref="GOA:D4J4K3"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4K3"
FT                   /protein_id="CBK79274.1"
FT                   /translation="MDKTIFVLLDACQYEAASKYLGYLEHMIDYNKGAKYKVLGELPSL
FT                   SKPMYATLFTGLPVCKHGVTCNEVGGVLPYDSVFSLCRKAGGRTAAISYSWMSELYSRA
FT                   PYVSDRDRVQLDAEGSIQYGMYYWDDNYPDSHVFAEGECLRKTFDPDFMLYHTMAVDEW
FT                   GHMKGADSAEYANAVAAVGHLIAARMPEWLEKGYQVVVTADHGMNNLGIHVGTEYAQRE
FT                   VALYIFSNKVENGRFEENYISQLNVAPLVCKLMGVPATEGMKQELEIVFSK"
FT   CDS             355480..356970
FT                   /transl_table=11
FT                   /locus_tag="CC1_03390"
FT                   /product="Sugar (pentulose and hexulose) kinases"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79275"
FT                   /db_xref="GOA:D4J4K4"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4K4"
FT                   /protein_id="CBK79275.1"
FT                   /translation="MIYSLIIDAGTSSIRGIIFDTDHQIVHIASQRYFMDVSEDGTALQ
FT                   KAECYQVCLEKMMQECAEWAAGRKGKMHRIALTAGRSSVLPVDEKGDPLGPIMMWYDKR
FT                   PQDICDRLNADYGDEIYRVTGMYARPMFSAPKMRWLKENYPAVYEQSHKLVGIQDYLIF
FT                   LLTGEWVTDLTFASRTNLLDLNSNRWSDRMLEIFGIDEQKLCRLVEPGSEVGILKKSWQ
FT                   NRGFDTETKIYTAGGDQQCSAIGQGLLASGKIGINNGTASYVAACSRRRLEDKEKVIHV
FT                   NKGAVLGTWIMEASNMGTGSVYDWMRKILFDYEEDAVSIEAMNQALNNSTAGADGIMAW
FT                   PYLAGKGMPDWVCHKAGGVLNLKLSSTKENIARAFLEAIVFEIADCYRRIERIVGRPET
FT                   IQVSGGLSKMPLFNQLLADVLDRKLVTVSCKETTGIGAYISMLLGCGEIEEKDISDILI
FT                   QEKTAVYTPEIEQVTLYTALQKKRRQIEERMPFEAISE"
FT   CDS             357031..358692
FT                   /transl_table=11
FT                   /locus_tag="CC1_03400"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79276"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4K5"
FT                   /protein_id="CBK79276.1"
FT                   /translation="MKKGMKKILSAAIVLAMTMSLAACGGGTKETQGQASSETAAASGE
FT                   SAGTEAGETSVGEIKRGGTLTLRRTGTTPINPTQVIAPAGDMMTYSLFFETLTWFNEED
FT                   YSAQPSLAESWEWSDDSLSLTMKLKEGVNFFDGTPVNAEAVKTTMEYYMDPDTAHAQAS
FT                   YLANVDNVEVVDDYTVKFNFSAPDSSFLTAMAQPIGIILAPAAIEKFKSTNDPEVFARE
FT                   GGCGPFKLSEFLDGESLTAVKNENYYKMGADGQALPYLDSVVVQIIGDEAVMAANMESG
FT                   DIDAVDFFYDQNYIDEFNANDDIVLYKIASQTQYILYMNMQKEPFDNVKVREALCYAFD
FT                   RDECIDVLLNGDGFKTPTIVLPTQTFYRDGKIYDYNPEKSKELLKEAGYPDGVTIEFYY
FT                   GTYGSNKDIAELLQSQAAAAGFNLTLCPTDGASVKQLWASYNEDTPAGIRMNELGHPKP
FT                   SPYIQMDYTFGQNALQNSSKWFSDDLAALLKEISQTTDETAQNEKLTQLQEMVEQEIPI
FT                   VSLYTAYKFSAYRTWVEGLKYNGEGTMIFTEAWLNK"
FT   CDS             358824..359777
FT                   /transl_table=11
FT                   /locus_tag="CC1_03410"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79277"
FT                   /db_xref="GOA:D4J4K6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4K6"
FT                   /protein_id="CBK79277.1"
FT                   /translation="MVSAIVKKILWSIPLLLLVSMIMFGVIHMLPGNAALVMLGDAGGS
FT                   AEQVQKLEESMGLTDPLYVQYFHWISNFVKGDMGTSYLTSQPVAKRIVERLPVTLELIV
FT                   CSVVLAVIIGIPIGILCAVKRNKLVDYIMSTIAMIGVAMPQFWLGILFVLLFSVDLGWL
FT                   PASGYVTFATNPMRHIQSMIMPSVTLALSLAAPIIRQTRSAMLDTLSQDYIMTAKAKGQ
FT                   NSVGIFVKHALRNALVPVITAITSQINGMIGGVFVIETLFLMPGMGKSMVDAIFQRDYP
FT                   IIMGIAMVVVSCIVLINLITDIIYIFIDPRISLDSK"
FT   CDS             359801..360634
FT                   /transl_table=11
FT                   /locus_tag="CC1_03420"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79278"
FT                   /db_xref="GOA:D4J4K7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4K7"
FT                   /protein_id="CBK79278.1"
FT                   /translation="MDIFKKLKKRKTAFISLIILGILVFLALVGNTILGIDPFETNSKI
FT                   RLLAPGMGHILGTDNLGRDVLARVIYGIRISLAISLVSVAFALIVGTAIGTISGYVGGK
FT                   VDSVLVLIIEAVCAFPTVLLGLLLATVLGSGMTNIMLAIGISNVPYFARLARSMAISIR
FT                   GREYIESAVTTGLNHFEIITRYVLPNMSSVIIVQTSLSAASALITESTLSFMGVGVQPP
FT                   AASLGVLLRDGYDYISKASWLSIFPGIAILLTVIALNFLGDGLRDALDVKIRVDN"
FT   CDS             360654..361643
FT                   /transl_table=11
FT                   /locus_tag="CC1_03430"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79279"
FT                   /db_xref="GOA:D4J4K8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4K8"
FT                   /protein_id="CBK79279.1"
FT                   /translation="MSEQLVEVKDLKVTYYQNGVETPVVRNVSFEIKKNETLGLVGESG
FT                   SGKSVTSKAIMRLIAEPPGKIANGEILFEGKNLLKMKEKQMQKVRGKDIAMIFQEPMTS
FT                   LNPLYTCGSQIAEAILLHNKCSKQEAWERAVEILKMVGVPSPEKRAQSYPHELSGGMRQ
FT                   RVMIAIALSCNPRLLIADEPTTALDPTIQAQILKLIHDMQKEKDMSVLLITHDMGIVAE
FT                   NCDRVAVMYAGQILEIADVKTIFGNPAHPYTIGLLKAIPKLDEKVDRLYNIRGMVPRFN
FT                   ELPNGCTFGPRCDFCDKKCEEEAPQLVNMGDGHLVRCHYAGYLPERGI"
FT   CDS             361648..362628
FT                   /transl_table=11
FT                   /locus_tag="CC1_03440"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79280"
FT                   /db_xref="GOA:D4J4K9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4K9"
FT                   /protein_id="CBK79280.1"
FT                   /translation="MEKLLEVRHLKKYFPVKKGFIKRTVGSVKATDDVTFDIYKGETFG
FT                   LVGESGCGKTTVGKLILQLHKADSGEILFEGTDLTKLSKSELQKYRKDIQIIFQDPYGS
FT                   LNAKMKVGTILAEGIKKHKLLPPDQIQPRVLELLKLVGLHDSDVNKYPHEFSGGQRQRI
FT                   VVARALSFNPKLIVCDEPVSALDVSVQAQVLNLLEDLQKELGISYLFIAHGMAVVRHIS
FT                   HRVGVMYLGKMVEIAETDELFEHCGHPYTQALLSSVPVANPFHKKNQIMLEGEVPNPIN
FT                   PPTGCRFHPRCRFACDKCKQEEPQLRKIAQGHVVACHYPEKVYGN"
FT   CDS             362659..363822
FT                   /transl_table=11
FT                   /locus_tag="CC1_03450"
FT                   /product="Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases"
FT                   /EC_number="2.5.1.48"
FT                   /EC_number="4.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79281"
FT                   /db_xref="GOA:D4J4L0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4L0"
FT                   /protein_id="CBK79281.1"
FT                   /translation="MGKSEDLMKGIDRVGIFERMKDYEDMAFETRAIDVGNDSGRSAMP
FT                   IYASVTGDTYQRHGDPSRDAISTCIASLEGMNYCLVTGSGVSAMTLPMLALLKKGDRII
FT                   CHKDLYIWTYFFVREDLPRLCDIQVDMVDFTDLNALEAALKKEPARMVVFETIANPLLH
FT                   VADMKACCELAHQYGALALVDNTFASPYLCRPAELGADIVAESLTKYINGHGDALGGSI
FT                   STNSHAIYYELQRMMGVVGCCASPFNSFLISRGVQTLGIRMERHCDNAEKLVEYLRTKP
FT                   FVLDLTYPGMQEHPQHEIAACQLKRFGGVLCFRLDIDHETLYEKFLPELKLFKHWVSLG
FT                   EGHSLISPKDEDKEKGIPADFIRVAVGLENCDDLICDLERAFKRIFG"
FT   CDS             363842..364945
FT                   /transl_table=11
FT                   /locus_tag="CC1_03460"
FT                   /product="L-ascorbate 6-phosphate lactonase"
FT                   /function="L-ascorbate 6-phosphate lactonase"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79282"
FT                   /db_xref="GOA:D4J4L1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4L1"
FT                   /protein_id="CBK79282.1"
FT                   /translation="MSKIDEITRESWIMSTFPEWGTWLNEEIEHEVVAPGNVAMWWLGC
FT                   TGIWIKTPQDCNISVDLWCGNGKRTHGDGKMKVGHQMANMCGARMMQPNLRAIPFVIDP
FT                   FEIKKVDAVLATHYHQDHMSAEYASHVIKSNLTTFDAEGKEIPVPFIGPKKSVELWQKW
FT                   GVPADRCITVKPGDVIKIKDLEIIALDSFDRTCIVTTDSQGPDREELTGICPTDMDDKA
FT                   VNYLIKTPGGNIYHSGDSHYSIYFAKHGKDYDIDVAFGSYGENPIGMQDKMTSCDILRM
FT                   AEALRCKVVIPIHYDVWTNFMADVNEIRVLYDMKKDRLDYQFHPFFWEVGGKYIYPQDK
FT                   DKRAYHHRRGFEDCFEAPQNIPYRSCL"
FT   CDS             364957..365802
FT                   /transl_table=11
FT                   /locus_tag="CC1_03470"
FT                   /product="L-xylulose 5-phosphate 3-epimerase"
FT                   /function="L-xylulose 5-phosphate 3-epimerase"
FT                   /EC_number="5.-.-.-"
FT                   /EC_number="5.1.3.22"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79283"
FT                   /db_xref="GOA:D4J4L2"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4L2"
FT                   /protein_id="CBK79283.1"
FT                   /translation="MDKKYCLGLYEKAMPGNLTMAEKLTAAREAGYDYLEMSVDETDEK
FT                   LARLDMSREERKELTLLMEKTGMPIRSMCLSGHRRYSLGSAEGAEQSLRIMEKAIELAD
FT                   DLGIRIIQLAGYDVYYESSTYDTKKRFLDNLRKAAAMAEKAGVLLGFETMETEFMNTVE
FT                   KAMKYVCLVDSPYLQIYPDIGNLTNAAVTYKQDIYDDMALGKGHLIAMHLKETVPGKFR
FT                   EIPFGEGHVDFEKAVRKAWELNIRRYVTEFWYTGNLQWKEELLHICQKFNELLEEISNS
FT                   "
FT   CDS             365825..366871
FT                   /transl_table=11
FT                   /locus_tag="CC1_03480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79284"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4L3"
FT                   /protein_id="CBK79284.1"
FT                   /translation="MKVEKKIISNLTKCYSIAPLHYHEQDYILVAAEKQDPCLLFDCEG
FT                   NQVDKVWDGPGGTMSMVQVPGTDGQFLATHRFYSPNDSKEAEIVIVTPKAKGDWEVRTL
FT                   VKLPFVHRFDILERNGVHYLIACALKSGHEYKEDWSMPGKVYAAVLPEDLSGFDENHQL
FT                   KLEVLKDEMLKNHGYYRIPEQDKDTCVISADCGVYLFTPPAKLNESWEIKQLIDTPASD
FT                   AVLVDLDEDGEKELVVLSPFHGDVISIYKKTDSVYQKVYEYEKTAEFTHAIYGGMLCGH
FT                   PAAVIGHRKGERNLIAFSWNKAEKKYQAEIIDRDCGPANVFHYMKDGADRLISANREID
FT                   EVALYTLS"
FT   CDS             366983..368335
FT                   /transl_table=11
FT                   /locus_tag="CC1_03490"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79285"
FT                   /db_xref="GOA:D4J4L4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4L4"
FT                   /protein_id="CBK79285.1"
FT                   /translation="MMKIQRKNSGMDMLRGSLSGNIIRFALPLAGSSMLQQLFNAADTA
FT                   IVGRFDGRQALAAVGSNTMIISLFVNMFVGLSIGANVVIAKYVGQRQEEKIKKSVHTVM
FT                   FLAVLSGLFLLVFGQMTAEKILTLMQTPEDVMAQAVLYLKIYCLGMPFMMVYNFGAAVL
FT                   RCKGDTRCPLYALILSGILNVGLNLLFVVAFKMGVAGVGIATVIANGVSGSLVCCFLMQ
FT                   EKGSMHLSVKAMQLDKKYLKEVLQVGIPAGIQGMCFSVANVCIQSAVNCFGAEGSAGFS
FT                   IALTFESLTYYISNAFGQAAVTFTSQNYSVGNIKRCRQIFNWCLLLGGVLCESISLLFV
FT                   AGHRWLIPFFTSDAGAAAYALIRMQRVVTFNGMTAGYEVGSGLLRAMGHSLQPALLVVV
FT                   GCCGFRILWILTAFRRIGTFEILMNAYPLSWLVTDILIFVTYKYYITISTR"
FT   CDS             368463..370472
FT                   /transl_table=11
FT                   /locus_tag="CC1_03500"
FT                   /product="Molecular chaperone, HSP90 family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79286"
FT                   /db_xref="GOA:D4J4L5"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4L5"
FT                   /protein_id="CBK79286.1"
FT                   /translation="MSEVKQEQGNLSINSENLFPIIKKWLYSDHDIFFRELISNGCDAV
FT                   TKVQKLEVMGEYQLQEGEKFRVDVIVNPEEKTLKFIDNGIGMTADEVKEYITQIAFSGA
FT                   TDFLEKYKDKTNEDQIIGHFGLGFYSAFMVADKVTIDTLSYQEGAEPVFWECDGDSEYS
FT                   MSKGSRTTRGTEITLYLNEDSYEFSNEYRAREVITKYCSFMPVEIYLSKEGGEQEYQTI
FT                   EKDELREDDVIAETIVEDEKTEEKENENGEKETVVVSPRTERYKINKRPSLMNDIHPLW
FT                   TKHPNDCTDEEYKEFYRSVFHDYKEPLFWIHLNMDYPFNLKGILYFPKINMEYESIEGT
FT                   IKLYNNQVFIADNIKEVIPEFLMLLKGVIDCPDLPLNVSRSALQNDGFVKKISDYITKK
FT                   VADKLSGMCKTDRESYEKYWDDINPFIKFGCIKDDKFNEKMKDYIIYKDLDGKYISLDE
FT                   YLEAAKNKHENQVFYVTDELQQSQYINMFKEQGLNAVILKNPIDQPFISRLEEAMKDKN
FT                   VKFRRIDTDLADVFKEAASEDDKKVLEEDQTKLTDIFKKALGVEALDVKVEKLKNADTS
FT                   AMITLSEDMRRMQDMMKMYGMSQGQMGTEGQTLVLNANNALVQYVLNNPEGEHVNMFCQ
FT                   QIYDLALLSHCPLSAEAMTKFVARSNEILKLLAK"
FT   CDS             complement(370668..371345)
FT                   /transl_table=11
FT                   /locus_tag="CC1_03510"
FT                   /product="AroM protein."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79287"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4L6"
FT                   /protein_id="CBK79287.1"
FT                   /translation="MKQIKIGAITIGQAPRTDITRDILPLLPDYMTLTEYGALDDMTYE
FT                   EVMSQFAPSEDDEVLVSRMRDGRQAKFTERFIRPLVQKKIDQAEAEGVSAIILFCTGVF
FT                   PEFRHKVLFIEPQPLFHAIAAKLAGNQKIGILVPEPDQVEQAYHTWGKSGIPVEVTSAS
FT                   PYLDFDKVVEAASFFKGKNLAFICTDCMGFTMEMKHQIQEVTGLPVLLPRTLVVRILCE
FT                   MFS"
FT   CDS             complement(371359..372297)
FT                   /transl_table=11
FT                   /locus_tag="CC1_03520"
FT                   /product="Protein of unknown function (DUF1177)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79288"
FT                   /db_xref="InterPro:IPR009561"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4L7"
FT                   /protein_id="CBK79288.1"
FT                   /translation="MLLRQVIELFDLLDTPAANGTTVTDLFKERGNVEVTVENVKGDEG
FT                   DTDCVTILIKGSEGKSVGGSAPTLGIIGRLGGLGARPEVTGFVSDGDGALAALAAGLKL
FT                   TEMNTKGDIMKGDVIIATHICPDAPTQEHFPVPFMGSPIDMTTNNEKEVLPEMDAILSI
FT                   DTTKGNRVINLNGFALSPTIKEGYILEVSNDLMDVMTRVTGKLPAIFPVAQQDITPYGN
FT                   DLHHLNSILQPATSTNAPVVGVAITTEQPVAGCATGACHFEDVESAARFAVEVAKGYGD
FT                   GIISFYDQKEYDHLIELYGPMNVFQTFGKDK"
FT   CDS             372563..373738
FT                   /transl_table=11
FT                   /locus_tag="CC1_03530"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79289"
FT                   /db_xref="GOA:D4J4L8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4L8"
FT                   /protein_id="CBK79289.1"
FT                   /translation="MQSSIVSEAKAIENELIAHRRHLHQNPELGFDLPETTAYVMQQLR
FT                   EYGYAPKAVGKAGISAVIGPDGGKTFLIRGDMDALPMKEETGLPFSSINGKMHACGHDF
FT                   HTSALLGAAKLLKAHESELKGQVKLMFQPAEEIMDGANDMIAAGILENPHVDAAMAMHV
FT                   LHDNLGKAGYTRGTGCGSSDVFTIKVKGVGGHGAAPHLNVDPINVACHIQLALQTINSR
FT                   EINPNELIVLTICSIHGGTAANIMPDEAVMQGTIRTMNMDVKAFARQRLIDICEGVCKT
FT                   FRAECEIDFIGDGIPPMYNDDQLLTDTIRYIDDLLGESTAQPIERMTGSEDFSALSVKV
FT                   PSVLYWFGTGSTEEGYNYGVHDCRVTFNEEAIHRMAAVYTECAMRWLEEHQ"
FT   CDS             373768..375405
FT                   /transl_table=11
FT                   /locus_tag="CC1_03540"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79290"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4L9"
FT                   /protein_id="CBK79290.1"
FT                   /translation="MKKRILALALVASMCVSLAACGNSGSKETEGTAANSSSAAAETTA
FT                   SGETEAEGDPVKGGTLTISLSASPSKLDPIHYSGVYESEIIKNVCDTLMEYNKDLSEYV
FT                   PSLATDWTVSDDGMTYVFNIRQGVKFQKGKYQDGREMTAEDVAYSLNRSGELSDSNRLS
FT                   MLDKAEATGDYEVTCTLKTANSSFLTALTDAGNAIVPKEEVEGWGDDFGSHLVGTGPFS
FT                   LESFQLDQQAVLKKNVDYWLAEPNLDEVIFKVITDSTQAANALQTGELDVAMDLKGESV
FT                   QKVKDNADLTLLETPGLHVAYIYFNMEQGPTADIKVRKALIEAVNVEEMVASLYKYGEA
FT                   QKASLPLPPGSWGYDASLESKVPGYDPEDAKALLAEAGYGDGLTLDLYISDTEARQNMA
FT                   VLLQAYWAQVGVTLNIHASEWGTFSEVAMSNNADVYGMSWTWYPDPYFFLNKLFSTDEF
FT                   GGIGNGQHYSNPQVDELLQKALEATDQADRADYYKQALALIVDDLPGLFYANENVIYGV
FT                   NGRVHDFIQRADSTVKFVTTENNVWVTD"
FT   CDS             376473..377387
FT                   /transl_table=11
FT                   /locus_tag="CC1_03560"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79291"
FT                   /db_xref="GOA:D4J4M0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4M0"
FT                   /protein_id="CBK79291.1"
FT                   /translation="MADITKTTSADALGLDAQAEMLKTERRANNVWNKLKRNKTAMIGL
FT                   VIVVVMVFIAVFAPVLAPYDPNEIHPLDAFLKPFSEGHIFGTDQFGRDLLSRVIYGARV
FT                   SLIVAAGGTLVGGVIGVLLGLIAGFMGGIVDSVIMRIMDGFLSFPFVLLSIILMTVLGQ
FT                   GLINVIIAIGIGNIPSFARVVRGEVHIVKNEEYCNACRVIGVSNTRLLFTHILPNAISP
FT                   IIVYATLNVASAIISEAALSFLGLGIAAPTASWGSILREGKSSLTTAPFVATISGAFIL
FT                   ITVLGFNLFGDGIRDVLDPKMKQ"
FT   CDS             377590..378768
FT                   /transl_table=11
FT                   /locus_tag="CC1_03570"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79292"
FT                   /db_xref="GOA:D4J4M1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4M1"
FT                   /protein_id="CBK79292.1"
FT                   /translation="MENKQTVQKRIEEIMPDLRELSDYLWHHPEYSFHEFKACKAMSEL
FT                   LRKYGFQVETGVGGIETSVKAVYDSGKPGLNVGFVGEFDAFPGMGHACGHNLMCAIACG
FT                   AGIGLKSVIDTLGGKITVLGTPAEEGGGGKITMLENGAFEGLDFAMLTHASSDTCVNDI
FT                   SYSRTDIRVHYYGKTAHAATWPEEGISALTPVLELFNIVNAMRLELGDKGKILGIIRDG
FT                   GDQAIFIPDHCSAEFTIRSFSMKYKWELFHRFIKICENVAAITGTRFEYEMIDLSYEDI
FT                   RNNPVLEDTLAENFKVLGEELCPRLKEQGIGCTDMGNVTHALPGIQAYIRLRPGLRVHT
FT                   PEFEEATGSPDGYRAIEAAAKGMAMTAVDILSDSSKMEAVRKAFSEMKAQYE"
FT   CDS             378782..379795
FT                   /transl_table=11
FT                   /locus_tag="CC1_03580"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79293"
FT                   /db_xref="GOA:D4J4M2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4M2"
FT                   /protein_id="CBK79293.1"
FT                   /translation="MSENILTVKDLKTYFYTASGIAKAVDGVSFNIAKGETMGIVGESG
FT                   SGKSVTSSSIIRLLPPRTGKIVGGSIEFEGKDVLALSKKELNDFRGKDIAVIFQDPMTS
FT                   LDPVFKIGKQMTEMIMAHQNVTKDEAWKMAVEALSKVGIPEPEKRMNSYPYELSGGMCQ
FT                   RVIIAMAVCCKPKLIIADEPTTALDVTVQAQVLELLKELQRDMDTAILLITHNLGVVWE
FT                   MCDKVMVMYAGNTVEFTDTKTLYSNPRHPYTWGLLDSMPKLSDESKGELKTIPGTPPDL
FT                   RLTGKCCNFYNRCPYVTEACTQSVPPLVEVEPGHFVACHRQNLTNKLEKGEGLKDE"
FT   CDS             379788..380768
FT                   /transl_table=11
FT                   /locus_tag="CC1_03590"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79294"
FT                   /db_xref="GOA:D4J4M3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4M3"
FT                   /protein_id="CBK79294.1"
FT                   /translation="MSNEKKVLMKIEHLTKEFEIKSKKLGGKPQILHALNDVSVDIYEG
FT                   ETLGVIGESGCGKSTFGRTLIQLHKATAGSVTFDGKDLFSLKGAELKKAKKDVQMVFQD
FT                   PYSSLDPRKTAGKLIEEPLIVHKLISDKNEREKRVLELMREVGLDIQHVHRFPHEFSGG
FT                   QRQRINVARALAMNPKVIVCDEPVSALDVSIQAQVLNLFNRLQQQYNLTYIFISHDLGV
FT                   IKHVSDRIAIMYLGRIVELCEADAIYENPLHPYTKALLSAIPPVSPFAKKERIVLKGDI
FT                   PSPIGDQIGCPLAGRCPNCMDRCRKEIPKLKDAGDGHQVACFLYE"
FT   gap             380772..381140
FT                   /estimated_length=369
FT   CDS             381220..382482
FT                   /transl_table=11
FT                   /locus_tag="CC1_03600"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79295"
FT                   /db_xref="GOA:D4J4M4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4M4"
FT                   /protein_id="CBK79295.1"
FT                   /translation="MNNVTRNDVWELAKSRRNDLVKLASDLIRIPSENPVGTQRDVIDF
FT                   VEKYLSDAGISYEEVSCNPDHPNVLAKMGSDDGFSVILNGHVDVVPAGDRSQWDYDPFG
FT                   GEITDKRILGRGASDMKAGVAGLLFAMKVLKDSGADLKGNIRLHIVSDEESGSEYGTTW
FT                   LCEQGYAEGANAAIIAEPTTNWTIESGQKGNLHIVFKSIGKSAHGSLGNYKGDNAILKL
FT                   NKVLANIEMLTKIEGHYPEDLLQSLANSQMVAEKELDMKGIGNVINHVSANVGLISGGT
FT                   RPNMVPDYCEATIDCRLPYGVDHEEIENTVKEMIKAAGVEGVEYELIWKSEANVTRDDS
FT                   DIVQAIKKNAEAIWGITVYPAWQWACSDAREYRLKGVPTIQYGPSNTEGIHAPNENVDI
FT                   EDVVNAGQIYVLSLCDLLGVK"
FT   CDS             complement(382562..383863)
FT                   /transl_table=11
FT                   /locus_tag="CC1_03610"
FT                   /product="Aspartyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79296"
FT                   /db_xref="GOA:D4J4M5"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4M5"
FT                   /protein_id="CBK79296.1"
FT                   /translation="MQTLPKEIEQLFHYLQNGTSAFHVIAHTKQVLTEAGFTELHIKDN
FT                   WTLTKGGRYFCSPFDTTLYAFTIGESCDLSNGIHIAGAHTDFPAIKIKPNPEIFSHGYM
FT                   QLNTEVYGGPILNTFFDRPLSLAGKVVTKGDRYDRPVSHLVDLKRPAVYLPNLAIHMNR
FT                   AINENGAPIDNQKHLLPILGTLNEYLNKDTTFMDLLSKEIGVDAKDILDYDLCMYNLDQ
FT                   PELVGFTEEFISAPRLDDVTSVCALIHGLVESKNSDRVNLVCLFDNEEIGSLSKQGADS
FT                   TLPSVIIGKIWQAFGKNQIDCMSDISDGLMLSVDVAHAYHPNYPGTQDITNYPIMNGGF
FT                   ILKTASNQSYTWDCESMASLIALCQQENIPYQRFAKHSNTKGGGTIGSIISSHLPMRTA
FT                   DIGVGLLAMHSSREMMGKDDQIGLTHFAKAFFEN"
FT   CDS             384108..384947
FT                   /transl_table=11
FT                   /locus_tag="CC1_03620"
FT                   /product="EDD domain protein, DegV family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79297"
FT                   /db_xref="GOA:D4J4M6"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4M6"
FT                   /protein_id="CBK79297.1"
FT                   /translation="MAYHIAVDSCTDMTAAMKKDEHITLVPLTLNVGEDKVIDDETFNQ
FT                   AEFLRKVAECPEAPSSACPSPDAYMQAYGYNNEDAYAITLSSELSGSYNSAKLGADLLK
FT                   EEYPDKKIHVFNSRSASAGQTLILMKLQECLEAGKAFSEVVSEVEQYIEEQTTLFVLES
FT                   LETLRKNGRLSGLKATLVNVLNIKPVMGSTPEGTIQQLDMGRGMKKALMKMIEQIGKTV
FT                   IHPTDKYLLISHCNCLKRAEWLKVEIEKKYAFKGIVIVDTAGVATMYANDGGIVVAY"
FT   CDS             complement(385132..385950)
FT                   /transl_table=11
FT                   /locus_tag="CC1_03630"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79298"
FT                   /db_xref="GOA:D4J4M7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4M7"
FT                   /protein_id="CBK79298.1"
FT                   /translation="MSDLTILYPVSNTSREEFLAERKKKKNFITGMRFFILIFILAGWE
FT                   IAARCHLIDAFIFSSPTRIFKVMLQMAADKSLFYHIGITIGETLVSFVLVLTIGTLIAM
FT                   LLWWCRSAADILEPYFVVLNSLPKTALAPILIVWLGNNMKTIIVCGVTMAVFSTIINLY
FT                   TAFIHIDSDKLLLIRTLGGTRRDILRYIVLPASISAIVSNLKVNIGLCLVGVIIGEFLA
FT                   ANAGLGYLIIYGSQVFRLDYVMLSIIILCILAMVLYQLLSFVEKRYQKKQ"
FT   CDS             complement(385943..386683)
FT                   /transl_table=11
FT                   /locus_tag="CC1_03640"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79299"
FT                   /db_xref="GOA:D4J4M8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4M8"
FT                   /protein_id="CBK79299.1"
FT                   /translation="MKPLLDLTDVNYTYQTAEGETPAVKNLSFRVFPDHFLGIIGPSGC
FT                   GKSTILSLIAGLIQPNSGKIAVSAEIGYMLQKDHLLDWLSIKDNITLGPRIHHKLTPEK
FT                   ESWADKMLEEYGLAPFADARPSQLSGGMRQRAALIRTLALSPGLLLLDEPFSALDYQTR
FT                   LTVSDDIYRILRTQHMSAVLVTHDISEAISFCDRIIVLTSRPASVKKTFDIHLTLDEDR
FT                   TPFKARMAPEFKDYFNEIWGELNV"
FT   CDS             386763..387671
FT                   /transl_table=11
FT                   /locus_tag="CC1_03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79300"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4M9"
FT                   /protein_id="CBK79300.1"
FT                   /translation="MHSYGIDVRTRQMAFGTGRVAWCSQCYKVRRFYMDKKHRYSAGML
FT                   AAALIVGIGIGFCGGFAVGGHTGSRQQNMAAGAEQNFETGDLSMEESQKTESGTDSSGE
FT                   TEIEPIGSYAVDDEPVLTIDDTTVYLSEINARAYMARDQYVADYGEEPWDTKMDNGMTV
FT                   GEYAKATMLDEIERAVILCNKADEYDVPALTDDEEKQCASKAEDYMASIGEDIAAQFSV
FT                   EQSAVLAIYEKDALSMKVYNQILENLSETLRQEEDYKDMEDSEFEQVLNDKFEEQYAQW
FT                   KDTCKVETTETWEQLVIGAVG"
FT   CDS             387757..388911
FT                   /transl_table=11
FT                   /locus_tag="CC1_03660"
FT                   /product="Putative virion core protein (lumpy skin disease
FT                   virus)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79301"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4N0"
FT                   /protein_id="CBK79301.1"
FT                   /translation="MGLKNLIKGQLLSSISYRSSDPQELAAVYDRDGRRIMYESVLTVM
FT                   PGQAAILVNEGQMTDIFMPGRYELTTNNMPVTTTLNQWKYGFHDTFIVDIIFVNTNEII
FT                   DIPWGTSEQVTVKDEVFGLVNVGANGKYSLSITDPKLFAENLMGVKNRYTVADLKSFVT
FT                   PQIAMYFKEIVTEKQMDFFDMQGYCYEAAQILKAKSDDFFGRYGIQMQKMAVQVALPET
FT                   VKKSIDERASLGAFGGMDAYAYKRQVDAQADAMVAMAKNPNGGMNSMAGMGMQMSAGMA
FT                   FGGMMAGQMNGGVQGQSGTHKESFVICPKCGSEMKKGLKFCSECGASLVVQKKKCIKCG
FT                   AEINADMKFCPECGANQAQPVCPKCGYKAAAGQKFCPECGTSLL"
FT   CDS             388998..391304
FT                   /transl_table=11
FT                   /locus_tag="CC1_03670"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79302"
FT                   /db_xref="GOA:D4J4N1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4N1"
FT                   /protein_id="CBK79302.1"
FT                   /translation="MSIYESLNPVQQEAVYHTEGPLLILAGAGSGKTRVLTHRIAYLID
FT                   ECQVNPWNILAITFTNKAAGEMRERVDQIVDFGAEDIWVSTFHSTCVRILRRYIDRLGY
FT                   DRSFTIYDGDDQKTVIKEVCKKLNIDTKIYKERTLLSAISSAKDEMIGPKEYLLRSEGD
FT                   YARQRIAQVYEEYQKRLRSNNALDFDDLLFKTVELFKTDAEVLNYYQDRFKYIMVDEYQ
FT                   DTNTVQFQFVSLLAAKYRNLCVVGDDDQSIYKFRGANIHNILDFEKTFPDAKVIKLEQN
FT                   YRSTKTILNAANGVIHHNQGRKDKTLWTDNEQGVPIALNQYQTEYEEAMGIVNDIAAKT
FT                   ERHEAEYKDFAVLYRTNAQSRVLEEKFVTRNIPYRVVGGVNFYQRKEIKDILAYLKIIN
FT                   NGQDDVAVRRVVNVPKRGIGATTVTKAAEYADQWGISLYEAFKQVDGIPGLGRAAAKIN
FT                   GFVNLIQVFRTKAEYMSLAELYDEVLEDTGYLKELQAEQTDEATTRIENLDELRNKIVA
FT                   YEEETEQPSLNELLEQIALVADVDNMDDSDNKVILMTLHSAKGLEFPYVYLCGMEDGLF
FT                   PSYMTIVNDDPMEIEEERRLCYVGITRAMKKLTLSYAMCRMMHGQTQYNKISRFVKEIP
FT                   PQLIGGSLPRERFPRKAEDDLPWNTGSASNGISGFGGGRAGTYGSGSRMGTGVGNRGIR
FT                   QSHKFDVSAFAKKGGDMKKTAPDYEVGDTVKHIKFGTGVVQAIKDGGKDYEVTVDFPKY
FT                   GPKKMFAGFAKLKKV"
FT   CDS             391379..391666
FT                   /transl_table=11
FT                   /locus_tag="CC1_03680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79303"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4N2"
FT                   /protein_id="CBK79303.1"
FT                   /translation="MNKFEEYLSMAKISDFIHRKELEDEKKKTVCLVFAIIAGIAAIAA
FT                   IAFGIYKYLSREDDVDDFEDDFEDDFDDDFEDEEDDFVKEDEAAPAKDEE"
FT   CDS             391824..393215
FT                   /transl_table=11
FT                   /locus_tag="CC1_03690"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /function="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79304"
FT                   /db_xref="GOA:D4J4N3"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4N3"
FT                   /protein_id="CBK79304.1"
FT                   /translation="MKKGQMCEGIIEYIDFPNKGRVKVEDQYVTVKNGIPGQKIRFVIN
FT                   KKRKDRCEGRLLEVLEKSPLETIEPVCHEFPACGGCMYQTMGYDEQLKMKAGQVKKLLD
FT                   TAISSAGQVDAEGKPDYVFEGITGSPKQWAYRNKMEFSFGDDHLDGPLTLGLHKKASTY
FT                   DILTVDDCKIVHDDFTTVLKTVLDYFTEHPMPYYKKMKHTGYLRHLLVRRSETTGEMLV
FT                   HLVTTSQEECDLTELTQRLLDLQLEGRIVGIMHIINDTLADVVQSDETRILYGQDYFYE
FT                   HILGLKFKISTFSFFQTNTLGAELLYDIARSYIGDTKDMTVFDLYSGTGTIAQILAAVA
FT                   KKVVGVEIVEEAVEAAKVNAGLNQLDNCEFIAGDVLKVLDTIEDKPDYIVLDPPRDGIH
FT                   PKALDKIIDYQVPNMVYISCKPTSLARDLGVLIERGYKVKKTHCVDMFPGTVHCETVCL
FT                   LSKKP"
FT   CDS             394568..395071
FT                   /transl_table=11
FT                   /locus_tag="CC1_03710"
FT                   /product="Adenylate kinase and related kinases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79305"
FT                   /db_xref="GOA:D4J4N4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4N4"
FT                   /protein_id="CBK79305.1"
FT                   /translation="MKIHIIGCSGSGKTYLANALSKKYNISHFDLDDIQWDNNAKEYGK
FT                   KRTLDERKALLQEILYNNDEWIIEGVYYAWVQQSFDEADKIYVLDMPGYLYKSRIIMRS
FT                   IKRKLGIQKGKRETLKSVYNLLKWTETFQNKNLKEIRSILDRYDDKVIWLSRKKDVEKI
FT                   IKAV"
FT   CDS             395334..396371
FT                   /transl_table=11
FT                   /locus_tag="CC1_03720"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79306"
FT                   /db_xref="GOA:D4J4N5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4N5"
FT                   /protein_id="CBK79306.1"
FT                   /translation="MDIGVVIKKYRKEAGMTQEEMANRLGVTTPAVNKWENSNSKPDIE
FT                   LLAPIARLLDISLDTLLSFHENLSDTEIEEIIRKMDRMFSEEGYEKTYEWALRLIKEYP
FT                   NCNMLIWQAAVILDARRIMDKCTNPEKYDKQINAWYELALHDENEEIQHHAADSLFGFY
FT                   LRKKNYTKAEKYLDYFSEHDPMKSYYQGRLLQKQGKIKEAYEKYENIIFSGFSTLNFVL
FT                   STMARLALRENDIGYARFLSGKVQAVAHTLEMGKYNEYSPMLDIVCAGKDVEGTYKVVK
FT                   HLLDNVGTMYDFRKSGLYKHMKFRDIDEAILDGVKEKLLEGFRNEEEFGYMAGYEPWEE
FT                   LIFDR"
FT   CDS             396479..396850
FT                   /transl_table=11
FT                   /locus_tag="CC1_03740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79307"
FT                   /db_xref="InterPro:IPR026989"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4N6"
FT                   /protein_id="CBK79307.1"
FT                   /translation="MKSTFEKMGGTYTLGADGIYYPNLVSTDEEPHYGKYGMMRKTYLK
FT                   EHRPARYSLYMLEDRLTEHLNAVDDEAQERMGILVRQMMEKQGVTEELKARDQMEWVRA
FT                   VNGICNMAEEIVLNELIYR"
FT   CDS             397169..397930
FT                   /transl_table=11
FT                   /locus_tag="CC1_03750"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79308"
FT                   /db_xref="GOA:D4J4N7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4N7"
FT                   /protein_id="CBK79308.1"
FT                   /translation="MYQISNEKFGLFVTELRKEKNLTQKDLAEKLYVSDKTVSKWERGL
FT                   SMPNVVLLIPIADILDVSVTELLRGEKIDRQKNIDTKEVEELVVGSLDMAVSNSIHRHR
FT                   KNWILAYLLCFLISITEIIMLVVSGNLIAEMKDDILLVTGLMLLFGAWFCFFAKDMLPT
FT                   YYDANKINYVSQGIFRIHLVGLSLNNGNWMYICTTLKIWTLATVVLYPLAGIIIINCLN
FT                   IALWDILSKIFLIMILGGMVVSIYIIGKKYE"
FT   CDS             398108..398593
FT                   /transl_table=11
FT                   /locus_tag="CC1_03760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79309"
FT                   /db_xref="GOA:D4J4N8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4N8"
FT                   /protein_id="CBK79309.1"
FT                   /translation="MANDNQIAFLCSRLKELREKNGCTMDDMAKKIDVLEGLKPGTGMN
FT                   KSSISRVEGGKTTEKTLLEMARKYCKAFGMSESQTEQFLRGEKVAVPDTSALLKDSQLI
FT                   DELNKEYSKVVIPKVVVDELDNIKNKNSGSLGRKAWEVIRGISYGSRLQQGFRRIHL"
FT   CDS             398924..399223
FT                   /transl_table=11
FT                   /locus_tag="CC1_03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79310"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4N9"
FT                   /protein_id="CBK79310.1"
FT                   /translation="MSFNIIKNTLETQENGVLIIENDVYRIKMRYIGNYREDLKNHKLN
FT                   TDFLTVNSKIKQAHSVYMPTFTLMHDEVMFKIIDTGAGIFDEKSMDNMIADLDS"
FT   CDS             399220..399342
FT                   /transl_table=11
FT                   /locus_tag="CC1_03780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79311"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4P0"
FT                   /protein_id="CBK79311.1"
FT                   /translation="MRDRSKEIAMLEDTLKILKQGWYEKNGNFFQKCGMHMVKN"
FT   CDS             399409..400734
FT                   /transl_table=11
FT                   /locus_tag="CC1_03790"
FT                   /product="transporter, NhaC family (TC 2.A.35)"
FT                   /function="transporter, NhaC family (TC 2.A.35)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79312"
FT                   /db_xref="GOA:D4J4P1"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4P1"
FT                   /protein_id="CBK79312.1"
FT                   /translation="MREGKGIALLPIGVFLVLYLGLGILFEYVMEIPMGFYNVPIVVAF
FT                   LAAILVACLQNRALNFDQKLEIMAQGVGDKNIITMLLIFLTAGSFVGVVGRSSAESVAY
FT                   CMLSLIPARFSVAVLFIVGCFVSVAMGTSVGTITLLTPIAVAVSTASGFDLAFCVASVM
FT                   GGAMFGDNLSFISDTTIAACNGQGCEMKDKFRENFWIAFPAAVVTLILILMLSFQTEIQ
FT                   GHVIQPYHLTQVIPYVLVLIGGIVGINVFVVLLIGIVSGALIMLIGGHTVPVEILKNMG
FT                   SGVSGMFETCMVAILVAAMCALIREYGGFDALLSWIHRIFRGKKGGQLGMGFLVGTMDI
FT                   ATANNTVAIVMANPIAKEMAEEYGITPRKTASLLDTFSCVFQGVIPYGAQMLVAISAVN
FT                   ELGGEISAFQIMPKLFYPLLLLLSSLITIMKSTERTETASHE"
FT   CDS             400727..400861
FT                   /transl_table=11
FT                   /locus_tag="CC1_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79313"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4P2"
FT                   /protein_id="CBK79313.1"
FT                   /translation="MNKFSHKMNFDGTKEVNRECLEQANQIIEDGIDAQKLYLLSSTA"
FT   CDS             400998..401384
FT                   /transl_table=11
FT                   /locus_tag="CC1_03810"
FT                   /product="Predicted thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79314"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4P3"
FT                   /protein_id="CBK79314.1"
FT                   /translation="MEMKAGMKFETEIIVNEGMLANHNDPQLPAIELPAVFSTPSMINL
FT                   MELTCAKLMDNCLEEGKGSVGMSVEVRHLASTPCGKKVRCEVEITEVVNGKKVTFAVNA
FT                   YDENGLIGTGTHKRAVINKAAFNM"
FT   CDS             401715..403472
FT                   /transl_table=11
FT                   /locus_tag="CC1_03820"
FT                   /product="threonyl-tRNA synthetase /Ser-tRNA(Thr)
FT                   hydrolase"
FT                   /function="threonyl-tRNA synthetase"
FT                   /function="Ser-tRNA(Thr) hydrolase"
FT                   /EC_number="6.1.1.3"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79315"
FT                   /db_xref="GOA:D4J4P4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4P4"
FT                   /protein_id="CBK79315.1"
FT                   /translation="MVNFKEDEQLKMLNHSCAHLMAQAIKHLYPQAKFWVGPVVAEGFY
FT                   YDVDLGDDVIRDEDIAAIEKEMKKVAKSGKKIVRHEISKEEALEMFKDDEYKIDLINGL
FT                   EDGNISCYTQGDFTDLCRGPHVDNVKLCRHFKLLRHSGAYWKGDSKNKVLQRIYGVCFP
FT                   TAEELEAHLQLLEEAKERDHRKIGKDMELFMVDDLVGRGLPMFLPKGYTIWQELENYIK
FT                   EKERKLGYQHVMTPCVGTVNLYKTSGHWDHYKENMFPAMEVDDEAFVLRPMNCPHHMMI
FT                   YANKRHSYRDLPIRIGEIAHDFRYEASGTLKGIERGRHFCQNDAHLFVTPEQIKDEISR
FT                   VVDLIFSTYEDFGITDYRCVLSLRDPEDKAKYHDDDEMWNKAENALREVMNELGLEYTE
FT                   EIGEAAFYGPKLDVNVKPAVGNEITLSTCQLDFCLPAKFQLTYVDKDGEMKTPVVLHRA
FT                   ILGSLDRFMAYILEETKGNLPTWLAPIQVKVMPVKTDDDDLNAYANEICELLEAQNVRV
FT                   DLDDRAEKLGYRMREGQIQKVPYLLVIGFNEKDNRTVSYRLHGEKDTTVVGLDEFVEKI
FT                   VDEIKNKVH"
FT   CDS             complement(403453..404343)
FT                   /transl_table=11
FT                   /locus_tag="CC1_03830"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79316"
FT                   /db_xref="GOA:D4J4P5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4P5"
FT                   /protein_id="CBK79316.1"
FT                   /translation="MILNRYEIFLKTAEIGNITKTAEILHYTQAGISHAIAALEKETGF
FT                   SLLARSASGVTLTENGKRLLPYIQTLVNDQHGLSQAIYDINETVAGTLRIATFTSVSTQ
FT                   WLPTIIRKFQADYPLVEFDLLAGDYDEITERILSGRVDCGFLTAPVADPLVFHLLYKDP
FT                   MNVLLPERHPLTRQNVLTLPEIKKEPLVLPTKGSDNDIQAVLNSTRGKTNVRYVLNDDL
FT                   SVISMVSHGFGITIMPELILRNLNYSLEIRPIDPPQYRAIGIASMPLNRVSVLTKTFIQ
FT                   YLTDPSKIDFNELCS"
FT   CDS             404513..405412
FT                   /transl_table=11
FT                   /locus_tag="CC1_03840"
FT                   /product="Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79317"
FT                   /db_xref="GOA:D4J4P6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4P6"
FT                   /protein_id="CBK79317.1"
FT                   /translation="MREYGWTQQRADSMLALVAMAWGSSYLLMKIGLDGIPPFCIIALR
FT                   FGIAFIAVSLLFFKKFKKTTKRVMMKGAVLGLFLFGLFAFLMHGLQTTSASNGGFLTST
FT                   TVVLVPLFHAVIKKKMPDHQNVLSILLTMTGICLLTLQQSLVFHSGDILCLAGAAVYAV
FT                   QILLTDKFAQEEDGMLLGIWQLGFAALYGVICTFMFETPTLPSSSSQWIAILGLAFVCS
FT                   AFGFVMQPMAQKYTTPEHTGLLFALEPVFSAVFSYIFLHETLSGKGYMGAMLVMAGVVA
FT                   ASVVRKKRQLVRVVAHQS"
FT   CDS             complement(405479..407251)
FT                   /transl_table=11
FT                   /locus_tag="CC1_03850"
FT                   /product="Response regulator containing CheY-like receiver,
FT                   AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79318"
FT                   /db_xref="GOA:D4J4P7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4P7"
FT                   /protein_id="CBK79318.1"
FT                   /translation="MKYTIRVLAIAPYEGLAHLLKLIGSQYDMLHLDIFVGDLEQGLTI
FT                   ARSHLPGRYDAVISRGGTADRIRCITPLPVIDISFSVYDILRSLKLAENYAQNYAFVGF
FT                   QSIIDTVHILCDLLQYRIETHVVNSEEEIAPTLEQLKKQGITLVFGDTLTHEIAGEMGM
FT                   NAVFINSGAESIHEAFRQVIQMFNTFSMFDSRVHLLEDAMRLQTSSSIILQEDGKLYFS
FT                   SYDEDDAEEVLNYLQGMISSALPDRQSKSFHLIGEKLFSIQMQKKNYKDNVFYLFSLGL
FT                   SPIPKGSSKNGVRYYNHEEIKSNYFTSFFCLTAKASDLNTTLHEMNASRRPIMILGERG
FT                   TGKDHIAYRLYLESPYTNKPFISIDCKLITERYWTFLTKHINSPFCDNDNTIYISNIQD
FT                   LSDSWCRQLLSLILDTHLYKRNRLMLSCSLSIESDRDPSRDFIDYLPCTSLYMPPLREL
FT                   TDDLPSASALYLNKLNSELSKHISGFEPDALKILCDYDWPDNFLQLKRVLSDVVIHTTG
FT                   NYIQVDCVKEILAREMTQYAMTAPVKSTIDCNQPLQDIIKNVVLSTLQDCGGNQTKAAQ
FT                   RLGISRTTMWRYLK"
FT   CDS             407829..409127
FT                   /transl_table=11
FT                   /locus_tag="CC1_03860"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79319"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4P8"
FT                   /protein_id="CBK79319.1"
FT                   /translation="MVKLLILADDFTGALDTGVQFSGKGIRTQVVVSSHWVEPDSDCDV
FT                   MVIDMETRHVPKEKAYEIVYDVCQQAVKYGIRCFYKKTDSALRGNVGSELQAAVDAVSG
FT                   KNIVFVPAFPAMRRITVDGVHYIDGIPVKESVFGQDPFEPVMYDRVDELLRATGYKGGV
FT                   IGVGKAERKLQAAEERKTQASEERGQKAAEAAKQQLFLYDAETDADLDEIAESVGKKKD
FT                   IPILAGCAGFAAKLPELLKLSVKESDDVKLKENLVFLCGSVNPITKSQIVYGEKMGIPR
FT                   IHLKPEEKLEISYWNQPVGLEKIRQLAKDGMQHIIIDSNDEEGHNDTMEYAAKKGYSIE
FT                   DVRVRISETLGYLLKKLIDAGMEATYLITGGDTLIGFMKAIGVSELEPMNEIRPGCVLT
FT                   SLNYQDKKHYVITKSGGFGQERLIEQLTRILAQ"
FT   CDS             409236..410393
FT                   /transl_table=11
FT                   /locus_tag="CC1_03870"
FT                   /product="Alcohol dehydrogenase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79320"
FT                   /db_xref="GOA:D4J4P9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4P9"
FT                   /protein_id="CBK79320.1"
FT                   /translation="MLEQYTLKMPHAVYAGKGALANVKDITAQNAKKIAVFADQGIIGA
FT                   GLLEAPLNYIKEAGVAYELISDLAAEPTCDQAQDVVNEFRNKGCDFIVAVGGGSVMDTA
FT                   KLCSILATDEYQVRDLLDNPKLAKKCVKSLMIPTTAGTGAEATPNAIVAVPEKELKVGI
FT                   VNDEMIPDYVILDGEMIKNLPRKIAASTGIDAMAHAIECFTSNKANPFSDTFALKAFDL
FT                   IINNIEAACDDKTADDARNNMLIAAFYAGVAITASGTTAVHALSYPLGGKYHIPHGVSN
FT                   AIMLAPVMKFNEPVVREKFAAAYDRVNHNGDASLSVEEKSAWVLDRMCSIIKHLDIPTS
FT                   LKEYGVSKDDLDFLVTAGMDVQRLLVNNMRKVTAEDARALYLEIL"
FT   CDS             410475..411374
FT                   /transl_table=11
FT                   /locus_tag="CC1_03880"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79321"
FT                   /db_xref="GOA:D4J4Q0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Q0"
FT                   /protein_id="CBK79321.1"
FT                   /translation="MKNVEIKGIIPPIITPMNDDESINAAELRNQVNRLIDGGVHALFP
FT                   FGTNGEGYILNDQEKELVLKTVIEETNGRVPVYAGTGCISTKDTIRMSKMAESLGADVL
FT                   SIITPSFAAASQNELYEHFKAVAEAVPNMPIVLYNIPARTGNAIAPDTVGRLAEIDNIV
FT                   GAKDSSGNFNNILEYIAKTDKNFSVLSGNDALIIWNLLAGGTGGIAGCANLYPKTMSSI
FT                   YDLFMEGKIEEAKAANASIASFRACFKYGNPNTIVKTAVALMGHPVGKCRAPFNQVPEA
FT                   GIEAIKKVLKENEAKGMA"
FT   CDS             411388..412422
FT                   /transl_table=11
FT                   /locus_tag="CC1_03890"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /function="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79322"
FT                   /db_xref="GOA:D4J4Q1"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Q1"
FT                   /protein_id="CBK79322.1"
FT                   /translation="MSKKPILGITMGDPASIGPEITVKALSDPAIYEKCSPIIIGDAAV
FT                   MEAAVGIVGKNVKINAVSDVKEAKFEFGIIDVYDMKLVDMDKLERGVVSAMAGNAAFQY
FT                   VKKVIELAMNHEVDATVTNALNKEAMNLAGHHYSGHTEIYAEYTGTKKYTMMLAHENLR
FT                   VVHVSTHVSLREACDRVKKDRVLEVIRIADQACKELGIKEPKIGVAGLNPHSGENGMFG
FT                   REEIEEITPAIEAAKGEGIIVDGPVPPDTVFSKARGGWYDIVVAMYHDQGHIPLKVVGF
FT                   VYNQAEQKWDAVAGVNITLGLPIIRASVDHGTAFDQAGKGVANELSLINAMDYAIRMSE
FT                   GRTK"
FT   CDS             412436..412924
FT                   /transl_table=11
FT                   /locus_tag="CC1_03900"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   small permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79323"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Q2"
FT                   /protein_id="CBK79323.1"
FT                   /translation="MEKAKNHWFKELEENVIAVGIIIMFIMETVNVICKFLAPGWMGIP
FT                   EEISIFAYIWVCFFCASYCTKRGANIIVDALTAKYPKKLQNFLFSAQFVFDGILTVFFI
FT                   YGSVIFVAQTKAEGSVGVTGMPLWIIYLAPLVGFALNLIRDIQMFIKTIKSSEEVSVS"
FT   CDS             412945..414228
FT                   /transl_table=11
FT                   /locus_tag="CC1_03910"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   large permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79324"
FT                   /db_xref="GOA:D4J4Q3"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Q3"
FT                   /protein_id="CBK79324.1"
FT                   /translation="MLGVIFGVFFVVLLLFGFSMVAAYGAAFIIPSLMTGGSLYQMSDI
FT                   VGWLTSAAGKTTYVAIALFVVSGNIMSQGQLTEKIFNVFRYFLGRFRSCIPLVAVLTAI
FT                   FYGMISGSGMAVVAAVGAMVLPILIEYGYDRLFFACMIAAAGSLGQLIPPSSAILQYCA
FT                   MAGTDEGQMFKVGAVIGLTCAVALIIITLLHCRKDQGDQTKIRESYEALRAEGIGKVIG
FT                   HGIWGILSPVIILGGIFSGLLTVVEAAAVSVVYACIVSLFIYKSLDLKGLWLAIVGSVK
FT                   NVASVAMMLAFAVAFSKLMDVFNGGEIIGTAITSVLSSPQAFIFVSIIVMSIGMMFMNP
FT                   IAIIVPIVAPIAASFGIDPMVYGAGMSGIVAIGSLTPPFGVSLYIMAPIAKVEPFKIAK
FT                   SILPLWGIMTLIIAIYMFFPQLSTWAYM"
FT   CDS             414267..415427
FT                   /transl_table=11
FT                   /locus_tag="CC1_03920"
FT                   /product="Predicted neuraminidase (sialidase)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79325"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Q4"
FT                   /protein_id="CBK79325.1"
FT                   /translation="MEFKHIQGLTPDGTVYYNEDMGTLEAMVPPGKYSTAHAPALLELE
FT                   NGDMLCAWFAGSFEGSKDISIVCARWENGSDHWSEPVQVSYDSERSEQNPSLFKGPDGA
FT                   VWCMYTAQLDRMEGKDNMQFTSIIRCQKSFDGGKTWGEAEVIFPEEGSFCRQPIQVLSN
FT                   GRWIFGNWICTDSVNGLEGDPTAFRISDDEGRTWKKVDMPESNGAVHANVVELEGGKLV
FT                   CFLRSRFADNIYISESKDWGDTWTKPVPTVLPNNNSSISALKLASGRIAIAYNPTHAPH
FT                   PVYGKVAWPGLRCPVAVALSEDGGKTWPMIRVMERGEGFTGDENTTNNKQYEYPYLMQG
FT                   KDGRLHLAFAYKNRIGIKYMSFTEEDVMGEKRETAGFYNPTSAQIK"
FT   CDS             415567..416019
FT                   /transl_table=11
FT                   /locus_tag="CC1_03930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79326"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Q5"
FT                   /protein_id="CBK79326.1"
FT                   /translation="MIIDHIKHISFYEPMAAGITEAWNAIQAMLQEKGELPDGRYELKK
FT                   GFFKVQRGETKPLSEGTFESHQKYIDVQILLEGQEEMAWMELDNLTEAIPYDEEKDAAR
FT                   WNGECTHHMLITKDMFYIAYPHDGHKAVSHVDEKNTFIKIILKLPV"
FT   CDS             416185..417549
FT                   /transl_table=11
FT                   /locus_tag="CC1_03940"
FT                   /product="Predicted transcriptional regulator containing an
FT                   HTH domain and an uncharacterized domain shared with the
FT                   mammalian protein Schlafen"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79327"
FT                   /db_xref="GOA:D4J4Q6"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Q6"
FT                   /protein_id="CBK79327.1"
FT                   /translation="MVFRESETVELKEVVVDDIKKEIIAFANCDGGKLYIGVRDDGTVV
FT                   GLDNPDGTALQISNMVRDAIKPDITMFLHYETVEENGKKIVAIDIQSGTDRPYYIAKKG
FT                   MRPEGVYVRQGYSAVPATDTAIRHMIKETDGDRFEAMRSLNQELTFNAVKKAFEQRNVD
FT                   FGVQQMRTLNIIDSDGLYSNLAMLLSDQCTHTIKVAVFQGTDQTVFRDRKEFAGSLMQQ
FT                   MNDVYAFIDFRNQTHAAIEVLLRIDTRDYPEIAVREALLNLLVHRDYSFSASALISIYE
FT                   DRIEFVSIGGLVPGIELEDVMAGISICRNQDLANVFYRLQLIEAYGTGISKMMMAYRDM
FT                   LQKPVIETTKNTFKIILPNVNVQKQYAQTKPPVYRVEDQSMQYSYNAAEIKGLSDEEEI
FT                   ILEYIGKHDRLTKQQAAELLEVSASTATRLLKRMVESHMLKRNGKARNTYYTEIK"
FT   CDS             417761..419197
FT                   /transl_table=11
FT                   /locus_tag="CC1_03950"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79328"
FT                   /db_xref="GOA:D4J4Q7"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Q7"
FT                   /protein_id="CBK79328.1"
FT                   /translation="MEAFSQFVGHVDSMIWSMVLVLLCLGVGLYLSIRMKFPQIRFLKE
FT                   MVHLLGAKEESENGITPFQAFATTVGARVGMGNIAGVASAIYFGGPGSVFWMWIITLIG
FT                   AASAYTESALGQAYKVKNPDGEYMGGPAYYIEKGLKCKPYAILFAMVAFLGPGFLMPGV
FT                   QINSLVTVFEEAFSVNKILVGAICCVILGIVVYGSIKRIAKIAEMLAPVMCGIYIVAAV
FT                   VILGLNITKLPGILGMVVSSAFGKHAIFGGILGSAVSWGVKRGIYSNEAGMGCGAIVSA
FT                   AAECSHPAKQGLIQSFSIYVDTLFIGTATALIILLTGTFDVCDGAGNLLLDQTDGIEAG
FT                   IKWTQYALMNTFGTWSGKALAIIIVLFVFTSMTGYCYQAEANIRYLTHNSKLAVNICRA
FT                   VFLAASFFGAIVNADAIWSMGDIGYGLMAWANIIAIALLAPKASAILEDYEQQKKEGKN
FT                   PVFDPAKFGIEDETGAWKRK"
FT   CDS             419306..419761
FT                   /transl_table=11
FT                   /locus_tag="CC1_03960"
FT                   /product="Domain of unknown function (DUF1934)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79329"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Q8"
FT                   /protein_id="CBK79329.1"
FT                   /translation="MEQDYIYMEETTVKSSSEVRNVHIRIRSVVEGVENLWETTGEYKW
FT                   DGRQHMLAYTDYTGNAITKNGIFADHEKMLLHRVGAITCDMLFDPLTATMVDYKAYMVG
FT                   AKFLLHTETYSMEENEVGLNIRVQYTLDDGGGHTPIVGEQEITVEYY"
FT   CDS             419951..420208
FT                   /transl_table=11
FT                   /locus_tag="CC1_03970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79330"
FT                   /db_xref="GOA:D4J4Q9"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Q9"
FT                   /protein_id="CBK79330.1"
FT                   /translation="MVKTVLKIDGMMCGMCEAHMNDLIRKNFKVKKVTSSAKDGETVII
FT                   SDAELDIPWAKKQIKDIGYELVDYTSEPYEKKGLFHFGRK"
FT   CDS             420309..420962
FT                   /transl_table=11
FT                   /locus_tag="CC1_03980"
FT                   /product="phosphoserine phosphatase/homoserine
FT                   phosphotransferase bifunctional protein"
FT                   /EC_number="2.7.1.39"
FT                   /EC_number="3.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79331"
FT                   /db_xref="GOA:D4J4R0"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR011863"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4R0"
FT                   /protein_id="CBK79331.1"
FT                   /translation="MDQRVENGPSEWKELSVMYITCLDVEGVLVPEIWIAFAEASGIPE
FT                   LKKTTRDEPDYNKLMNWRLGILKEHGLGLKEIQETIAKIDPLPGAKAFLDELRTFTQVI
FT                   LISDTFTQFATPLMEKLGWPTLFCNTLEVADNGEITGFKMRTEQSKLSTVKALQSIGFE
FT                   TIASGDSYNDMGMIQASKAGFLFRSTDKIKADYPDIPAYETYDELLDAIKKAMV"
FT   CDS             421338..422789
FT                   /transl_table=11
FT                   /locus_tag="CC1_03990"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_03990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79332"
FT                   /db_xref="GOA:D4J4R1"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4R1"
FT                   /protein_id="CBK79332.1"
FT                   /translation="MYKRESGGWLKHYDFLLLDMICLQIAFLLSFVVLGRWMNPYSHIL
FT                   YRKMALYLELADVVVVFFFDSFSGVLKKGYYRNFVSTIQHAAIVFALFVLYLFLSKEGQ
FT                   LYSRLSLVITFILYIFITYAVRELRKREMRKQMENGSKASLFIVTTGDVAGQVVDRMLK
FT                   NNYARYRMAGMAVVDNSVIGHKIHGVDVVADASTALSYICHTWVDEVLIVISDNQPYPK
FT                   KLIDQLIETGVTIHLNLAKVSNTSGKKQFVEEIGPYTVLTTTMNYASERQLLIKRVMDI
FT                   AGGLVGCLLTGIIFIFVAPAIYISSPGPIFFAQERVGKNGRKFKMYKFRSMYMDAEARK
FT                   AELMKENKLCDGKMFKMDFDPRVIGNKILPDGTKKTGIGDFIRRTSLDEFPQFFNVLKG
FT                   DMSIVGTRPPLVSETELYELHHYARLSIKPGITGLWQVSGRSDITDFEEVVRLDREYID
FT                   NWNVGMDIKILLKTVAVVLKKDGSM"
FT   CDS             422846..423742
FT                   /transl_table=11
FT                   /locus_tag="CC1_04000"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /function="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79333"
FT                   /db_xref="GOA:D4J4R2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4R2"
FT                   /protein_id="CBK79333.1"
FT                   /translation="MKGIILAGGSGTRLYPLTKVTSKQLLPIYDKPMIYYPMSVLMNAG
FT                   IRDILIISTPQDTLRFENLLGDGHQFGVNLTYAVQPSPDGLAQAFIIGADFIGDDSVAM
FT                   VLGDNIFAGHGLKKRLEAAVHKAENGKGATVFGYYVDDPERFGIVEFDKNGKAVSIEEK
FT                   PEHPKSNYCVTGLYFYDNRVIEFAKGLKPSARGELEITDLNRIYLEDGSLNVELLGQGF
FT                   TWLDTGTHESLVDATNFVKTVEQHQHRKIACLEEIAYLNGWISKDDLMEVYEVMKKNQY
FT                   GQYLKDVMDGKYQEHLY"
FT   CDS             423787..424806
FT                   /transl_table=11
FT                   /locus_tag="CC1_04010"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /function="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79334"
FT                   /db_xref="GOA:D4J4R3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4R3"
FT                   /protein_id="CBK79334.1"
FT                   /translation="MNIIVTGGAGFIGSNFVFHMLKKYPDYRVICLDKLTYAGNLSTLA
FT                   PVMDNPNFRFVKADICDRDAVNQLFEEEHPDVVVNFAAESHVDRSIENPEIFLQTNIIG
FT                   TAVLMDACRKYGIQRYHQVSTDEVYGDLPLDRPDLFFTEETPIHTSSPYSSSKAGADLL
FT                   VLAYHRTYGLPVTISRCSNNYGPYHFPEKLIPLMIANALADKSLPVYGEGLNVRDWLYV
FT                   EDHCKAIDLIIHKGRVGEVYNVGGHNEKQNIEIVRIICKELGKPESLITHVGDRKGHDM
FT                   RYAIDPTKIHNELGWLPETKFEDGIKKTIQWYLNNREWWETIISGEYQNYYEKMYSNR"
FT   CDS             424828..425742
FT                   /transl_table=11
FT                   /locus_tag="CC1_04020"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /function="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79335"
FT                   /db_xref="GOA:D4J4R4"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029900"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4R4"
FT                   /protein_id="CBK79335.1"
FT                   /translation="MRFFVTGVGGQLGHDVMNELLKRGHEGVGSDIQECYSGAADGSAV
FT                   TRAPYRTLDITDREAVHNVIAEIHPDVVFHCAAWTAVDLAEDADNVNRVRAINAGGTKN
FT                   IADVCKELNCKMIYISTDYVFNGQGSEPWQPDCKDYAPLNVYGQTKLEGELAVSQILEK
FT                   YFIVRIAWVFGVNGKNFIKTMLNVGKTHDTVRVVNDQIGTPTYTYDLARLLVDMSETDK
FT                   YGYYHATNEGGYISWYDFTKEIYRQAGYQTKVLPVTTEEYGLSKAARPFNSRLAKGKLV
FT                   EAGFVPLPTWQDALSRYLKEIQY"
FT   CDS             425764..426363
FT                   /transl_table=11
FT                   /locus_tag="CC1_04030"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /function="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79336"
FT                   /db_xref="GOA:D4J4R5"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4R5"
FT                   /protein_id="CBK79336.1"
FT                   /translation="MGQIKVEKNVGGIEGLCVIEPAVHGDARGYFMETYSQRDMEENGI
FT                   HIQFVQDNQSMSTKGVLRGLHFQKNYPQTKLVRVIKGSVFDVAVDLRSGSETYGKWYGI
FT                   ELTEENKKQFLIPRGFAHGFLVLSDTAEFCYKCDDFYHPNDEGGMAWNDPEIGIEWPKV
FT                   KGEYRGNADAEGYTLEDGTALNLSDKDQKWLGLKDR"
FT   CDS             426360..426470
FT                   /transl_table=11
FT                   /locus_tag="CC1_04040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79337"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4R6"
FT                   /protein_id="CBK79337.1"
FT                   /translation="MIVFVAILGLMALQKKRKKWINPFFCKEKQKCYIDK"
FT   CDS             426688..427629
FT                   /transl_table=11
FT                   /locus_tag="CC1_04050"
FT                   /product="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79338"
FT                   /db_xref="GOA:D4J4R7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4R7"
FT                   /protein_id="CBK79338.1"
FT                   /translation="MFQKITKELKKNKVLKAGIGYTIGNYFLKGLGFITVPIFSRLMAV
FT                   SDYGIYNTFLSYEGMLYLFIGLALHSSIKNAKYRYGDERLDSFTSSITIFPLVISCIVL
FT                   ILGNLLLPVINHFLSVERVEYNLLIALCLCSSLLYIYQSRLALEYNSKSYMKMSYFNAL
FT                   SSVALSILLMQTVFKEQKYLGRICGSVIPMSILAVWILYKLYSKARPKKNTDYWKFALK
FT                   ISLPIIPHGVGQIILSSFDRVMITSYIGSTAAGLYSFAYTIYSIILVAGDSISTVYEPW
FT                   AYERFAEKEYDIIKKGVPYILCYWRLYVLVRC"
FT   CDS             427623..428132
FT                   /transl_table=11
FT                   /locus_tag="CC1_04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79339"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4R8"
FT                   /protein_id="CBK79339.1"
FT                   /translation="MLIAPELVRILGSQKYVDAIPAVTPILGAGFFAMAYNIPSTVEYY
FT                   YGKTSFIAIGTVFAAVLNIAMNAIFIPQYGYLAAAYTTLGSYLVYFIFHCMIAHRIIGQ
FT                   NIFSIKVLMATVAGLSVIGAISLYYQNDYIVRYSCAAAVVGGVLVWLKKGVLADFGFNV
FT                   GKGKRS"
FT   CDS             428248..429489
FT                   /transl_table=11
FT                   /locus_tag="CC1_04070"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79340"
FT                   /db_xref="GOA:D4J4R9"
FT                   /db_xref="InterPro:IPR015393"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4R9"
FT                   /protein_id="CBK79340.1"
FT                   /translation="MQQKNKIQHVYLIGAKSLGAYGGYETFTYKLTEYHQNNLNIKYHV
FT                   ACKANGDGAMDETKFEGVTKINDYEFEFHNAHCFKINIPQIGAAQAIYYDVAALKICCE
FT                   HIKKNHIQHPIVYIMACRIGPFAGHYYRKIHKLGGIVYLNPDGHEWMREKWSAPVRKYW
FT                   KISEQMMVKYCDLAICDSVNIEKYIHKCYDGKGIAGRNPKTTFIAYGADLTLSKLTDDD
FT                   KKLVNWYKEKKLAPKNYYLVVGRFVPENSFEVMIREFMKSHSHKDFAIITNVNDKFLNE
FT                   LEEKLHFRSDKRIKFVGTVYDQELLKKIRENAYAYFHGHTVGGTNPSLIEALGSTDLNL
FT                   LVDVVFNREVAEDCALYWSRDNGALAKLIDQADELSADEITKLGQMAKKRVSQEYTWNK
FT                   ICGQYEKVFVNIDK"
FT   CDS             429508..430857
FT                   /transl_table=11
FT                   /locus_tag="CC1_04080"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79341"
FT                   /db_xref="GOA:D4J4S0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4S0"
FT                   /protein_id="CBK79341.1"
FT                   /translation="MRILHYALGFPPYRSGGLTKWCVDLMVQQAKEGHEVAMLWPGKMG
FT                   IVKKKTEVKRQKDVCVKEQNLQSFEVINPLPVPFDEGIADVPAFTANAGATAYGAFLDA
FT                   FLPDIVHVHTLMGLHKSFLQATKNRKIRLVFTAHDFFPICPKVTMFRHGAICSNVKNYE
FT                   ACGVCNATALDLKKIHILQSPIYRCLKDLSVVKKLRKKHRDDYLSEATVDDSVIPVGTV
FT                   EDYRKLRNYYYSLLKLMDMIHYNSSVTRSVYESVFDLPQHCLVAITHADINDNRRIKEF
FT                   SDGRLHIRYLGPQSGSKGYFLLKKALDQLWEKEKEFCLDVHFRPIEMAPYIEVHPRYAY
FT                   GELETIFEQTDILVTPSIWFETFGFTVLEALSYGVPVVISGTVGAKDILADGAGIIVDD
FT                   ITSDRLCNVLKNLTTADLRKMNENIVRKQPIMQIETMSMKIETDCYGWNL"
FT   CDS             430892..431737
FT                   /transl_table=11
FT                   /locus_tag="CC1_04090"
FT                   /product="Predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79342"
FT                   /db_xref="GOA:D4J4S1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4S1"
FT                   /protein_id="CBK79342.1"
FT                   /translation="MNITVVVLHYENIKDTKECLDSLKKYLNDTKNNINVVVVDNGSIK
FT                   EKTAAIEEDYVNDKIYFIESCRNLGFAKGNNIGFHYAKYELHSDIIILANNDLIFKQVD
FT                   FMNQIAKEMIENHIDVAGPRIISLVDHKNQNPVPYAHPDLVSVNKRIFKLHVLKIMCYF
FT                   GVDKFFQTIFSRKYSADVKSDNYQLHGACLIMANNYVKNYDGLYPKTFMYMEEDILKYI
FT                   TKRDNLIMKYFDGAEVFHKEGSSTEKIYGEGRKKRLFYYKWNIDGCKKLRQLMKSGRDK
FT                   "
FT   CDS             431734..433065
FT                   /transl_table=11
FT                   /locus_tag="CC1_04100"
FT                   /product="O-Antigen ligase."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79343"
FT                   /db_xref="GOA:D4J4S2"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4S2"
FT                   /protein_id="CBK79343.1"
FT                   /translation="MKLTKERRILIEALITLQLINYMVGTIILKDFFLVKYLRDVIVVV
FT                   LLFEIVRGKKKKVQFGAITLCLLVFAFCGIFGVIQGETFQVVLLVARRYAIPLAVLFIA
FT                   AHIDFNGEEQKLFKYIFYLIVVLSIFGAFQAQVLGDNFLRNLGYPVEYSYGYGREMLYN
FT                   SFYFGGLGIQRVVATLSSSNICALVFGTSLLYFLVCSPIFNVKYKTVMMACIALAFLLT
FT                   FSRSNILFFMIAVICVWRYIPYKKYILTGIGCAAVIVLIVGIIQGQNGIVYKLWMWVQA
FT                   SLNMTESSAAGRSGIWHAALEQVFKSPLGIGFGHVGAIGYESELVFLAENSYLTLALDT
FT                   GWIGVISYVAALVMIVVKLYKNAEMYGRTGNEKGKRICVAGYAVLVYLMGVMLFSNHIQ
FT                   DMEAITLVYMYVGIALSYVRYNRGINEEKLKALFISKICKRGNR"
FT   CDS             433062..433892
FT                   /transl_table=11
FT                   /locus_tag="CC1_04110"
FT                   /product="LPS biosynthesis protein"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79344"
FT                   /db_xref="GOA:D4J4S3"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4S3"
FT                   /protein_id="CBK79344.1"
FT                   /translation="MKELSIEEIHEGTLGILKKIIEICDEINVNYFLAYGSLIGAVRHG
FT                   GFIPWDDDLDIVMLRPDYEIFNQYCLKHERELYPFKLINRKNEKKYPYNIARFNDLRYR
FT                   AIYENVQEYDSGMFIDVYPLDGAGHMTESEVVSLDKKRDYLMKMILWSIDDHYEPSKHN
FT                   KWYRSVIKYLVRNYAKMKGSEYFLNKMEELKNQYEFDDSEYVAEMVWDIKTVLCKKEWF
FT                   GEGQMIQFEDIKVKAPNDIDSFLKVYYGDYMKLPPVEQRVPSHGYTLYKRNETD"
FT   CDS             434071..435843
FT                   /transl_table=11
FT                   /locus_tag="CC1_04120"
FT                   /product="CTP:phosphocholine cytidylyltransferase involved
FT                   in choline phosphorylation for cell surface LPS epitopes"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79345"
FT                   /db_xref="GOA:D4J4S4"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4S4"
FT                   /protein_id="CBK79345.1"
FT                   /translation="MNIQERDLLKVLYSENYINQRILADLSGHSLGVVNRSLKQLLLEG
FT                   YINEENQLTQKAENLFRQNAPKQAVILAAGFGMRMVPINLESPKAFLKVKGEYLIERLI
FT                   RQLHEVGVHQIYVVVGFMKEQFEYLIDEFGVKLIVNSEYAGKNNLHSMKLVSDHLANAY
FT                   ILPCDIWCRKNPFSREELYSWYMVSDAADEESDVRVSRKMELVRTAETSGNAMIGITYL
FT                   TAQDGASVSERIHQLCGKPAYDGCFWEEALYNKDRMIISAKVAHASDVVEINTYEQLRD
FT                   LDSHSEQLKSDAIAAIAEKFQVKAKEIVEISVLKKGMTNRSFLFSCKGKKYIMRIPGEG
FT                   TDQLINRRQEADVYHAISSKGICDDPVYINPENGYKITAFLEGVRTCDPLNEEDLKKSM
FT                   ELLRKFHHMSLNVEHEFDLFKQIEFYESLWEGNASVYRDYEQTKKKVLGLKPYIDVHAT
FT                   EKVLTHIDAVPDNFLFYTGEHGEELQLTDWEYAGMQDPHVDLAMFCIYSFYDRGQVDHL
FT                   IELYFEGKCDAAVRIKIYCYIAVCGLLWSNWCEYKRRLGVEFGEYSLRQYRYAKEYYRI
FT                   VQKELEAQKESEEA"
FT   CDS             435844..436563
FT                   /transl_table=11
FT                   /locus_tag="CC1_04130"
FT                   /product="CTP:phosphocholine cytidylyltransferase involved
FT                   in choline phosphorylation for cell surface LPS epitopes"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79346"
FT                   /db_xref="GOA:D4J4S5"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4S5"
FT                   /protein_id="CBK79346.1"
FT                   /translation="MHRVQRAIIMAAGLGNRMRPVTLTTPKPLVKVNGIRMIDTVIEGL
FT                   HQNGIYEIYVVVGYLKDQFMGLEQEYPGVQLIENPYYDTCNNISSLYVAREHIENAIIL
FT                   DGDQIIYNAEVLSSEFERSGYNSIWTDEETDEWLQTVENGIVTSCSRNGGKCGWQLYSI
FT                   SRWTAEDGRKLKYYLEEEFAQKGNRQIYWDDVAMFCYPQAFRLGIRPMLKGDVIEIDNL
FT                   SELAVIDESYKKYGEME"
FT   CDS             436565..438100
FT                   /transl_table=11
FT                   /locus_tag="CC1_04140"
FT                   /product="Choline-glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79347"
FT                   /db_xref="GOA:D4J4S6"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4S6"
FT                   /protein_id="CBK79347.1"
FT                   /translation="MNEKNERGKIDWMITLLPLGIVIALCVLFFFVPEQSNAVLSQIRF
FT                   FFGDTFGTYYLVIGLGIFILSLYIAVSRYGNIVLGEPNEKPKYSFFAWGSMMFTCGLAA
FT                   DILFYSFSEWVLYATDPHIEEMGSIQDWAGVYPLFHWSFIPWGFYLVLAVAFGFMLHVR
FT                   KRNRQKYSEACRPILGKHTDGWIGRIIDLLAVFALLAGTATTFSVATPLMATIIGELFH
FT                   VAVNRTVINIIILLITCAIYTYSLLHGFKGISKLANLCIYMFFGLIAFVLLFGGETRYI
FT                   IETGLSSLGKMVQNFIDLSTFTDPLRTSNFPQNWTIYYWAYWMVWCVAAPFFIGNISRG
FT                   RTVRQTILGGYIFGVGSTLTSFIVLGNYSMGLQMTGKADFIADYLTNGDLYGMIVSIIK
FT                   TMPCAPVIMVVVLLTMIAFYATSFDSIALTASCYSYHTLKEDEQPHKGIQLMWCILLIL
FT                   LPIALLFAESSMNNLQSVSIVAAFPIGAVIVLIAASFIKDAGNYLVNCNKITG"
FT   CDS             complement(439635..440399)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04160"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79348"
FT                   /db_xref="GOA:D4J4S7"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4S7"
FT                   /protein_id="CBK79348.1"
FT                   /translation="MSSSHDITLTAQEQALIMRLKSFHVPEMAHILEEQLKDPNADLNT
FT                   FMERMTAMVDAEWQARADKRFNRLMKEAHLRYPAADLDETIYRPERQLDTQTIERLSTC
FT                   HWIEEGKNLIVTGSSASGKTYLINAFCVTAMKHSKSVKYIKANTLMSEMEQARIKSTNL
FT                   DYLNKLTKLDLLVIDDFGLMDLDLDKCRDLFEVLDTRDGRKSTVVISQFPVSTWFDMFA
FT                   DNTYADACLTRITDKHHTYRLEMNGINMRETE"
FT   CDS             complement(440396..440458)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79349"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4S8"
FT                   /protein_id="CBK79349.1"
FT                   /translation="MNGTGKLPFHANIRGKEAYK"
FT   CDS             complement(440455..441966)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04180"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79350"
FT                   /db_xref="GOA:D4J4S9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4S9"
FT                   /protein_id="CBK79350.1"
FT                   /translation="MHDYNTILGVIELRLSKVSYDTIQKRYRIGRSGITLIMKRYNESG
FT                   LSLDDLRQMPASKVVNLIYPKENLRHKDIPLPDFGKIHEQMVQMGKHADLSFLWIDYKK
FT                   EHPNGYQLAQFYKLYRDFMVDTYSTSKTSMPVERIPGEKMFIDWVGDQPELLLDTTTGE
FT                   LQKVHIFTTTLGFSSLVYAEIFPDEKLPHFIAGTVHALSYYGAVPKYLVPDNLKTTVTK
FT                   HSKDELVLQSAFSDLETFYDTIILPPPPRKPKGKPTVENHVRFLETHLVEELKKDTYTS
FT                   LEALNAAVKKIVADINQRPFQKKSDIRRSRMNGFEKYDKPRMNQLPGESYTLCDYKYFL
FT                   KVPDNYHLEYDAHYYSVLYTHKGKPAILKATMTEIRICDEYNRLICHHPRSYRDFPLYI
FT                   TDDSHMPPEHLYYKEVNAHDGAYYRRWASVYGESMVTLIGRILRSSKQEEQAYNSCAGV
FT                   LHSCKDVPHRLVQEAAEKCVEASACKYSYFRKHWAWSGIIIPAAV"
FT   CDS             443083..447942
FT                   /transl_table=11
FT                   /locus_tag="CC1_04200"
FT                   /product="FOG: Glucan-binding domain (YG repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79351"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4T0"
FT                   /protein_id="CBK79351.1"
FT                   /translation="MKKRKLLKQAKKFVAVVTAVALLDAPVAYAADTSVPETAQYQAEE
FT                   VVDSTDEISSEQPESESEVQQTGESEEAVESETEQSSESETSETEKTAEVKKESVADTE
FT                   KETLEAVTETAETVQSAPESGNGWGDDGYYYQNGEIVKDREVTYWDEENERYRYTRFDE
FT                   NGIQYKNSWYQDGDNWYYYGEEGDRAEGLVDIAGNTYFFDSSGIMLRNSTFSITDQETG
FT                   KEINYRSDENGHVVKGWYHDSWNSWYYDPVTGIMATGVVTIDDKTYCFDTYMRVNYAYT
FT                   QDGILYYFGEDGVLEEQQEITQDGWTSFRGNEYYIRDGELVKGQFITEGDDTYFVAWDG
FT                   VLYKSTTFSVYDGEKDTYGNYRADENGRLVKGWYQPEGSDERYYYDESGNAANGITEVD
FT                   GDTYYFELGGRMCTDYVFSEKGILYFFGSDGTLTDSQTIEEDGWIQNGDKRYYVQDGKL
FT                   VTSKFITVDDSTYYMDGSGVMMKDQTFSVWDEEEGASHDYRADSNGHIIKGWYQPEESD
FT                   EWYYYDANGKAGSGITEVNGNAYYFGYEGRMYTDYIVSENKTLYYFGSDGVCRNPQSIE
FT                   QDGWIQLEDKWYYAKDGELVKSNFVTDNGNTYYMGYDGYMLTNDTFYAYNQDKGQEDWY
FT                   RVDQDGHLVKGWYYESDSDAMGYNNWFYYNEDGSAVKGITEINGKTYYLNYEGEMLTNY
FT                   VVTENGKIYHFDKNGVLSEEKALDKDDWVQFDGDWYYVKDGQLVQNEFLTVDGQTYYMN
FT                   YNGVMETNTEFSIYDSDSDRTCYYRVDKDGHLVKGWFRYNESNTDWYYYDENGVKAEGL
FT                   QNLNGTTYYFKNDYDGNGEMVANQAVVIDGTFYYFGSNGALEKKDNIEKDGWIGTSSCW
FT                   YYVQNHDLVRKCAMKIDNALYVFDANGEMVVNDTCYAYPKGDTDGERYIYRTDSDGHAI
FT                   KGWYENQNGWYYYDAEGRGVSGIQTINQSMYYFVDSEMQLNTKSVKDGKLYVFGGDGVG
FT                   AEYTKDGWVGSRYMHNGGYYIKDGKLAEGWTKIDNKWYYFAKEDGESGMPGLKSLGQTK
FT                   IDGSYYFFNSNGEMQTGLIKSSDKTRYADASGKLQESGWYQHTDGTWYYFKDAVAVTGL
FT                   VKINGTYNMFQQDGTWSGALTASNNGWQKNGSDYYYLQNGVPITSTSKVVGGETYYFDE
FT                   DGVMMRNCQYDGHYLQASGAMLVNGWLQDDAGVYTYYDANGVCVESGWKQINNQWYYFE
FT                   QTNMNNQDRIIDGKLYRFASSGVSDGIGIDVAEGWNLIAGQYYYVKNNALVKNSIETID
FT                   GNSYCFDYEGRMLFNRIMEIDGKRYFFNANGMMEKNVWCYKDNSYAGSDGVLYTGEHVI
FT                   EGQKYLFSDQGILIRGNRLSEDYKTVTVVDENGVIKNTVSANDDGWVRIANSWYYVKNG
FT                   MFVRNRLLQINGKCYYFGMNGEMAVNEGIGDWSGFGQGYANADGVVITDGWVNNNQYVE
FT                   DGTFIWSDPAIINGKYYLFVDRYSISGVGEEDGVYYYFDGNGNRTRQNMVQGWNKVHDE
FT                   WYYMDDEGNLLKNTSKQIGNAFYCFDSSGKMVTNRLETVHSYTELHYAYYGADGTPVRN
FT                   CWKTFEDETYYLDDNGWAVTGVQQIGGKQYVFDNDGCLIQ"
FT   CDS             448101..450020
FT                   /transl_table=11
FT                   /locus_tag="CC1_04210"
FT                   /product="Transglutaminase-like superfamily./Putative cell
FT                   wall binding repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79352"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4T1"
FT                   /protein_id="CBK79352.1"
FT                   /translation="MKKKSIFWALILMILFLLSGTVNAQTEFTLEDYHYTNPVYKDIEI
FT                   NQRSEAIQPYSLNTADEVYTSDVQKIAEKFRQELVERDSVIDVYYYSSDSITQNFFDAL
FT                   ANQLFQNAISHTGVGNEGDYLKWHYQGWTAEASYTFDANGGYDLHITYYMSYLSDAGQE
FT                   EQVTEKVDDLLQSFNLSGKTDYEKVKAIYDYICDNITYDYKTLDDDTYTLKYTAYAALI
FT                   NKTAVCQGYASLFYRMVLDAGVDARVISGDAGGPHAWNIVSIDGKYYNLDSTWDAGNDS
FT                   YVYFLKNMADFSDHVRDEEYTDASFEEAYPISEESYYESDDVEQFGDYEYVINNDQIMI
FT                   TRYTGDDQNVVIPAEIDNKPVAVIGPFAFDSAQTLEILEIPEGVETVEVGAFWDCTNLR
FT                   KVYFPYSVTSIENYAFYNAVNLVDIYYAGTQEEWEQIPKDGAFDDLTPIYHFNYDNEGK
FT                   GQWIQSGSRWWYQYADGSYPASERIQIDGTWYGFDHSGWMETGWASHENTWYYFSAGGA
FT                   MCIGWVFDGNTWYYMDENGKMIVGWQQVNGVWYYFGESGAMRTGWVLDDSKWYYMNENG
FT                   VMQTGWQQVNDIWYYFGEGGSMVTGWQEIGNTWYYFDLNGQMASDAWIGNWYVDGSGAW
FT                   VSSR"
FT   CDS             450226..450492
FT                   /transl_table=11
FT                   /locus_tag="CC1_04220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79353"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4T2"
FT                   /protein_id="CBK79353.1"
FT                   /translation="MKMITEPFYITFMDICDIYTLEELRNYSSMADFVNKTGYIQSDSI
FT                   YEGFSPGYVTNFENTALDKAKQWGYEDIDSYVAYLCQGRICKM"
FT   CDS             450527..450796
FT                   /transl_table=11
FT                   /locus_tag="CC1_04230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79354"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4T3"
FT                   /protein_id="CBK79354.1"
FT                   /translation="MVSKDLVSREAVAAVAEEHNYTLFETDSLYYIHGTYTRDYAYNML
FT                   MKWIHGPVDGIIFYMVMNILPMDVIQKILPDQDITLIIGEQVLG"
FT   CDS             451537..452271
FT                   /transl_table=11
FT                   /locus_tag="CC1_04250"
FT                   /product="Capsular polysaccharide biosynthesis protein"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79355"
FT                   /db_xref="GOA:D4J4T4"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4T4"
FT                   /protein_id="CBK79355.1"
FT                   /translation="MEFYDIHSHILAKVDDGAETFEMSCRMLDMAYEEGIRHLCVTPHY
FT                   NRHNADDAERPKKVMRAFRALELYAKKQYEDMHLYRGNEVMYFPDVVKYLDSGSITTMN
FT                   GGRYVLVEYKPNASYHNVYSGLQQILYGGYLPVLAHVERLDCLIDEWDKLEELKESGII
FT                   LQMNTDGLIGGRFDRWVRRCRALVEDGYIDVLGTDAHNMTSRPPQYRKAAEWIEKKCGR
FT                   ARLRQLAEENPRAILENQLIST"
FT   CDS             452350..453147
FT                   /transl_table=11
FT                   /locus_tag="CC1_04260"
FT                   /product="Capsular polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79356"
FT                   /db_xref="GOA:D4J4T5"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4T5"
FT                   /protein_id="CBK79356.1"
FT                   /translation="MEKKRNDNEEMEIDLLELLMVMKKHLSAILLAGIVGLVIMFAYTS
FT                   FLVTPLYSASSMMYVMPDNSNSMNSSTLSDMQVGQQLTSDYSSMIKSRSFMEDVIKKLN
FT                   LTIDYQQLLEKVEVTNPTSSRILQVTVNDPNPQTAADIANEMASVAESKLKEITGMQAI
FT                   KIYEEAAVPDRPSSPSLKKNCALGLLAGIVLAMAVITILYLLDDTIKTEDDIEKYLGMT
FT                   TLAVLPYNGRKQQRQAQKHKKQRAKQERQTSRKRKEIETDEFN"
FT   CDS             453134..453826
FT                   /transl_table=11
FT                   /locus_tag="CC1_04270"
FT                   /product="capsular exopolysaccharide family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79357"
FT                   /db_xref="GOA:D4J4T6"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4T6"
FT                   /protein_id="CBK79357.1"
FT                   /translation="MNSINLTRIDDGEAVSEYYKQLRTNIYFCGQDKQCIAFTSSFPNE
FT                   GKSTVVFNLCKALAEDGKRVILLDADLRKSVLYNRCMPDQEVKGLSHYLAGFVPLNDVI
FT                   CKTNIKNMYMAFAGLNAPNPAELLGNPKFKAAIEAMKKSFNYIIVDCAPIGAVIDAAVV
FT                   AKSVDGMVMVIEQKKVSRRMAQKMKEQLEASGCPLLGVVLNKVKISENKGYGGYGQYYG
FT                   HYGKYGEY"
FT   CDS             453927..456038
FT                   /transl_table=11
FT                   /locus_tag="CC1_04280"
FT                   /product="Predicted nucleoside-diphosphate sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79358"
FT                   /db_xref="GOA:D4J4T7"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4T7"
FT                   /protein_id="CBK79358.1"
FT                   /translation="MQNKINSSKKHTPDNNEKIPYMKRAIEHWKIVALYLILYDVIAVN
FT                   VSYFLGLWLRFDLHYGAIPKGYIIAFLEFAPIYTVVCLLVFGRLHLYSSVWRFASFTEL
FT                   NRVMMATIITTIFQFVGITVFFNRMPVSYYLVGAVAQFGLITVVRFSYRYINLQRNSRV
FT                   QKKQSTHNIMVIGAGAAGQAILREMRNSEQISGQASCVIDDNPNKWGRYMEGVQIVGGR
FT                   DDILSAVEKYEINEIYFAIPTASPQIRRDILNICKETKCELKRLPGMYQLANGDVSLSK
FT                   LKPVAVEDLLGRDPIKVNMDEIFQYIKGKTIMVTGGGGSIGSELCRQIAAHEPKQLIIF
FT                   DVYENNAYEIEQELKRKYKDSLNLVVLIGSVRDSRRVDMVFKKYRPEIVYHAAAHKHVP
FT                   LMETSPNESIKNNVIGTYKTAYAALKYGTQRFVLISTDKAVNPTNIMGASKRLCEMVIQ
FT                   TMDAVSKTGRMDILPLLHAHNGKDDVAIRHRSAESRKTSNIQISSVSNKNRTSTQFVAV
FT                   RFGNVLGSNGSVIPLFKKQIEAGGPVTVTHPDIVRYFMTIPEAVSLVLQAGTYAWGGEI
FT                   FVLDMGDPVKIDTLARNLIKLSGYEPDVDIKVAYTGLRSGEKLFEEKLMAEEGMKHTDN
FT                   KLIHIGKPIPFDINTFLGQLEELAEASYNNSEDIVEMVEEIVPTFHPVGAHPVGNEMKN
FT                   VSEKMRKEA"
FT   CDS             456053..456724
FT                   /transl_table=11
FT                   /locus_tag="CC1_04290"
FT                   /product="Uncharacterized proteins, LmbE homologs"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79359"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4T8"
FT                   /protein_id="CBK79359.1"
FT                   /translation="MNYLFVVAHPDDESDAAGGTIHKLIQEGNNVAVAIMVSQAAARRD
FT                   LSDTLSDDEREALSILGVEKVYHADFPNIKMNTVPHLELVQFIEGCIEDFKADAIVTHH
FT                   PTDTNNDHAMTSYAAQAASRLFQRKPGIPQLKLFMYMETPSATEWSLDSSAKRFTPNYF
FT                   VEIDKEGVQTKIKALQAYKGVMRPYPHPRSNEAYEGLAAYRGCQAGLKYAEAFEIVFQA
FT                   Y"
FT   CDS             456877..457476
FT                   /transl_table=11
FT                   /locus_tag="CC1_04300"
FT                   /product="Sugar transferases involved in lipopolysaccharide
FT                   synthesis"
FT                   /EC_number="2.7.8.6"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79360"
FT                   /db_xref="GOA:D4J4T9"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4T9"
FT                   /protein_id="CBK79360.1"
FT                   /translation="MYKQFGKRVIGIFLSICGLVVCCIPMLIITVLIKLDSKGPALFKQ
FT                   ERLGKNQKPFIVYKFRTMCNHAYEMGGVATRSDDARITKVGSVLRRTSLDELPQMFNII
FT                   KGDMAIIGPRPILPIEFEEYKNNKRYAHRYDVLPGMFCTVDIDYRSSSDRDLQFSMDAD
FT                   YVDNISFGLDVKTFFSIIAPVVKGKNVYREEVKRDK"
FT   CDS             458639..459190
FT                   /transl_table=11
FT                   /locus_tag="CC1_04320"
FT                   /product="Bacterial transferase hexapeptide (three
FT                   repeats)."
FT                   /EC_number="2.3.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79361"
FT                   /db_xref="GOA:D4J4U0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4U0"
FT                   /protein_id="CBK79361.1"
FT                   /translation="MLELVRNIVAIIRGNVLCFVFGIKHNVLIRFFPGIQITKESQGEI
FT                   LMEKGVMIGRNTIITVRNGAQLYMGKKSSLNADCKVICQKKICIGENTIFGPNVLIYDH
FT                   DHVYDADGVKRNEFECDNVVIGNNCWIGAGTIILKGTNIGNNCVIAAGSVVKGRIPSGQ
FT                   LLVQKRHGTLFDLNRSESRI"
FT   CDS             459187..460338
FT                   /transl_table=11
FT                   /locus_tag="CC1_04330"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79362"
FT                   /db_xref="GOA:D4J4U1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4U1"
FT                   /protein_id="CBK79362.1"
FT                   /translation="MINVLIATDFKMICKGRDVYLKDTTYNTLKRYKKAFGTVTLCTRA
FT                   YQNDSTEGFVLANDVVDNYIPITNLLNTLIGKHDKDIEVAVNQCDLVVARVPSIIAYKA
FT                   ATISKNVNKPLFSVAIGCAWDAYWNHAFPGKIIAPYMYKKMKWCMKKTDYALYVTEQFL
FT                   QNRYPTNCKSIGVSDVVIGEIDRTVIEKRYKKIESMDFSEITVMTSGSVGNKAKGQEYM
FT                   IKAIPLLNKKGIKVNYLLAGAESPAYLEKIAKQLHVEEQVRFLGLLSTDEVFSYLDKTD
FT                   IYVQPSLQEGLPRAVVEAMSRGCPVIGARTGGIPELLPDNYIVNRKSSKQIATKIEGLL
FT                   SKDRMIHASKKNFERATDYNEHTLSARRNEYYSKILSNITAQK"
FT   CDS             460354..461055
FT                   /transl_table=11
FT                   /locus_tag="CC1_04340"
FT                   /product="Exopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79363"
FT                   /db_xref="InterPro:IPR015037"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4U2"
FT                   /protein_id="CBK79363.1"
FT                   /translation="MAEFSIFARVTNKIKNMMNPYLGPIRQKRLTNTDFSIISNNCWGG
FT                   VCYEYFNLKKKSPTVGVYFFADDYIKFVFNLRYYLSKEIEIIDCNQSKYYDELKKRGEN
FT                   NIPIGRIDDIEVVFLHYKDPDVAKDKWERRRKNVNWNNIILKFSYMNGCTDEHVNQFEK
FT                   IKNVKKFVLVPRKFPEYEDCYVASYSVHNEMITNDTFYFNKDIDIYKLINKKITSYDER
FT                   DKVCVGEIRDE"
FT   CDS             461048..462001
FT                   /transl_table=11
FT                   /locus_tag="CC1_04350"
FT                   /product="Predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79364"
FT                   /db_xref="GOA:D4J4U3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4U3"
FT                   /protein_id="CBK79364.1"
FT                   /translation="MNKYVENELVSVIIPTYKRSDTLVRALESVLAQTYKNIEIIIVDD
FT                   NARFPEIRRHNKTLIEKYPGIIFVENKENLGGGLSRNEGMKVASGRYVAFLDDDDEYLP
FT                   EKIEKQLSCLVSQDEKAAVIYCYAEMINVDGSRYNYINDFEGNVLLENIEHCLAPTSFW
FT                   LCSREKLLSVGGFENISSRQDASLLTKLLLNGYTVYRVPEVLLRYYWHSSSNGISNSSL
FT                   KSVNAEKQYHLMFSKLACQKKISKTIIDKANYLFYFRLAREYVAIGYRKAALLLFIKML
FT                   KIDVFDIRNLRILCTSLFNKTYLFAASLKNKKRVGN"
FT   CDS             462002..463438
FT                   /transl_table=11
FT                   /locus_tag="CC1_04360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79365"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4U4"
FT                   /protein_id="CBK79365.1"
FT                   /translation="MRNGYRVYKRVVFITTIITIFVALLSNKGYGYEFIYFIPIVYLVL
FT                   FMICKRVHFYSSKYSGLLILNGLMFLKYVIAILATCATQSYTLPSYYAVSVSQSSYHWA
FT                   TFIVMGEEIATFLTIELCADAIYKSKKNQIHVDKKYDRVKMGPVMFLFIIISLICVALM
FT                   PQYLFGTIGILFSSENQMTQTLETNHVMSMVFGAFKIVFIGLFINKAIVKYQESHKIRY
FT                   MIFSYLLIAVHCFLNISTSRMNIIIPFFLFVLITPKIYGKAGLWFNTIIGISLSVIIGI
FT                   VSVYKMPWIFVGNSSPFVAFFSDFSKRLQEYTSNIMPTAMGLQAIEAYKSSIDITTFFK
FT                   DIFGVMPVISHYINENEMIYTIYNQYALAGINNTQLIPMTISSIAYFTPVCTYLLVIVC
FT                   TLLLMKLEDKNNYEAKNYINDYLKLYLFFVFASCTFSNVQMLAGRLFTNYIPAMAILYL
FT                   NQYVGRDTRIVIGKNKVWQK"
FT   CDS             463426..464841
FT                   /transl_table=11
FT                   /locus_tag="CC1_04370"
FT                   /product="Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79366"
FT                   /db_xref="GOA:D4J4U5"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4U5"
FT                   /protein_id="CBK79366.1"
FT                   /translation="MAKISKLKLNLFYNICYQILSLIVPLITAPYISRVLGASGIGEYS
FT                   YSYSVAHYFVLFVMLGVLNYGNREIASVKDSVNKVALKFSEIYIVQLAMGIVVIGLYVI
FT                   YVAFFCKFNRLVAMAQILYIVSALLDISWLYFGIEQFKTTAGVSSLNKIVTTILIFLLV
FT                   QDKNDVFIYTVILAGGVLLNNIFYWIMLKRYINVSAISLNLRDIRKHLQPMLVLFIPVI
FT                   AVSVYKYMDKIMLGILIGTSEVGIYESAEKFVNLPLSLITAVGTVMLPRISNLKEKVQD
FT                   KEIKKYNYISMILIMFLGFGIVFGLAGISDRLIPWFYGIEFVRSTYVLLVLLPSVLFVS
FT                   WANVVRTQCLLPNKRDKEYCISVILGAVVNFIVNILLIQKYGAIGAAIGTSIAELFVCL
FT                   IQSFQTRNEMEFIKYIIDSIPFAISAVAMFFIIHSITFKSDLYTVVTRISVGGLLYCAL
FT                   SSYFIRKTIKAIK"
FT   CDS             466452..467546
FT                   /transl_table=11
FT                   /locus_tag="CC1_04390"
FT                   /product="Nucleoside-diphosphate-sugar epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79367"
FT                   /db_xref="GOA:D4J4U6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR008089"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4U6"
FT                   /protein_id="CBK79367.1"
FT                   /translation="MKNSNIKLKNKTVLVTGSSGFIGANLVLELLRTQQSIKIIGIDNM
FT                   NDYYDVSIKKYRLKQIEKAVAEHPESSWKFIKGSIADKALINEIFETYKPSVVVNLAAQ
FT                   AGVRYSITNPDVYIESNLIGFYNILEACRHSYDNGQTGVEHLVYASSSSVYGSNKKVPY
FT                   STEDKVDNPVSLYAATKKSNELLAHAYSKLYNIPSTGLRFFTVYGPAGRPDMAYFGFTN
FT                   KLRNNETIYIFNYGNCKRDFTYVDDIVEGIKRVMQATPEKKLGEDGLPIPPYAVYNIGN
FT                   NHPENLLEFVDILQQELIRAKVLPEDYDFESHKKLVPMQLGDVPVTYADTSALEADFGF
FT                   KPSTSLREGLRKFAEWYREFYLDK"
FT   CDS             467574..468818
FT                   /transl_table=11
FT                   /locus_tag="CC1_04400"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79368"
FT                   /db_xref="GOA:D4J4U7"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4U7"
FT                   /protein_id="CBK79368.1"
FT                   /translation="MEKQYKIAVAGTGYVGLSIATLLSQHHQVTAVDIVPEKVKLINEK
FT                   KSPIQDDYIEKYLAEKELNLTATLDAESAYKDADFVVIAAPTNYDSKKNFFDTSAVENV
FT                   IELVIKYNPDAVMVIKSTIPVGYTKSVREKFHCDNIIFSPEFLRESKALYDNLYPSRII
FT                   VGTDVENVRLVKAANTFASLLQEGAIKEDIDTLIMGFTEAEAVKLFANTYLALRVSYFN
FT                   ELDTYAESKGLNTQQIIDGVCLDPRIGSHYNNPSFGYGGYCLPKDTKQLLANYADVPEN
FT                   LIEAIVESNRTRKDFIANRVLEIAGGYEANDSYDAAMEKEVVVGVYRLTMKSNSDNFRQ
FT                   SSIQGVMKRIKAKGATVVIYEPTLEDGTTFFGSKVVNDMDKFKEMSQAIIANRYDSCLD
FT                   DVKDKVYTRDIFRRD"
FT   CDS             468864..469769
FT                   /transl_table=11
FT                   /locus_tag="CC1_04410"
FT                   /product="dTDP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79369"
FT                   /db_xref="GOA:D4J4U8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4U8"
FT                   /protein_id="CBK79369.1"
FT                   /translation="MKTTLLIMAAGIGSRFGGGIKQLEPVDDNGHIIMDYSVHDAIEAG
FT                   FNKVIFIIRKDIAEEFKAVIVDRIAAICSKHNVTVEYAFQDIHDIPGELPEGRTKPWGT
FT                   GQAVLSAKELITTPFIVINADDYYGKESFKAVHDYLMNGGKSCMAGFVLKNTLSDNGGV
FT                   TRGICKMDDDHNLTEVVETKNILKIANGAEADGVKLDINSLVSMNMWGLTPEFLDILEQ
FT                   GFADFFEKEVPANPLKAEYLIPIFIGQLLERGSMSMKVLKTHDTWYGMTYKEDFEAVRE
FT                   SFKKMLEDGIYEEELFSDLK"
FT   CDS             469852..471231
FT                   /transl_table=11
FT                   /locus_tag="CC1_04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79370"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4U9"
FT                   /protein_id="CBK79370.1"
FT                   /translation="MIVNQMYIGRKKMTVESLKNDRIKLKSVEVERDYTLNSILKVVFS
FT                   KCNISVIYGENGCGKTTILKLINAFLAQNDSIFEQEKVLSISITFSLNGEENKVSVKKS
FT                   EKEEVIKDEDGKAIKCITRYYDWEEYRESKLSDMTSILFGVNRGITTNSSISEDEICDC
FT                   ILKSRFRRNFKDSHELIVFSHMLKRNLNMNERRRRGRKIRSSLDLSASNLNIDSISMDV
FT                   IEEVLVERYRIAKMVINDKVRKALFDTLADACDSLDDNDITEEKYHEVLLKNKDRLISA
FT                   LSSGETNTLSDRIVEILKNVDEQKDNFENSENPLLKKLIVNMSKELNKESGYIQAINKL
FT                   EEVFNEYIGPKKFLQITDESVTVKFCGSEESHRIEALSSGERHLLVLLTIFVIEGNRRQ
FT                   LFMVDEPEISLNMIWQRKLLPLLGELAPNAEIIVASHSPSIARANSNYLVGVNNGRSDE
FT                   E"
FT   CDS             471221..472132
FT                   /transl_table=11
FT                   /locus_tag="CC1_04430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79371"
FT                   /db_xref="InterPro:IPR029492"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4V0"
FT                   /protein_id="CBK79371.1"
FT                   /translation="MKNDLEETVIAAFMNKQPVVLVEGQDDIKFYDNIATLNEKTVDVQ
FT                   AIEMIDGYAEGCEHVCNAMDEISLLIQNDSRLKGYAIGIIDKDVRDYLNEVPSNDNLLI
FT                   LKYYSYETHLITDVTIKRLIEQLTKVPGSLITDHVIDIIKQGFSNQSRELYYFSLEALK
FT                   KRVDASYQANVEYGEKGGALIGRGGEYKWGLIAHKVTILDQFASRYNINPENLKLIVKG
FT                   KWYLEAWCDYLIKKVRELHSLCGTEIPKCKYCDAGNEQKCLWRVSSTFQREQIKSLLYS
FT                   RQFIDKDEVKYISDFMREKLAG"
FT   CDS             472224..472643
FT                   /transl_table=11
FT                   /locus_tag="CC1_04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79372"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4V1"
FT                   /protein_id="CBK79372.1"
FT                   /translation="MKNQTNFIQSFIHTVDITRQDTILCNHELMRQVVDTYLTYPCYLE
FT                   SDGWLAFDDSAKRGAGALGIFKADVSLTADILTSVKAPVNTILEMGGQPRFADGVRGES
FT                   IIRMLRDGREVHQELDTYLRFYASVYYWIGVNGRT"
FT   CDS             472760..473128
FT                   /transl_table=11
FT                   /locus_tag="CC1_04450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79373"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4V2"
FT                   /protein_id="CBK79373.1"
FT                   /translation="MAEQTSLVAQQVRLMHWAEQIRECQNRPEGMDVSTWCEHNNITKA
FT                   NYYYRLKRVRQMCLDQLPEAEKSAFVELPRPKAEGTGTVAEVPVMCIKNVHGLSADIFS
FT                   SVSPKLLHCLVEAFGHAE"
FT   gap             473626..474006
FT                   /estimated_length=381
FT   CDS             complement(474099..474704)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04470"
FT                   /product="DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79374"
FT                   /db_xref="GOA:D4J4V3"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4V3"
FT                   /protein_id="CBK79374.1"
FT                   /translation="MFIIHRQYRCFPDWIYRLTRKLLHKLNKDLINRLATCEYISEHRN
FT                   LFITGATGCSKTYMACAFGMEACKQYYNTRYVRMPDLLMDLDIARTEGNYRKVMAKYSN
FT                   PVLLILDEWMLLKPTDTEQKDIFELLHRRRKKSSTIFCSQYVFEEWYDQLGGEASPLAD
FT                   AIIDRIAHDSYQINITSIDAEHDRSMREVYGLDKSLRE"
FT   gap             476165..477107
FT                   /estimated_length=943
FT   CDS             complement(477111..478055)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04500"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79375"
FT                   /db_xref="GOA:D4J4V4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4V4"
FT                   /protein_id="CBK79375.1"
FT                   /translation="MSNKITSLVTSYLDYKRGLGFQMTAESVYLNAFARYTQDLGYTGA
FT                   LTRKIVFQWCESGDDSSLVTKGRRFEPLKGLADYAGAFDPDSELLPKLPYGNPHKRVRP
FT                   HIYTLDETCRLMEQCDHLYSPDGIRSLTMKTAIGLLWATGLRTSELVNLTISDVDFTNN
FT                   LLNVCSSKFNKDRIVPLLPEVSDQLRSYRSQVESICNKVRLGNEFFITTGGKPFKRNAF
FT                   EYAFQTIRDIIDVSDSGYPHARLYDFRHTFATRTIKNWLEQGMDVNAKLFLLSTYMGHI
FT                   HPEDTYWYLSSTPELMDIASRKYEDIYGGDAHE"
FT   CDS             complement(478052..479248)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04510"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79376"
FT                   /db_xref="GOA:D4J4V5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4V5"
FT                   /protein_id="CBK79376.1"
FT                   /translation="MKQETINQFHDYLKDQGHVNTTIAGYIRTICDLEEPPDTTDPLIL
FT                   LVYVDRAIKLKRQSLSRANFASAQAALGSFFFMKAGIRIRDFRKQCAAKDQYDPLMAQY
FT                   ASYCRDFLHLSEPVTLAAVRETKKFLKAVVPDIHDIAWTSITANDVINYLSKERNDLCT
FT                   ASIGVTVTALRRFFRFLQHHDIVIHTSVLNLPLSVPAWSKGSILPITLTKDEQSRLSNY
FT                   SFPSTPTGLRDYSILLCFTELGLRCSEVANLQIGDIEWNRGTVIVRKTKTHAERELPMS
FT                   VKLGKALEDYVMNARPISLGSPLYFKSARRMLEPASTDNIRSVIRQLYSKVGITGWHVG
FT                   THALRRTVGSYLYNAGNDLKTVADLLGHTSVSTTKAYVRIDVESLREVASSWPGRESI"
FT   CDS             complement(479353..480825)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04520"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79377"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4V6"
FT                   /protein_id="CBK79377.1"
FT                   /translation="MAASAKDLQLHELKDTVSQLKMMISEQTELIRSLREVIATKSETE
FT                   QVFREQNRLLQEQIDYLTKKLFAPSSEKRSAEIPGQLHLFDEAETEQDLSKTDSGQETA
FT                   VSAHTRKKKASSKETFKGFKFNKIVIPLSPEEQICPVCGTQMTLIGEEYARRELVFIPA
FT                   RCEINEYYTQSYRCPSCKEGFGDTETPVIVKSKAPSALVGKGPASPSCAAWTMHQKYAN
FT                   GMPLYRQEKDWAQYGAAISRTTLANWIIYCSQHYFQPVYDYFHRELLKRRFAMADETRV
FT                   QVLDEPDRKAETQSFMWLFRSGEAGQPTIILYDYTPTRNGDHAAKFLEGFQGYLETDGY
FT                   QGYNKIPGIKRCSCWAHIRRYFIDAVPKGKQFDYSQPAVQGVQYCDRLFRIEDDINKRY
FT                   PGNYEKRKQLRLEKEKPVLEAFWSWLDSLHPVRNSRMYKAVNYVQNRRETAETYLEDGR
FT                   CSFTNNASENAIRPFTVGRNYAVSRIMFCSAA"
FT   CDS             complement(480929..481213)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04530"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79378"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4V7"
FT                   /protein_id="CBK79378.1"
FT                   /translation="MRKSIDGLSAIIYDQLQMDPSSNSLYLFCGRRRDRIKALFHEPDG
FT                   FVLIYKRLSVKGGYQWPRKRSEVRNLTWREFDWLMSGIDIDHPKALKPE"
FT   CDS             complement(481340..482362)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04540"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79379"
FT                   /db_xref="GOA:D4J4V8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4V8"
FT                   /protein_id="CBK79379.1"
FT                   /translation="MKNRTLNCQLFFSKTNDFLSCYLPCQAARSIHTIETYRDGLTVFR
FT                   RYITNVRKISIKKFLFTDCISELMLDYLGYLNSQGCEASTCNNRLAALRAYLWYASDMD
FT                   ISLQSIALSASHVPFLKEPKKEKQIIQDEDMKALLAAPPDTQKGNRDRMIMILLYDTAI
FT                   RITELLELKISSLKLTSVPSIHIHGKGDKERSVSITDATLSHLKKYLRQFLSEMLPNQP
FT                   LFYMKIKGSIAPMSPGNVSRIINKYADAIRPEHPNLPKHLHCHMFRRTRATGLYRNGVE
FT                   LEMISVILGHSSTETTRIYATPSIEMLGEAMNTANSTIPDETPEWEENEDELARICGLR
FT                   "
FT   CDS             complement(482352..483332)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04550"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79380"
FT                   /db_xref="GOA:D4J4V9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4V9"
FT                   /protein_id="CBK79380.1"
FT                   /translation="MSGHYSFTSCFAPFIESVITEKRNACFQYEHAEWILHKFDEFCNQ
FT                   EQVETSVITQELAGKWGTLRKTETKVTLAGRISVLRQLSLYMQAYGIKCYVPRNFTRKS
FT                   NRSAYVLSIEEIQSLFLEIDSYQPTINAEVFHRLALEYRILFRMLFYCGLRVSEARKLR
FT                   LDMVDLENGVLKIYQSKGSNDRLVYLPDDLRQLCCEYLKIMTVKYKIKSEWFFPASDPA
FT                   RVLQVASVGKRFHRAWEQTPYAREGALQPTVHSLRHTFVVLKMNEWMKSGVKLDNMMPY
FT                   LSKYLGHSSPDDTFYYYHQVEEAFSIIKQKDQSASFVIPEVADEK"
FT   CDS             complement(485099..485242)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79381"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4W0"
FT                   /protein_id="CBK79381.1"
FT                   /translation="MNQYNIIVQQLLAYLTKRKQCSSSRLSHKQCYEEFGQYLKENNLY
FT                   LS"
FT   gap             485439..486007
FT                   /estimated_length=569
FT   CDS             complement(486014..487147)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04580"
FT                   /product="Biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79382"
FT                   /db_xref="GOA:D4J4W1"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4W1"
FT                   /protein_id="CBK79382.1"
FT                   /translation="MWKDHLCIVMAIEHYNPLGQIRSLGEAGVKPVYIAIKGRAKIASV
FT                   SKYISKCHYVDTVEEGYDILMKEYGSVAAETGKKPFLFSSDDKGVGFLDLHYDELKDKF
FT                   TFFNAGKQGRINEFMDKHNILELAKKHGLNVLENRVCKRGEIPEGLEYPVITKSISPNV
FT                   GGWKSDVHICHSEKELEEAYKSIEAPTVLVQKYIEKQNEYCMEGFSANKGNDVLIAIVN
FT                   TYNYLLPDYYSPYMTVKNMTNDYIKNALKGMFAEIGFEGVFEVEFLIDQDGTYYFGEIN
FT                   FRNSTWSYAATKAGMPLPVLWAQTQEQGFMDQNADKEFEPFTAMVEPIDYAKRVKTGKI
FT                   DLAEWMKDFKEAKCGYYYSPDDLEPWRVCVNNWNNLG"
FT   CDS             complement(487163..488281)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04590"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79383"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4W2"
FT                   /protein_id="CBK79383.1"
FT                   /translation="MNSKSNLLSILTLCGACISFYIGAGFATMQEVVQYEASYGSLFPI
FT                   VIFVVAVIYVYTNLSFATNGNRLNLSRGGDIFGTYCGVFGKKFGKIASVFFDYFSAIFC
FT                   YMSFVVMCGGASSTMTQQWGLPVGIGAVILTIAVICTVVFGLDGILNALSKIGPVIIIM
FT                   ILLVSIVTAISGAPNYAQNLAAVDAGTYSDVMQQVGNGNPFASGASYGGFVILWFAAFL
FT                   AEIGAKNKLKNVNLGMLLSTIFIFGAASICCLALIGHIDTTAAADIPALVLAGQVSPVL
FT                   AQLFAIIICAGIYTSAVPLLWTGIRKISKEGTSKYKIITIIGGILGCIIACFVPYKGLI
FT                   NVLYGLNGYLGFILVFFMIIYDIKTKMSKKAN"
FT   CDS             492724..492891
FT                   /transl_table=11
FT                   /locus_tag="CC1_04650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79384"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4W3"
FT                   /protein_id="CBK79384.1"
FT                   /translation="MKEISYIHSEAYAAGERKHDTIIENYYSEHDIVYDRMADMRKIGM
FT                   KKTGRMNNIF"
FT   CDS             493292..493369
FT                   /transl_table=11
FT                   /locus_tag="CC1_04660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79385"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4W4"
FT                   /protein_id="CBK79385.1"
FT                   /translation="MGRFMNPDSSVFQVALNSRIYVEKD"
FT   CDS             493600..494817
FT                   /transl_table=11
FT                   /locus_tag="CC1_04670"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79386"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4W5"
FT                   /protein_id="CBK79386.1"
FT                   /translation="MVERKEYLDQLWAWKDEQQIKVVTGIRRCGKSVLLEQYQQRLLAN
FT                   GVTPEQIISINFENLDYEPLKDYMKLYNYLKERLCADKMTYIFLDEVQEVPSFEKVVDS
FT                   LYIRDHVDVYITGSNAYMLSSELATLLSGRYTEIKMLPLSFREYMVVTGMAKEEAFAEF
FT                   MKTGGIPYVAVMNRTDEKIDQYLEGIYNTVIVKEIEQRQARREKEGGKRKITDIALLKT
FT                   IARYLASVIGSPVSMKSITDYLTSAGRKVSQNTVSNYVEALTESFIFYPVERLDIVGKQ
FT                   LLKVNNKFYMVDMGIRNHILPRKRYDLGFTIENIVYLELSRRGGKVNIGKCGSTEVNFV
FT                   TQKEGVLTYYQVTADMTAEETFEREMRPLRSIQDNYEKIVLTLDRFSLGNYDGIKVVNV
FT                   IDWLLG"
FT   CDS             497137..498084
FT                   /transl_table=11
FT                   /locus_tag="CC1_04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79387"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4W6"
FT                   /protein_id="CBK79387.1"
FT                   /translation="MDILGDKVICQLIQSLKVRLRKKTISSREQPFLSAPRLIFVCGKE
FT                   WVDSEETIRNYTIRTLRKCRIANHYGTQNEAVLCIIAEKLYVQDLSEDIFSFEKMLAEI
FT                   SDRIIIVAESPGTFCELGAFVMDEDCRRKTMVINEDNADYENSFITKGPIKKLESLNES
FT                   SIIRHNGLERIKNSHEYNFKVQEIAKAPLTIAINDNAGSVELKSLIYELANIVELFQPV
FT                   EYFEIETLYKRLKDFEGYTIKNTADHKIRSIRQVLSLMEKMDMLLRQDGYYILNKNISC
FT                   YNVMFRISRKEFNDFRIMYLNRLNKCQKSRVDVL"
FT   CDS             498081..498905
FT                   /transl_table=11
FT                   /locus_tag="CC1_04720"
FT                   /product="Reverse transcriptase (RNA-dependent DNA
FT                   polymerase)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79388"
FT                   /db_xref="GOA:D4J4W7"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4W7"
FT                   /protein_id="CBK79388.1"
FT                   /translation="MRLSERIAKGIGIDESYVTIIASRNNLYAKYYIPKKNGRYRLILQ
FT                   PSKELKVLQRWLLRNIFAYFPVSEYSSAYSKGNSVRKNAAVHKEGRYLLHTDITNFFPT
FT                   ISRTMLKQYFQSNESLTRKLGMADEDIELILDICLYRGENLVVGSVASPQIANMLMYAF
FT                   DLELKQMLDDFGSFRYTRYADDIVISSMSFIDEQVLKQTEQLMIKYGFKMNHEKTYYMG
FT                   KNGKRQVTGIVLDNNRNALTIGNKKYKKFQRQHTKSSLQLCSFYSLPLFLIQ"
FT   CDS             complement(500293..500355)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79389"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4W8"
FT                   /protein_id="CBK79389.1"
FT                   /translation="MCKVMEDMRNEAAKEAARKN"
FT   gap             500512..501114
FT                   /estimated_length=603
FT   CDS             complement(501176..501511)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79390"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4W9"
FT                   /protein_id="CBK79390.1"
FT                   /translation="MFLVYRLNNTMDSMFESNTYVFRDLKKSLREIIAEEKGMVTLNSQ
FT                   FKSIDIRDISDNYRFIGGKEQCAEFIKKSLASMPQERCVNKTIQRTYRREDIPDAVFTK
FT                   SHRDVEY"
FT   CDS             complement(501495..502613)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04760"
FT                   /product="UDP-galactopyranose mutase"
FT                   /function="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79391"
FT                   /db_xref="GOA:D4J4X0"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4X0"
FT                   /protein_id="CBK79391.1"
FT                   /translation="MKYDYLVVGSGLYGAIFAHEAKVHGKTVLVVDKRPNIAGNIYTEN
FT                   IEGINVHKYGAHIFHTNDKKVWKYITQFAEFNRFTNSPVANYKGELYSLPFNMYTFNKM
FT                   WGVVTPEEAVAKIEEQRSEITGEPKNLEEQAISLVGRDIYEKLIKGYTEKQWGRDCKEL
FT                   PAFIIKRLPVRLTFDNNYFNALYQGIPVGGYTKMVERLLEDIEVRLDTDYLEQKAELDA
FT                   LADKVVYTGPIDAYFDYKLGTLEYRSVRFENELLDKPNFQGNAAVNYTDRETPWTRIIE
FT                   HKWFEFGKDENGNDLPKTIISREYSSEWKPGDEPYYPVNDEKNGALYAAYRKLADAEEK
FT                   VIFGGRLGEYKYYDMDQVIAAVLEKCENVFGL"
FT   rRNA            complement(502798..506307)
FT                   /gene="23S"
FT                   /locus_tag="CC1_R_34990"
FT                   /product="23S rRNA"
FT   misc_RNA        complement(503305..503412)
FT                   /locus_tag="CC1_35080"
FT                   /product="Pseudoknot of the domain G(G12) of 23S ribosomal
FT                   RNA"
FT   gap             504079..504816
FT                   /estimated_length=738
FT   rRNA            complement(505857..508732)
FT                   /gene="16S"
FT                   /locus_tag="CC1_R_35000"
FT                   /product="16S rRNA"
FT   gap             506439..507762
FT                   /estimated_length=1324
FT   gap             508837..509178
FT                   /estimated_length=342
FT   tRNA            complement(509321..509408)
FT                   /locus_tag="CC1_T_34980"
FT   CDS             complement(509478..510029)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04780"
FT                   /product="hydro-lyases, Fe-S type, tartrate/fumarate
FT                   subfamily, beta region"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79392"
FT                   /db_xref="GOA:D4J4X1"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4X1"
FT                   /protein_id="CBK79392.1"
FT                   /translation="MDRHIKAPLNDDEVKMLKAGDYVYISGTIYTARDAAHKRMYEALQ
FT                   NGQEVPMPLKNNIVYYMGPSPAREGRPIGSAGPTTSSRMDKYAPLLMDQGLKGMIGKGK
FT                   RSAEVREAIVRNGAVYFAAVGGAGALLSKAVKKAEVIAYDDLGTEAIRKLEVENLPAIV
FT                   VIDSEGSYLYEDVAKKYRKI"
FT   CDS             complement(510042..510884)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04790"
FT                   /product="hydro-lyases, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha region"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79393"
FT                   /db_xref="GOA:D4J4X2"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4X2"
FT                   /protein_id="CBK79393.1"
FT                   /translation="MREISCNAIISSIKEMCIQATHYLSDDMKSALYKGVEKEESPLGR
FT                   QILEQLCENLTIAGEDMIPICQDTGMAVVFVEIGQEVHITDGGLEDAINEGVRQGYVEG
FT                   YLRKSVVSDPIERVNTQDNTPAIIHYSIVPGDRFRITLAPKGFGSENMSRVVMLKPADG
FT                   IEGVKKVILETVDLAGPNACPPMVIGVGVGGDFEKCAIMAKHALTRAAGEHSSVPYVRA
FT                   LEEEMLDKVNRLGIGPGGLGGTVTAFAVNIETYPTHIAGLPVAVNICCHVNRHVTKEL"
FT   CDS             511039..512313
FT                   /transl_table=11
FT                   /locus_tag="CC1_04800"
FT                   /product="Chloride channel protein EriC"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79394"
FT                   /db_xref="GOA:D4J4X3"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4X3"
FT                   /protein_id="CBK79394.1"
FT                   /translation="MNFKDQIEHLKTFFTPSVKNVILLIRWLITAVFTGLLVGAVGTLF
FT                   YYAMSFVTGCRTAHPILIYLLPFAGLLIIFLYRVSGQYNNTGTNLVLSSIQSDNHISVK
FT                   VAPLILVSTLITHLFGGSAGREGAALQIGGSLGDFLAQTFHFDEKDKKLMIMCGMSACF
FT                   SAVFGTPMAAAVFSMEVISVGIMHYSALVPCVISSLTASMLARHFGAMPEVFPITDLPA
FT                   LTALTVGQAILAAAAFAAISVVFCIALHLSEHTYKKYIANPYLRVFVGGLIVVLLTLLL
FT                   HTNDYNGAGMPMIARCFEGSVPPWAFMMKIIFTAATLGAGFKGGEIVPSFFIGATLGCV
FT                   IGPILGLPAALCAGCGMVGVFCGVTNSPITSLLISFELFGFEGMPYYLITIAVSYMLSG
FT                   YYGLYSSQKIIYSKTRTEYIDAHTH"
FT   CDS             complement(512467..515016)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04820"
FT                   /product="DNA gyrase subunit A"
FT                   /function="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79395"
FT                   /db_xref="GOA:D4J4X4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4X4"
FT                   /protein_id="CBK79395.1"
FT                   /translation="MDDKIFDKIHEVDLKERMETFYIDYAMSVIASRALPDVRDGLKPV
FT                   QRRILYAMIELNNGPDKPHRKCARIVGDAMGKYHPHGDSSIYGALVNMAQDWSTRYPLV
FT                   DGHGNFGSMDGDGAAAMRYTEARLSKISMEMMADINKDTVDFQPNFDETEKEPVVLPSR
FT                   YPNLLVNGTTGIAVGMATNIPPHNLRETIDGVIKIIDNRVEENRETTIEELMEIIKGPD
FT                   FPTGAMILGKNGINQAYRTGRGKLKVRAVTDIETMPNGRHRIVATELPYMVNKAKLIEK
FT                   IAELVKDKRIEGISDLRDESSREGLRVVIELKKDANPNVVLNQLYKHTQLQDTYGVIML
FT                   ALVNNQPMILNLKQMLELYLKHQEEVVTRRTRFELNKAEERAHILQGLLIALDHIDEVI
FT                   SIIRSSKNVAEAKTRLMETFGLTEVQAQAIVDMRLRALTGLEREKIENEYNELMKRIGE
FT                   LKAILADEKLLLGVIREEIKLIRDKYGDDRKTSLGVDDDEITVEDLIKRENTVIAMTQL
FT                   GYIKRMTMDNFRSQNRGGRGIKGMTKLDEDCITELMMANTHDYILFFTNKGRVFRLKGY
FT                   EIPEASRIARGTALINLLQLEPGEKVTATIPLEKYENDKYLFMATKNGMVKKTSIMEYI
FT                   NVRKTGLLAIGLREDDELIEVKVTDESDLIYLVSQKGMSICFKQDNVRATGRTSMGVIG
FT                   MDLDADDLIVGMQVSSQGEAVLIVSEKGLGKRTMLEEFNVQNRGGKGLKCYKITDKTGL
FT                   VVGVKCVNAEDELMIITTGGIIIRMPVEGISILKRITSGVKLIQLDEGSVVASIAKIRE
FT                   DMKDDEETSDEQSEEDGMTEEVLENDSVDNSEENEIE"
FT   CDS             complement(515052..516962)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04830"
FT                   /product="DNA gyrase subunit B"
FT                   /function="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79396"
FT                   /db_xref="GOA:D4J4X5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4X5"
FT                   /protein_id="CBK79396.1"
FT                   /translation="MSEGYGASQIQILEGLEAVRKRPGMYIGSTSAKGLHHLVYEIVDN
FT                   SVDEALAGYCDHIEVTINKDNSITVVDNGRGIPVGIQAKAHKPAVEVVFTILHAGGKFG
FT                   GGGYKVSGGLHGVGASVVNALSEWLEVNVYVDGYEYYQRYERGKVMCELQKIGPTEKRG
FT                   TTVHFLPDKEIFEETVFDYKVLKQRLREIAFLTKGLRISLTDVREEEPILSSFHYEGGI
FT                   REYVAYLNKANTPLYDEIIYCEGEKDGVLVEVALQHNDGYNENVYSFVNNITTPEGGTH
FT                   LVGMRSALTKTFNDYARKNKLLKDNEQSLTGEDIREGLTAIVSIKIGEPQFEGQTKQKL
FT                   GNSEARGAVESIVSDKLGVFLEQNPAIGKLIVEKSVMAQRARDAARKARDLTRRKGALD
FT                   SMSLPGKLADCSDKDPAKCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARL
FT                   DKILVNNEIKAMITAFGTGIHEDFDITKLRYHKIIIMTDADVDGAHISTLLLTFLYRFM
FT                   PDLIREGYVYLAKPPLYKIERNKKEWYAYSDDELNAILTEIGRDQNNKIQRYKGLGEMD
FT                   AEQLWETTMDPERRILMRVSMDDAEKVSIDETFSVLMGDKVEPRREFIEKNAKYVRNLD
FT                   I"
FT   CDS             complement(516980..518077)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04840"
FT                   /product="DNA replication and repair protein RecF"
FT                   /function="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79397"
FT                   /db_xref="GOA:D4J4X6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4X6"
FT                   /protein_id="CBK79397.1"
FT                   /translation="MYVESLALENYRNYVHLSVNLSPGINIFFGDNAQGKTNVLEALYM
FT                   CATTKSHRGSRDREIIRFGEEEAHIRMLLSKEHVRHKIDVHLKKNKSKGIAIDGIPIRK
FT                   SGELFGLVHMICFSPEDLAMIKNGPGERRRFLDLELCQLDKVYLHNISNYNKIVNQRNN
FT                   LLKQIGFDSALKDTLDIWDMQMVNYGRKVIETRRLFIAQLNEWLEQIHGRLTGNREKLR
FT                   LVYQPSTEPEDFERVLLSKRDQDIRMKMSGTGPHRDDFLFMVGEVDIRKFGSQGQQRTA
FT                   ALSLKLAEIELVRQSIGDEPVLLLDDVLSELDSSRQNYLLDCIKDIQTVITCTGLDEFV
FT                   NHRFNIDRIFKVTDGTVDFVNEVVG"
FT   CDS             complement(518081..518287)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04850"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79398"
FT                   /db_xref="GOA:D4J4X7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4X7"
FT                   /protein_id="CBK79398.1"
FT                   /translation="MQTFGLKDEHIKLGQLLKATGLVGSGVDAKIVVQEGLVKVNGKVC
FT                   YMRGKKIVSGDIVEFENEKIEVV"
FT   CDS             complement(518390..519493)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04860"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /function="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79399"
FT                   /db_xref="GOA:D4J4X8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4X8"
FT                   /protein_id="CBK79399.1"
FT                   /translation="MKIICNKSALLTGVNTVLKAVPARTTMPILECILIDTTSGVIKLT
FT                   ANDMDLGIETTVDGDVLDKGCIALEAKLFSEIVRKLPDSEVTIETDDNNKALIKCEKAK
FT                   FNIAGKDGEDFVALPEIEKTHFITLSQFSLKEIIRQTIFSISDNESNRMMSGELLQIDQ
FT                   DQLRLVSLDGQRISIRKISLKESYDPIKAVIPGKTLNEISKILSGDMDDDVRIYFTDRH
FT                   VLFEFDQTVVVSRLLEGEYFQIDKMISSDYNTKITINKKELQGCIERASLLIRESERKP
FT                   IIINVTDGSMEMKIQSAMGSMNEDIDISKEGRDIMIGFNPKFILDALRVIDDEEITMYL
FT                   VNPKAPFIIKNDEQSYIYLVLPISFNM"
FT   CDS             521804..521938
FT                   /transl_table=11
FT                   /locus_tag="CC1_04880"
FT                   /product="LSU ribosomal protein L34P"
FT                   /function="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79400"
FT                   /db_xref="GOA:D4J4X9"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4X9"
FT                   /protein_id="CBK79400.1"
FT                   /translation="MKMTFQPKTRQRSKVHGFRKRMSTANGRKVLAARRAKGRKVLSA"
FT   CDS             522065..522424
FT                   /transl_table=11
FT                   /locus_tag="CC1_04890"
FT                   /product="ribonuclease P protein component"
FT                   /function="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79401"
FT                   /db_xref="GOA:D4J4Y0"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Y0"
FT                   /protein_id="CBK79401.1"
FT                   /translation="MEYSESLKKNRDFKTVYGNGKSRANKYLVMYVMKNGTEKNRIGIS
FT                   VSKKVGNSVVRHHLTRLIREIYRLNEHHFKKGLDIIFIVRVNAKKIDYHTLEKALMHVA
FT                   DIHRVLEKSRNEQNE"
FT   CDS             522408..522626
FT                   /transl_table=11
FT                   /locus_tag="CC1_04900"
FT                   /product="conserved hypothetical protein TIGR00278"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79402"
FT                   /db_xref="GOA:D4J4Y1"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Y1"
FT                   /protein_id="CBK79402.1"
FT                   /translation="MSKMSRILIAMIRFYRKYISPMKRGCCIYIPTCSQYAIEAIMKYG
FT                   AVKGSYLAARRILRCHPFAKGGYDPVP"
FT   CDS             523952..524746
FT                   /transl_table=11
FT                   /locus_tag="CC1_04920"
FT                   /product="Predicted RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79403"
FT                   /db_xref="GOA:D4J4Y2"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Y2"
FT                   /protein_id="CBK79403.1"
FT                   /translation="MEYIEVSAKTVEDAISEAAIKLEVPSDKIEYEVITEGSTGFLGLI
FT                   GSKPAVIKARKKFNLLDHTKDFLARLFKAMNVDVNSTVDYDEESRTMNIVFDGEDMGLL
FT                   IGKRGQTLDSLQYIISLVVNKESDSYIRIKVDTENYRERRKATLENLAKNLAYKVKRTR
FT                   RPVSLEPMNPYERRVIHSVLQNDRYVETHSEGEEPYRKVVITLKKDYRERSPRSGYNRE
FT                   GRYNRENNYNRERGYRRERSYSREEVERPAENNENNDSNDNV"
FT   CDS             524949..526325
FT                   /transl_table=11
FT                   /locus_tag="CC1_04930"
FT                   /product="tRNA modification GTPase trmE"
FT                   /function="tRNA modification GTPase trmE"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79404"
FT                   /db_xref="GOA:D4J4Y3"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Y3"
FT                   /protein_id="CBK79404.1"
FT                   /translation="MQSDTIAAISTGMTNAGIGKVRLSGDDAVTIVDRIYRSPGGRKRL
FT                   SDVSTHTIHYGYIYDGDCLIDEVMVLIMRGPNSYTREDVVEIDCHGGVVVMKKLLETVL
FT                   KYGARLAEPGEFTKRAFLNGRIDLSQAEAVIDVINAKSDMALESSLNQLRGSVKKSIEK
FT                   LRKGIIGNIAFIEAALDDPEHIQAEGFGDELAVQVRGYMAELQKMLDSADNGRLVKEGI
FT                   KTVILGKPNAGKSSLMNVLLGENRAIVTEIAGTTRDTLEEHVSIHGIPLNIIDTAGIRQ
FT                   TEDVVEKIGVRKAIDFAEEADLIIYVVDSSTEMDQNDDDIIRMIQSKKVIVLMNKSDLR
FT                   PVVSRSDIEKQLQAPIIEISAREETGLDIFEDTLKDMFFAGDIHYNDELCITNVRHKAA
FT                   IAAALESLKMVMHSIEDGMPEDFFSIDLMDAYEQLGHIIGEAVEDDLVDTIFSDFCMGK
FT                   "
FT   CDS             528302..529021
FT                   /transl_table=11
FT                   /locus_tag="CC1_04950"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /function="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.-.-"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79405"
FT                   /db_xref="GOA:D4J4Y4"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Y4"
FT                   /protein_id="CBK79405.1"
FT                   /translation="MYSIESFKKKVDMLHIKLSDEQYNQYVTYYEMVVEKNKVMNLTGI
FT                   TEFDEFIDKHYIDSLSIVNAVDIHQVQSAIDVGTGAGFPGIPLKIAFPHLKITLLDSLN
FT                   KRINFLNEVVETLGLENVETCHGRAEDFGHRKEYREQYDLCTSRAVANLSTLSEYCVPF
FT                   VKIGGQFVSYKSGNVDNELRESEKAIRILGGEIGKVCSFVLPETDFARTLVPIKKIKST
FT                   GKKYPRKAGTPSKEPLQ"
FT   CDS             529033..529473
FT                   /transl_table=11
FT                   /locus_tag="CC1_04960"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79406"
FT                   /db_xref="GOA:D4J4Y5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Y5"
FT                   /protein_id="CBK79406.1"
FT                   /translation="MIRGVYLNTMNDDLSKCMKIYQDVFEEDMNENVETWKNSNSEDMA
FT                   IYLLLYNENEIPVGTARLIFDFDGVFKFDGLAVLPEFRKNGYGDFIMHMIFDKAYQSGA
FT                   HYLVSNDIYHMPDYFKKYGFSIENNHLSLDLKQYFNTHKCCH"
FT   CDS             complement(529532..530185)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79407"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Y6"
FT                   /protein_id="CBK79407.1"
FT                   /translation="MESKIFAKLNFDPGILVILSLILTVVAIVLVIMLVLRQSRLEMNY
FT                   KIFMKGKNGKTLEDTFKAQFDDIDLVKEQTDLLHKRMMYVEKSLNRSYQKCGVVKYDAF
FT                   KELGGQLSFAYALLNDSNTGFVMNCIHSREGSYTYIKDIVRGECELPLSEEEAEAVKNA
FT                   IASNSPQPTTTTIAGGKKIRKINKSKAQSEETPSKKEAVAKKKSASQSTTKENE"
FT   CDS             complement(530212..531303)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04980"
FT                   /product="ParB-like partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79408"
FT                   /db_xref="GOA:D4J4Y7"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR022086"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Y7"
FT                   /protein_id="CBK79408.1"
FT                   /translation="MAVKKKKGLGRGLDALISPTTSLTTHSETTAPKKSELQSTSSKTE
FT                   ADLKSTQNDATHSSNIVEKIVEVPVEKVVEKIVEVPVEKVVEVPVEKIVEKVIEKNAET
FT                   LVKIDEIEPNRSQPRQNFDEDALQELADSIKLHGIIQPLIVQKKDDFYTIIAGERRWRA
FT                   ARLAGLTEIPVIIKDYTPMESMEIALIENLQREDLNPIEEAIAFQKLIDEYGLKQEEAA
FT                   EKVSKSRTAVTNSLRLLKLDNRVKQMIVDEMISSGHGRALLAITDPELQYTLAMKIFDN
FT                   KLSVRETERLIKNMLADKKNKKATGIDPQTAIIYHQLEDKIKSIIGTKVQINAKSNKKG
FT                   RIEIEYYSEEDLERIVSLLETIK"
FT   CDS             complement(531294..532073)
FT                   /transl_table=11
FT                   /locus_tag="CC1_04990"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_04990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79409"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Y8"
FT                   /protein_id="CBK79409.1"
FT                   /translation="MSRIIAVANQKGGVGKTTTAINLSACLAEKNKKVLTLDMDPQGNT
FT                   TSGLGVDKNQAENTVYELILDESELSECIYPSVMENLSVIPSNINLSGAEIELIGFENK
FT                   EYLLKSKLDMIRSDYDYIIIDCPPSLNLLTINAMAAADSVIVPIQCEYYALEGLSQLIH
FT                   TIDLIKERLNPKLEIEGVVFTMYDARTNLSLQVVENVKENLDKNIYKTIIPRNVRLAEA
FT                   PSYGMPINMYDSRSAGAEAYRYLAEEVIEKEDENEWL"
FT   CDS             532287..532439
FT                   /transl_table=11
FT                   /locus_tag="CC1_05000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79410"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Y9"
FT                   /protein_id="CBK79410.1"
FT                   /translation="MFHMKNPTQIRKAKATTIIQTMRNTLREFLKLSRQSPRSRASTDF
FT                   GSLLA"
FT   CDS             complement(532534..534219)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05010"
FT                   /product="arginyl-tRNA synthetase"
FT                   /function="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79411"
FT                   /db_xref="GOA:D4J4Z0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Z0"
FT                   /protein_id="CBK79411.1"
FT                   /translation="MKNQIVNLLSQNIEVLTSEEISQLIEIPPKPEMGDFAFPCFRLAK
FT                   SYHKAPPMIAQDLKESIGDQAFLSEIKVIGGYLNFYVDKAQYAQQIIDKYNNTTDYGCS
FT                   DQGKDKTICIDYSSPNVAKNFHVGHLRTTIIGNSLYKIFSKLGYKVVRINHLGDWGTQF
FT                   GKLIVAYKKWGSREAVEEKGIEELMDIYVKFHEEAEKDDSLNDEARAWFLKMEQGNEEA
FT                   LEIWQWFRDISLKEFMRVYNILGMEFDSFAGESFYRDKTADVIKRLTDDGLLKESQGAM
FT                   IVPLDEYDMPPCIVAKKDGSSIYATRDLAAILYRKATYNFDRCLYVTGLEQKLHFAQVF
FT                   KVIELMGNDYAKNLVHIPYGLVSLKSGKISSRKGNVIFAEDLLRESINKTTSIIEEKNP
FT                   DIPDKEEVAKQVGIGAIIFNDLYNQRIKDVIFDWNKLLNFDGETGPYVQYTYARASSVL
FT                   RKIGEVPDTIDYTLLTDEASIGLLKEIERYPQVIKDAAERYEPSVIARYSIDLAHAFNK
FT                   FYHECQINVEDKTTKYTRTNVVKIARYIIKDALSLLGIQCPEQM"
FT   CDS             535636..537123
FT                   /transl_table=11
FT                   /locus_tag="CC1_05030"
FT                   /product="Arginine/lysine/ornithine decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79412"
FT                   /db_xref="GOA:D4J4Z1"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Z1"
FT                   /protein_id="CBK79412.1"
FT                   /translation="MCKNSEIERNDEQPLLERLEAYGRTDVYPFHMPGHKRRLGPKEMG
FT                   HLYEMDITEIDGFDNLHEPEGILKDAQLFAAELYHSEETAFIVNGSTAGLLAAIAGICR
FT                   DGGEILAARNCHKAVYHAIELHHLKPYYIYPPINTKYGINEGIYPQDVEKMWITHQNIQ
FT                   AIVITSPTYDGVVSDIEAICEIAHRHRVPVIVDEAHGAHFCFSDYFPKSAVACGADVVI
FT                   QSTHKTLPAMTQTALIHLNGDLIDRERIRRMLTIYQTSSPSYILMGSIDGCLHMLSENG
FT                   KMLYKAYTERLQKLRNAIHEQCRWIKLPEYEELDAACSKDYDKSKIVLSVRNTGMTGRQ
FT                   FHEILLHDYHLQMEMVSAEYVLAMTAVGDSEEGYERLLHALVETDAKINEMLAQNEAKK
FT                   DALDEEEKLHDWAKLPVVSQKMTIYDAEQRKKILCRLDDAAGEIAADYIYLYPPGIPIV
FT                   TPGEMITGAVIGTIHWWLSDGLHVSGVYEERDVRIIC"
FT   CDS             537233..537817
FT                   /transl_table=11
FT                   /locus_tag="CC1_05040"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79413"
FT                   /db_xref="GOA:D4J4Z2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Z2"
FT                   /protein_id="CBK79413.1"
FT                   /translation="MGKLFCLIGKSASGKDAIFRYLRDNKELGLKEIVPYTTRPMRKGE
FT                   ENGVGYYFVDQAAYEKMCQNGKVIESRTYETINGPWHYFTVDDGQIRLDRDNAILIGTL
FT                   EVYNQMKRYFGEEQVVPLYIEVEDGLRLERALARERMQDVPNYAELCRRYLADRQDFSE
FT                   EKIAEAGILKRYENIDFDACCREIVRDVKIF"
FT   CDS             537911..538900
FT                   /transl_table=11
FT                   /locus_tag="CC1_05050"
FT                   /product="DNA polymerase III, delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79414"
FT                   /db_xref="GOA:D4J4Z3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Z3"
FT                   /protein_id="CBK79414.1"
FT                   /translation="MTGFGDIIGHEQIIEHFRSALKNHQVSHAYILNGENGSGKNMLAK
FT                   AFAKALVCEAGYGDSCNMCRACHQFDSGNHPDVKWITHEKANSIGVDEVREQINNDIVI
FT                   KPYSSKYKVYIIDEAEKMTVQAQNALLKTIEEPPEYAVILFLTNTLDVLLQTVRSRCII
FT                   MNLRSVDTKLIQQYLMQKYQLPDYQARVCAAYAQGNVGKAIMMATSEHFREMQDFLLRL
FT                   LKRVDDMEVYEIVAAIHDMTTYKMDIRDLIDLMMVWYRDVLILKATEDINQLVYQDEHK
FT                   YLQKKATTSSYEGLNNIMEALEKAKVRLNANVNFDITMEMLLLTIKEN"
FT   CDS             538902..539804
FT                   /transl_table=11
FT                   /locus_tag="CC1_05060"
FT                   /product="Uncharacterized homolog of PSP1"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79415"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Z4"
FT                   /protein_id="CBK79415.1"
FT                   /translation="MVKVIGVRFRNAGKIYYFDPLDLDIEVGQNVIVETARGIEYGHVL
FT                   IAPREVDDSKVIQPLKAVIRLATPEDDEIEHKNKEKEKDAFKICLEKIAKHKLQMKLID
FT                   AEYTFDNNKVLFYFTADGRIDFRELVKDLASVFKTRIELRQIGVRDETKIMGGIGICGR
FT                   SLCCHTFLSEFAPVSIKMAKEQNLSLNPTKISGVCGRLMCCLKNEEETYEWLNSKLPNI
FT                   GDRVTTDDGFKGEVQSVSVLRQLVKVIVTLENDEKEIREYKVSQLKFRPKRRRDKGNVN
FT                   DAELKALEAMDRKEGKSSL"
FT   CDS             539804..540538
FT                   /transl_table=11
FT                   /locus_tag="CC1_05070"
FT                   /product="Predicted O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79416"
FT                   /db_xref="GOA:D4J4Z5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Z5"
FT                   /protein_id="CBK79416.1"
FT                   /translation="MDYLLPGERFDELQRNGYRIIQNPAKFCFGMDAVLLSGFARAKRG
FT                   ERVLDLGTGTGIIPILMAAKTDGEHFTGLEIQEESADMAARSVACNGLQQKIDIVNGDI
FT                   KEASGIFGAASFDVVTTNPPYMTDTHGLKNPDMPKAIARHEVLCTLDDVVREGAKVLKP
FT                   GGRFYMVHRPFRLVEIFQTMTKYKLEPKQMKLVYPMADREPNMVLIEGIRGAKSMIKIE
FT                   KPLIVYEKPGVYTSEIYDIYGY"
FT   gap             540601..540876
FT                   /estimated_length=276
FT   CDS             complement(540960..541733)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Z6"
FT                   /protein_id="CBK79417.1"
FT                   /translation="MEGTIKYVNPEQKYGYIKAEGEHDISFKMKEGMEYPLNAHVTFDL
FT                   IVLENSRRYADNIVLQEHGPRKHGKLKISNPYAPSKIENQIAENKESCAIISALISKSR
FT                   GTKETVFPFNDYAYLPTYYQHRPENQWLIGKPSGYWINGNSLLYLKIKKQIRYQGTTQG
FT                   NGTMVPKYGCDSLLLGKHVYKNICAFTKNAGIRPEFYHIAYLDGENSVAIISLAQLNTL
FT                   LEKGYNGIAIGEYPGKRPDLPNRYMIPVTCFKEYR"
FT   CDS             541977..542831
FT                   /transl_table=11
FT                   /locus_tag="CC1_05090"
FT                   /product="conserved hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79418"
FT                   /db_xref="GOA:D4J4Z7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Z7"
FT                   /protein_id="CBK79418.1"
FT                   /translation="MAGKLYLCATPIGNLDDITYRVLETLKSVNLIAAEDTRNSIKLLN
FT                   HFDIHVPMTSYHEFNKIDKAKYLVNQMLDGTNIALITDAGTPGISDPGEELVRFCYEAG
FT                   IEVTSLPGPAACITALTLSGLSTRRFCFEGFLPTDKKERQVVLERLKKETRTTVFYEAP
FT                   HRLLKTLPLLIEAAGEDRKVSVCREITKRHETVFRATLGEAYAYYQANEPKGEIVLVLE
FT                   GVSQKKLDEEQQQSWESMSIEDHMALYMSQGLQKKEAMKRVAADRGVTKRDIYQYLLDC
FT                   KGE"
FT   CDS             542981..543433
FT                   /transl_table=11
FT                   /locus_tag="CC1_05100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79419"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Z8"
FT                   /protein_id="CBK79419.1"
FT                   /translation="MTNLEFENLLQMKKVFVKDNVSLPSRGEAGIFDLKSKTTNDKFYL
FT                   DVDRRGRIEFSKFKIQNRFAGNKLPLVRIDIDSAPHMNPDGSKTSRNHIHIFKEMENDT
FT                   GNLPWAYSLEDFEPINFNRDCINFMEIFSGFCEYCNIIMNNIQGVI"
FT   CDS             543436..544212
FT                   /transl_table=11
FT                   /locus_tag="CC1_05110"
FT                   /product="Domain of unknown function DUF1828./Domain of
FT                   unknown function DUF1829."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79420"
FT                   /db_xref="InterPro:IPR014960"
FT                   /db_xref="InterPro:IPR014961"
FT                   /db_xref="UniProtKB/TrEMBL:D4J4Z9"
FT                   /protein_id="CBK79420.1"
FT                   /translation="MAQLDIDFSKQYLEWLKQNIEQYQVRDSIFRITLPFLDRNNDCVE
FT                   VYIVDNGDGTYQITDDGATINDLEFSGFDIETSERRKKILNSIIAAYGITRLDTNELVV
FT                   KCTRDDLPLKKHMLAQCMVKVSDMFYLSKNTIQSVFLDDVQSFFDANDVRYVDNICLTG
FT                   KSKLTTHYDFAIARSKKSAERFIKVVNNMDLNAARNIIFAWNDTKDMRQPEAKLYAFIQ
FT                   NTDKKISDDAIGALKEYEIKPALWSKKDSYISELIA"
FT   CDS             complement(544291..544560)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05120"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /function="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79421"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="UniProtKB/TrEMBL:D4J500"
FT                   /protein_id="CBK79421.1"
FT                   /translation="MKSTGVVRKLDDLGRITLPIELRRNLNIGEHDPLEIFVDDDRIIL
FT                   RKYEASDIFTGNMDELIDFHDKKVSKQSIMEMARLAGLHVIEGV"
FT   CDS             544849..545391
FT                   /transl_table=11
FT                   /locus_tag="CC1_05130"
FT                   /product="Amidases related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79422"
FT                   /db_xref="GOA:D4J501"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:D4J501"
FT                   /protein_id="CBK79422.1"
FT                   /translation="MRILPEETGAVVIDMQEKLMMAMNETKACEEKAAMLLKGLQVLSI
FT                   PTVIVQQYTKGLGHTLPSLYEAAGTTEYCEKASFSCCRNKAVLDKLESMGKKNILVMGT
FT                   EAHICVLQSCIDLKAAGFQPVMVVDAVASRREADKKIAIERAIQEGILVTTAEAVLFEL
FT                   TLDSTNPCFKAISKLVK"
FT   CDS             complement(545496..545912)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05140"
FT                   /product="Mn-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79423"
FT                   /db_xref="GOA:D4J502"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="UniProtKB/TrEMBL:D4J502"
FT                   /protein_id="CBK79423.1"
FT                   /translation="MKEETTRLSASLEDYLKEIYLLNLEGQEVRITDIARSLGISKPSV
FT                   NRAMNTLKELELLEHEHYGKITLTDAGRDTAKNILDTNKIVYRFLTEILDVDEQTALAE
FT                   ADLMEHDISKGTRKKLKKFIKKSTDKKSADKKSK"
FT   CDS             546531..546599
FT                   /transl_table=11
FT                   /locus_tag="CC1_05160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79424"
FT                   /db_xref="UniProtKB/TrEMBL:D4J503"
FT                   /protein_id="CBK79424.1"
FT                   /translation="MKSKQEAMQMTSPPVGKFYDMI"
FT   CDS             complement(546601..548298)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05170"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79425"
FT                   /db_xref="GOA:D4J504"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/TrEMBL:D4J504"
FT                   /protein_id="CBK79425.1"
FT                   /translation="MSTKAYYPLNEIGAGKVGFSKTRSIIEAAFYGNNVVKVNTLKEAY
FT                   NLAKNSPGTIVTDMPVYRGEEFGLDSDARVLLFNDGAITGRYATARRIAGEPGVDCDAL
FT                   DKVVMDAVYTARFKKLYHATVYAGLDPEFMVKCHLLIPEGEENILYNWMLNFQYMSDDY
FT                   VKMYKASKPVGDGKEADIYIFSDPQWIPNEAPGVSLDCLSDPAKKTLCYFNTETNCACI
FT                   LGMRYFGEHKKGTLTMVWAIANRNGYASCHGGQKEYLLPDGSKYVASVYGLSGSGKSTL
FT                   THAKHGGKYEIKVLHDDAFIINTDTCSSIAIEPTYFDKTADYPTGCADNKFLLTAQNCS
FT                   ATMDEDGKIQLVTEDIRNGNGRAIKSKLWSPNRVDKINAPVNAIFWIMKDPTIPPVVKL
FT                   KGASLASVMGATLATKRSSAERLAPGVDPNKLVVVPYANPFRTYPLANDYEKFKKLVEE
FT                   KHVDCYIVNTGDFMGKKVQKEDTLGILEAIVEKRADFHQWGPFSDIEIMDWEGFVPDMQ
FT                   DKNYTDQLKARMNDRVNEIKAFATEKEGYNKLPDDALAAIQKVVDELK"
FT   CDS             complement(548417..550234)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05180"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79426"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:D4J505"
FT                   /protein_id="CBK79426.1"
FT                   /translation="MKNTFHRLIAGLIAASVLLCGCSSANMLTSAAAHELYDQRYSVGT
FT                   ASDEVNADFDDFTREIFTDAVSTDALTLHFELKDPSAYDIDLDTIDLGRINLQNPIDTF
FT                   VSDISTDALRQELHDFDYEELTEKQQQTYDILDEFLETEQTYDSKTLFYYPEYLSSTSG
FT                   TQSLLPVMMSEYAFYSPADVDDYLLLLQDFPDCFNNILDYEQEKADAGLFMSDESADEV
FT                   IASCQSFIEDPDNNMLIEVFPEKLESVSGLSDSDKADYIKRNDQAVHDYVIPAYQSLIK
FT                   GMEALKGSGTNENGLCYFDHGKEYYEYLVKSQTGSDKSPEELIEWLDDTLQNTMVQMAL
FT                   LLSSDDSLADKLDEDIDISENDPKIILQTLQSSLKEDFPDAVSSQYTLKYVPESLEDSM
FT                   NPAFYMIPPVDVTDSNVIYLNNSQITDNLSLFTTLAHEGYPGHLYQQSAFSATDPDPLR
FT                   QAMNFLGYVEGWATYAENMSYTWTGLDDNLARCLQLNQDITLALYGRIDLGIHYEGWTT
FT                   DDVTEFLSDYGLDDDETVHSVFRAIVSDPASYLPYCIGYMEFKELRDDTEETMGDDFNL
FT                   KEFHQCILNIGPCSFDVLEKYIQKDYIRA"
FT   CDS             550424..552400
FT                   /transl_table=11
FT                   /locus_tag="CC1_05190"
FT                   /product="methionyl-tRNA synthetase"
FT                   /function="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79427"
FT                   /db_xref="GOA:D4J506"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="UniProtKB/TrEMBL:D4J506"
FT                   /protein_id="CBK79427.1"
FT                   /translation="MAKKPYYITTAIAYTSGKPHIGNTYEIVLADSIARFKRMQGYDVR
FT                   FQTGTDEHGQKIEIKAGEAGITPKQFVDNVSGQIKEIWDLMNTSYDKFIRTTDEYHEKQ
FT                   VQKIFKKLHDQGDIYKGYYEGKYCTPCESFFTESQLVDGKCPDCGREVIDAKEEAYFFK
FT                   LSKYADRLIDYINTHPEFIQPESRKNEMMNNFLLPGLQDLCVSRTSFKWGIPVDFDDKH
FT                   VVYVWIDALSNYITGLGYDVDGNSDELYKKYWPADLHLIGKDIIRFHTIYWPIMLMALD
FT                   LPLPKQVFGHPWLLVGDGKMSKSKGNVIYADDLVNYFGVDAVRYFVLHEMPFDNDGSIT
FT                   WELMVERMNSDLANILGNLVNRTISMNNKYFGGVISNPGVNEPVDDDLKAVALAMHEKV
FT                   DAKMEKLRVADAITEVFTLLRRCNKYIDETEPWKLAKDETKQDRLATVLYNLMEGIRMA
FT                   AVALAAYLPDTSARILDMLGTQERDYLKLDQFGLLETGGKVVEKPEILFARVDIKELME
FT                   KVEADKAANAQAQSAAAPAEEAETEEGIDIEPKAEITFDDFEKLQFQVGEIIACEAVKK
FT                   SKKLLCSQVKIGNQVRQIVSGIRKHYSPEEMVGKKVMVVTNLKPATLAGVKSEGMILCA
FT                   EDADGNLSLMVPEKKMPAGAEIC"
FT   CDS             552483..553280
FT                   /transl_table=11
FT                   /locus_tag="CC1_05200"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79428"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D4J507"
FT                   /protein_id="CBK79428.1"
FT                   /translation="MTRQRPRLFLRLFMTIYRADMLSAQQNFILRRNLQVSFEQEKESF
FT                   GCKERKSFVNTEMLVFIIEIIGTVAFASSGAMVGIRKKMDVLGVIVMAVMTAVGGGIIR
FT                   DLVLGIHPPNTFKNPIYVEYSVLTAVILFVVFYIKKQMLDSKALFYYEKIMILLDAIGL
FT                   GAFTVIGVETAYESGYVHHRFLLLFVGVITGVGGGMIRDMMAQQIPFILVKQIYACASL
FT                   AGAGVCIWLMPYHKSASMILGAVVVVIIRILAATYRWDLPKIE"
FT   CDS             553378..554154
FT                   /transl_table=11
FT                   /locus_tag="CC1_05210"
FT                   /product="hydrolase, TatD family"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79429"
FT                   /db_xref="GOA:D4J508"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J508"
FT                   /protein_id="CBK79429.1"
FT                   /translation="MIFETHAHYDDKMFDEDRESLLESMQEAGIGRIVNIGADLASTAS
FT                   SIALAEKYPFIYATAGVHPSDAAQLNEHTFQWLSEQTAHEKVVAVGEIGLDYYWEKDPE
FT                   VRANQRYWFRRQLNLAREKVLPVSIHSRDAAKDTLDIAKEEHLAEIGGVVHCFSYTVEM
FT                   AREYLNMGMYLGIGGVLTYKNARVLKEVVDYAPMDRIVLETDSPYLTPVPNRGKRNSSL
FT                   NLPYVVMAIAEIKGITTAEVEDITWENAMKLYRMAE"
FT   CDS             complement(554325..554549)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79430"
FT                   /db_xref="UniProtKB/TrEMBL:D4J509"
FT                   /protein_id="CBK79430.1"
FT                   /translation="MPQVYEPEFKRKLVRLHLEEGRSYYSLFQRLSIGIFRFFQIFILC
FT                   IFPKSKKSKKRHPLIFSLYLIQSHIKRCL"
FT   gap             555539..556877
FT                   /estimated_length=1339
FT   CDS             556949..557200
FT                   /transl_table=11
FT                   /locus_tag="CC1_05250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79431"
FT                   /db_xref="UniProtKB/TrEMBL:D4J510"
FT                   /protein_id="CBK79431.1"
FT                   /translation="MSLVEPYIKIAVGDYNDLCKVQGKDDALAAILCSITHELTHYFQW
FT                   IKYHELWLSGEKNQYFERQAVYYGRQIVYDYADTREHP"
FT   CDS             557484..558044
FT                   /transl_table=11
FT                   /locus_tag="CC1_05260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79432"
FT                   /db_xref="UniProtKB/TrEMBL:D4J511"
FT                   /protein_id="CBK79432.1"
FT                   /translation="MNTGTVQIMWKEIIVGFIILYLLRGVLDVYMIKKYEKLLKLFGVI
FT                   EMDTLKLEAEKHLKLCNFFSVGPWNKAIYWTYNGLCWLLATISYVEDDEYDFLAYLGKV
FT                   KNEQEFEMKSFVLALYYRSKKDFNQARHYYDVYLTSKHVNNDIGVIMDSVWSGKAKSEL
FT                   VAESVKKFENPVLRKLFAENHIL"
FT   CDS             558151..558198
FT                   /transl_table=11
FT                   /locus_tag="CC1_05270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79433"
FT                   /db_xref="UniProtKB/TrEMBL:D4J512"
FT                   /protein_id="CBK79433.1"
FT                   /translation="MRDFLANMTSELPVS"
FT   CDS             558460..559323
FT                   /transl_table=11
FT                   /locus_tag="CC1_05280"
FT                   /product="dimethyladenosine transferase"
FT                   /function="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79434"
FT                   /db_xref="GOA:D4J513"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J513"
FT                   /protein_id="CBK79434.1"
FT                   /translation="MEKLSNPQRTIEVIKKYEFCFQKKFGQNFLIDGHVLDKIIAGAGV
FT                   TKDDMVLEIGPGIGTMTQYLAEAAGKVVAVEIDRNLLPILQETLADYDNVKVIHADVLS
FT                   LDLEKLVQEENGGRPIKVVANLPYYITTPIIMALFEQHVPLANVTVMVQKEVAARMKSG
FT                   PGSKDYGALSLAVQYYAEPYIVANVPCNCFMPRPNVDSAVIRLTRYEEPPVQVKDEKML
FT                   FKIIRASFNQRRKTLQNGLNNSSELNFTKDQIAAAIAEAGFSPSVRGEALTLEQFAKLT
FT                   DILLNA"
FT   CDS             559562..560845
FT                   /transl_table=11
FT                   /locus_tag="CC1_05290"
FT                   /product="Aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79435"
FT                   /db_xref="GOA:D4J514"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="UniProtKB/TrEMBL:D4J514"
FT                   /protein_id="CBK79435.1"
FT                   /translation="MNEYYDVIIVGTGAAGLYCALMLPERKKILMLTKQEADLSDSFLA
FT                   QGGICMLRGEDDYKDYFEDTMRAGHYENNERAVDLMIRSSNDIIRDLVFRKVDFARTAD
FT                   GELDFTREGAHSRPRILFHKDITGKEITSTLLKQVLTKENIEIREHMTMVDLIEKDNIC
FT                   GGVVAMDEENHVYPIRSQYVVLACGGIGGLYQNSTNYPHIAGDGLGIAMKHQVEVEHLD
FT                   YIQIHPTTLFSRSKGRRFLISESVRGEGALLYDKNGQRFTNELQPRDIVSQAIFAQMEK
FT                   DGTEFVLEDMRPLGEKTIREHFPNIYQHCIEEGFDPIKEPIPVVPAQHYFMGGIKVDLS
FT                   SRTSMKGLYACGETSCNGVHGKNRLASNSLLESLVFARRAAYDMLFGQAPDPCQAEPDL
FT                   KRYEDKEVLLEDYHQVVLEGIERMRGNE"
FT   CDS             560838..561689
FT                   /transl_table=11
FT                   /locus_tag="CC1_05300"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79436"
FT                   /db_xref="GOA:D4J515"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="UniProtKB/TrEMBL:D4J515"
FT                   /protein_id="CBK79436.1"
FT                   /translation="MNSITMQLQADKLIRMALEEDITSEDVSTNAVMPTKVQGTVDLIA
FT                   KEDGVIAGMDVYARVFKLLDEDTEIEMFCHDGDEVREGDLMAKVTGDIRVLLSGERVAL
FT                   NYLQRMSGIATYTRSVAKLLEGSGVTLLDTRKTTPNCRVFEKYAVRVGGGCNHRYNLSD
FT                   GVLLKDNHIGAAGSITKAIQMAKAYAPFVRKIEIETETLEQVAEAVEAGADIIMLDNMT
FT                   PEVMKQAVALIDGRAQTECSGNITKENIARICEIGVDFVSSGALTHSAPILDISMKHLH
FT                   AV"
FT   CDS             561704..562240
FT                   /transl_table=11
FT                   /locus_tag="CC1_05310"
FT                   /product="Predicted small molecule binding protein
FT                   (contains 3H domain)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79437"
FT                   /db_xref="GOA:D4J516"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="UniProtKB/TrEMBL:D4J516"
FT                   /protein_id="CBK79437.1"
FT                   /translation="MKTAERRNAILKLLQNAEEPVAARKLAERYGVSRQVIVQDMAVIR
FT                   AYTPGIISTTKGYVMEQEPRCVREFKVRHKQSDAAKELNLIVDCGGRVCNISISHRVYG
FT                   RVSAEMDIRSRQDVTEFIAALNDSQSTVLSTATSGYHYHLVEAASEERLNLIGEQLKAA
FT                   GFLAPLRPWEQKKGE"
FT   CDS             562246..563163
FT                   /transl_table=11
FT                   /locus_tag="CC1_05320"
FT                   /product="quinolinate synthetase A"
FT                   /function="quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79438"
FT                   /db_xref="GOA:D4J517"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="UniProtKB/TrEMBL:D4J517"
FT                   /protein_id="CBK79438.1"
FT                   /translation="MTIAEIQQEIMRMKKEQDICILAHAYQGQEILEVADYMGDSYGLS
FT                   VQASKSDCKGVIMCGVRFMAETCKVLSPDKKVWLANPAAGCPMAEQLDLEGLRELKAKY
FT                   PDYAVVAYINTTSELKTECDVCVTSSSAVQICSRLDNDKILFIPDPNLGRYVAEQMPEK
FT                   KFAFYKGGCPRHIVVSAKDVEKARKAHPNALLLVHPECRQEVVEQADYVGSTTGIMNYA
FT                   KKSDCREFIIGTENSIVEHLQFDCPNKSFYPLAVPLTCMNMKITTLMDIYNCLKGRGGE
FT                   EIQLPENVIEGAGRCIRRMVELGE"
FT   CDS             complement(563282..564517)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05330"
FT                   /product="Na+/H+-dicarboxylate symporters"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79439"
FT                   /db_xref="GOA:D4J518"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J518"
FT                   /protein_id="CBK79439.1"
FT                   /translation="MKEKKKLSLAGQIFIALILAIIAGLLMQSHAEFAENYIKPFGTIF
FT                   LNLLKFIVVPIVLFSIMSGIISMSDIKKVGSIGLKTVIYYFCTTAFAITFGLLFGNLFK
FT                   NAFPVVATTDLSYEVTEAPSLMDTIVNIFPSNFIAPMSESNMLQVIVMALIFGFSIILI
FT                   GSEKNSRLVTAINDLNEVFMKSMELILKLSPIGVFCLLCPVIAANGSNIIASLAMVLLT
FT                   AYLCYVIHVVVVYSLAVKAIGGLSPLKFFKGMLPAMMFAFSSSSSVGTLPINLECVEGL
FT                   GASREISSFVLPLGATINMDGTAIYQGVCAIFIASCYGITLTPTQMLTVVLTATLASIG
FT                   TAGVPGAGMVMLAMVLTSVGLPVDGIALVAGVDRIFDMGRTVVNITGDASCCIVVSNLE
FT                   KKREARKSARNA"
FT   CDS             564940..566139
FT                   /transl_table=11
FT                   /locus_tag="CC1_05340"
FT                   /product="molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79440"
FT                   /db_xref="GOA:D4J519"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR020817"
FT                   /db_xref="UniProtKB/TrEMBL:D4J519"
FT                   /protein_id="CBK79440.1"
FT                   /translation="MQTITLEEAQARLLEVVHCVMSEKVELLRSIDRILAEDVYAHVSQ
FT                   PPFERSAMDGYAVRSEDIRTVSRSNPVCLKVIDRVCAGEVTDKSVHAGEAIRIMTGAMI
FT                   PEGADCVVKQEDTDYGQEQVKIYVSLAQKMNCCPAGEDFHQGDCLGWEGEKVDAYMMAS
FT                   MASGGIDSVPVRRKVRAAVITTGEELMPHGQPLLPGKIYNANLAYLTGRLLQLDCNLTE
FT                   GIFVGDDADKITAAVEKCAEEADVILTTGGVSVGVKDLLPEIMKKLGADILFHGIDLKP
FT                   GMPTMASLYGGKPVISLSGNPFSASAVFELLMQPLLQKMTGSQQTSLVKKEADIAYDYP
FT                   GNKGSRRVLKAYDDGHAVHITKGQHNAQMRQGIGTNCFVDMPAGTEPLKAGDKVHIWRL
FT                   "
FT   CDS             complement(566179..567993)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05350"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79441"
FT                   /db_xref="GOA:D4J520"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J520"
FT                   /protein_id="CBK79441.1"
FT                   /translation="MNEVKTPKKNWFYYYTIVLLILIILNTFIMPLIQQHSVKEVDYGT
FT                   FISMTEKKEIGKVEIESNQIVFTNKDESQIYKTGLMDDPNRTERLYESGAEFSSEIIEQ
FT                   MSPLVSFLLTWILPLVIFFALGQYMSKKLMNKMGGGKDSMMFGMGKSNAKIYVKSTEGI
FT                   KFSDVAGEDEAKENLTEIVDYLHNPNKYKEIGASMPKGILLVGPPGTGKTMLAKAVAGE
FT                   SNVPFFSMSGSEFVEMFVGMGASKVRDLFKQAKEKAPCIVFIDEIDAIGKKRDGQIGGN
FT                   DEREQTLNQLLTEMDGFEGNTGVIILAATNRPESLDPALTRPGRFDRRVPVELPDLKGR
FT                   EEILKVHAKKIRLSDDIDFNKIARMASGASGAELANIVNEAALRAVRDNRRFATQADLE
FT                   ESIETVIAGYQKKNAILTNKEKLIVSYHEIGHALVAAKQNNSAPVQKITIIPRTSGALG
FT                   YTMQVDEGNHYLMSKEEIENKIATFTGGRAAEEVIFGSVTTGASNDIEQATRLARAMIT
FT                   RYGMNEDFDMVALETVTNQYLGGDTSLACSAETQAEIDHKVVELVKQQHQKALQILIEN
FT                   RAKLDELAHFLYDKETITGEEFMNILNA"
FT   CDS             568161..568262
FT                   /transl_table=11
FT                   /locus_tag="CC1_05360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79442"
FT                   /db_xref="UniProtKB/TrEMBL:D4J521"
FT                   /protein_id="CBK79442.1"
FT                   /translation="MHTYSRGCMPAPAMMERSGADSVRRIDGGEICD"
FT   CDS             568262..570001
FT                   /transl_table=11
FT                   /locus_tag="CC1_05370"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79443"
FT                   /db_xref="GOA:D4J522"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J522"
FT                   /protein_id="CBK79443.1"
FT                   /translation="MLSYLKRYKGLVFLNFISVFGFALTELGIPTIISRMVDGGVASGD
FT                   REYLLKMGGLIALISVVGILGTVVLGYCGARISTAVTCDIRNDLFEKVQSFSHREMNQL
FT                   GVSSLITRTSNDALQIMNFMNIILRTAMLTPVMIAVSFTLIIMSSVKLSLIIAATVPFI
FT                   ILGVILVAKISGPVSERQQTALDGLNRIFRENLTGIRVIRSFNNDARETERFGEQNQAF
FT                   TNQSKKLFTLMSSTEPLFFLLMNIAALAIYFVASQMIDKSALQVGQLMAFMEYLFHAMF
FT                   SVMLFCLVFMMYPRANISAKRIETVMNMTPDITDETVSTQRVHDDKEPIKEVIFEHVDF
FT                   CYPDGEEAVLKDISFSARAGQTTAIIGSTGSGKSTLIQLIPRFYDVTGGRVLVNGVDVR
FT                   QINSHKLREHIGFVAQKANLFSGTIEENIRFGCSEATDEEIRHAADIAQAADFIMNKPK
FT                   GFKERIVEGAGNLSGGQKQRLSIARALVRKPDIYIYDDSFSALDMKTDAVLRQALKPEV
FT                   KNAIVIIVAQRVSTIMDADQILVLDEGRLAASGRHEELLKTCPLYYEIAASQLSEEELQ
FT                   NVC"
FT   CDS             569991..571820
FT                   /transl_table=11
FT                   /locus_tag="CC1_05380"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79444"
FT                   /db_xref="GOA:D4J523"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J523"
FT                   /protein_id="CBK79444.1"
FT                   /translation="MSVDRTENKNGRKGLAQVGYCLKYLMNFLRPYKGGLILGLLMVVV
FT                   ANITFAVMPVVEGEMTTQLFSDGEAILKGVEGAHVHFDVIFGIMGTLVIIYIIKTVSQL
FT                   ITAVFLTRVLQQAMCDIRNALQKKIQRLPVRYFDDHAFGDVLSCVTNDVDTLSNALQET
FT                   LQRVLAAILTFIFVIGMMFYIHTILACIAILIIPLSLIVTRFFVTRSQKLFDTQQETLG
FT                   ELNGTITEMYGGFNEIILYNRQKMALDKFHDVNDRMRKASFRAQFASSLISPCISLITY
FT                   LIIGSVAVTGCLFVMNGTLLLGNLQAFVRYIWQINDPLSQISQLSSQVQSAFAAMGRIF
FT                   NLMDEEEEVQDGKVEIRPEKFRGEVTFDHVVFGYDDETLMRDVNFQAKPGQMVAIVGPT
FT                   GAGKTTLMNLLLRFYDVKGGAIKIDGIDIRDMNREELRQLFSLVLQDTWLFKGSIYDNI
FT                   HYGRLTARKDEVISAAKMANVHHFIKTLTGGYNFEINEESSNISQGEKQLLTIARAILK
FT                   DPRIIILDEATSSVDTRLEKMLQDAMHKVMDGRTSFVIAHRLSTVRNADLILVVDHGDI
FT                   VEQGTHEELLAKKGVYENLYHSGTSLANHQPVC"
FT   CDS             571904..573385
FT                   /transl_table=11
FT                   /locus_tag="CC1_05390"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator common domain"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79445"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D4J524"
FT                   /protein_id="CBK79445.1"
FT                   /translation="MSSKRRRKKARVPGLIITIILLLLVAEFVGLLAITKLLPVYLLFA
FT                   VGIVFMTCVLLVAMLTGNFRKKVRFIIGAILGVLLLVILLLGNLYVMSTYNTLNKISGV
FT                   NTQTSQIGVYVLKDDSAQSIEDAKSYTFGTLSNLDTENTQAAVKQIEERTGQSVKTQEE
FT                   NGVTKLVDSLLDGSCDAIILNHAYLPVLEDMEGYADIEDKIRELDLLSVDVEIKTDDTA
FT                   SSDDTAKQTDPDNIIRLYISGIDTRGSEIINTRSDVNIIATINIDTKQMLLVSTPRDYF
FT                   VPLSISNGVPDKLTHAGIYGIDVSMDTLGMLYDISLDDYFRVNFAGFIKIIDALGGVDM
FT                   NVEASFSDRGYSFTQGMMHMNGEEALVYARERYAFSDGDRARGRHQMELINAVMQKVLS
FT                   PEILSKYTEVLASLDGCFETNFSYDRLAELVRQQLTDGGSWNIVSYSVNGSGDTRQPYS
FT                   MSANAYVMIPDQTTVDKAKELMQQVVDGEVVNLNE"
FT   CDS             573405..574367
FT                   /transl_table=11
FT                   /locus_tag="CC1_05400"
FT                   /product="Inhibitor of the KinA pathway to sporulation,
FT                   predicted exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79446"
FT                   /db_xref="GOA:D4J525"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:D4J525"
FT                   /protein_id="CBK79446.1"
FT                   /translation="MNYVVVDFEWNQACYGKGSENRKIPFEIIEIGAVKLDENLKEIDR
FT                   FSRTIRPKVYKKLHYITRDLTGITQEELCASDPFSYVLVDFMLWCGKDYIFCTWGNMDL
FT                   VELQRNMKYYGLLDLLKGPVKYYNVQKFFRLLCAHDASAVSLESAVDYFQLPKEAGFHR
FT                   AVNDAAYTADVFRRIDQEEAKKLYSIDYYQNPQSKGDEIHLRYDSYYKYISRVFDTREE
FT                   ALADREVRSTKCYKCGRAARKKMHWFSARTKAYYCLADCPEHGYIRGKLRIKKDDEQHI
FT                   YIVKTLRLIDEEGAQQLRQMKADVLKKRRERRQKGCQCH"
FT   CDS             complement(574400..575137)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05410"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79447"
FT                   /db_xref="GOA:D4J526"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4J526"
FT                   /protein_id="CBK79447.1"
FT                   /translation="MNWVAPIKDDETLQKFRDTLRSVDDKYYILFEIGIGTGLQLQDIL
FT                   QFKVKDVRGKDMLIAVIGTRQIEQAFPLKPELQAVITDFIDGRDDDEYLITGYASTNRP
FT                   LSREQAYRIFKQTGNKIGLKSIGTQTMRKTFAWRYYKETGDIQYIQNLLNHASPNITFR
FT                   YIGEKPNIKVIYDKITDDGNQKAMEYLLKEKKGVRDIDAIILELKQIRRKLSGKRQPLP
FT                   YYGRVDTLLEQMHDTLRDFNQSH"
FT   CDS             complement(575272..576588)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05420"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79448"
FT                   /db_xref="GOA:D4J527"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J527"
FT                   /protein_id="CBK79448.1"
FT                   /translation="MKKLISLFTVLLCILSGCLWFSTDTYADETKSSDSETAPSETVPE
FT                   TQAGPVILSTDKVSTDDIILYSSAACVIDVDSGEILYYKNMDDRHYPASITKVLTGLLL
FT                   IENANLDDTITFSQDCWNGLNYYNDMNIGILDGEQLTVNDALHAILMSSANEVCNGAAK
FT                   FVSGSVSAFCDLMNERAKALGCTNTHFVNPNGLHDPDHYTSAHDMALISREAIQNPIFR
FT                   EITGCTEYTVASTNLRPEGFPLSHKHQMLMYTKYHYDACIGGKTGYTSEAKNTLVTYAE
FT                   KDGHTLACVVMENSDGHIYPDTINAMDYCFDHYDQLMAQMADTAANTETETSAFAHSGE
FT                   TEDLPAFAPLTETETETEAAVPDARTSLSPKVLASHLKSKLMTFAMHHMALFILCMLVA
FT                   FALFTLILIWLYHVLKRSYHRRKYKRLRNERIKKNVKNK"
FT   CDS             576845..577270
FT                   /transl_table=11
FT                   /locus_tag="CC1_05430"
FT                   /product="uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79449"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4J528"
FT                   /protein_id="CBK79449.1"
FT                   /translation="MLSKEMQEKLMGEIKRSDKFIELIGIKIIEADEGYCKAELKVDDC
FT                   HLNPLGTVHGGCLYTLADTVAGFAAASCGFEGPTLSGNMYFLRPTMGVKKLTCESRVVK
FT                   NGKRIRVVEATIYGDNGQEIARSLLEYMDMQREMVVK"
FT   CDS             577515..579137
FT                   /transl_table=11
FT                   /locus_tag="CC1_05440"
FT                   /product="acetolactate synthase, large subunit"
FT                   /function="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79450"
FT                   /db_xref="GOA:D4J529"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4J529"
FT                   /protein_id="CBK79450.1"
FT                   /translation="MLTGAQVMVKCLEAEGIKAVFGYPGVAICPFYDSLYDSGIRNILV
FT                   RQEQNGGHMASGYARVTRKPAVCVATSGPGATNLITALATAYADSIPLIAITGQVSSEL
FT                   LGKDVFQEADITGSAEPFVKYSYLVRDAREIPRIFKEAFHIASTGRRGPVLIDVPLDVQ
FT                   QKQIDYVPVNEVSIRGYKPTVKGNNLQIRKVVDVLSHAHKPLICVGGGTILGNGEQVVR
FT                   EFANKFHIPVVSTMMGIGVMPNDDDLYMGMLGTNGKPHANYAVHECDVLVLVGARVADR
FT                   AVVKPYKLERRNTTIVHIDVDPAEIGKNLGTTVPLVGDVHVIFENLLQYEIPGDYTAWN
FT                   EELAEKKAAYVDRRHFNPDFVNPCRFVQTLSSKMNDDAIYVADVGQNQLWSADNYVMKH
FT                   GRFLTTGGFGTMGYSIPAAIGVRAALPDTQIVAVCGDGSFQMSLMELATMRQWNLPIKF
FT                   VIMRNGYLGLVREYQHHTYHDRYSGVSLDGSPDFEKIADAYGLDYFHLEHNDEMEQRID
FT                   EFLACEHAAMMVCEVYSFDLVKE"
FT   CDS             579145..579627
FT                   /transl_table=11
FT                   /locus_tag="CC1_05450"
FT                   /product="acetolactate synthase, small subunit"
FT                   /function="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79451"
FT                   /db_xref="GOA:D4J530"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="UniProtKB/TrEMBL:D4J530"
FT                   /protein_id="CBK79451.1"
FT                   /translation="MKGIFSVLVENKAGALSKTAGLFARRGFNIDSLAVGETDDRDISS
FT                   MTIISTGDERIMEQIEKQLNKKIDVIKVRRFAENKCVTRELLMLKVTYTNVTRSDIMEI
FT                   CNITGAHIADLSPKSMVIELTAKTSKIDRFIKLMQPFGIIEMARTGALAVQRDSNE"
FT   CDS             579639..580301
FT                   /transl_table=11
FT                   /locus_tag="CC1_05460"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /function="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79452"
FT                   /db_xref="GOA:D4J531"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J531"
FT                   /protein_id="CBK79452.1"
FT                   /translation="MRLRNVRGSRETIAADECVLHDPEEQRAQKGHWHELFGNDHPIHI
FT                   EVGMGKGQFIMTLAQQNPDINYIGIEKYSSVLVRALEKYHTYEGDNIFFLRMDAEEIAD
FT                   VFDENEVSRIYLNFSDPWPKDRHAKRRLTSKEYWARYDRILCPEGRVIFKTDNRPLFDF
FT                   SLEQVEVAGWQLDNYTFDLHHSEYVEGNVMTEYEERFTAKGNPICRLVAHRDPQKKG"
FT   CDS             580670..580819
FT                   /transl_table=11
FT                   /locus_tag="CC1_05470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79453"
FT                   /db_xref="UniProtKB/TrEMBL:D4J532"
FT                   /protein_id="CBK79453.1"
FT                   /translation="MASFKRRMSGKAVLFAYDHKQISKRGKRLGDSYKEVKKIIENIGK
FT                   DKTR"
FT   CDS             581230..587955
FT                   /transl_table=11
FT                   /locus_tag="CC1_05480"
FT                   /product="Rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79454"
FT                   /db_xref="GOA:D4J533"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:D4J533"
FT                   /protein_id="CBK79454.1"
FT                   /translation="MSKELMNTTEMKEVISKRTACMKVFEHADHRFTAAIYGTPVHYMK
FT                   DGRWEEIDNRLEAAADKVPADADDMKNISGAFKVRLSNKVKKKQMVSLGEGSRKLTWGF
FT                   VDANAVKRQILKETEEEQQPDSAGTEGNASGSEKDPTAAYAVRHLKSRILYPEAFHGVD
FT                   IRYTIGPESLKEDLVLKQSDAVHAFTWRYAPGGLKARQEGADIVFEDAGGREAYRLSAP
FT                   YMTDAAGEVSHGLTLTLTDDGGEKNKEAYVRLEADAGWLAAEERAYPVVIDPVVTTDVA
FT                   RDKIQDCHVSSFYNTDNFYNSHILKTGRVDGSVLRSYLKFTLPQLNKASEMVTSAWYVA
FT                   IRRPGGSDQRRIDIHRVTKDWNSKTVTWDNKPSYDPKVADYIAFSGSGLTRLVFDITGV
FT                   VKDWYADGKNYGLMMKEHGEEEGTYNEYISSDDNLDDNAATRPQIMIQYVSCEGLEDFW
FT                   TYHQHDIGRAGTGYVNDYNGSQILVHPTYALSGSRAPISLSHVFNSSEQGADIGYGKGF
FT                   RLNYHQTMTAKKIGSTDYYCQTDGDGTRRYFAKDTTDSKWKDELDQTRILTLDSSNRYT
FT                   VTDKDGGKQHFLNGLLVKEEDASGNTLSILHNASKIVKLTDGSGREVNLAYGSDGHLSK
FT                   LTDAAGRVTAFGYTNGFLTSITDPDGAVSRFTYDTAAGKGMMLTAADPYGYKVQYSYGS
FT                   RAPYRVSKVTEYAGSTEGQSLTLAYGHNRTSFTDSKGRKEVYLFDNAGRTVSVRNDAGY
FT                   GAAWQYLDTAKNKNKLSAATDLRYVSPQYLRGVTGGMAGWTRYSNADHVVVEDSAAGEA
FT                   YIGTKCIRIRSTAASGDGAAFQNLTVKAGKKYVFSVYVRASVSELAAKGRIWLQIEDTA
FT                   KNLAVVADSAGITAGTEGFKRLSVSFTAPDNGTGNGTSSLRILARTRNFKGTAWFDGLQ
FT                   MEEGEAAGRLNLVSNNCFQNGMTDHTALQFAGGDGVLKTGAAAQVPTVLKGTVNEDKVN
FT                   IRAAAGTAYQALVMAPKGTSATIHGADYDSDGSIWYAIRAKISNKIYDGYMKGTYLNLS
FT                   ISGAVVTVRGVVAADNLNLRAGAGTGYSAKTMMAAGTTVGIKGAAKDSSGTKWYRLAFT
FT                   KNGTQYDGYASADYVAVMRPSTSHAAPSGTLNVRTEPNTSCSVAVQIGSSDKVNIVSHA
FT                   GLKNGDLWYGVKLTKGGKAYTGYVLSDLVTVSSTDVPAEIRMGQQEKVPGGNGPTGDSV
FT                   LKITGDEKNNKRCYQPLAISGKKGDCFMACGWGYADSVSLKEKFFESDPHAGNSLNSRK
FT                   NRHFGLHINFISSDANDRNDIHYAEFGADCSEWQFMNTAFVAKHDYVRVDIGFCYGNNS
FT                   NQAYFTGLGLYKEEYGTSFAYDDKGNVVKVTDQAKKNSSFEYDTADNLKKLMDPKGNAF
FT                   KYDYDKKHRVTGAASAAGMKYTFVYDDYGNPVTARTVDPSAETDAKKAMTSKAVYTTGT
FT                   AEGQYMASQTSPEGVTTAYAWDVTKGLLKNVSVSGHQADYSYDTMDRLTKVAGKAAVNG
FT                   TETDVQVQYTYDRDRLTKITHNGFDYTFAYDGFGNRKSVSIAGKAAVSHDYEAKNGNLL
FT                   KSTYANGWEVTYTYDNLDRVTEVKASKDGTSYTIGRYIYDKLGRVARFVDGQVSGKSCT
FT                   YGYDLTDRLCEAVFDDGTAYRYTYDANDCLVKEVQTTPDGIRTVTRGYDADSRETSVAC
FT                   GSARVEKTFDKLGRLTSIKRNGGKHTTTYTYETASDGGQTGRIKTVKNGSGTWEYAYDA
FT                   WGNVSKATENGSADSHTYTYDAQGQLIREYDPDKKLYLGYQYDAGGNLTEVRSYPAGAE
FT                   GGPEGTGTVLKRFAYGSTWKDQMTSVTMDGKTRNFTYDANGNLLSDGKYTYSWTKGSLL
FT                   EKVTGDGLEAVYTYDASGIRTSKKVNGITTEYLTAGGSVLSEKKNGVWQHYLYDGSGQL
FT                   MAIRYKGADYYYIRDGLMSITGLVDANGVAVVNYRYDSWGILTGITGSMAGTLGKDNPY
FT                   RFKGYYYDEETGMYYLKSRYYQPEICRFISADSYDVLTQSPMALVDTNLYNYCDNNPVY
FT                   REDENGQFWNIVIPALIGAAVGTFLTWAATSATGQEYRTKDYLSDFVAGFIINLIPIKN
FT                   ISRAFYVIYTTGKGIYDGEEPKSIAFNAAIAWTASSLNISERLNLPYKTNYDKVANNVI
FT                   DVVENAGREFVGAITSRIFNSGPSKTKASKSVKNSFKRTLISNQIIRKGKKVYRKRVYY
FT                   YRGRKEWRIERIH"
FT   CDS             588661..589194
FT                   /transl_table=11
FT                   /locus_tag="CC1_05500"
FT                   /product="toxin secretion/phage lysis holin"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79455"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/TrEMBL:D4J534"
FT                   /protein_id="CBK79455.1"
FT                   /translation="MRDLMLQFSNNIFIEILMLAICADTLLGVLRAIKFRQFNSSVGID
FT                   GAIRKVAMVVSVGILMLADLLIHVNLLAFIPEEYVHDLGVQKLGMCEFFCLLFTACECL
FT                   SVLKNMVLCGLPVPKKVESWLRDFLANMTSELPMDNGISDKIYEAGEANTNEANTNNSV
FT                   LNKMKAGGGENVRK"
FT   CDS             589181..590149
FT                   /transl_table=11
FT                   /locus_tag="CC1_05510"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79456"
FT                   /db_xref="GOA:D4J535"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:D4J535"
FT                   /protein_id="CBK79456.1"
FT                   /translation="MSENKKLLVVIDPGHTGNTYNAGAVKGYYESKAVYDLSLYEKTAL
FT                   EKRGIDVILTRERNQDPGLYERGQMAVKKGNGYANVLFESNHTDAFNGKACGVTVVRSA
FT                   HLPGSEKLAEKMIDAIVKVMKPSTGITYNRGVVTKTQSNGADWYGVIRGAVSGAASQGQ
FT                   AKNGPVRYDYIVEHGFHDNPKECLFLSKQEDLKAIAEAKAAAIAEYFGIGNKSQPANQS
FT                   GQSSQNNRNNNSHQANQNTSTDSTTLNKKTAYLVRVSVDDLNIRQAPTIHSKAVGFTGK
FT                   GVFTITEEATGIVNAAGEKSQWGKLKSGQGWICLDYAEKVA"
FT   CDS             complement(590529..590687)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05520"
FT                   /product="Domain of Unknown Function (DUF1540)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79457"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:D4J536"
FT                   /protein_id="CBK79457.1"
FT                   /translation="MEVNNSIKCGVHDCKHHAGNVEYCTLNCVSIGACECSPKTKEGTD
FT                   CESFAAR"
FT   CDS             590913..591947
FT                   /transl_table=11
FT                   /locus_tag="CC1_05530"
FT                   /product="Protein of unknown function (DUF2804)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79458"
FT                   /db_xref="InterPro:IPR021243"
FT                   /db_xref="UniProtKB/TrEMBL:D4J537"
FT                   /protein_id="CBK79458.1"
FT                   /translation="MQHEVTDVQKLLDKQGYVVTPGWARRPVWQYNRENIAAPSFRIKE
FT                   WDYYLAGNEHYAVAFTLSDLGYAGLISVSLIDLVERKEHTETILTAMPMGRLGLGRTSD
FT                   DGNADFRNGRIHLRYTVKPHRRRIQCVFRDFQDGKTLTADLLMKQPEMDSICIATPWKE
FT                   NQKAFYYNQKVNCMPVKGKVNFDGRDYIFDGRKDMAVLDWGRGVWTYDNIWRWGTCSTR
FT                   LNGVPFGFNLGYGFSDRSSATENVIFYNGRAHKLQEVVFMIGQDDKGNFNYMDPWTISS
FT                   SDGRFEGIFEPILDRKAKIDMKVIASDQHQVFGHLTGTAVLDDGTELKMRDVIAAIEVV
FT                   HNRY"
FT   CDS             592045..592455
FT                   /transl_table=11
FT                   /locus_tag="CC1_05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79459"
FT                   /db_xref="UniProtKB/TrEMBL:D4J538"
FT                   /protein_id="CBK79459.1"
FT                   /translation="MRGAVELRTDGCTDLQMDSNKQYIVTKWYGSSLAIFEEAAFQKYL
FT                   RRLDTDFKDNGHGQSVIRYFLSAAVTMMTEESDGWRIPPELLTCIEKDGERLEYWECEI
FT                   NSSYQDSLPVFVVAASGNMDSAIEMTKERHAA"
FT   CDS             592588..594159
FT                   /transl_table=11
FT                   /locus_tag="CC1_05550"
FT                   /product="Protein of unknown function (DUF1703)./Predicted
FT                   AAA-ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79460"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J539"
FT                   /protein_id="CBK79460.1"
FT                   /translation="MGGYLNPGNEKFGEALNSQIYVDKTGLIEYTNRVMYSNQKYVCVS
FT                   RPRRFGKSMAANMLAAYYSRGCDSRELFQGLKISKADACEKKLNQYNTIFLNMQEFLSQ
FT                   TSSMDEMLRLVKKSVLWDLFFEYPDINYFDKENFSRAMQDVYQQTKCPFVIIIDEWDCI
FT                   FREYRENHEAQEQYLDFLRDFLKDKAYIHLAYMTGILPIKKYGTHSALNMFDEFSMTNP
FT                   GPLAEFVGFTEEEVAALCKQYGRNLSELKEWYDGYHFEKARSIYSPRSVVTAILTGICD
FT                   SYWNRTETFEALRFYIDMNFEGLKDDVLSMLAGERIPVNTGTFSNDMTTFYSEDDVLTL
FT                   LIHLGYLGYDFSYKEVFIPNSEVRGEYINAVAASQWGEVSKALKNSSDTLQAIWQKYPE
FT                   KVAEGIEQAHFETAHIQYNDENALSYTISLALYAARNFYTVYRELPTGKGLADMVFLPR
FT                   RQFPDKPALVVELKWNHSAEGALAQIKEKQYCKSLEDYRGNILLVGVNYDKVTREHTCV
FT                   IEEAEK"
FT   CDS             596086..596313
FT                   /transl_table=11
FT                   /locus_tag="CC1_05570"
FT                   /product="Phosphopantetheine attachment site."
FT                   /EC_number="6.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79461"
FT                   /db_xref="GOA:D4J540"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D4J540"
FT                   /protein_id="CBK79461.1"
FT                   /translation="MKELLDILNKVKPGIDYVNEKHLVSDELIDSLDVMTIVTEICDEF
FT                   DVEILPTDVVPENFESVEAMWQLIMRLQED"
FT   CDS             596320..597891
FT                   /transl_table=11
FT                   /locus_tag="CC1_05580"
FT                   /product="Predicted membrane protein involved in D-alanine
FT                   export"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79462"
FT                   /db_xref="GOA:D4J541"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:D4J541"
FT                   /protein_id="CBK79462.1"
FT                   /translation="MSYTSYFYLLFFLGVLVALYYLIPLKKRWLVLLGGSYFFYWMASG
FT                   KMIVFLLITTVSVYLGALAMEGEQQAFDSVCKSLKKEERKARKAVMMRRKRYIVFAMVL
FT                   INVGLLAFLKYYHFFSANINALGSHLEPGFQLPALKLLMPLGISFYTLSAVGYVIDVYR
FT                   GQTAADHHFGRLALFLSLFTNITEGPISRYDQLAGQAFEGHRADYRQFTFGAQLILWGL
FT                   FQKMVLADRAALLVSTVFGSPSDYSGGIVILAMFVYTLQIYADFAGCMDIVRGSGALFG
FT                   IEIARNFNQPFFSKSIGEFWRRWHMTLGAWFKDYIFYPVTLSKTNMKLGRWAKKHLSVH
FT                   LGQAMPTAFALFFVWLANGLWHGAAWKYVAYGMYYYVLTLFGLFGKPVIHCFYEKTGIR
FT                   KESRPWQLLLIIRTFILVNIGMLLFRANSLRIFAEMFESMFRKTTGNWLELGLDRHDLA
FT                   VLALGALLMLMVGIVRERGICIRERIASWPMVLRWTVYAGVFCAIVLLGAYGSGYGVVD
FT                   PLYANF"
FT   CDS             597994..599004
FT                   /transl_table=11
FT                   /locus_tag="CC1_05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79463"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniProtKB/TrEMBL:D4J542"
FT                   /protein_id="CBK79463.1"
FT                   /translation="MHISNRKQFAGRALKMIAFVLLTVLLLVGMSKTLVPRSNSASGGM
FT                   HNYRARGFYGEEKDSLDVVAIGNSDLASGFSPMELWKTHGISGFACGEPNQTIDQSVRL
FT                   LQEVLTCQRPKVVILETDALFQENMDGHLTSLVKAAANYLFPVLEYHDRWKSVTISELM
FT                   GKPQKPWHDAAKGYRYSDDRVAYKGFDYMAKTDDREEIDAIALQSLNQFVEICRNADIQ
FT                   VLFVEMPSANSWNMARHQAVADYASDRNIPFIDFNMKDMMTKTGFDWLTDSRDGGNHLN
FT                   YSGAKKISTWLGNYLGSQYQLEDHRKDSRYQRWQQDSADYNRIVSGADKQAADEN"
FT   CDS             600321..602555
FT                   /transl_table=11
FT                   /locus_tag="CC1_05610"
FT                   /product="ABC-type transport system involved in
FT                   multi-copper enzyme maturation, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79464"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="UniProtKB/TrEMBL:D4J543"
FT                   /protein_id="CBK79464.1"
FT                   /translation="MTAIYKKELRSYFTSMTGYICMAFMLVVIGIYYAVINLSSGYPYF
FT                   GYTLSCVIVLFLLMTPVLTMRILAEEKNRKTDQLLLTAPVSLWKIVIGKYLAMVTVFGL
FT                   ALLITCFYPLILSRFGTVSLSMAYTAILGYFLYGAACIAIGLFISSVTESQVIAALLTF
FT                   FVLLVFYITGTITKSLPSTAVASFVIWIFVILFAAWLVYNLTANLKIALAAGIAAEAVN
FT                   IIIFFVKSDWMAGSVAKALGAFNMTSFFSNFGSGVFDVTGIVYYLSIIGFCIFLTIQAI
FT                   QRKRWGGDALMTAVVLAIVVVINLVVGQIPVKYTQFDLTDNQLYTITDQTKEFVKGLDS
FT                   DVDVYLVAQSGQEDKQIQKVLERYESLSSHIKVHTKDPVVNPSFTKQYTDSSLSDNSLI
FT                   VVCGDKYKVINYSDIYQSKFNYSTYSSQTTGFDAEGQLTSAIDYVTSDTMPKLYTLTGH
FT                   DEASLSDTLTSQIEKENIDIEELNLVTSESVPDDADCLMINGPQKDITADEKDRILSYM
FT                   ENGGHVLIFTDYTETDMPNLAELLNNYGLSTSAGLIFEGNSQYYYPGYPSYLIPRIQSA
FT                   DAVGSMTSKNLVLMPYAQNINISDDVRSTVTTEALLQTSSKSYIKTDLKNLTTTEKASG
FT                   DEEGPFTVGAAVTENYNDVETKLVYFSSSAILDENMNQAVSGGNYELISNVMSWMIDKE
FT                   ESISIPTKSLSTTYLTVTAADAGFWGAVVILIPAALVIGGGVVWFRRRRK"
FT   CDS             602559..604031
FT                   /transl_table=11
FT                   /locus_tag="CC1_05620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79465"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:D4J544"
FT                   /protein_id="CBK79465.1"
FT                   /translation="MKNRKKALIIAIICLAAAAVLYLLVVKLSQRSKDADSSDDSLVIS
FT                   SVDSGQITAISYEKDGKSLSFRKEDGTWYNAEDKSFPVDQDSLTTMTNALGAVSATRKL
FT                   DSPEDLSEYGLDSPVLTVRYMASDGKEAEFTVGDTNDAAGGSYLKISGDDAVYLVASDF
FT                   ADTFNSDIYQLADMESFPTITSDSITDINVKSGSHTLEIKNDSDGGRIVLENGEEKENC
FT                   ASSSVTQFINTVTGITFKSHVEYNCKDLSKYGLDKPTADISVDYTTAETVTETSAESVQ
FT                   ETADTEETESETETVEVAKQLILHIGSQNEDGDYYAALDGSKEVHVVSGDTIKELVEKK
FT                   AADFTDNTILSGSLNNAKGIDVAIGSDSWHLVKQEVAKADDLADSAETEAETEEKWYAG
FT                   DTEIALTDLSSAYSDLSGMSAEKILDTAAKSTGDAAISVTVKWEDDTETTVSFTVYDSS
FT                   FHLAEINGEARKLVNKRDVEKLVEDMTALLKK"
FT   CDS             604219..605229
FT                   /transl_table=11
FT                   /locus_tag="CC1_05630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79466"
FT                   /db_xref="UniProtKB/TrEMBL:D4J545"
FT                   /protein_id="CBK79466.1"
FT                   /translation="MIVNFSCPNCGADMSYDIKLGKLHCAHCDHSEDIRPDEENYKNAA
FT                   EEPADKQRYCVNCGGLLPAGGKTCATHCEYCGAPLVMADRLSGDWRPAYVLPFELDREK
FT                   AEAAFRKWCHNGRFSPKGFMAAKNIQRLQPLYIPYWLYDMNASVDVRGTATRVNIYVRG
FT                   ETEYTETDFFDVRRKMRLEYTKVPHDASEKMDDTLMAKLEPYRFDTLKTFQIPYLAGFE
FT                   ADQGDYRSEDLLPQVKQQVAGYAAEYARSTISGYTSVHIDHQQMDYDHISSNYVYLPIW
FT                   FISYRYRDKDYIFAMNGQTGKVIGEPPVSRGKVAGWFAGISAAAFAILMVIGGLL"
FT   CDS             605229..606125
FT                   /transl_table=11
FT                   /locus_tag="CC1_05640"
FT                   /product="Beta-propeller domains of methanol dehydrogenase
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79467"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:D4J546"
FT                   /protein_id="CBK79467.1"
FT                   /translation="MKKILNFLMVMLLVMGLGMASVMTAFQAEAAETAETAGETVSAAE
FT                   TVLTANQDGEAAADASMSASGIYDEADLLSADEEASLLTKLEKYSERYSADIAIVTTDD
FT                   AGGLSAQAYADAYAEKIGQSMSRDEYPGILFLIDMDNRQIYMATQGQAMNYYDDYRINK
FT                   VLDNCYNHITDGDYKGTCDAFLKGVRDYMGRSTDRSARMDAFGVLLRLIIAIVIGAVVT
FT                   FAMVFRRGGRVTTNSRTYFDASGSHLDAKEDRFMNRTVTRRHIEKPKGGGGSGGSGGGG
FT                   VHMSSGGGTHGGGGRSF"
FT   CDS             complement(606130..606600)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05650"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79468"
FT                   /db_xref="GOA:D4J547"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4J547"
FT                   /protein_id="CBK79468.1"
FT                   /translation="MKGNTNKFMKIHEITPKDYTDLHRLYCQLEDDWTSDIQDMIRVLE
FT                   EVKDDPHYHLVGIFDDADKLAGTITLSKCLDLTAKARFYYSLENLVIDENYRQQGYGQA
FT                   LMQYVEDYVRRHNGRYVNLTSSIHRTDAHEFYYRIGFPRNYTVGFKKNVVDD"
FT   CDS             complement(607363..607698)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05670"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79469"
FT                   /db_xref="GOA:D4J548"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J548"
FT                   /protein_id="CBK79469.1"
FT                   /translation="MKSTVGETLRKCRVAAGKSVREMSELLTANGFKASEKTIYSWENG
FT                   NSQPTPDALLVMCRAYGVEDVLGTFGYAPEKPTTIAAHFDGNEFTPEQIEKIKAFAAFI
FT                   KFDDQRK"
FT   CDS             608062..608352
FT                   /transl_table=11
FT                   /locus_tag="CC1_05680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79470"
FT                   /db_xref="UniProtKB/TrEMBL:D4J549"
FT                   /protein_id="CBK79470.1"
FT                   /translation="MQLEFRAGAVVMMAWQHYLYDGSGQLMAIRYKGADHYYIRNGLMT
FT                   ITGLIDANGTAVVNYRYDSWGILTGITGSMAGTLGKDNPYRFKGVRGWERY"
FT   CDS             608935..609207
FT                   /transl_table=11
FT                   /locus_tag="CC1_05700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79471"
FT                   /db_xref="UniProtKB/TrEMBL:D4J550"
FT                   /protein_id="CBK79471.1"
FT                   /translation="MVDFGAATVVGGIAGKIGGSGVNGRKLRGIYRRANDVIKTVKSAR
FT                   RIAKYVAKKTAIKVTVKSGVKQTVKAGFFSNITNFVRKLFTKSRV"
FT   CDS             609396..609719
FT                   /transl_table=11
FT                   /locus_tag="CC1_05720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79472"
FT                   /db_xref="UniProtKB/TrEMBL:D4J551"
FT                   /protein_id="CBK79472.1"
FT                   /translation="MCSLIKDKTTDKRKSQRDLKAVIGDGIIYAICALGISYVLSFWLL
FT                   LLVYILEMIYVAWVIFIYFKQQNGQRSRKQRRKKRVLVLGKKEHNRDTFYILYEICNVY
FT                   YIV"
FT   CDS             610347..610766
FT                   /transl_table=11
FT                   /locus_tag="CC1_05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79473"
FT                   /db_xref="UniProtKB/TrEMBL:D4J552"
FT                   /protein_id="CBK79473.1"
FT                   /translation="MEYVVETEKEIVQNYIIKSKQERIEWELSHSKKRKDIIWHFHKPD
FT                   IFKEACLHAVDYMDKEAMKNYLHKLSGAENVYFIGEDYIGKMLLEQAAERANEGEICII
FT                   YCGNGIGYYQGEQEKGAPPRFMLLKEKCCKTPSKI"
FT   CDS             610836..611699
FT                   /transl_table=11
FT                   /locus_tag="CC1_05750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79474"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J553"
FT                   /protein_id="CBK79474.1"
FT                   /translation="MLKREISERLYSWKNENKKKALCVIGARQIGKTTIIREFARKEYE
FT                   YFVEVNFILDKGADQIFDGKLDADTIIENLTAFKMQKLEPGKTLIFLDEIQECPNARCA
FT                   IKFLVEDGRFDYIESDSLLGVKYKEVPSYAVGFEEIVYMYPMNFREFLGANGVQETTFA
FT                   ALQSCYEKHEKVPQVMHETLLKLFAAYIVVGGMPDVVQTYVNTHDIGKVIQVQRNILEL
FT                   YRQDIAKYAEGSDKIKIKAIFDSIASQLDDKNRRFVLNHIDENGRMNRYESKNNRKNLR
FT                   LFFVRF"
FT   CDS             complement(611724..612428)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79475"
FT                   /db_xref="UniProtKB/TrEMBL:D4J554"
FT                   /protein_id="CBK79475.1"
FT                   /translation="MSYCVNCGVELDKTCSVCPLCNTKVINPNQPVDTVSPKPYPVDKG
FT                   YVDSGIRKETAILMAVCLAATAVVCGLLNLFFITFSHWSFYVIGTCIVLWIFCLPIFFP
FT                   TKAVFRITLLLDGLGIAMYFGIIAWLHPGNGWYTAIALPLIILGTLAVFFFAISMGHPR
FT                   SSILSQAVILVAEIGIYSVCVELLTRRYYAVPMALSWSAIVLTCAIIIDVTLVTILLRS
FT                   RLREEVRRRMHI"
FT   CDS             complement(612428..613756)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05770"
FT                   /product="Alcohol acetyltransferase."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79476"
FT                   /db_xref="GOA:D4J555"
FT                   /db_xref="InterPro:IPR010828"
FT                   /db_xref="UniProtKB/TrEMBL:D4J555"
FT                   /protein_id="CBK79476.1"
FT                   /translation="MKTINKTIKHTPKKQHKTWYKLDLSANVYPTLQRRNFSNVFRLSV
FT                   VLKEEIDPDTLQRAVDLTLPRFPAFKVALHKGIFWRYLEPNDHPGPFVMPDIINPCMPM
FT                   LFKSNNRYLIRIYYYRCRISLEVFHSLSDGSGALKLLKTITAVYLRLKGHEISNTCGVL
FT                   DINEPPRPEEMEDAYIKYASSRVKRPRSQGKAYRIRGHREPFYTLNIIHGLLSVQEVLQ
FT                   KARSYHVTLTEYLNAVLLYALLEKQKADHVFREHPVALALPVNLRNIFPSDTLRNFIAM
FT                   VYPSVDPRMGDYTFEEIITHVHNYMRFYINDKFLNADITTNASTQQSPLIRIVPLFVKD
FT                   IVVKQFYIRVQDKQSTAGLTNLGVIDVPEEMREFVDYFDVLMGQPFSLRTNCAVGSFGD
FT                   TLSINFTSTIIETDVERFFFRKLVQEGLHVKIETNRDMNRSEF"
FT   CDS             613858..614751
FT                   /transl_table=11
FT                   /locus_tag="CC1_05780"
FT                   /product="Esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79477"
FT                   /db_xref="GOA:D4J556"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4J556"
FT                   /protein_id="CBK79477.1"
FT                   /translation="MAISEKSNQGLMKAIKRMHTLVESDDLERVRASQENISALLKHRE
FT                   LNYEPFQVGEIPSEWVSVKRSHMRKFVIFYCHGGGYNTGSFHYARSITNKLSSTTSMDV
FT                   LSFDYRLAPEHPYPSATEDALAVWDYLMHLGYGARDVIVAGDSAGGNLALSLVLKLKEQ
FT                   KRILPRGLILFSPWTDLTGSGKSYETKVDVDPILNREYLDNAIAAYASGQDLKNPLISP
FT                   LFGNFTGFPPTYIQVGSNELLLSDSLLLKKNLEKYHVPVRLEEYKGMWHVFQMSPFKTA
FT                   YDAMDQVAEFIFDICR"
FT   CDS             complement(614827..616287)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05790"
FT                   /product="putative nicotinate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79478"
FT                   /db_xref="GOA:D4J557"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="UniProtKB/TrEMBL:D4J557"
FT                   /protein_id="CBK79478.1"
FT                   /translation="MNTNSRNLTLLTDLYELTMMQGYFKTHSKEHVVFDVFYRQNPCGG
FT                   AYAIACGLDQAIDYIKDLHFEQEDIDYLRSTGFFQEDFLDYLKNFRFTGDIYAIPEGTI
FT                   IFPKEPLVKVIAPIMEAQLVETALLNIINHQSLIATKAARVVQEAGGGVMEFGLRRAQG
FT                   PDAGIYGARAAVIAGCIGTSNVLAGQMFDIPVKGTHAHSWIMSFPSELEAFRTYAELFP
FT                   DNCLLLVDTYDTLNSGVKHAIQVFREMREKGIHSKLFGIRLDSGDLAYLTKKARIMLDE
FT                   AGFPDAIISASSDLDEYLINSLMNQGAKITSWGVGTNLITSKDCPSFGGVYKLACIIDE
FT                   NGTEIPKIKVSENVEKVTNPGNKKILRIYDKASGKIKADLITLEDEVFTEDQPLTLFDP
FT                   LATWKRTRLEAGTYTIRELLVPIFKNGQCVYESPSVMDIQAYCTQEKATLWDESKRLIN
FT                   PQEVYVDLSRKLYDLKNQLLDDAHTIKD"
FT   CDS             complement(616366..616845)
FT                   /transl_table=11
FT                   /locus_tag="CC1_05800"
FT                   /product="Cytosine/adenosine deaminases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79479"
FT                   /db_xref="GOA:D4J558"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D4J558"
FT                   /protein_id="CBK79479.1"
FT                   /translation="MQSHEAYLKRAIELSVKSRESGNTPFAALLVDKDGNIIMEQMNNE
FT                   ITEHKCTGHAETQLVERASHAYSKEFLWDCTLYTTAEPCAMCSGAIYWGNIGHVVYAMT
FT                   EKDLLSLTGADPQNPTFDLPCRDVFAKGQKAIEVTGPFPELAPAAAKVHEGYWNK"
FT   CDS             617029..617154
FT                   /transl_table=11
FT                   /locus_tag="CC1_05810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79480"
FT                   /db_xref="UniProtKB/TrEMBL:D4J559"
FT                   /protein_id="CBK79480.1"
FT                   /translation="MNFFENSFDFPLEPCYHGDIIDCCLEQDLMDVNTGHFVRRI"
FT   CDS             617216..617917
FT                   /transl_table=11
FT                   /locus_tag="CC1_05820"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79481"
FT                   /db_xref="GOA:D4J560"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:D4J560"
FT                   /protein_id="CBK79481.1"
FT                   /translation="MKGLEVIGSYLDEWNIVTITVRLILAVVCGGAIGLTRSVKRRGAG
FT                   FKTHALVCLGSALVMMTGQYIYVDFGAISDIARLAAQVISGVGFLGVGTIMVTRDNHVK
FT                   GLTTAAGLWTCAGIGLSIGIGFYSGAAITTILVLVIYRFMGRVDEIAYEHSRVLDIYIE
FT                   FESRRSIAPFISVLKQNNYKIVQMELNKSKKNKEELVNATLVLEVPEKTKHGIVIDLLR
FT                   EIPGIEYVEEI"
FT   CDS             618171..619337
FT                   /transl_table=11
FT                   /locus_tag="CC1_05830"
FT                   /product="ABC-type Fe3+ transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79482"
FT                   /db_xref="UniProtKB/TrEMBL:D4J561"
FT                   /protein_id="CBK79482.1"
FT                   /translation="MKRSKKLMGLTAVIMGVVMATAACGSSGGAAESKAADSAASTEAA
FT                   TEAAGGDTSAAGDLNSKTVDELTEAAKAEGEVVSVGMPDEWADWASLWKTMSDTYGISH
FT                   NDTDMSSSEELQMFATEGEKGTKDIGDVGYGFAGQAVSEDLVQGYKTSYWDSVPDWAKG
FT                   EDGKWMVAYTGVTTFLVNTDQVDKVPTSWQDIKDGDYKVALGPLTGGNAQAAFIASAYA
FT                   FGGDMNNLDPAFEFWTELAKEGRINTLDITQANFESGEISVGVVWSFTGIPYSKNISQY
FT                   KMQAVVPSDGCLQNGYASVINKYAPHPNAAALTRETMFSDEGQTYLALAGAIPTREDFT
FT                   IADEYKDQVISKDDIANAVLISDADAYSAACETAKTRWEEEVAPLLVQ"
FT   CDS             619494..620384
FT                   /transl_table=11
FT                   /locus_tag="CC1_05840"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79483"
FT                   /db_xref="GOA:D4J562"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J562"
FT                   /protein_id="CBK79483.1"
FT                   /translation="MNQKNSIRQGLNLMKKKTYIYLLALVPFLIVAMLYEIVPLITVIV
FT                   KSFQPDGGTGFTLENYQSVFSKLLYQKAIINSIKISLTSAVAGIIIAFLGARAAHQHQG
FT                   KLNHVFMTVLNMVSNFAGIPLAFAYMILLGNAGLVVNIGKELGINALSTYNLYTMNGMS
FT                   LIYIYFQIPLSTLLLIPAFDGVQKQWKEACTLLGGTPGIFWRKVGIPVLMPSILGTFSV
FT                   LFANALAAYATIYALMMDNIALLPVQIAGCFTGEVKIRAGLGGALSVVMMAIMVIMILI
FT                   TNGLSRRFQKGGNRK"
FT   CDS             620381..621181
FT                   /transl_table=11
FT                   /locus_tag="CC1_05850"
FT                   /product="ABC-type spermidine/putrescine transport system,
FT                   permease component II"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79484"
FT                   /db_xref="GOA:D4J563"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J563"
FT                   /protein_id="CBK79484.1"
FT                   /translation="MKKKSAGSVAIMLLVMIYLLIPLVISIIYSVFHKWTGVIPEGFTL
FT                   HNYVDLFTDSNFLASVGRSIAMSIIPIIVTIVIVLLALFVTAIYFPKLEKYVQIICMIP
FT                   YTIQGVILSVSILSLYVGSSSILSNRLVMLMGAYCIVILPYIYQGIRNGMRAVNMPTLI
FT                   EAAEMLGASKIYAFFRVVVPNILSAIIVSSLLAVGIIFGDYVLIRNLAGTSAPNMQIFL
FT                   YQTMKSDSTKASAVFVVIMFVTFVITAIVLFMKSREAKGKTHRK"
FT   CDS             621196..622203
FT                   /transl_table=11
FT                   /locus_tag="CC1_05860"
FT                   /product="ABC-type spermidine/putrescine transport systems,
FT                   ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79485"
FT                   /db_xref="GOA:D4J564"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J564"
FT                   /protein_id="CBK79485.1"
FT                   /translation="MSYIRFENIVKSFGSNTVLKDINLEVEKGQLVTLLGPSGCGKSTL
FT                   LRCLSGLETVTSGKVYLDDRDITDVNPKDRDIGMVFQQYSLFPNMDVAQNVAFGLKMKK
FT                   VPNAEIDKRVKEMVDIVGLSDHLHHYPSELSGGQQQRAALARAMVTNPKVLLLDEPLSA
FT                   IDALLRHSLQVEIRRIQQELNMTAIFVTHDQDEAMVMSDVIHLMYNGKIEQSAAPTEMY
FT                   TEPVSKFAATFIGHYNMVPVDAFKKMTGVDGEGTDVAFRPEVIDISTKPVEREGCVTIK
FT                   GHVGVSLPHGNVLRYAVMCGDHQIDVDVLFKKATIIPNGTDVYLTLKQDDCIFL"
FT   CDS             622511..623233
FT                   /transl_table=11
FT                   /locus_tag="CC1_05870"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79486"
FT                   /db_xref="GOA:D4J565"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D4J565"
FT                   /protein_id="CBK79486.1"
FT                   /translation="MTKNFAHRGFSGKYPENTLLAFSKAIEEGVDGIENDVHLTKDGVL
FT                   VVMHDELVDRTTNGKGYIKDKTYEELAQLDASYIFKEYGPQKVPTLREYLELVKDTDII
FT                   TNIELKTGVFEYTGIEQKVYDMLREFDMVDRIIISSFNHYSVLRMKAIDPAIKCGMLEE
FT                   SWLINAGAYVASTGVECFHPFFKNMTPENVAEVKSHGLEINTWTVNEEEDIREMFRVGV
FT                   DSVISNYPDLVNKIRNNG"
FT   CDS             623226..624668
FT                   /transl_table=11
FT                   /locus_tag="CC1_05880"
FT                   /product="Ethanolamine utilization protein, possible
FT                   chaperonin protecting lyase from inhibition"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79487"
FT                   /db_xref="GOA:D4J566"
FT                   /db_xref="InterPro:IPR009377"
FT                   /db_xref="UniProtKB/TrEMBL:D4J566"
FT                   /protein_id="CBK79487.1"
FT                   /translation="MADKTAILSVGIDVGTSTTQVVFSKLQMDNAGGYFSVPRVAIVDK
FT                   EVVYKSEVYMTPLKTDVLIDTDALRDIVAAEFRKAGYRPEDTDSGAVIITGESARKENS
FT                   DAVLKSLSDFAGDFVVSAAGPDMESLIAGKGSGAWQYSMDHHCRVANLDIGGGTTNVVL
FT                   FEDGETLARGCLDIGGRLICMNPQGIITKVSPAAAVMAQAAGVSVSVGDRCDELKLTAV
FT                   TRQMAAALNAYLGVGTKDIDAILRQIKTPGSSDFPVPEKVQAVFFSGGVADLIYHESAD
FT                   TWAYGDIGVLLGRAIRESRLFTDFQKMEPGETIRATVVGAGTYTTTISGSTITYSDDIF
FT                   PLKNIPVIKLDEELQEACFAGETEPVIRRIQWVLGQNDEEHFILAMPGKRNPGYTEMKR
FT                   AAASIRQIMDRVQPPGEPILLVIESDIAKAMGQMIRQQPDLKRQVVAIDSIHVEDGEYV
FT                   DMGKPMMNGMVIPVVVKTLIFG"
FT   CDS             626066..627079
FT                   /transl_table=11
FT                   /locus_tag="CC1_05900"
FT                   /product="Ethanolamine ammonia-lyase light chain"
FT                   /function="Ethanolamine ammonia-lyase light chain"
FT                   /EC_number="4.3.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79488"
FT                   /db_xref="GOA:D4J567"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="UniProtKB/TrEMBL:D4J567"
FT                   /protein_id="CBK79488.1"
FT                   /translation="MNIDEALIERIIREVVSQVVAEKAAGGGQNRSASGNNQNSMQSVN
FT                   LGQIEQLVKNVASGDRQTSFGGQTSNAGGYHPEEPVHDVDIEEDITSREVKKRPLIDQP
FT                   QDPEALERMMRLTTARIGVGCAGPRLKTQTLLTLRADHARARDAVMLDVHQDVIDNLKL
FT                   FSVQTRCQDKNEFLTRPDLGRRLSEDGVQKVKDQCIEGPDVQLIVADGLSSTAINANIE
FT                   NVLPVLMDGLSAAGLRVGTPFFVRYGRVAVEDEIAELVGAKVVCIFVGERPGLGTAESM
FT                   SAYLAYNAKIGMPEARRTVVSNIHKDGITAVEAGAYLTDLIQKILDKKASGVELQN"
FT   CDS             627095..627754
FT                   /transl_table=11
FT                   /locus_tag="CC1_05910"
FT                   /product="Ethanolamine utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79489"
FT                   /db_xref="GOA:D4J568"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="UniProtKB/TrEMBL:D4J568"
FT                   /protein_id="CBK79489.1"
FT                   /translation="MKNDPIRTKVLSIRLIPNADRFLLKAMQVQEGHRSLGLITTDCDD
FT                   VSYAALDEATKKADVSVAYARSMYAGSSNASTALAGEFIGILSGENPEDVKSGLAAAVS
FT                   YIENDACFYSANDDDSIVYFAQCISRTGSYLSEMAGVPEGTAMAYLIAPPLEAVTGLDA
FT                   ALKAADVEMNLFYGPPTETNFAGGLLTGDQAACRAACEAFRETICRIAEHPVENID"
FT   CDS             629576..629872
FT                   /transl_table=11
FT                   /locus_tag="CC1_05930"
FT                   /product="Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79490"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="UniProtKB/TrEMBL:D4J569"
FT                   /protein_id="CBK79490.1"
FT                   /translation="MADRLLALGMIETKGLVGSIEAADAMVKAANVNLIGKVHVGGGLV
FT                   TVMVRGDVGAVKAATDAGAAAASRVGELVSVHVIPRPHEEIEYILPTLTTSDR"
FT   CDS             629907..631346
FT                   /transl_table=11
FT                   /locus_tag="CC1_05940"
FT                   /product="Propanediol utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79491"
FT                   /db_xref="GOA:D4J570"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="UniProtKB/TrEMBL:D4J570"
FT                   /protein_id="CBK79491.1"
FT                   /translation="MEILTDIALRAHWFRSHEKAYHVSKDTMLTPAARDFIREHGITLI
FT                   YEDSALEGQPEVEVSSVPESVKAVNQLPDAAESVGEPYKAMPMAAVPQGADHKPQYVNG
FT                   ETGEVLSVKPENMTHLHGNVLVPKTHPQIAFRGMLDSLEAKIMSLQVVASENGLHRLTD
FT                   ALDEVLAYVRQILSAEVLDKELGEIHLLGLDSAGLRYESHHIKEIYGIPHPMPEYRMGR
FT                   ICIGLNELRTFVRETELAAARAFQSGDTCTRPDIVEAMNRLSSVIYILFCRQLTGRWPG
FT                   QQEPSEMKDLPGFLVEASGRHVHLTQQAIDVLFGENLHEKSPLSQPGQYASEERVRLVT
FT                   AKGEIDNVVVLGPPRGAVQVEMSLTDARILGITIPVNLSGDLKGAADVILVGPKGIYNA
FT                   VGSVIASKAHIHMTPEDARLYGVEDGDSVAVRLETERPVTIDDVIIRVSEKFSLAMHMD
FT                   YDEANACSYKKGDMGYIIKKN"
FT   CDS             631385..632107
FT                   /transl_table=11
FT                   /locus_tag="CC1_05950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79492"
FT                   /db_xref="UniProtKB/TrEMBL:D4J571"
FT                   /protein_id="CBK79492.1"
FT                   /translation="MSIDETPALGEVFEKMDEKLMKQIVEAVMQELMAQRSNASACTEG
FT                   LDKLLVIGDLQAVPADMAEKYQIFLIDDYIQNKNIHRYQKILITSLTLVQMSDIAQGRD
FT                   GSPEACAVIRGLLNGLDVCMAEAAFPHRKYAGKSSSRLYEVIENNARMLQSFGIKLLKE
FT                   CKVGAPPIPAKPPKYQAPPIEVPKGTGHTTTDRLITEDVARSLIDGGNTAICLAANAIV
FT                   TPSAWDLFKQKGIEVIRK"
FT   CDS             632192..632482
FT                   /transl_table=11
FT                   /locus_tag="CC1_05960"
FT                   /product="Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79493"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR023414"
FT                   /db_xref="UniProtKB/TrEMBL:D4J572"
FT                   /protein_id="CBK79493.1"
FT                   /translation="MLICKVVGHVWATKKEEGLEGLKLMVVQEIDGTGRKKGNTFVAAD
FT                   VVGAGIGEQVLTVSGSTARKAFGRDTVPVDAAIVAIIDTVEVNREAARGSE"
FT   CDS             633884..634432
FT                   /transl_table=11
FT                   /locus_tag="CC1_05980"
FT                   /product="Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79494"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR011238"
FT                   /db_xref="UniProtKB/TrEMBL:D4J573"
FT                   /protein_id="CBK79494.1"
FT                   /translation="MLETIGFLELNSIAKGVEAADLILKTAEVDLIFAKAGCPGKYYIL
FT                   FTGEVAAVKASLDAGAAIGGNHTVDSCVIPRVHPQVIKAINLAAEPGTPGAIGVMEFFS
FT                   VTASVYAADAAVKAADVDLIDVRLGTGIGGKSFVVLTGEVAAVREAIECGIHTENAEGM
FT                   EVSHVVIPNPRKEIFDSLL"
FT   CDS             634764..635111
FT                   /transl_table=11
FT                   /locus_tag="CC1_05990"
FT                   /product="Ethanolamine utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79495"
FT                   /db_xref="GOA:D4J574"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009307"
FT                   /db_xref="UniProtKB/TrEMBL:D4J574"
FT                   /protein_id="CBK79495.1"
FT                   /translation="MEQEKQRIIQEFVPGKQVTLAHVIANPDSSLYKKLGVIGDYTGAL
FT                   GIMTITPSEGAIIGADVAMKAANVEVVFVDRFNGSLIINGTVADVEAAVKDVLNVLENT
FT                   LHFAPTVITKS"
FT   CDS             635125..635574
FT                   /transl_table=11
FT                   /locus_tag="CC1_06000"
FT                   /product="ethanolamine utilization protein, EutP"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79496"
FT                   /db_xref="GOA:D4J575"
FT                   /db_xref="InterPro:IPR012381"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J575"
FT                   /protein_id="CBK79496.1"
FT                   /translation="MKKIILIGNVACGKTTICQYLNHMEIKYKKTQALEVYNTTIDTPG
FT                   EYLENRGYLRSLMVTATETDQVVFVQDASRDQFFFSPGQSSAFTLPVAGVVTKIDIATP
FT                   KQIADAVELLQLAGADPIFKVSPMTGEGMEELVAFLEEKEAVAEA"
FT   CDS             635598..635729
FT                   /transl_table=11
FT                   /locus_tag="CC1_06010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79497"
FT                   /db_xref="UniProtKB/TrEMBL:D4J576"
FT                   /protein_id="CBK79497.1"
FT                   /translation="MENNVKKKKYITKPMYSRTLLYSIVNVTVEICYDECRGDSNEE"
FT   CDS             635719..636054
FT                   /transl_table=11
FT                   /locus_tag="CC1_06020"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79498"
FT                   /db_xref="GOA:D4J577"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J577"
FT                   /protein_id="CBK79498.1"
FT                   /translation="MKNENERFVEMGKRIKARRVSLGMKQMELAERIDISNNHISSIER
FT                   GIERPGLESFIRICDVLDVTPDYLLLGSMKANDIPKNITDNLKLCTDEEVRFVEAMTQY
FT                   MIEQHKK"
FT   gap             636553..637099
FT                   /estimated_length=547
FT   CDS             637463..637849
FT                   /transl_table=11
FT                   /locus_tag="CC1_06040"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79499"
FT                   /db_xref="GOA:D4J578"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J578"
FT                   /protein_id="CBK79499.1"
FT                   /translation="MRNENERFVEMGKRIRTRRLSLKMKQMELAEEVDISNNHISSIER
FT                   GIERPGLDSFIRICDVLDVTPDYLLLGSMKSNNVPKNITDNLKLCTDEEIRLVEAMTQY
FT                   LVEQHKKVKSVKETKSSWLLRKSN"
FT   gap             638190..639076
FT                   /estimated_length=887
FT   CDS             complement(639330..639902)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06060"
FT                   /product="Accessory gene regulator B."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79500"
FT                   /db_xref="GOA:D4J579"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/TrEMBL:D4J579"
FT                   /protein_id="CBK79500.1"
FT                   /translation="MITTISNHLIDWLIREDTLQPADRELYVYAAYCFLFAWTPLFLLF
FT                   IISACIGRLPEALLLILPFMTIRKFSGGFHAKTARTCLIISCTLLSGFMYLAIHISTCL
FT                   ALYIVLALASISLMINSPIVSPQRPATLDEQKHFRHVVIAAMILYNSIILLLSCTGFSH
FT                   WAVCLALGLILSAALQIPCIISKMKTS"
FT   CDS             complement(639899..640063)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79501"
FT                   /db_xref="InterPro:IPR009229"
FT                   /db_xref="UniProtKB/TrEMBL:D4J580"
FT                   /protein_id="CBK79501.1"
FT                   /translation="MKKNIQHSFASITSNFLKIVIHSEAHSNSTVLGYEPPAPESLTQF
FT                   KKDLFKKKK"
FT   CDS             640251..641648
FT                   /transl_table=11
FT                   /locus_tag="CC1_06080"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79502"
FT                   /db_xref="GOA:D4J581"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D4J581"
FT                   /protein_id="CBK79502.1"
FT                   /translation="MILNSAFAVDIYIMNEYNLKITGVKGNIEMIDIIDIGINYIIEMT
FT                   VVWQYFRSFYSAKRSKQTEHVFMISAYVILFGLFWLRILWLNVVDFLIINCFLCFYLFS
FT                   RRVSSSVFHGLILTGTMVVTELIVELIGMKALNGFLVFMEHPLTYAMINISSRMVFFLI
FT                   IRIIIMNFAPKKEKIDVKSGFAVLIGIIPIVSIWFTIVIIMICVDSPIDNLMSSMLLTS
FT                   AILLLVMNFVVFWAYDSNQKFMRNYLMMQSNLREQQAEAEYYRRLAEQTENQKILIHDI
FT                   KNHLQTIAGLSEDGGESKIHEYVQQLMEMPEMKSSVTYCSQPVLNVILGQYQEICKKKS
FT                   IQFGVDIRKDSVDYITVDDLTALFGNLLKNAVEAAAGVSEAYIDVTVNYNYKSKQTFIS
FT                   VENSVLYPPVFDGDGGLISRKNDGKLHGVGIKSIQRAAEHYQGEVSYHYDKEAKCFHMM
FT                   VLLTNNK"
FT   CDS             641666..642370
FT                   /transl_table=11
FT                   /locus_tag="CC1_06090"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79503"
FT                   /db_xref="GOA:D4J582"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4J582"
FT                   /protein_id="CBK79503.1"
FT                   /translation="MRIAVCDDDQNFCKEMLKYLQGYFKEKKLRQPEYVCFSSGEAMMK
FT                   AGGIFDMAFLDVEMDGISGIHAGEYLKKKNDKIFIFIVTSFPEYLDEAMSFRVFRYLSK
FT                   PLDKARLYRNLEAALKIYMASDRKVVVETKAGVYSVVAEKIVMVEAVNRKVILYTLKRE
FT                   FECVHPIKYWAEQLTDKCFCRPHRSFIVNLKYVQKFDNHLISLAGDRVAYLTRRKYKEF
FT                   KDAYLFYLESEK"
FT   CDS             642545..642688
FT                   /transl_table=11
FT                   /locus_tag="CC1_06100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79504"
FT                   /db_xref="UniProtKB/TrEMBL:D4J583"
FT                   /protein_id="CBK79504.1"
FT                   /translation="MERKSYLDYAGWLSGQGKAGTTYTLCARLDNLFRSGYGYTQGAWN
FT                   SN"
FT   CDS             642773..643777
FT                   /transl_table=11
FT                   /locus_tag="CC1_06110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79505"
FT                   /db_xref="UniProtKB/TrEMBL:D4J584"
FT                   /protein_id="CBK79505.1"
FT                   /translation="MNRKIIGILGLVGLVLTGCAAPEVETEQTMMGSYSSDEIMQDNGR
FT                   KIEKHFQNEGEDGVLDINAVVDIPDISLKEGVIQSKEWDISMLENVLCPGTDMILEQNS
FT                   QSDYTRYIGGSAYNDLDYDIYFEISKLDNSLTYCNYKLDDYFVNEEFELVKETEWTESE
FT                   QNFVKKMEENSLDLYSKLGIEAEVANTDLTVSNEKQYCSVKMLRTLDGCSWLDAGGEPV
FT                   CDTIQIAEPGINVLSVAEQYTTKDVKEASVLSIDEIMQIIDDGVKNGNIHTYIMEEKGF
FT                   DYTIQSIRMGYMTQIEDGAMHFFPVWYFQCKLGEKGITLLALDARNGAVIYMG"
FT   CDS             643796..644224
FT                   /transl_table=11
FT                   /locus_tag="CC1_06120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79506"
FT                   /db_xref="UniProtKB/TrEMBL:D4J585"
FT                   /protein_id="CBK79506.1"
FT                   /translation="MKRIMLKRSILNIRMLFVIVTNFIILFVSLFEYGIITVDGKTPGT
FT                   TYDILTMYTIPFAISSFIIFAGIFPGLPYAFSYLEERNSGYLKYIRTRINIGKYAKYKV
FT                   LFSGLSGGLSVMIPGVMIFAVICLIGRKVIPGDNAHVR"
FT   CDS             complement(645344..645580)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79507"
FT                   /db_xref="UniProtKB/TrEMBL:D4J586"
FT                   /protein_id="CBK79507.1"
FT                   /translation="MDGLSGKDFFGGSVFPDNKAFRKLRFARCMKKWQPFWASLSNTEL
FT                   LEICQKWAQKKQQIFFGFTASCAAAGRRLFSCK"
FT   CDS             645638..645907
FT                   /transl_table=11
FT                   /locus_tag="CC1_06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79508"
FT                   /db_xref="UniProtKB/TrEMBL:D4J587"
FT                   /protein_id="CBK79508.1"
FT                   /translation="MKKAGYRFPEKVAVASEGNPTALYEKSWLRFLKKVAVASERQSGS
FT                   FLEQDSTEVPKFAFCSFCPCGNLVGECLPQTLLIRLAPLKNPSK"
FT   gap             646095..647844
FT                   /estimated_length=1750
FT   CDS             647849..648409
FT                   /transl_table=11
FT                   /locus_tag="CC1_06170"
FT                   /product="N-terminal phage replisome organiser
FT                   (Phage_rep_org_N)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79509"
FT                   /db_xref="InterPro:IPR010056"
FT                   /db_xref="UniProtKB/TrEMBL:D4J588"
FT                   /protein_id="CBK79509.1"
FT                   /translation="MIATLTRHQIGTVERALEIFRQLGLVEQLDSGAFYMTDIELMIGQ
FT                   SSTEAERKRAARLENKALLPSRTKGGHLSDIRPPEIELELEKEIKIEKEREGETGHPAP
FT                   AAYGRYNNVILTDTELSGLKTELPDKWEYYIDRLSCHIASTGKQYHSHAATIYKWAQED
FT                   AAKGKAAPKQGIPDYSCKEGESL"
FT   CDS             648406..649263
FT                   /transl_table=11
FT                   /locus_tag="CC1_06180"
FT                   /product="phage DNA replication protein (predicted
FT                   replicative helicase loader)"
FT                   /function="phage DNA replication protein (predicted
FT                   replicative helicase loader)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79510"
FT                   /db_xref="GOA:D4J589"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J589"
FT                   /protein_id="CBK79510.1"
FT                   /translation="MRNGIEAMITDITATTAEAEDYTGEDGLLYCGKCHTPKEAYFSKE
FT                   TAQWLGHDRHPTECDCQRAAREKREAAESRQKHLETVEDLKRRGFTDPAMRNWTFEHDN
FT                   GRNPQTATARFYVESWETMQAENIGYLFWGGVGTGKSYLAACIANALMEKEVAVCMTNF
FT                   ATILNDLAASFEGRNEYISRLCSYPLLILDDFGMERGTEYGLEQVYSVIDSRYRSGKPL
FT                   IATTNLTLEELQHPQDTPHARIYDRLTSMCAPVRFTGSNFRKETAQEKLERLKQLMKQR
FT                   KESL"
FT   CDS             649260..649448
FT                   /transl_table=11
FT                   /locus_tag="CC1_06190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79511"
FT                   /db_xref="InterPro:IPR026990"
FT                   /db_xref="UniProtKB/TrEMBL:D4J590"
FT                   /protein_id="CBK79511.1"
FT                   /translation="MTETKQTSTTKTDRRPDCVTEIRMGNSVLTVSGFFKQGATDTAAD
FT                   KMMKVLEAEAATQKTAI"
FT   gap             649569..650785
FT                   /estimated_length=1217
FT   CDS             650917..651234
FT                   /transl_table=11
FT                   /locus_tag="CC1_06200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79512"
FT                   /db_xref="UniProtKB/TrEMBL:D4J591"
FT                   /protein_id="CBK79512.1"
FT                   /translation="MYIWGGRFVLLLKAILLFLFGAMWAELALLFSNIFKNRYVAYVLP
FT                   FLAYELMWLVFPVGIWNPVYLVRSDFGRDIPVFIPYLVDMGYIVILCLINMVLMKRRGR
FT                   Q"
FT   CDS             651231..652091
FT                   /transl_table=11
FT                   /locus_tag="CC1_06210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79513"
FT                   /db_xref="UniProtKB/TrEMBL:D4J592"
FT                   /protein_id="CBK79513.1"
FT                   /translation="MNINFRQIILVLSGQLRAALMSKRVLIGYLIGVMAALKAAYLYGE
FT                   YASNHPIQIFEPWLMNFRSLADITIMLVGFILVVADAPFVDSRSLLTIYRTSRGNWYDG
FT                   LCLYVLVQGIIYFALSLTASCIYTIPHGYIQNQWSVAMKQLVLWPSDKAIITWHLVAPD
FT                   KTLIEGVLPWESVFHTFLLMLLYSLVLGMLLYVLNAGINKAIGTIAAAAVHVSGIILMN
FT                   LNVSYKITRWSLLKNSSYLWHFEAKLDLVFSYALFLLCYVCILFIGPIILKHADFRYSV
FT                   GEEND"
FT   CDS             652084..652812
FT                   /transl_table=11
FT                   /locus_tag="CC1_06220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79514"
FT                   /db_xref="UniProtKB/TrEMBL:D4J593"
FT                   /protein_id="CBK79514.1"
FT                   /translation="MTKKYRWIFGILITICMSIILILISSIALDYHRNVWRYLGGPVSD
FT                   GIVPQKVIEWLLIVTPVWTICGWWLNNQFALVQMTVFRYGNIGVWWKQQIKEVYLLHSW
FT                   YYILMFVVLKLRIQKYWTANLYLEILMILIHSLFMLTIMILIRIVVNNMLASFTCILML
FT                   EILSIYASAQKWFSPKYCPFVWGMYNVCNQTYPNKGYDIEKAIVLSVVFIIVLNAAIFV
FT                   DKKLLKRSLSHGKNRTDRSE"
FT   CDS             652781..653410
FT                   /transl_table=11
FT                   /locus_tag="CC1_06230"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79515"
FT                   /db_xref="GOA:D4J594"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J594"
FT                   /protein_id="CBK79515.1"
FT                   /translation="MEKIELIGVNKSFKEEKVLKDICLTLTDNKIYGFVGRNGSGKSVL
FT                   FKIICGYVIADSGKIMIDGKELGKDMDFPEGLGALIETPGFIWYQSGFENLRYLARIRN
FT                   KINDAQVKDAIRQVGLNPDSKKWVGKYSMGMKQRLGIAQAIMEYPDILVLDEPMNALDE
FT                   EGVEEIRQLLLKYRQLGRCILITSHNREDIEILCDEVFEIKSGVLQ"
FT   CDS             653592..654155
FT                   /transl_table=11
FT                   /locus_tag="CC1_06240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79516"
FT                   /db_xref="UniProtKB/TrEMBL:D4J595"
FT                   /protein_id="CBK79516.1"
FT                   /translation="MGMRKSGNLWLTMIAALILVCVMAIAGCGKQQAGAGSGSEQSAQS
FT                   ALEHVLSCTVQEAADFETASEGIKQAAEETGDETGIVSVDGLETYFQGRFGDDLTEDCL
FT                   NKMMADRTIAVSIKLAEQYQSDILAEDIQLTKRSGNEDMYDFEAKLVTAADSKQIASVT
FT                   GVVTMEESQSSWKISNLTLKVSES"
FT   CDS             654272..654532
FT                   /transl_table=11
FT                   /locus_tag="CC1_06250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79517"
FT                   /db_xref="UniProtKB/TrEMBL:D4J596"
FT                   /protein_id="CBK79517.1"
FT                   /translation="MKSFKTLRIVITIVDVVCLLAVLFVPALEAAKHNFFVWLILGLLT
FT                   LYVLFMWMVLGRRNTNGYDAESDREADISKELLSQRNKWYW"
FT   CDS             complement(654701..655645)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06260"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79518"
FT                   /db_xref="GOA:D4J597"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="UniProtKB/TrEMBL:D4J597"
FT                   /protein_id="CBK79518.1"
FT                   /translation="MNKKKRIVIALGGNALGNTLPEQMAAVKVTSKAIVDLIEEGCEVV
FT                   VTHGNGPQVGMINNAMIALTHEDAQQPNTPLSVCVAMSQAYIGYDLQNALREELFNRGI
FT                   TDIPVATMITQVRVNEDDPAFNNPSKPIGKFFNEEQAKMMEEKYGYIMKEDAGRGYRRV
FT                   VASPKPAEIIEIGTIRTMVESGDLVIACGGGGIPVTRQGNHLKGASAVIDKDFASCLLA
FT                   QELDADFLIILTAVEKVAINFGKPNEQWLEDLTVEEAKKYMEEGHFAPGSMLPKVQAAV
FT                   DFASSKEGRTALITLLEKSKDGIQGKTGTRFHL"
FT   CDS             complement(655751..656947)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06270"
FT                   /product="probable carbamoyltransferase YgeW"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79519"
FT                   /db_xref="GOA:D4J598"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR017702"
FT                   /db_xref="UniProtKB/TrEMBL:D4J598"
FT                   /protein_id="CBK79519.1"
FT                   /translation="MDAKLQAYIDKLNALNFKEMYNGDFFLTWEKSDDELEAVFTVADA
FT                   LRYMRENNISTKVFESGLGISLFRDNSTRTRFSFASACNLLGLEVQDLDEGKSQVAHGE
FT                   TVRETANMISFMADVIGIRDDMYIGKGNKYMHEVVDAVTQGNKDGILEQKPTLVNLQCD
FT                   IDHPTQAMADMLHIIHEFGGVENLKGKKIAMSWAYSPSYGKPLSVPQGIIGLMTRFGMD
FT                   VVLAHPEGYEVFPEVEAVAAENAKKSGGSFTKTNNMAEAFKDADIVYPKSWAPFAAMEK
FT                   RTELYGNGDTEGIKALEKELLAQNAEHKDWACTEELMATTKNGKALYLHCLPADITGVS
FT                   CEEGEVDASVFDRYRDPLYKEASYKPYIIAAMIFLAKFENPQEILKKLEERSMPRIFK"
FT   CDS             complement(657061..658374)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06280"
FT                   /product="M20/DapE family protein YgeY/putative selenium
FT                   metabolism hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79520"
FT                   /db_xref="GOA:D4J599"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017706"
FT                   /db_xref="UniProtKB/TrEMBL:D4J599"
FT                   /protein_id="CBK79520.1"
FT                   /translation="MLDFNKIKEVAQGYQADMTAFLRAIVKNPGESCDEKAHVETIAAE
FT                   MKKLDFDEVVIDPQGNVIGYMGTGDKIIAFDGHIDTVGIGNINNWTFDPYDGYENETEI
FT                   GGRGVSDQCGGVVSAVYGAKIMKDYNLIPEGYKIMVVGSVQEEDCDGLCWQYIINEDKV
FT                   RPEFVVSTEPTDGGIYRGQRGRMEIRIDVKGVSCHGSAPERGDNAIYKMADILQDVRAL
FT                   NENDDADETEIKGLVKMLNPKYNPDWEEARFLGRGTVTTSQIFYTSPSRCAVADSCAVS
FT                   LDRRMTFGETWESCLDEIRNLPSVKKYGDDVVVSMYNYDRPSYTGCVYEIECYFPTWAI
FT                   PKDHKVTKALEAAYHGLYGDKRIGAADTLEMRQARPLTDKWTFSTNGVSIMGRNGIPCI
FT                   GFGPGAEAQAHAPNEMTWKQDLVTCAAVYAALPMSYCE"
FT   CDS             complement(658469..659722)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06290"
FT                   /product="diaminopropionate ammonia-lyase"
FT                   /EC_number="4.3.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79521"
FT                   /db_xref="GOA:D4J5A0"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR010081"
FT                   /db_xref="InterPro:IPR019871"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5A0"
FT                   /protein_id="CBK79521.1"
FT                   /translation="MANKADNQIKWVLNKMPKSDDKQVANMSLEEMSKANNFHKSFPQY
FT                   SVTPLTGLPHLAEYLGLKKLYVKDESYRFGLNAFKVLGGSYAIARYMAQQLGKDVSEVP
FT                   YDVLTSEKLKEDFGQATFFTATDGNHGRGVAWAANKLGQKCVVRMPKGTTQTRLNNIAK
FT                   ENATVTIENLNYDECVRMAAKEAAETEHGIMVQDTAWEGYEEIPTWIMQGYGTLALEAD
FT                   HQLEEDNCRPTHIFIQAGVGSLAGAVVGYFANRFKENPPIMTVVEAKAADCLFRSASKG
FT                   DGSRVDVTGDMLTIMAGLACGEPNTVSWDILRNHADAFVSCPDWVSANGTRIYSSPMKG
FT                   DERVISGESGSVTMGLVAAIMTKPELKELKEALKLDENSQVLLVSSEGDTDPDRYREIV
FT                   WEGLCGTDKEPFADLQEN"
FT   CDS             660126..661511
FT                   /transl_table=11
FT                   /locus_tag="CC1_06300"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79522"
FT                   /db_xref="GOA:D4J5A1"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5A1"
FT                   /protein_id="CBK79522.1"
FT                   /translation="MNSKEDLGRKKGRRLSADDLFNMEGKPSFLQAFPLSLQHVAAMIV
FT                   GCVTPAIIVANAAGLSDSDSVILIQAALFVSALTTLLQLYPLFHGSAYAIGSGLPMIMG
FT                   ISFAYVPTMQAIATQYDVATILGAQIVGGIVALLVGLFIKQIRKFFPPLITGTVVFAIG
FT                   LSLYPTAINYMAGGTSNEHYGAWQNWLVAIIVLCIVTYLNHYGKGIFKLASILIGIIIG
FT                   YIISIFFGMVDFSSVTGASLISIPQPLHFGIKFEPSSCVAIGLLFAINAIQAIGDFSAT
FT                   TTGGLDRMPTDEELKGGIVAYGISNVVGAIFGGLPTATYSQNVGIVASTKVVARKVFRI
FT                   AAMILLVAGLVPVFSAVLTTIPYCVLGGATISVFASITMTGIKLITTQPLDFRNTTIVG
FT                   LAIALGMGVTQANAALATFPAWVTTIFGKSPVVLAMITAVVLNLLLPKPKGSAVEPAEE
FT                   KAE"
FT   CDS             661722..663053
FT                   /transl_table=11
FT                   /locus_tag="CC1_06310"
FT                   /product="putative selenium metabolism protein SsnA"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79523"
FT                   /db_xref="GOA:D4J5A2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017700"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5A2"
FT                   /protein_id="CBK79523.1"
FT                   /translation="MLVIGNGKLFTRNDEMPFVENGAVAIKGTKIAAVGETEAIKKQYG
FT                   DAEFIDAKGGVIMPAFINTHEHIYSAMARGLSIKGYNPKGFLDILDGQWWTIDRHLTLE
FT                   QTKYSAVETLISCIRNGVTTVFDHHASFGQIGGSLFTIADVAKELGVRACLCYEISDRD
FT                   GMDKARESVMENAEFIRYALKDDTDMIAGMMGMHAQFTISDATMELAAANKPDEVGYHI
FT                   HVAEGIEDLHDCLKKYGKRIVDRLMDFNILGEKTLLGHCIYINPHEMDLIKDTNTMVVH
FT                   NPESNMGNACGCPPTMELVHRGILTGLGTDGYTHDMIESYKVANVLHKHHLCDANAAWG
FT                   EVPKMLFENNAAIANRYFKTPLGVLKEGAAGDVIVVDYNPPTQLDASNINGHILFGMTG
FT                   RDVVTTVANGRVLMKDREIKVIDVEEAMAKCREESAKLWHSING"
FT   CDS             663161..666142
FT                   /transl_table=11
FT                   /locus_tag="CC1_06320"
FT                   /product="putative selenate reductase, YgfK subunit"
FT                   /EC_number="1.97.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79524"
FT                   /db_xref="GOA:D4J5A3"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR017701"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5A3"
FT                   /protein_id="CBK79524.1"
FT                   /translation="MSDRMTGMSFDQLMNWVTEELENHGTLFGLHRAYKAPEEALTIFG
FT                   RDLETPIGPAAGPNSQLAQNIAASYYAGSRFFELKTVQIMDGDELAACVNKPCIKADDE
FT                   AYNCEWSTELYVPQAQDEYIKAWFLLSFMAKEYGLGSMDGFQFNISVGYDLEGIKSEKV
FT                   NTFIESMKNAADTETFKVCKQYLLDHVSEFKHVTAEDIEAIRPDICNSVTLSTLHGCPP
FT                   QEIERIATYLLTEKKLNTFIKCNPTLLGYEFARETLDKMGYDYIAFGRFHFEDDLQYVD
FT                   AVPMLQRLIKLSGEMGLEFGVKITNTFPVDVKAGELPSEEMYMSGKSLYPLSISLAAKL
FT                   SREFDGKLRISYSGGADAFNIDRIVGCGIWPVTVATTILKPGGYQRLQQMADSLEAMGV
FT                   GEFKGIDVAALNKLAEDAITDAHHVKPAKLPASRKSNETVPLLDCYTAPCQDGCPIHQE
FT                   IPTYVALAGEGKYEEALKVILNRNALPFMTGTICSHPCQGYCTRNFYEKSVQIRNTKLE
FT                   CAEQAMDAIIDCVSVTGDYSGSVAVVGGGPAGMAAAYYLARLGAKVTIYEKRERLGGVV
FT                   SAIIPNFRIDDSVIAKDAALLEKLGVKVLYNTEAPAVDVLKKEYDSVILAVGAYKRGEL
FT                   KLEGGEAQNALAFLEDYNRTNGKMAIGKNVVVIGGGNTAMDTARAAKRCDGVEHVYLVY
FT                   RRTKRYMPADEHELVLAVEDGVEFRELLAPEKLENGQLICRVMKLGELDASGRAGIVET
FT                   DETVAVPADRVIAAVGEKVPTDFYEANGLQVDDRGRVKVSPTLESSVENVYVIGDGLYG
FT                   PSIVVKAMAQAITAAEAICGREISGSCDIAADPVSIYAKKGILAEPGDKPESERCLGCS
FT                   TVCENCVDVCPNRANISIKVPGMAKAQVIHVDYMCNECGNCKSFCPYASAPYLDKFTLF
FT                   AKEADMADSKNDGFAVIDKEAVTAKIRFFGKETTWTKGQESSVPFGLLKVIEAVCTDYS
FT                   YLLP"
FT   CDS             666524..667096
FT                   /transl_table=11
FT                   /locus_tag="CC1_06330"
FT                   /product="Carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79525"
FT                   /db_xref="GOA:D4J5A4"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5A4"
FT                   /protein_id="CBK79525.1"
FT                   /translation="MIHHMIMTADEAIEKLKSGNMRYLLMNSNSGNVSAALRKFTYEHG
FT                   QHPHAIIVTCSDSRVIPETIFSAGLGELFVIRVAGNVIDDHQLGSIEYAAGHLGSPVVV
FT                   VLGHTHCGAVDAAINSDPEGYIKFITDEIKLAIGDETDDYKACCLNVKRSVALIEHSLD
FT                   IQQIEEQEGLRVVGAMYHIEDGSVEFL"
FT   CDS             668815..669201
FT                   /transl_table=11
FT                   /locus_tag="CC1_06350"
FT                   /product="uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79526"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5A5"
FT                   /protein_id="CBK79526.1"
FT                   /translation="MQSEKNFRQHGRMSVYEHSLAVARMCLRIAKYFPGEVDMRSLVRG
FT                   ALLHDYFLYDWHIPDESHKWHGVTHAGDALKNARRDFELNEIEQDMIRKHMFPLNPVPP
FT                   KYRESWILCMADKICASKETVKRH"
FT   CDS             complement(669250..673638)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06360"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79527"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5A6"
FT                   /protein_id="CBK79527.1"
FT                   /translation="MSNLTTNDTQLFVGIDVGSTTTKIVAINPEKHEILLSNYKRHNAA
FT                   QAQSVQDALAFFEDKFPNARIRLALTGSGAKHLAEALGCCYIQEVVANSIALQKEYDNV
FT                   GTAIELGGQDAKMIFFRRDPATQTLNVADMRMNGSCAGGTGAFIDEIASILKVPVEEFN
FT                   ELASQGSCIYDISGRCGVYAKTDIQPLLNQGISRQDLALSSFHAIAKQTIGGLAQGLDI
FT                   QKPVVFEGGPLTFNPTLVNVFAKRLGLTPEETLRPTHPEIMIAYGAALSLDGMFAGNSS
FT                   WYMPKHYLELLENPELRAHLQASADGPLFFESEEEHRAFNERHQLPEFTPYVPQKGETV
FT                   HAYLGIDSGSTTTKFVLMDEDENILDSFYAPNEGDPLTIAKTALLTIHDRYEKAGAKLD
FT                   IIAAGTTGYGELLFSKAFSTECHVVETVAHARAADKYIKDATFILDIGGQDMKAIWIDN
FT                   GIITNIVVNEACSSGCGSFLENFASSLHIPVEEIAEAAFSSKHPASLGSRCTVFMNSSI
FT                   VTEQRNGKQSADIMAGLCRSIIENVFTKVIRISNLDSLGDKIVVQGGTFRNDAVLRALE
FT                   QYTGREVIRAPYPGIMGAIGAALITKKRFEQNHPAKTFIGIDGMADFSYTQEANAPCPF
FT                   CANHCKRTIVRFSNGNSWVTNNRCERGEILGDPKDASVRQQLADAKKSREQTPNLFKLR
FT                   QELLFKDYPYPKAAKERDITIGLPRVLSYWETMPFWTTFWRALGFKIQLSDLSTRKIYE
FT                   DGLSAVTSDTVCFPAKLVHGHLRNLVKKDVDRIFMPSITTVTSENTESTSESMCAIVKG
FT                   YPIVIRNSDNPEKRWHIPFDAPLFHWYKREDRNRQLTGYMEKTFGISPAETRQAINVAD
FT                   AAEKQFHDEMHRAGKAVLDEVTANGSYAVILASRPYQNDALVNHDLPEMFTSLGIPVLT
FT                   ADSLEEADHVDLSMSRLDIVNNYHARMLSTAILAARNPHLEYVQIVSFGCGHDAYLSDE
FT                   IIRLMKEISGKTPLVLKLDESDIQGPLRIRVRSFTETVSMNHAIHPELDIHPLEDPYPV
FT                   KFTKEDCRKKIVLVPNTSHAFCRIMSAAMRGQHIQAEPLEIGREEAIRLGKQYVHNDIC
FT                   FPCQIVIGEALAALKSGKYDGKEVAIGMGKYIGDCRLTHYSALLRKALDDAGFHDVPIL
FT                   TNDDVDYHNMHPGFRMSLGSAIRLAFALPVIDVLEELLRKIRPYEKVAGSTNRAFEKGM
FT                   DAVVEGLELHGISGLKKGFKKAIDLMNQVKYDRTNRRPRVLIVGEYLLNFHPGANHDIE
FT                   NYLEHNGFEIIEAHMTDVIQKSYFYLDAQIKEYKLKKPLNKKIWFSTVDTVFDMAHNMA
FT                   DAIAKKHPLYTPACRMPDLVKASDPIINHTFDAGEGVLIPGEILHHAKDGCRSFVILQP
FT                   FGCLPNHVVGRGISKRLKEMYPDAQILPLDYDPDVSFANIENRLQMLIMNAKSGNIKDK
FT                   N"
FT   CDS             complement(673658..674122)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06370"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79528"
FT                   /db_xref="GOA:D4J5A7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5A7"
FT                   /protein_id="CBK79528.1"
FT                   /translation="MTYTEQCVPLIRHIHCAMEKEANNKLREMDLTVSQIYLLQALNHA
FT                   PDGTHTLTLKALEKQLQIGQSTTVGLVKRLQKKDFVTCTQSIDDKRIKIVALTAAGKNI
FT                   CCNAEAHMTHVFDHMSEGLSENEKKILLTLLTRVQQNLIPHQDSQMDPES"
FT   CDS             674654..675820
FT                   /transl_table=11
FT                   /locus_tag="CC1_06380"
FT                   /product="Predicted oxidoreductases of the aldo/keto
FT                   reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79529"
FT                   /db_xref="GOA:D4J5A8"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5A8"
FT                   /protein_id="CBK79529.1"
FT                   /translation="MEYRQNDWSILGFGCMRFPKKGGSVDMKETERELAYAIAHGVNYF
FT                   DTAYIYRGNEKVLGELVAKNHWRAQIQIATKMPHYLIHSIDELEKLFCEQLKRLQTDYV
FT                   DNYLMHMLPDVHIWKKLVRMGILDWINEKKENGQIRRIGFSYHGNSQNFIALLDAYDWE
FT                   FCQVQYNYMDIHNQAGAEGVAYAAKKGIPVIIMEPLRGGRLVNGLPKKAKDLFAAAEPK
FT                   RSPAEWGLRWLWNQPEISVVLSGMNSMAMIQENIRIADTVKVGEMTETDGAMFEDVRNA
FT                   VNEKMKVPCTGCGYCQPCPYGVDIPGAFRCYNVRYTDNFFTGMREYLMCTTFRAERTNA
FT                   SLCRQCGKCEQHCPQGIAVRKELKQVVRHMENPVYKVIAFFAKDMFKK"
FT   CDS             complement(675823..676956)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06390"
FT                   /product="cysteine desulfurase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79530"
FT                   /db_xref="GOA:D4J5A9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010969"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5A9"
FT                   /protein_id="CBK79530.1"
FT                   /translation="MIYLDSSATSFLKPPQVAEAVFRSFNTIGNAGRGAHAPTLNASRL
FT                   IYDTREKLAALFGTPDPSRIAFTCNATEALNIAIHGAIHPGEHVITTACEHNSVLRPLY
FT                   LKEKEGTELTIIPADKKGRIRYDLLESSVKSNTSAIVLTHASNLSGNVTDLAFVSNFTK
FT                   KHGLLLIVDASQTAGSLPINVVKMGIDILCFTGHKGLFGPQGTGGLYVREGLTLSPLKS
FT                   GGSGVHSFDRQHPTDMPTALEAGTLNGHGIAGLNAGLDYILSTGVKNIHAKEISLARRF
FT                   VNGISDISDLKLYGDIDAPLRTPIISLNIGNMSSASVSDILWEDYEICVRAGAHCAPLM
FT                   HKTFGTEKQGAVRFSFSCFNTETEIDTAIRAMHEIAE"
FT   CDS             complement(676953..677732)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06400"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79531"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5B0"
FT                   /protein_id="CBK79531.1"
FT                   /translation="MNTTPVYFTGIDIGSTASKTVVLKEGKIEDYFVLPTGWNGRETAN
FT                   AILEQLKSRGYADDMRCVATGYGRICVDYADKIVTEITCHGKGGWAIFKKNMTIIDVGG
FT                   QDTKMIKVVDGQVADFLMNDKCAAGTGKFIEVMATRLGADLNEMYELAAKGQPLAISAM
FT                   CTVFAESEVISHIGSGEKREDIAAGVIHSVANRVANLAARFGVEENIVLTGGLCESPYF
FT                   IQTLSDKLEHKVETDAFARYAGALGAALTAAKRRDLA"
FT   CDS             complement(677740..678888)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06410"
FT                   /product="Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA
FT                   dehydratase subunit, BcrC/BadD/HgdB"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79532"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5B1"
FT                   /protein_id="CBK79532.1"
FT                   /translation="MLNLPANFETYAEARKSGFMKMKEIKDNGGRIVGVYCSFVPQELL
FT                   MAAGAAAAPLCASSDEPIPAAETKLPRNLCPLIKASYGFALTDTCPYFYFSDFIVGETT
FT                   CDGKRKMFELMNELKETYVMQLPHSRDDAALRSWTEEVIRLKEKLEDFYHITITEKDIR
FT                   DAIRLKNHERRAMLGFLELGKLNPAPISGYEMGTRLDGLGFNFNLEERIAIIEERTKEV
FT                   LTDWEANYKGKASDRPRLLITGCPNSGVRDKIIKTVEELGADVVAFDCCNGTREKVEPV
FT                   DENMPIYDALAKKYLNINCSVMSPNNSRMQYIDEMIDEYQVDGVIEIILQACHTYNIES
FT                   HYVKQTVTNKGKSYLMIETDYSQADKGQIRTRLEAFLETLEK"
FT   CDS             complement(678947..679846)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06420"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79533"
FT                   /db_xref="GOA:D4J5B2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5B2"
FT                   /protein_id="CBK79533.1"
FT                   /translation="MDFKQLHSFISVVRCRSFTEAAEELGISQPTISTHIRILEEELNS
FT                   RLIVRTAKSFEVTPRGMELFECAQNILKLRDDMVSRWNGHDSKVIRLGVSTIPSAYILP
FT                   EILPTFGKSHDDIYFVVTQSDSRGIIDAVHKGSYDLGLVGMKTDDEQLVFKKFYQDHLV
FT                   LIAPVTDYFLEMKDTGSFSLEKVLQEQPVILREQGSGTGKSASAFLEKIGIPEDKLHIA
FT                   ARINDQEAIKNLVAGGLGVSIVSEKAVHDYIDAKRLLQFELPGHIAGREFYIIYHKDFI
FT                   LKDYVCEFIKYLEHCYKQ"
FT   CDS             680104..683328
FT                   /transl_table=11
FT                   /locus_tag="CC1_06430"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /function="carbamoyl-phosphate synthase large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79534"
FT                   /db_xref="GOA:D4J5B3"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5B3"
FT                   /protein_id="CBK79534.1"
FT                   /translation="MPQRTDIHKVLIIGSGPIIIGQACEFDYSGTQACKALKKLGYEIV
FT                   LVNSNPATIMTDPETADVTYIEPLNVERLEEIIAKERPDALLPNLGGQSGLNLCAELNK
FT                   AGILDKYHVKVIGVQVDAIERGEDRIEFKHAMDKLGIEMARSEVAYSVEEALAIADKLD
FT                   YPVVLRPAYTMGGAGGGLVYNKEELKTVCARGLQASLVGQVLVEESILGWEELELEVVR
FT                   DKDNNMITVCFIENIDPLGVHTGDSFCAAPMLTISEECQKRLQEQAYKIVESVEVIGGT
FT                   NVQFAHDPVTDRIIVIEINPRTSRSSALASKATGFPIALVSAMLATGLTLKDIPCGKYG
FT                   TLDKYVPDGDYVVIKFARWAFEKFKGVEDKLGTQMRAVGEVMSIGKNYKEAFQKAIRSL
FT                   ETGRYGLGHAKNYDTMTKEELLHLLINPTSDRHFIMYEAIRKGATTEEIFDLTKVKTYF
FT                   IEQMRELVEEEEEILKSKGHLPADALLIQAKKDGFSDKYLSQLLEIPEEEIRNHRISLG
FT                   VEEAWEGVHVSGTKDSAYYYSTYNAQDKNPVAEAKPKIMILGGGPNRIGQGIEFDYCCV
FT                   HAALALKKLGFETIIVNCNPETVSTDYDTSDKLYFEPLTLEDVLSIYKKEKPLGVIAQF
FT                   GGQTPLNLAAELEKNGVKILGTAPAVIDLAEDRDLFRAMMEKLDIPMPESGMATTVDEA
FT                   LEIANKIGYPVMVRPSYVLGGRGMEVVYDDESMAGYMAAAVGVTPDRPILIDRFLNHAT
FT                   ECEADAISDGTHAFVPAVMEHIELAGVHSGDSACILPSVHISPENVATIKEYTRKIAEE
FT                   MHVRGLMNMQYAIENGKVYVLEANPRASRTVPLVSKVCNIRMVPLATDIITSELTGRPS
FT                   PVPELKEQKIPYYGVKEAVFPFNMFPEVDPVLGPEMRSTGEVLGLSESYGEAFFKAQEA
FT                   ASLKLPLEGTVLISVNKKDKPEVVDVAKRFHEDGFKIIATGKTCDLLNESGIPAEKVKK
FT                   LYEGRPNILDMITNGKIDLVVNSPAGKESVHDDSYLRKAAIKAKIPYMTTIAAAKATAE
FT                   GIGYVKAHMEENNGVKSLQQMHSEIQ"
FT   CDS             complement(683438..683932)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79535"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5B4"
FT                   /protein_id="CBK79535.1"
FT                   /translation="MCYDVFTRCASYFEVFYYSYMNSFYGKMEVDFMAQWQPSTFTPDK
FT                   TADTAAYAASLSASATSQSLNRTFLSSLFEQIFNSPSEALSLYNAINGTNYSDPGLLTI
FT                   TTLSGALFLGYRNDCPELKISLNFFLKLAAFLMISGNGLHLRLILIPSSNGPEMPRAVR
FT                   I"
FT   CDS             684177..684395
FT                   /transl_table=11
FT                   /locus_tag="CC1_06450"
FT                   /product="Heavy-metal-associated domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79536"
FT                   /db_xref="GOA:D4J5B5"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5B5"
FT                   /protein_id="CBK79536.1"
FT                   /translation="MKKTYKIDVDCANCANKMEDAANKTAGVKNAVVNFMALKMSVEFE
FT                   EGAAPKDVMQEVLKNCKKVEDDCEIFL"
FT   CDS             complement(686888..689005)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06480"
FT                   /product="PTS system, glucose subfamily, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79537"
FT                   /db_xref="GOA:D4J5B6"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5B6"
FT                   /protein_id="CBK79537.1"
FT                   /translation="MKKHLFSLLQRIGQSFMLPIALLPIAGIFLGIGSSLTNTNMLAAY
FT                   HLKGLMGPGTAPYILFSLLNSAGSIIFDNLPILFAVGVAIGMARSEKAIAALSSIVAFF
FT                   VMHSTIGSLITYTGRSHSFLTGATTEIVGITSLQMGVFGGIIVGLGVAALHNRFYKIEL
FT                   PRVFSFFGGTHFIPIISAITYVGIGILMFYIWPPIQILINDAGKLVLMSGYGGTFVYGL
FT                   LERALIPFGLHHVFYMPFWQTAVGGRELVNGQLIEGAQNIFFAELASPDTSHFSVAATR
FT                   FMSGKFPLMMFGLPGAALAMYTCARPENKKAVGSLLLSAAISSAVTGITEPLEFAFLFV
FT                   APPLYVIHCAFAGLSYMLMHMLNVGIGMTFSGGFLDFFLFGILQGNTKTSWLHVIPVGI
FT                   LYFIVYFIVFRVMILKFNYQTPGHEKDNAAPVNNADNKSQQILDGLGGLENISDLSCCA
FT                   TRLRVTLHRPSKLNKEKLLATGAAAVVANGDGVQVVYGPEVTIIHARLQDYIAQIIPAS
FT                   SSTADNSAAVPTTSAEVSNPAVSAEAKDSDNLSVADAITDIVYAPCNGTVIPLKEINDG
FT                   VFSEGYIGEGLAIEPVDGSFYAPFDCSVAMVFDTHHAIALHTANDTELILHVGLDTVKL
FT                   NGQHLEVFVQEGQEIQKGDLILRADLEGIQSAGCRTVTPVIITGAGGAESVELLKTGPV
FT                   HMGDAVLKVHY"
FT   CDS             689274..690254
FT                   /transl_table=11
FT                   /locus_tag="CC1_06490"
FT                   /product="Lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79538"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5B7"
FT                   /protein_id="CBK79538.1"
FT                   /translation="MMYDEKRTGGAGMVEKEEFYLNSTNGVNKLHVILWHPLEEIRAIV
FT                   QISHGMCEYVDRYDRLATFLAQHGMMVIGNDHLGHGETAKDEEELGYFPKAKGSETVVD
FT                   DLYKVTKSIRARYPRIPYFLLGHSMGSFMARRYLMTYGSQLDGAILMGTGSQPPALLSA
FT                   AKTTAHSLSVVRGEHHRSQLMMKMAFGSYNKQYPSVRTEYDWLSRNEANVDTYLEDPYC
FT                   GFMFTLNGYKVLFDVLSFIQEPAHISKLPKEVPLLFVAGSDDPVGHFGKDVPEICRTYR
FT                   EAGVKNVEMKLYPGDRHEILNELDYEQVQMDILSFIEKRLEALKA"
FT   CDS             690269..690925
FT                   /transl_table=11
FT                   /locus_tag="CC1_06500"
FT                   /product="Chloramphenicol O-acetyltransferase"
FT                   /EC_number="2.3.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79539"
FT                   /db_xref="GOA:D4J5B8"
FT                   /db_xref="InterPro:IPR001707"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5B8"
FT                   /protein_id="CBK79539.1"
FT                   /translation="MTFERIDMEQWPRREHYRYYNEQIRTSYEMNVELDVTKLRKRCRK
FT                   KGIHFYPAMMYAIMYSINHHENFRMALDEEGHLGVYDICHPSYTIFHKDDETFSDIWTE
FT                   WNEDFSIFYKDVCRDMKQYKDSKGIKAKPDRPDAFTPVSCVPWVSFTSVGHDTPGPRQM
FT                   YFPIIVFGRYHEVHDRWMLPFSIMVNHAVADGYHTSMLIHDIQEQCSHCRKWLKK"
FT   CDS             691184..692974
FT                   /transl_table=11
FT                   /locus_tag="CC1_06510"
FT                   /product="Na/Pi-cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79540"
FT                   /db_xref="GOA:D4J5B9"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5B9"
FT                   /protein_id="CBK79540.1"
FT                   /translation="MSVFDILTMIGGLALFLYGMEVMGNGLSKASGGRMERILEKMTDN
FT                   IFKAVLLGAGVTAVIQSSSATTVMVVGFVNSGIMKLSQAVGVIMGANIGTTVTSWLLSL
FT                   TGIQGDNFILTLMKPSSFSPILAVIGVGFLMFSKNEKKKDIGTIMIGFTVLMFGMETMS
FT                   DAVKPLADVPEFANILLMFKNPLLGMLAGLVLTAVIQSSSASVGILQSLCVTGAVSYGA
FT                   AIPIIMGQNIGTCVTALLSSIGASKNAKRTAFVHLYFNIIGTTIFMIGFYALNAFVHFS
FT                   FIDNMANPAGIAVIHSVFNIFATAILLPFHRGLEKLAILTVRTSDEDEKQSVQPAEEGQ
FT                   DMLLLLDDRFIEKPGFAMENCYSVTSHMAELSRQALFIAMELLQKYDETKAENVLKLEN
FT                   KVDHYEDRLGTYLIRLSSRDLSEKDSKSLSMLLHCIGDLERISDHAVNIMEKAQEMNEK
FT                   NLSFSDKGAQELEVYSRAVRDIMNMSIEAFKNDDIHLARQVEPLEEVIDYLNDELKQRH
FT                   VRRLRSGECSVELGFVLSDITINYERVADHCSNLAVDLLRIHENVFDVHEYLEGLKENK
FT                   DAAFREAYQKDKAVYALPQS"
FT   CDS             692986..693669
FT                   /transl_table=11
FT                   /locus_tag="CC1_06520"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79541"
FT                   /db_xref="GOA:D4J5C0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5C0"
FT                   /protein_id="CBK79541.1"
FT                   /translation="MATIYILEDDLNIQEIEAYALKNSGYQTEGFDNAREFFKKVSERV
FT                   PSLLLLDIMLPDADGLDVLRKLRSMPETKKLPIILVTAKTSEIDKVKGLDVGADDYITK
FT                   PFGIMELISRVKALLRRSAYVEEKKFLTLGNVFMDDEKHAVYVSDQVCELTYKEYELLK
FT                   LLMSNAGIVTARDTIMERIWGIDFEGESRTLDMHIKTLRKKLGEAGSMIKTVRNVGYIM
FT                   SDKEN"
FT   CDS             693676..695016
FT                   /transl_table=11
FT                   /locus_tag="CC1_06530"
FT                   /product="Signal transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79542"
FT                   /db_xref="GOA:D4J5C1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5C1"
FT                   /protein_id="CBK79542.1"
FT                   /translation="MRGKKMKHKIYLQFCLIAALAILITTTIVTALFYQRFKAQVFSDV
FT                   RTYAYVLTSVDTYDEATLIQEVHQLDNLRVTIIDKEGKVLLDTNADIGGMENHSNREEI
FT                   KAAFETGEGQAVRQSKTVAKSTFYYAVRMNDGNVLRVATETGSVLSIVQGMLPIIAVMV
FT                   VILFVICTFLGRLLTDSLLRPIEQMAENMDYVNEIAVYQEMEPFIDTIRRQHEDILKNA
FT                   SMRQDFTANVSHELKTPLAAISGYSELIENGMVSEKDIARFGGEIHKSADRLLTLINDT
FT                   IRLSELDATTQDVVLETVDLYQAAENCMDTLEMSAKKHDVTLKLEGESCKIRTEKGMAD
FT                   EVIYNLCDNAIRYNNKGGSVTISVMPVDNQIVLSVKDTGIGISKEHQERIFERFYRVDK
FT                   SRSKSTGGTGLGLAIVKHIVARNGARMELTSEVGKGTEIRIYFDKAA"
FT   CDS             695164..696612
FT                   /transl_table=11
FT                   /locus_tag="CC1_06540"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79543"
FT                   /db_xref="GOA:D4J5C2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5C2"
FT                   /protein_id="CBK79543.1"
FT                   /translation="MAKKKSVKKGLIIGISSVVVLLAAAYAGVGYYFHDHFYPGTVINE
FT                   TNFSLGTVEAAEAKIKEEAEDYLLAVHDREDRVSYISGSDIDYHYESDGSIQKMMDEQN
FT                   SMLWPLHIGKEHSHTVEVKMTYDESKLVTLVEAMDCFKEENIVKPEDAYLKYTENGYEI
FT                   VPEKQGSQPLEEQIMLDVKAAIDSRQSVLQLSDNDYVQPSVTSDDPKLQEKLQVTEKYK
FT                   NMSITYEIEGSEQVLDGTTILSWLTINDDLSVTVDSDMAASYAQQLASKYNTYAATRSF
FT                   ETTAGDTVKIGGGDYGWVINKKGEAAQIVEDIKNGESVTREPKYEQRAFVEGADDIGNT
FT                   YIEIDYTNQHLWYYKDGSLVVDSDLVSGNLNNGNGSPDGVFKVISRQSPATLKGEDYES
FT                   DVTYFMPFAYNVGLHDASWRSSFGGSIYKNGGSHGCINLPYDAADTIYKNVELGTPVVA
FT                   YYREDVKLTSNNAKVSNAYSYSSK"
FT   CDS             696628..697224
FT                   /transl_table=11
FT                   /locus_tag="CC1_06550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79544"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5C3"
FT                   /protein_id="CBK79544.1"
FT                   /translation="MYFLIGLGIIVIIVYGNMLYDRIKTKKNKDTTDVEKSAGTADNHF
FT                   AEQKETKGQKTEINRQASDQDQSGSMVKTAANIAFSGPTLTQMIADDLKQKKHIFGLPL
FT                   TLCEEMGDGQLIALDREDNIYVIETVQRADYEELYLQVLDDMAAQRKRIQKNAADRKVY
FT                   AVVCVTTLPETLKLAAEKDNAIRIFSYELNFRNVM"
FT   CDS             697384..698088
FT                   /transl_table=11
FT                   /locus_tag="CC1_06560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79545"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5C4"
FT                   /protein_id="CBK79545.1"
FT                   /translation="MKKWMLLLSLVLMIVIVNCGQAQAAEKTATKDITFEELNDENVFI
FT                   KQSRRGTCTLASSAMIMRRAAMLAGFENWEDITESSVGSVAWREGVGISWTFTYDGVTM
FT                   THDYVSSVEDLKKLLEEHPEGIVAYDSNKPHAIALTDYDAETDTFYCSDPAECCAKARV
FT                   PVSEAIISLENVDVVWYVTSPSNLSAPVMAAAEANEAEENTEAQSVIPEIETAPVTSLD
FT                   NLSHTELKLEMN"
FT   CDS             698089..698682
FT                   /transl_table=11
FT                   /locus_tag="CC1_06570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79546"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5C5"
FT                   /protein_id="CBK79546.1"
FT                   /translation="MIKMILAIGHINYDKFLNNMLEMAKQHPEQMGGMKLPPFTAQMIK
FT                   MLPARKKNEMVAQALNSSKGKVEPQIEQLLAPITGPIQLKNFDIQCGSKRDADEVTLTV
FT                   EFAGYDCGYVADHILPFYYMEATAPAFLGPEYNGPTDLASVQAYIKAQDHKKAQFLIAK
FT                   SMSVNKAYIMNLLQDKAKLAEIELQVNNLRLMIK"
FT   CDS             complement(698736..698996)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79547"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5C6"
FT                   /protein_id="CBK79547.1"
FT                   /translation="MDLMKDIYKKELRTRIAAWEGKKTDDFQYEPERAELKAQMKDWLA
FT                   EKLGVDDEKKLLIANRKYFATCMAELVYEETVRPNMKDFIH"
FT   CDS             699223..700005
FT                   /transl_table=11
FT                   /locus_tag="CC1_06590"
FT                   /product="Predicted hydrolase of the alpha/beta
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79548"
FT                   /db_xref="GOA:D4J5C7"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5C7"
FT                   /protein_id="CBK79548.1"
FT                   /translation="MVIKEMVHITPYHLDRMLHIYLPDDYEESEARYPVMYMYDGHNLF
FT                   YNEDATYGKSWGLQEFMRQWENQLIIVGIECNHEGNKRLEEFSPYDFKDFDGQRIHGTG
FT                   KVFMQWVVDELKPLIDTHFRTKPEREYTGIGGSSMGGLMAYYTVVAHNDVFSKAACISS
FT                   AVGFCYDAMREELTSAGPLLPDTRVYMSWGSKESGRKPGLVKYTCTNLEFSHLLVERGA
FT                   VTYPYLQAFGGHCEADWEKQNAIYMPFLWNGVFEDGME"
FT   CDS             700009..700938
FT                   /transl_table=11
FT                   /locus_tag="CC1_06600"
FT                   /product="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79549"
FT                   /db_xref="GOA:D4J5C8"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5C8"
FT                   /protein_id="CBK79549.1"
FT                   /translation="MSAIFAVAGKLVTLFIYVLVGYVVSKRKMISEGFSAGISRFLLVV
FT                   TIPCLILSTFETDYTFERLVKAGEVYVISLIIFGASILIGYLTAWIFRISEESKSVWIY
FT                   SVTFTNHAFMGWAVMDAVFGGESIFYATFANLAFSTYAYTYGVWLMRSTGTEAGKKHSM
FT                   KEYILTPVNAAIVVGLIMFIFQLRFPAPVDNAVQGMSSLTTPMAMLYVGTILTKSSIKD
FT                   VFSDWRTYACSFVRLVLIPLLVLMIARPLIHDPMIYGVLVIGHAMPVAGFCAIFAGEYG
FT                   NDVVLASKFIFITTLLCIITIPIFVMLL"
FT   CDS             complement(701096..701680)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06610"
FT                   /product="intracellular protease, PfpI family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79550"
FT                   /db_xref="GOA:D4J5C9"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5C9"
FT                   /protein_id="CBK79550.1"
FT                   /translation="MAKKILMLCGDFTEDYETMVPFQALSMLGYQVDAVCPDKKAGDVV
FT                   KTAVHDFLGDQTYTEKPGHNFALTADFDTVNTADYVGLFITGGRAPEYIRLNPRVIEIV
FT                   QEFFAAKKPVASICHGPQILTAAGVLKGVKATAYPAVGPDITLAGGTYVEVPADQAVVD
FT                   EAAQLVTAPAWPGDTAILAEFVKLLGAKIEI"
FT   CDS             complement(701893..702924)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79551"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5D0"
FT                   /protein_id="CBK79551.1"
FT                   /translation="MNTAIVNAITAAGSKAQYDACAKRLIGQKIILSHILVRTVEEFKG
FT                   MKPEEVVLLIEGDPQIGTVPVSPGMTNRQNNNNSNTDVNQNITDAIDASDISRPTNTRV
FT                   GGLNTEDSEINEGTIRFDIIFYVRMKDGLAQMIINIEIQKDQPKDYHLLNRSIYYVSRM
FT                   ISSQKDRDFEHSNYDDLKHVFSIWICLNMDENSLTRYYLSSENILGNPQWKGKQDLLNI
FT                   VLIGITREIPKQDEKYELHRLLGTLLSDKLAINTKFEIMKSEYHIPLNDDFRRDVNIMC
FT                   NLGEGIEERAIRETTERVTNEMTQQFIISMYKKGYSLEQISDIIDKSTSEIEEIVNTAV
FT                   LSV"
FT   CDS             complement(703429..704658)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06630"
FT                   /product="Major Facilitator Superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79552"
FT                   /db_xref="GOA:D4J5D1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5D1"
FT                   /protein_id="CBK79552.1"
FT                   /translation="MSHTKNFSLLVLGQIISLFGNAILRFALPLCLLRETNSAIIYSSI
FT                   TSFAMLPLLIGYLIGGSFADRYPKAKIMTFLDLLTAIVCAAASFFANQAPMIPFILLVL
FT                   GFLYAIQGLYQPAVQASLSLLLKKEKLMIGNAIIQCVDTVDEFLGPAIGSLLMLTLSLN
FT                   QLLFSCACCFLFSSFIEKLLDFHDIPLSYEHNSAALIIKDLKNTFFYITKGSQQLLPLS
FT                   SLLALLNLCVIPALTIGIPILIIQYLHMSNGSLGLTQSLMSVGGFVGCTLAGIFSKKMQ
FT                   LHHGLYPLFGISILCFAFSIATLPVFTSSLIYYGITILAFCMMTLASYFNIWFFSYIQI
FT                   KAPASQIGKVISLLTVLVCLTQPVGRIIYGLLYEILSNHPWIVLFFAGILSVGINILAF
FT                   FIFVSHRHQP"
FT   CDS             complement(704743..705393)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06640"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79553"
FT                   /db_xref="GOA:D4J5D2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5D2"
FT                   /protein_id="CBK79553.1"
FT                   /translation="MPRNKYPEQTVEKILDAATILFLQKGYQHTTLQDIIDETHLSKGA
FT                   VYHHFKSKEEIAFRVGDRLGAKMLPIFANIRDDSSLTGGEKLKKIFSASLEPKRQHEMM
FT                   TILPYLSTDSYFMDMEQKDLLEKIVPSYVTPIIRQGVQDGSIKTSAPEALGEAIFLLAD
FT                   TWLHPLIRKTTAKEQTMRNQVFQQLTANIGVELLDKEQAALLVQMAEHAQSKE"
FT   CDS             705392..705514
FT                   /transl_table=11
FT                   /locus_tag="CC1_06650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79554"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5D3"
FT                   /protein_id="CBK79554.1"
FT                   /translation="MDSSFTNQWSVKRIAYTGGKVKEKKMKRELKKRDEIKTLK"
FT   CDS             705742..706224
FT                   /transl_table=11
FT                   /locus_tag="CC1_06660"
FT                   /product="Cytosine/adenosine deaminases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79555"
FT                   /db_xref="GOA:D4J5D4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5D4"
FT                   /protein_id="CBK79555.1"
FT                   /translation="MTEDEKFMKAALAQAKKAAAIDEVPIGCVIVYEGKIIARGYNKRN
FT                   KEKNTLSHAEMNAIRKASKYLGDWRLEGCTMYITLEPCPMCAGAIVQARVDRVVIGSMN
FT                   AKAGCAGSVLNVLQERRFNHQVELTKDVLHEECSSMLSGFFRELRERRKKEKEKCI"
FT   CDS             706215..707057
FT                   /transl_table=11
FT                   /locus_tag="CC1_06670"
FT                   /product="histidinol phosphate phosphatase HisJ family"
FT                   /EC_number="3.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79556"
FT                   /db_xref="GOA:D4J5D5"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5D5"
FT                   /protein_id="CBK79556.1"
FT                   /translation="MYLADYHMHSKYSFDGSEELDTICQTAIRRGLSEIAITDHMDIYT
FT                   GLPYDEQMNFEVPGGEQYHMDVSGLYAGLVQMKEKYAGQLKVRIGAELGQPQVNPEAAA
FT                   LFIRDYGDVLDFVIGSIHNMEKDLDVYYYDFTKIDVAKMYDHYVDWLLKLSEMGDFDVM
FT                   GHLTYPLRYMFERNQLRLDLRPYEEKFRQLFKNLTEKGRGIELNVSGYYKAMQDAMPPM
FT                   SILKLYRECGGEIITIGSDAHKAEYIGFYQKEAHEMLETAGFRYLTIFEHRKPEFIKL"
FT   CDS             707278..708501
FT                   /transl_table=11
FT                   /locus_tag="CC1_06680"
FT                   /product="LL-diaminopimelate aminotransferase apoenzyme"
FT                   /function="LL-diaminopimelate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.83"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79557"
FT                   /db_xref="GOA:D4J5D6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5D6"
FT                   /protein_id="CBK79557.1"
FT                   /translation="MFKINDNYLKLPGSYLFSTIAKKVAAYKEANPEKKDQIISLGIGD
FT                   VTLPLAPVVIARLHSAVDEMAVKETFKGYAPDLGYEFLRSAIAQHDYKARGVDIAIDEI
FT                   FISDGAKSDSGNIGDIFSVDNRIAVCDPVYPVYVDTNVMAGRAGDYNPATERFSNVIYM
FT                   PCTEENGFAPELPEETPDIIYLCFPNNPTGATIPKTELQKWVDYALEKGAVIIYDAAYE
FT                   AYISEDNVAHTIYECDGADRCAIELRSFSKNAGFTGTRLGFTVIPKALKCGDVTLNSLW
FT                   ARRHGTKFNGAPYIIQQAGAAVYTPEGQAQTQEQIAYYMNNAKIIREGLASAGFSASGG
FT                   VNAPYIWLKTPDKMTSWEFFDYLLDKANVVGTPGSGFGPSGEGYFRLTSFGSYENTLEA
FT                   VERIKKLK"
FT   CDS             708604..708696
FT                   /transl_table=11
FT                   /locus_tag="CC1_06690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79558"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5D7"
FT                   /protein_id="CBK79558.1"
FT                   /translation="MISEPLWFLMKMKMPAVSSEELSMPECKGE"
FT   CDS             708700..709479
FT                   /transl_table=11
FT                   /locus_tag="CC1_06700"
FT                   /product="Archaeal fructose-1,6-bisphosphatase and related
FT                   enzymes of inositol monophosphatase family"
FT                   /EC_number="3.1.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79559"
FT                   /db_xref="GOA:D4J5D8"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5D8"
FT                   /protein_id="CBK79559.1"
FT                   /translation="MLDEIVTVVKKCGDIILFADGAERNVSSKEGRANFVTKYDVAVQA
FT                   YLEEELLKILPEAVFIGEEGEHSKAIGEGYAFIVDPIDGTTNFIKNYHRSCVSVGLALH
FT                   GTMEIGVVYNPYSNEMFYAQRGKGAFLNGQPLHVSSNRLEEGLVCFGTSPYYAELIDQT
FT                   FDLVKTLHRASLDVRRSGSAALDLCDIASGRCELFFECRLSPWDYAAGSLIVQEAGGRI
FT                   SRMNGTEISLDKGCSVLAGGPAAWKDYFKMEGHMELA"
FT   CDS             709581..710429
FT                   /transl_table=11
FT                   /locus_tag="CC1_06710"
FT                   /product="EDD domain protein, DegV family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79560"
FT                   /db_xref="GOA:D4J5D9"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5D9"
FT                   /protein_id="CBK79560.1"
FT                   /translation="MSKVKIMSDSTCDLSAELLAQFDVAVLPHPIVRDGELLQDNVTIT
FT                   PDDIYRHYEQTGRLCTTSAPNAYDYEMCWKPWLDEGYEIVHFTISSEMSTAYNQAMLAA
FT                   EETGHVYPVDSRTLSTGIGLLVLEACDLREQGLSAEKIAAKVREDADKCQASFLVDVIE
FT                   YLWKGGRCSSVAAIGANILKLKPRIDVLNGNMLSTKKYRGRTAKCFAAYADDMLKGKDN
FT                   IRQNRIFITHSGIDPDIIELMKEKIHEWQPDIENIYVTRAGGTISCHCGPGTLGILYMY
FT                   E"
FT   CDS             710422..710490
FT                   /transl_table=11
FT                   /locus_tag="CC1_06720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79561"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5E0"
FT                   /protein_id="CBK79561.1"
FT                   /translation="MNKNQTEDMNAAIDCIYIFGFL"
FT   gap             710739..711787
FT                   /estimated_length=1049
FT   repeat_region   711854..712149
FT                   /rpt_family="CRISPR"
FT   CDS             712372..712506
FT                   /transl_table=11
FT                   /locus_tag="CC1_06730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79562"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5E1"
FT                   /protein_id="CBK79562.1"
FT                   /translation="MEVMLSKRNQREAFNHFSMKRMGVALMVCRFLSWRINGRLIMSR"
FT   CDS             713435..713602
FT                   /transl_table=11
FT                   /locus_tag="CC1_06750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79563"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5E2"
FT                   /protein_id="CBK79563.1"
FT                   /translation="MFALNCTELPGAAIDACGAGISLRGISVAAGMTEVKPIMHSALTV
FT                   EKSAYNGSSR"
FT   CDS             715483..715566
FT                   /transl_table=11
FT                   /locus_tag="CC1_06780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79564"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5E3"
FT                   /protein_id="CBK79564.1"
FT                   /translation="MVNNKRNFQYAFYVDGQSGNKGGDNEK"
FT   CDS             715556..716119
FT                   /transl_table=11
FT                   /locus_tag="CC1_06790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79565"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5E4"
FT                   /protein_id="CBK79565.1"
FT                   /translation="MKNDMKRIILILAFILCFGISACGRGSSDGYDAEDSEDHRGSGEN
FT                   ESVVYGSTDDGQDKESVEIDKDNPAKQLGYSSIEELRVQEHEIIASDDSDNTVAEGYWY
FT                   PDGNRNSLTYIKIQRDTLYWYEFNPEQGDVQVGEADGIVFKLGSKRRLKSGKTLTYTDT
FT                   SKLNFEDCKICFEGDATEYYWRER"
FT   CDS             716311..717555
FT                   /transl_table=11
FT                   /locus_tag="CC1_06800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79566"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5E5"
FT                   /protein_id="CBK79566.1"
FT                   /translation="MKKWKKYGAFMFAMVMCLSLAACGSSDSIAASSEETGNAEGDSEE
FT                   LVTDAASLEGMWSINGGTKLYFDSGGGYYIYRSYYGVGGRGEMSESPEDGKPMMTFNGF
FT                   MYDFVLRSDGVLMPNQNGDGDGLNIHRNTFKRDDTAKLAEWEANNWDGMWQNAVGETIV
FT                   IDTANMIYTASSPDYSMDGTLGDDGEGMGLYLYDNEDRAYLCASEDGNSFTLSGQYPDR
FT                   YSDDGHFDGVFYRDGDIAAYTDLEKAKFYYGNGSDTWLWYNDGVNEYFLGDEYKIGDDG
FT                   LAYYEADNKVYPGGWIPDEPYDPSVDWGENAQEETSINLENDFSHFEGIWYYDGDLSAE
FT                   TYIVMDASGNWSYYQRAPGAEPAEMDCGTLTQDADAADIYYAESTMYDGVSHQVFVGDG
FT                   DVFLWDEEGNYYLME"
FT   CDS             717612..717809
FT                   /transl_table=11
FT                   /locus_tag="CC1_06810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79567"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5E6"
FT                   /protein_id="CBK79567.1"
FT                   /translation="MTFGMAAVLLILIIAGIILAVRGLQQRKILCIIIIVLLSVFGLAL
FT                   AVYMGLTMLFVDAVRSQPPV"
FT   CDS             718017..718460
FT                   /transl_table=11
FT                   /locus_tag="CC1_06820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79568"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5E7"
FT                   /protein_id="CBK79568.1"
FT                   /translation="MNSDANPFHIIFLCYSKILPVVLGETRCNSADGWAWEHMQGKTMF
FT                   RLSNLFVRMFNSAVRMIRVTFGKPYCDKLEKPFKDDKTGQLYEKLGEVILTSLYEQSNT
FT                   KNWVARLNKKIMAKVVCEIMDAADSDEDAKRVATEAIAYTIGR"
FT   CDS             718472..718726
FT                   /transl_table=11
FT                   /locus_tag="CC1_06830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79569"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5E8"
FT                   /protein_id="CBK79569.1"
FT                   /translation="MLDQQVLEDIYTIAEKVGTHQMLTEQEQAMYDDILEDAGYYQVFC
FT                   LYTAMIDFPTFYEQSVSGEKQKAKEWQSEKIREIEKHKN"
FT   gap             718776..719141
FT                   /estimated_length=366
FT   misc_RNA        719378..719480
FT                   /locus_tag="CC1_35090"
FT                   /product="Bacterial signal recognition particle RNA"
FT   CDS             719756..719839
FT                   /transl_table=11
FT                   /locus_tag="CC1_06840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79570"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5E9"
FT                   /protein_id="CBK79570.1"
FT                   /translation="MNLTNRMISKEWNVFELNEMKVRWPCE"
FT   CDS             720368..721624
FT                   /transl_table=11
FT                   /locus_tag="CC1_06860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79571"
FT                   /db_xref="InterPro:IPR025645"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5F0"
FT                   /protein_id="CBK79571.1"
FT                   /translation="MTEKEVEMAYKKMTESDAPDLWARVESNLPEKEIQPEMKVKKGFF
FT                   AKIGQVFSGGSTWKTSIALCAVCIIVYGAAQGAGGMFRAGASNGTASAASKSSYGMDAY
FT                   SVDGAEAYSAEGDGAEAAPADYNGMNYAAAAAGTGADADSSGGAVVLSENEASAAVGTE
FT                   AAEASADEAGTAENGKETANSADTENGQSSRKLIRTFNLDAETTDFDNLVTQLQQETQN
FT                   LGGYVESSYVNGNSYYTENSRYASLTLRIPKDKTNDFLGTVGEMANVTSKSENVEDVTL
FT                   TYTDLKSHVEALQAEQEQLMKLMEQAKTVEDTMSIQSRLTDVRYELESYMSQLKVYDNQ
FT                   VDYDTVNISIQEVKNETPTGELSIGQKMLNGLENSLRAIAESAKNLCIWFVASIPYFVI
FT                   LFAVIFAVVSIIKKIRKKK"
FT   gap             721899..722352
FT                   /estimated_length=454
FT   CDS             722817..724073
FT                   /transl_table=11
FT                   /locus_tag="CC1_06880"
FT                   /product="Bacterial capsule synthesis protein PGA_cap."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79572"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5F1"
FT                   /protein_id="CBK79572.1"
FT                   /translation="MSVDWNKQVGVLLTDCFGLIVDEENRQRYMKLKKNTTIAFTGDIG
FT                   FDKYMEKKWEDEALLAPEITEFLTSADHVVANVEGPLVDNTATLTQAAEMRLMHTIHPD
FT                   AEKVLRDIHADIWNLCNNHIMDAGQDGLALTLQEAKKFGAKTIGVGMNMTEAARPLILD
FT                   EAGGIGLFAVGYQRGCKPAGEDKGGCLSWSEMEIIRSIIQEIKTKCRWCVVVAHGGEEF
FT                   TAIPSPYTRERYHAYLEMGADLVVCHHPHVPMNYETVGDKMIFYSLGNFIFDTDYQRAQ
FT                   FNTEKGILLKLHFTEDSYSFEAFGLKINRENEHIESAPLPRIFADIQENDYNKLEPLAA
FT                   KMFLAATKRQQLFLYPDKFKDATEEQWKAHFYEEKRSGRVPGEALDFQIIYPIAQEEAK
FT                   GAWKTCKLEYVKAYILEQM"
FT   tRNA            724172..724247
FT                   /locus_tag="CC1_T_34530"
FT   CDS             724636..725979
FT                   /transl_table=11
FT                   /locus_tag="CC1_06890"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79573"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5F2"
FT                   /protein_id="CBK79573.1"
FT                   /translation="MERFILKELLEWKNSPYRKPLILKGVRQVGKTWILKEFGRCYYEN
FT                   TAYFNFDENEEYKQFFETTKDVSRILQNLMLASGQKIVPEKTLIIFDEVQDCPKVINSM
FT                   KYFCENAPQYHIACAGSLLGIALAKPSSFPVGKVNFMQINPMTFSEFLIANGDENLAVY
FT                   LESVDAIEPIPDAFFNPLYEKLKMYYITGGMPESVLMWTEARDVSAMQEALSNIISAYE
FT                   RDFAKHPDIKEFPKISMIWKSIPSQLARENKKFLYKVVKEGARAREYEDALQWLVDARL
FT                   VHKIYRSSAPGLPVAAYDDLSAFKIYLVDVGLLRRLAKLAPTAFGDGNRLFTEFKGALT
FT                   ENFVLQTLITQFEVTPRYWSQSNPPYEVDFLIQRENDIFPVEVKSEANISSKSLKKFKE
FT                   IFPDKVKLRVRFSLDNLKLDDDMLNIPLFMADQTDRLIGLALEQKVAN"
FT   CDS             726027..726515
FT                   /transl_table=11
FT                   /locus_tag="CC1_06900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79574"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5F3"
FT                   /protein_id="CBK79574.1"
FT                   /translation="MYWTIQFNVFRLLLFYLCRKSERSLFIPDIKHTSVWHFDAGIGNE
FT                   PFSIRVVSAVGRVICDDKSMLGGMVAKTDVFYGNLEETTGLVHKTELPQYFGDDSIGIY
FT                   VSADDVYSGEMLYTAKNLFEEDSNTIWIASLDNHMYHDLSSNTIENTMIPQDYTGIIR"
FT   CDS             726546..726758
FT                   /transl_table=11
FT                   /locus_tag="CC1_06910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79575"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5F4"
FT                   /protein_id="CBK79575.1"
FT                   /translation="MHRRFQGEEIPRASIYAYAESEHHPSLIVREGELQRACELERIAR
FT                   RAIDANPNSRFGSVEEIYDEIVKAE"
FT   CDS             726912..727442
FT                   /transl_table=11
FT                   /locus_tag="CC1_06920"
FT                   /product="thiW protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79576"
FT                   /db_xref="InterPro:IPR012652"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5F5"
FT                   /protein_id="CBK79576.1"
FT                   /translation="MCTKERKSVMNIKKLTLTAFFVAIAVAGSLFSFPVLGSRCSPIQH
FT                   LVNVMCAILLGPWYGLAAAFLAALIRNILGLGTLLAFPGSMCGALLSGLLYKWMKKLPA
FT                   AYIGEVVGTGIIGGMLSYPIAAVLMGNQTAALFTFVVPFLISTVGGTIMAIVITMTMKK
FT                   TKVLAKFQQQINS"
FT   CDS             complement(727439..728311)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06930"
FT                   /product="conserved repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79577"
FT                   /db_xref="GOA:D4J5F6"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5F6"
FT                   /protein_id="CBK79577.1"
FT                   /translation="MPTFSNQAQLSYNGITANSNIAYGQILEVLAASKTALSDTYASGD
FT                   RITYIFSIVNSGTTAFSDLTVTDNLGAYSFTTDTPETITLYPLTYIPNSMQLLINGTLQ
FT                   PAPTVTAADGITITGVSIPSGGNAAFIYQADINDYAPLAAADNVINTVRVTGAQLAAPL
FT                   TATHTISTATVPNLSIVKGICPAQVAENGRITYTFGIQNYGNTATTDDDLVQITDTFTP
FT                   ILSDISVTYNGTVLPPSNYSYNQATGVFSTNAGVINIPAATYVQNQTTGAYALTPGTAT
FT                   VTVTGNISG"
FT   CDS             complement(728437..729795)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06940"
FT                   /product="C_GCAxxG_C_C family probable redox protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79578"
FT                   /db_xref="GOA:D4J5F7"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5F7"
FT                   /protein_id="CBK79578.1"
FT                   /translation="MLREIANDFYMNQNYNCGECILRAANKAYDLGLDERGLKLASGFG
FT                   AGMGCGNTCGALSAAMSVLSLLFCGDKAHETEGFKELCAAYVETFKTALGSDNCEELKK
FT                   RYRYPEEDERRCLITVEKAADVLEAFVASHQSEPASDAPSEAPVSADEIKRLKGLGFLN
FT                   NKGTNRFNARVVTGNGRITTAQAKCIADAAALYGSGQITMTTRLSQEVIGVEYDKIPDF
FT                   IAYLAKEGLETGGTGAKIRPVVSCKGTTCQYGLIDTYALSEKIHHLFYKGYRGLTLPHK
FT                   FKIAVGGCPNNCVKPSLNDFGIYGQRVPQPNTELCKGCKKCQLEAACPISLPKVVDGKV
FT                   FIDPDKCNRCGRCLHKCPFHVNEDYIAGYSIVIGGRWGKKVAMGKRIPKIFTTEEEVLA
FT                   TLEKTILFFAEQGQKGERLSDTIHRIGFEKVTKELLSDDILSRKDAIVGDALK"
FT   CDS             729968..730441
FT                   /transl_table=11
FT                   /locus_tag="CC1_06950"
FT                   /product="Predicted flavin-nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79579"
FT                   /db_xref="GOA:D4J5F8"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5F8"
FT                   /protein_id="CBK79579.1"
FT                   /translation="MRRADREVTDVNEIIDIIDHCKVCHIAMMDGEWPYIVAMNFAYRY
FT                   ENDQLVIYLHSAKEGKKLDLLRKDDHVCFEMDYDHEMIPAKYACAYNFRYASVVGRGHC
FT                   EIITDVDEKIKALELLMKHQTGEDFVMEAKHTLAVEILKITVEEFTGKRRFKK"
FT   CDS             730448..732496
FT                   /transl_table=11
FT                   /locus_tag="CC1_06960"
FT                   /product="Anaerobic dehydrogenases, typically
FT                   selenocysteine-containing"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79580"
FT                   /db_xref="GOA:D4J5F9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5F9"
FT                   /protein_id="CBK79580.1"
FT                   /translation="MIKDGYKMATTIHKMSCPYDCPSTCGLEAEIEDGRLIKVKNDKTH
FT                   PVSKNGICRKMQHYEQDIYSADRLRTPLRRVGRKGEAKFEPISWDEAVREITDQFKAII
FT                   EKWGAEAILPCVYSGVMSDIQRNCGDAFFNRMGASELVKTLCSSAKGAGYDAVVGKTGC
FT                   LEPTELNDSDLYLIWSCNMAATRLQTLADLQKPANRHKKKILIDVYPNPTAAYCDQVIT
FT                   IKAGTDGALALSMMHVLKNEHLVDKSFVEKYTSGYPAFAETLDVYTPEWAESETGIPAE
FT                   VIRQLAREFGQAKAPAIILGSGNSRHGNGGMTVRLITILSALTGAWQHPGGGLCGCTPI
FT                   DTDYVNKSLITRPDFRKKPARKININQIGQALAMEGKEAVRGFYVYGCNPANTVSDQQL
FT                   IIRGLEREDLFTVVHERFMTDTARYADIVLPATFSVEQTDIYRAYGYCTLSTGRKLVDA
FT                   PGECRSNWDTFCLLAKGMGYADDYFDRSENEMLDILLSHPTRAIAETSDEAKETLRQGG
FT                   SIALPFSDHLAFGTETGKMLIVNEKLAEPMPHYTAGYSGKCQDYPLHLVAAPSVWSLNS
FT                   TFLDREHLMASRKEMTLWLNPEDAGTRQITDGMPVMAFNELGEVQFTARVDDRVAAGNA
FT                   VSEGIFAGHQTQNGSGFNTLTHGRLSDIGAATTMNDNRVDVRPLQRV"
FT   CDS             complement(732645..732896)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06970"
FT                   /product="Coat F domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79581"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5G0"
FT                   /protein_id="CBK79581.1"
FT                   /translation="MIDEKTMVADTLAGINGELTRFGEMIPQTENKQLKQTLKQLRNAC
FT                   ETSQEEIYQLARAHQYYVPAEKASTQEIQHVKNILTQG"
FT   CDS             complement(732912..733097)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79582"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5G1"
FT                   /protein_id="CBK79582.1"
FT                   /translation="MDELSVLDLQNLRHLIGGYETSHKKMMEYASGASDPQIKQFFQKS
FT                   AQSAMQNKQQLMQFFH"
FT   CDS             complement(733265..734215)
FT                   /transl_table=11
FT                   /locus_tag="CC1_06990"
FT                   /product="Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_06990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79583"
FT                   /db_xref="GOA:D4J5G2"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5G2"
FT                   /protein_id="CBK79583.1"
FT                   /translation="MSNFMFSLNATLPVFLVIVLGWFLMQKKMFNENFVDIINKFVFKV
FT                   SLPVLLFKDIATTPIRDAFDPKFVIFCMVGTTIMFMGIWALTSIFMKDKSMVGAFTQAS
FT                   ARGSAAVLGIAFVQNIYGNSGMTPLMIVSAVPLYNIYSVIILTFCANNQDHSDKSATIK
FT                   RAFKNILTNPIILGIAAGVPFSLLNIELPPLVLKTVTNVAQTATPMALLAVGAGFEGRK
FT                   AIKKLKPTMIATFIKLVALPAIYFPFAIAMGFRESALVAILIMVGSPTTVTCYIMAKNM
FT                   GNDGVLSSSIIVMATLLSSVTLTFWIFLLKSMGLI"
FT   CDS             734350..734919
FT                   /transl_table=11
FT                   /locus_tag="CC1_07000"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79584"
FT                   /db_xref="GOA:D4J5G3"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5G3"
FT                   /protein_id="CBK79584.1"
FT                   /translation="MAIKIFIDQGHNPSGPNTGAEGFGLKEQDITYQVGKDLAALLRAD
FT                   ERFEVRLSRNTPEERLGTSNATSLAARVRAANAWPADYFVSIHANANTDPAINGTEVYV
FT                   YRKYTQSYYLAQHILNAVVNIVGTKDNGVRANPSLYVLRRTNMPAVLVELAYLTNAGDA
FT                   EKLETMQPEFARGIYEGMLSYFGMDQ"
FT   CDS             735097..736074
FT                   /transl_table=11
FT                   /locus_tag="CC1_07010"
FT                   /product="Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79585"
FT                   /db_xref="GOA:D4J5G4"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5G4"
FT                   /protein_id="CBK79585.1"
FT                   /translation="MRYKKFGKTGLEVSEICLGTWGIGGAGWDAHSDEERMDAIKAALD
FT                   CGINFIDTAPAYNAGRAEQYIGETLHCLGARKHVILTTKCGNKYVDGKYIRCGSEALIR
FT                   RQCEESLRNLQTDYIDLYLVHWPDPNVSMEETIGAVAQLKKEGKILHAGVSNFTKEQIE
FT                   EAGKYCEIEAYQPQYSMLDGDNEAVIRWAAAQGMGIMSYGTLGGGILTGTYREVRTFGE
FT                   TDNRNRFYPYFREPLFSKVMELLEVMDAIAAERGVPLAQIAVNWTLQQPFITSCIAGAQ
FT                   SRKKVEENCAGLKWQLTEDEMHRLDQAIQRYQFPVQCGEVYQRR"
FT   CDS             complement(736489..737838)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07030"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79586"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5G5"
FT                   /protein_id="CBK79586.1"
FT                   /translation="MALPEHTRQPAPNSEKSSGKKKKFESNNKYFSICTYVVATFTICL
FT                   IIFKFINNWRDMQIYTSSILSTLSPFLIAFLIAYFINPLVNRIDHILFSRTASQKFAKL
FT                   HKFLSLLLAYVIVIGFIALVLTFVIPQIVESILELIRQSSSLYDTIMTNLNLLNERYPN
FT                   IDFAYIIDTINNALPNAINSVQAVMTDIVPMIYNAGMSIISWIINIILAFVISCYLMSS
FT                   KHRIIHGMKRIIYALFDQKTAYKVIFTIKECNHIFGQYIIGKALDSLIIGIICFVLMCI
FT                   LHLQYALLISIIVGMTNMIPYFGPFIGAIPGLIILLIISPKQALIFLILIFLLQQFDGT
FT                   ILGPKILGDSTGLSPIWIIFAITVGGATCGVVGMFLGVPIIAVLVYLMNHIFDYMLYKK
FT                   HLKTDLSNVIIPEINPDNVFIPKDFDASKANDPKAASDASDTSSSKENSH"
FT   tRNA            738184..738256
FT                   /locus_tag="CC1_T_34540"
FT   CDS             738689..739303
FT                   /transl_table=11
FT                   /locus_tag="CC1_07040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79587"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5G6"
FT                   /protein_id="CBK79587.1"
FT                   /translation="MIKVNLQNTAVQNMLTGQNTLDSVFIDGNSILFIEKPEYLKQLYR
FT                   DEIKARAIKVNLKVAREEIHKRTQDDRYNNLDDMETLKKFRAQTDELRETEKEYRRMLG
FT                   ECENVKMIPVYSGTKLDVTTGDSVEVKQAEFEDYIETEGNKARMVLDILALDADRLERD
FT                   CQWLQTKGCDINIMTTPGAPLAVEGGTLEEAIAALIEEKAA"
FT   CDS             739558..740835
FT                   /transl_table=11
FT                   /locus_tag="CC1_07050"
FT                   /product="Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA
FT                   dehydratase subunit, BcrC/BadD/HgdB"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79588"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5G7"
FT                   /protein_id="CBK79588.1"
FT                   /translation="MDYVKKYGELIKDKAGVKPERARSMIRLGLRAENARTKLLPNKEM
FT                   PKAFRMLTHLAMESVMKALDHPEKSCWTNIFAPVEIMQCFGLQCVSMECLSSFMSGFKI
FT                   EDYLIDYAQNEGIASTLCSYHKNFIGGVDSGVLPKAAMSVTTSMICDGNINTFRHMEQK
FT                   HQVESYVLDIPNTYSPEAERYVVGQLQELIELLETKTGQKLDMNELKAAIQRENESKEY
FT                   YKTFLKEQKHRYYPNTMTLDLYMLFASHLNIGTRETLDFFKCLAEDVKTYPEFNGKGIL
FT                   WVHLMPYYQETLQQYMNYQEKYYIQACDLNLDYMEPLDAAHPLEALAKKMILNIYNGPY
FT                   ERKVEMIRHLVKEFQSDAVIHFCHWGCKQSSGGVMLLKEAMREENVPMLILDGDALDRR
FT                   NSHDGQIKTRLQAFLELIDNIEEDKD"
FT   CDS             740835..742514
FT                   /transl_table=11
FT                   /locus_tag="CC1_07060"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79589"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5G8"
FT                   /protein_id="CBK79589.1"
FT                   /translation="MIGYVCKYTPVEVFEAMGVEIGRIQPEVTNFNQADTLMHPNICSF
FT                   TKSVLEDVLAGDYEGVVLTTCCDSIRRLYDVLKQQCPDKFLYLLDVPRKVNDFSTDMYR
FT                   KNILDMVHAYEAFSGKTFDEIVLKQLLERREAGQNLRTAPKNKASVHIGLMGARCSKGI
FT                   IDLLENRGVDILFDMTCTGLKREFHVEPDNLLQAYAWQLLNQVPCLRMVKAVNRENYME
FT                   GFRDRLDGILYHTVQFCDNYAYEYTDLKHRLDIPMLMVETDATKQCEGQIRTRVEAFIE
FT                   SLKIAKGASISKKSLKKAEDGKMYVLGIDSGSTSTNAVILNEKKEIVAFDVVRTGAKSG
FT                   ESAERILSEILERAGLKREDISLIVSTGYGRVSIPFADENVTEISCHGRGAHYFNPDVR
FT                   TILDIGGQDSKAIRLNENGEVVDFVMNDKCAAGTGRFLEMMARTLEMDISEMGPESLKW
FT                   KEDIDISSMCSVFAESEVISLIALNKEKADIAHGLHKAIANKSYSLLKRVGLNETFMMT
FT                   GGVAKNPGVVKAVEEKLGCKLFICKEPEIVGALGAALFGLDK"
FT   CDS             742683..743606
FT                   /transl_table=11
FT                   /locus_tag="CC1_07070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79590"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5G9"
FT                   /protein_id="CBK79590.1"
FT                   /translation="MSQAKIFKLLSEAYGLTWSGGIAAEVIDGCPVTLKEDRYYVQVSA
FT                   YMPERVYEAKHEIFNEQMKAVKGVKCGFDKKTSRITTVLSQPNRVVEQYGALREIIKQY
FT                   AAPYVEEDKCPYCGQGECDMAAIYNDQYRRVHVRCHQYHTDRTRDVVLSGQGNLAMGII
FT                   GALAGAVLFMAIALAIGIFAERSYGWFFVLATFAALGGYKLFHGPYGRTGMVTVTLCSI
FT                   LSMVLYLFCEMVYLIAQYYELAIGEVLKQWPAVIQIAFSPDNLAESWFQLIFFLGGLAW
FT                   FLIKRPLSKQKVVGTMDVMDDFNRAL"
FT   CDS             744145..744249
FT                   /transl_table=11
FT                   /locus_tag="CC1_07080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79591"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5H0"
FT                   /protein_id="CBK79591.1"
FT                   /translation="MSCTLKDRTGREKEAFNGDGWQIAKTEVTGCRDM"
FT   CDS             744234..744920
FT                   /transl_table=11
FT                   /locus_tag="CC1_07090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79592"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5H1"
FT                   /protein_id="CBK79592.1"
FT                   /translation="MPGYVIHLAEAELILDKMRKLRQTDDAFEQAFLTGTLLPDTRLKG
FT                   EKRFSHFWDPDKLECLALGPDLTRFTDKYGQRLNEPVMLGYLAHLHLDARYVTEYWPTV
FT                   MAFYGCTGEPEYRKAHIAEVEIKRLQKCVPVSQFFSIDYYYGDYTKLNGYFIHKYHLRV
FT                   PKWQSIPMSPPEEVNLQDMQMICRELDHLKKECHAGDEKRIQVFELGSLERFMAASAEE
FT                   FCDSYI"
FT   CDS             744962..745105
FT                   /transl_table=11
FT                   /locus_tag="CC1_07100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79593"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5H2"
FT                   /protein_id="CBK79593.1"
FT                   /translation="MNYILTAATAVSKEAGSMSEMLPKFGVIALVVVIILIGMFIYAKK
FT                   KK"
FT   CDS             745141..746064
FT                   /transl_table=11
FT                   /locus_tag="CC1_07110"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79594"
FT                   /db_xref="GOA:D4J5H3"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5H3"
FT                   /protein_id="CBK79594.1"
FT                   /translation="MKKGENMRLFFTKMHGLGNDYIYMDGFDSRMSKPAAWPSEQKGRL
FT                   AVMMSRRHTGIGADGLIFIQPSEEAAFRMEMYNADGSRGAMCGNGIRCAARYAYDHGIS
FT                   TNQSFQVQTDSGIRSVYIRKTDEGEHITSVRVDMGVMANLGEQRVLLKAKEEWTDFTGG
FT                   SFPVQYVSAGNRHCIFFVENVEAFQLKKAAELIHTLPGNEDGVNVEAAAVEKIAVTGEK
FT                   YIKMRVIERGSGETMACGTGACAVTAAAVWQGYCRYDENVEIRQPGGILTTAYLADGRM
FT                   LMEGPAEYVFEGYFDIPIASLYNSAR"
FT   CDS             complement(746284..746589)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07120"
FT                   /product="Protein of unknown function (DUF1292)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79595"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5H4"
FT                   /protein_id="CBK79595.1"
FT                   /translation="MSDFDETLNEEELNIITLTDEDGTDKDFEFLDLIDLDDKEYVVLL
FT                   PVESEDENADGEVIILEVHPLDEENEEYLSIEDATTLNKVFEVFKERFKDDFNFVD"
FT   CDS             747733..748803
FT                   /transl_table=11
FT                   /locus_tag="CC1_07140"
FT                   /product="spermidine/putrescine ABC transporter ATP-binding
FT                   subunit"
FT                   /EC_number="3.6.3.31"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79596"
FT                   /db_xref="GOA:D4J5H5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5H5"
FT                   /protein_id="CBK79596.1"
FT                   /translation="MNNPIISLEGVEKRFGSNLVVKKMNLEIAEGEFLTLLGPSGCGKT
FT                   TTLRMIAGFEEASAGVIKVEGERIEDKEPFQRNVNTVFQNYALFPHMTVFNNVAYGLTI
FT                   KKVPKPEIQERVMEMLRLVQLEGFEKRKPDELSGGQKQRVAIARALVNRPKVLLLDEPL
FT                   GALDLKLRKQMQIELKRLQKKLGITFIYVTHDQEEALTMSDRIAVMHDGVLEQLDVPME
FT                   IYEHPKTKFVAGFIGESNIFDGKVTDKKDNVLTVQTEAGMMQVCGADFEVGEEMHVAIR
FT                   PEYMDVSKTPVEGFDLPGTVKDFIYQGTVVKTALDIKNGQEIKYSRFEQDTDIAEGNQV
FT                   YVYWRPEKAVAIKKSM"
FT   CDS             748815..749678
FT                   /transl_table=11
FT                   /locus_tag="CC1_07150"
FT                   /product="ABC-type spermidine/putrescine transport system,
FT                   permease component I"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79597"
FT                   /db_xref="GOA:D4J5H6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5H6"
FT                   /protein_id="CBK79597.1"
FT                   /translation="MNNKKKKNMLPVLAMAGPVSVWMILFVTIPMLYIIYISFMSRGVF
FT                   GDVVYKFSTESYKTILNPTYFKVILKSLKAAGITTILCLLLGYPLAYIIAHKPKDTAAK
FT                   LITLIMIPFWTNSLMRLNSWLLLFQTSGPINNFLVGTGFVKEPITFIYTDGLVLIGLIT
FT                   NMLPFAVLPLYSTIEKLDKSLIEASADLGASAATTFMRVTLPITFPGIFSAIILVFIPS
FT                   LGIYTVTDMLGGGKILYIGNIIKNQFGSIRNWPLGAALSVMLIVITMLLIFIYTRFAKI
FT                   EDMEVV"
FT   CDS             749678..750484
FT                   /transl_table=11
FT                   /locus_tag="CC1_07160"
FT                   /product="ABC-type spermidine/putrescine transport system,
FT                   permease component II"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79598"
FT                   /db_xref="GOA:D4J5H7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5H7"
FT                   /protein_id="CBK79598.1"
FT                   /translation="MSKIAKKRKRLNIISNVYAFLVYALLYIPVAVMMVFSFNDQKYNY
FT                   YWNGFTTQWYAKLFTNSTLVDSLIYSLIIAVLSTLISVFIGTIGALGLKRYEFKMKKFI
FT                   DNMLYIPIIVPEIVLAVALLIIFLKVGVSMGIGTILIGHCTFCIPYAIVTIKGRISGDN
FT                   ETLEEASMDLGANRVQTLLRVTLPNIFPGVMSAAFLSFTMSFDDVVMSNMLAGAKQSTL
FT                   PVLILSMNKTGVTPDVNALATIMILIIVAAMILNNIIQGALHKRVK"
FT   CDS             750498..751616
FT                   /transl_table=11
FT                   /locus_tag="CC1_07170"
FT                   /product="Spermidine/putrescine-binding periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79599"
FT                   /db_xref="GOA:D4J5H8"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5H8"
FT                   /protein_id="CBK79599.1"
FT                   /translation="MKKRLLATVLAGAMVLSMAACGSSNANKTESAAASETANASTEAG
FT                   AESGETQAAAQDGDASSELNIYMWQQYISDDLIKNFETENNCKVNLSYMSDNADAINKL
FT                   TAGGGDEYDLIMTCDAYMKSLIAGGYVEELNLDNIPNSSNINDTYWVSKGYCVPYLMNY
FT                   IYVVYDSETCPVEIHSYNDLLQSGLKISTIDGARNLFPIALVALGYDPNSTNESEIAEA
FT                   YEWLQKFNENVVAYGNAEQNLTNGTANVAVTYDGNASWAMKEKNTIKVADFTSDPIQLG
FT                   IDLFVMPKGAKHVDLAEKFLNYICTPEVMAKNLEEFPYSCPNDAAVAAASDDYKNDPAR
FT                   DFSYKENVFFQEDVGDTLTIYNDYYQKLKVGE"
FT   CDS             752001..752996
FT                   /transl_table=11
FT                   /locus_tag="CC1_07180"
FT                   /product="Predicted phosphosugar isomerases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79600"
FT                   /db_xref="GOA:D4J5H9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR024713"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5H9"
FT                   /protein_id="CBK79600.1"
FT                   /translation="MLKFDEQKQLDSVNGALALRGRIEEIVDAICAEGYKNICWLGIGG
FT                   TWASALQAEVHMKEKSAIEFFSENAAEYVTTGNKRVGKGTIVILSSVTGSTIEMVEGVK
FT                   KAQADGAKVFGFIDKAEAELAKMVDYVISYPANEQLKFFMVADRFMKNAGEFEDYDEYY
FT                   AEMDAHLAQGLVDVEKAADAFGAAYAEKHCNDKLHYFVGAGNQYGSTYSYAMCYWEEQH
FT                   WLRTKSIHSAEFFHGMLEVIDKDTPVTVFVGEDSQRRLSERVAAFLPKVCANYTIIDTK
FT                   DYPIKGISEKYRGSISHLISHAVTQRIDAHIEKINCHPMEIRRYYRQFDY"
FT   CDS             complement(753184..753597)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07190"
FT                   /product="Pyruvate:ferredoxin oxidoreductase and related
FT                   2-oxoacid:ferredoxin oxidoreductases, gamma subunit"
FT                   /EC_number="1.2.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79601"
FT                   /db_xref="GOA:D4J5I0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5I0"
FT                   /protein_id="CBK79601.1"
FT                   /translation="MRGGTANCTVKYSNDGYIYNPSPETPDLLLAMNEPSLIKFLPTVS
FT                   PGGTVLIGDTVEIPEGARQDVTYVKVNCTEIATSLGNPKGANIVMTGAIIKLMGDFTHD
FT                   AAVAAMNHMFAKKGKSKFNESNARAFDAGFNAV"
FT   CDS             753628..754275
FT                   /transl_table=11
FT                   /locus_tag="CC1_07200"
FT                   /product="FAD/FMN-containing dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79602"
FT                   /db_xref="GOA:D4J5I1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5I1"
FT                   /protein_id="CBK79602.1"
FT                   /translation="MNTFTGCNIRDNQAGSKDTLTAGHTKDEGKVDLLYLVEEATEDAL
FT                   YETAGTIAEICENNGAVGSVIAEDSKQQRNLLDIRSAIYEVYKPVFVDSLDTAVPVANI
FT                   GDLLKEFDAIAEKYGTTTPRFGHVADGNFHNFILMVDGKVPEWADDMRRDIYKAAIKYG
FT                   GTITAEHGTGKTRKPYMNLQYTPHVLGIMKSIKKAFDPNNILNPGVIIDLDN"
FT   CDS             755308..756117
FT                   /transl_table=11
FT                   /locus_tag="CC1_07220"
FT                   /product="Sugar kinases, ribokinase family"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79603"
FT                   /db_xref="GOA:D4J5I2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5I2"
FT                   /protein_id="CBK79603.1"
FT                   /translation="MRENKMKKIRIAAAGDNCMDVYDKENKAFPGGNPVNVAVYVARLG
FT                   GASAYIGPVGTDVYGKQMMDAIQGKGVDVSRMKILEGTTAVTHVEIVDGDRVLGDYEEG
FT                   VMADFKLDAEDIDFLSSYDMVVSGLWGMIENDLPILKEKGATVAFDFATRPDDPVSVKA
FT                   IPYVDYGFFADDDKDEEELKKMLIGLHAKGPKVMVVTRGEKGSMAYDGEKFYYGGIVPC
FT                   EVVDTMGAGDSFIAGFLYAICEGKGIQEAMADGAANSSVTIAYSGAW"
FT   CDS             756199..756822
FT                   /transl_table=11
FT                   /locus_tag="CC1_07230"
FT                   /product="Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79604"
FT                   /db_xref="GOA:D4J5I3"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5I3"
FT                   /protein_id="CBK79604.1"
FT                   /translation="MVLNLRKNILILNDLSISCRLIRSDRRSLGLEIRKIPEGGAELLI
FT                   RAPRRMKIAYIEWFINEKERWITEKYLAALVEKPGPQMMEIPEYVTEQWLRTEGAERFH
FT                   QKTAFWAARMKVTYGRITIRDQKTRWGSCSSGGNLNFNWRLLLMPERVMDYVIVHELAH
FT                   RREMNHSAAFWQIVETYLPDYRERRQWLKENGNRYSGPVELLKR"
FT   CDS             complement(756870..757826)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07240"
FT                   /product="Predicted permease, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79605"
FT                   /db_xref="GOA:D4J5I4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5I4"
FT                   /protein_id="CBK79605.1"
FT                   /translation="MSSKKMQSNLMLLLTAFIWGVAFVAQSVGMDYVGPFTFNSVRNFI
FT                   GAFVLLLFIPLLDKVNQKSAATVNASNSDAASATDIASTSSSSVSDRKTLIIGGIVCGI
FT                   LLAIASSFQQVGIVYTTVGKAGFITAMYIVIVPILGLFVGKKVRLIAWISVGLSVIGLY
FT                   LLCMTESLSLGKGDILVLICAFCFSFHIMVVDYFSPKVDGVRMSCIQFFTCGIICGIPA
FT                   MLTESPNLHAILTAWQPLLYAGVLSCAVGYTLQIVAQKNTDPVIASLLMSLESAFSLLA
FT                   GWIILHQYLSPKELCGCLLMFAAIMLSQIPAKKPVAA"
FT   CDS             758094..759422
FT                   /transl_table=11
FT                   /locus_tag="CC1_07250"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79606"
FT                   /db_xref="GOA:D4J5I5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5I5"
FT                   /protein_id="CBK79606.1"
FT                   /translation="MKIVVKFGGSSLASAEQFKKVADIIHADPHRRFVVPSAPGKRFDG
FT                   DTKVTDMLYACYDLAEAGKDFDGALADIKTRYEEIIEGLGLNLTLDKEFETIHEQFRLK
FT                   AGRNYAASRGEYLNGIVLANYLGFEFVDAATVIRFDDAGNFEADRTDLILSSRLKDVEY
FT                   AVVPGFYGAQDDGVVTTFSRGGSDITGSIVAKAVHADVYENWTDVSGFLVADPRIIKNP
FT                   EAIEAITYKELRELSYMGASVLHEDAIFPVRKEGIPINIRNTNKPDDLGTWIVESTCRK
FT                   PKHTITGIAGKKGFASINIEKDMMNSEIGFGRKVLQVFEDNNLSFEHMPSGVDTMTVFV
FT                   HQSEFEHKEQQVISGIHRAVHPDLLDLESGLALIAVVGRGMRDTRGVASKVFNALASAN
FT                   INIKMIDQGSSELNIIIGVKEKYFEDAIKVIYDAFITNAAPAK"
FT   CDS             759697..760455
FT                   /transl_table=11
FT                   /locus_tag="CC1_07260"
FT                   /product="NCAIR mutase (PurE)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79607"
FT                   /db_xref="GOA:D4J5I6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5I6"
FT                   /protein_id="CBK79607.1"
FT                   /translation="MDVLKLLEDVKNDKISLEEAAKELKQLPYEDLGFAKLDHHRKIRS
FT                   GFGEVVFCSGKSDEHLLKIYETFYKTDTEVLGTRASEHQYELVKAVIPEVTYDPLSRIL
FT                   KIEKPGKERIGRVAVCTAGTADIAVAEEAAQVAEYFGTNVDRFYDVGVAGIHRLFAKLE
FT                   EIRKANCIIAVAGMEGALGGVLAGLVEVPVIAVPTSIGYGANFGGLSALLTMLNSCSNG
FT                   ITVVNIDNGYGAGYISTQINRLAVKAYKPE"
FT   CDS             760567..762003
FT                   /transl_table=11
FT                   /locus_tag="CC1_07270"
FT                   /product="conserved hypothetical protein TIGR00299"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79608"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5I7"
FT                   /protein_id="CBK79608.1"
FT                   /translation="MSKKVLYLECFSGISGDMTVGALLDLGADPEVLKQSLDSLHVDGY
FT                   EVKIGRSSKCGIDACDFDVLIPDQPEYDEGHMHHHDDDHDHEHHHHDDDHDHEHHHHDD
FT                   DHDHEHHHHDDDHDHEHHHHDDDHDHEHHHHDHDHDHDHHHHDHGHGHHHAHVHRNIHD
FT                   VFAVIDRLENEHVKTLAKKMFMIVAEAESKAHGLPIEEVHFHEVGAIDSIVDIISVAVC
FT                   VDNLGVDDIVVSELYEGSGHVHCQHGMMPVPVPATANIVAANHLPMKITDAQGEMVTPT
FT                   GAAIVAALRTQDHLPEDYQLLKIGLGAGKKDFPKANVLRAMLLETKDQPQTGEEEDIWK
FT                   LESNIDDCSGEVLGYTMERLLAAGARDVCYAPIYMKKNRPAYMLHVLCDRRQIPAMEEI
FT                   IFNETTTIGIRRYKVERTILKRHEAKAKTAYGEVELKICEKNGIVYRYPEYESVKKLCE
FT                   AAGVPFKVVYQAACEAEISE"
FT   CDS             762085..762894
FT                   /transl_table=11
FT                   /locus_tag="CC1_07280"
FT                   /product="conserved hypothetical protein TIGR00268"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79609"
FT                   /db_xref="GOA:D4J5I8"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5I8"
FT                   /protein_id="CBK79609.1"
FT                   /translation="MEIRTRLVNYMKELGDKDLCVAFSGGVDSSVILRAACEAAAANGK
FT                   KVYAVTFETKLHPKADLPQAQKVAKEAGAIHHVIYVNELDNEEMLNNPVNRCYLCKKYL
FT                   FQNLLTFAAEKGIDTIMEGNNADDLHIYRPGTQAVKELGVLSPLAELGITKAQVREIAA
FT                   DMGLSCATRPSSPCLATRLPYGTPISFELLARVDAGEQWLKEQGFPIVRLRIHGDILRI
FT                   EIEKERFSDFIAMADKITAKMKELGFVYITLDAEGFRSGSMDVHIVK"
FT   CDS             complement(763006..763380)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07290"
FT                   /product="ParB-like nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79610"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5I9"
FT                   /protein_id="CBK79610.1"
FT                   /translation="MRQKYHFATDNGILIWDVTSILEDIEQHPDSYTIQTLSTALLADH
FT                   NDARVSHTRAMASDLAKPLVVAELSKDHLLLIDGNHRLYKARTLGLENIPCYYLSQRQQ
FT                   QHFIVHFRPSEYEHIIACVS"
FT   CDS             764362..765090
FT                   /transl_table=11
FT                   /locus_tag="CC1_07310"
FT                   /product="ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79611"
FT                   /db_xref="GOA:D4J5J0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5J0"
FT                   /protein_id="CBK79611.1"
FT                   /translation="MDEYAITVKDLKIRYKSVQAYSIKKSLLRLKGVEAKAFEAVRGIS
FT                   FEVKQGEILGITGKNGSGKSTLLRALAHIFSADEGSIDLHGHSVSLLAIGVGFKNEMTG
FT                   RENIMLSGMLLGFSEKEVLDRMDDIIEFAGLGEFIDMPVRTYSSGMYSKLAFSITAILE
FT                   TDIMLIDEVLSVGDEKFKKKSYEKMKSLISQRNRTVVIVSHNLKTLEELCDRVMWMHEG
FT                   KIVKIGEPVEVLNEYREFMK"
FT   CDS             765112..766071
FT                   /transl_table=11
FT                   /locus_tag="CC1_07320"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79612"
FT                   /db_xref="GOA:D4J5J1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5J1"
FT                   /protein_id="CBK79612.1"
FT                   /translation="MNGLLSVIIPAYNEQEMIPKAAATIAEILEQAEISYELLFVNDGS
FT                   RDLSWQCIEEAADQNPSIRGLNFSRNFGKESAMFAGLSEAVGDCVVVIDCDLQHPPGKI
FT                   VEMYRLWQEGYEVVEGVKSSRGKESPVHTFAASCFYKLIGSAAGFDMSRASDFKLLDRK
FT                   AVNVLLNMKEKNAFFRALSSWVGFKTTEVPFEVQEREAGESKWSVKALTRYAISNITSF
FT                   SAAPMQIVTFLGVVMLIVSVVLGAISIGQKICGVALGGFTTVIIIQLFTGSIIMISLGI
FT                   IGYYIAKIYDEVKGRPRYIIASTCGSKPLDKDKMTVDK"
FT   CDS             767243..767671
FT                   /transl_table=11
FT                   /locus_tag="CC1_07340"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /function="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79613"
FT                   /db_xref="GOA:D4J5J2"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5J2"
FT                   /protein_id="CBK79613.1"
FT                   /translation="MIALGCDHGGYELMQEVIKYLEEHGLEYKNYGTYSTDSCDYPDYA
FT                   KKVAEAILAGECEKGILICGTGIGITIAANRYEGIRAANCTNSFMAEATREHNDANILG
FT                   MGARVIGVGTALKIVDTFLNTPFSNDERHKRRIAKIEH"
FT   CDS             767765..768250
FT                   /transl_table=11
FT                   /locus_tag="CC1_07350"
FT                   /product="Deoxycytidylate deaminase"
FT                   /EC_number="3.5.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79614"
FT                   /db_xref="GOA:D4J5J3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5J3"
FT                   /protein_id="CBK79614.1"
FT                   /translation="MSEKRQDYISWDEYFMGVAKLAGLRSKDPNSQVGSCIVSPDNKIL
FT                   SIGYNGFPRGCSDDVFPWSREGDELDTKYFYVTHSELNAILNYRGGSLEGSKIYVSLFP
FT                   CNECSKAIIQSGIREIIYDSDKYGDTPAVIASRKMLDAAGVHYRRYIRSGRELKITV"
FT   CDS             768468..768743
FT                   /transl_table=11
FT                   /locus_tag="CC1_07360"
FT                   /product="Putative F0F1-ATPase subunit (ATPase_gene1)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79615"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5J4"
FT                   /protein_id="CBK79615.1"
FT                   /translation="MRDKHGIGQAIVMITQLSINMLVPVFMCLFIGIWLDKRLGTGWLT
FT                   LVFLILGIMASIRSMFITLKPLLKGEREKKDEAFKKQLDEQFKDSE"
FT   CDS             768718..769125
FT                   /transl_table=11
FT                   /locus_tag="CC1_07370"
FT                   /product="ATP synthase I chain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79616"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5J5"
FT                   /protein_id="CBK79616.1"
FT                   /translation="MSNLKTQNEALADLILGILIFGILVVFVGLFVAPDKAAFVLGAVL
FT                   GTATSVIRAVHMAVTLDRQLDYGEKDARAYAARNYGIRYLIMIAVLLVSTRLGVSGMAG
FT                   AVIGLFSMKPAAILSPQIHKYIYTRIFGKGR"
FT   CDS             769130..769825
FT                   /transl_table=11
FT                   /locus_tag="CC1_07380"
FT                   /product="ATP synthase F0 subcomplex A subunit"
FT                   /function="ATP synthase F0 subcomplex A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79617"
FT                   /db_xref="GOA:D4J5J6"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5J6"
FT                   /protein_id="CBK79617.1"
FT                   /translation="MGNEVDFMVHGYVPLNIFGHEVWLTTTHVCLLIVCLFMLVIGLIV
FT                   NNKMKHATEVPGMVQNIAELYVEMMDGVVQSSMFRHWGKYANYILTIFMFLLFSNISGL
FT                   FGLRPPTADYGVTLPLALITFVLIQFNAFKWKGVGGYVKDLMDPIPLFLPINIISEFAT
FT                   PVSLSLRLFGNVMAGTIMLALYYGMLPVLATVVIPSFLHAYLDLFSGAIQAYVFCMLSM
FT                   TFIYQKMPE"
FT   CDS             769872..770138
FT                   /transl_table=11
FT                   /locus_tag="CC1_07390"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /function="ATP synthase F0 subcomplex C subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79618"
FT                   /db_xref="GOA:D4J5J7"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5J7"
FT                   /protein_id="CBK79618.1"
FT                   /translation="MNGITNEGLVLACSAIGAGLAVIAGIGPGVGQGIAAGHGASAVGR
FT                   NPGAKGDIMQTMLLGQAVAETTGLYGLVIALILLFANPLFGKL"
FT   CDS             770704..771186
FT                   /transl_table=11
FT                   /locus_tag="CC1_07410"
FT                   /product="F0F1-type ATP synthase, subunit b"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79619"
FT                   /db_xref="GOA:D4J5J8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5J8"
FT                   /protein_id="CBK79619.1"
FT                   /translation="MVELIVTAINVFILFFLIGYLVSDMLSGMLTKRQERIADDINTAR
FT                   MSKEEALALKNDYEHRLADFESERADILENTRRKAAQMEERILLDGQQEADRVIARAKR
FT                   EAELKKTKLKEDVRHDMIMAASITACKLAAETLDDKKQAVYIQEMLDEMGESTWQN"
FT   CDS             771174..771713
FT                   /transl_table=11
FT                   /locus_tag="CC1_07420"
FT                   /product="ATP synthase, F1 delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79620"
FT                   /db_xref="GOA:D4J5J9"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5J9"
FT                   /protein_id="CBK79620.1"
FT                   /translation="MAELIDKTYGEALFQLSLEEGKVEQYADEVRSIKEAIAENPEFMV
FT                   LLDHPQITREEKVEVMRNCLDGRASDSVTGFFVTVIQAGRQHFLMGMIDYFLDAVRKYQ
FT                   HIGIADVTSACALSDAQKAAVEKRLLETTGDVSIEINYQVDPEIIGGLVIRIGDKVADN
FT                   SIRTQINTLTKAILNS"
FT   CDS             771735..773255
FT                   /transl_table=11
FT                   /locus_tag="CC1_07430"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /function="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79621"
FT                   /db_xref="GOA:D4J5K0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5K0"
FT                   /protein_id="CBK79621.1"
FT                   /translation="MNLRPEEISSVIKEQIKRYKSELEVSDIGTVVQVADGIARIHGLE
FT                   NAMQGELLEFPGDVYGMVMNLEEDNVGAVLLGSNRNINEGDVVKTTGRVVEVPVGDAML
FT                   GRVVNALGQPIDGKGPIDTNAFRQIERVAHGVIERKKVDTPLQTGIKAIDAMIPIGRGQ
FT                   RELIIGDRQTGKTAIALDTIINQKGQDVLCIYVAIGQKQSTVSSIVHTLESFGAMDYTV
FT                   VVAATASELAPLQYIAPYAGCAIGEEWMEQGKDVLIVYDDLTKHAAAYRTLSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERASRLSDDLGGGSLTALPIIETQAGDVSAYIPTNVISITDG
FT                   QIYLETEMFNSGFRPAINAGLSVSRVGGDAQIKAMKKIAGPIRTELAQFRELQSFAQFG
FT                   SDLDADTLQNLAQGERIQQILKQPQYQPMPVEKQVVMIYAVTRRHLTDIPVDQVLDFEK
FT                   GLLEYMDSKCDDVLAAIRTEKVLTEDIEAGLVKAITEYKKVFLEENKR"
FT   CDS             773262..774128
FT                   /transl_table=11
FT                   /locus_tag="CC1_07440"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /function="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79622"
FT                   /db_xref="GOA:D4J5K1"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR023633"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5K1"
FT                   /protein_id="CBK79622.1"
FT                   /translation="MASMREIKRRKTSIQSTAQITKAMKLVSTVKFQKAKVKAETTRPY
FT                   FDKMYETVSSILSRSGNIHHRYLMQGESQKKAVIVITSNRGLAGGYNSNVEKAVTSVGF
FT                   NPADVQLYTVGSKGRDNLSKKGYAVAKDYGDVIEAPTYRAAMDIGRDVLNAFSSGEVGE
FT                   IWMAYTVFKNTITHIPKMIRLLPVAVPEEETAEEKKDGPLLLMNFEPEPEEVLDAVIPK
FT                   YINSVIYGGMMDAVASENGARMTAMDNATSNAEDMIENLTLSYNRARQGAITQEITEIV
FT                   SGAEALK"
FT   CDS             774152..775540
FT                   /transl_table=11
FT                   /locus_tag="CC1_07450"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /function="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79623"
FT                   /db_xref="GOA:D4J5K2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5K2"
FT                   /protein_id="CBK79623.1"
FT                   /translation="MAEHSIGKITQIIGAVLDIKFADGNLPEINDAIRITRKDGSTLVV
FT                   EVAQHLGDDTVRCISMGPTDGLVRGMEAIATGGPITVPVGEKTLGRIFNVLGEAIDNKE
FT                   APQAEEHLPIHRKPPAFEDLSDEQEILETGIKVVDLLCPYQKGGKIGLFGGAGVGKTVL
FT                   IQELIRNIATEHGGYSVFTGVGERTREGNDLYTEMSESGVINKTTMVFGQMNEPPGSRM
FT                   RVGLTGLTMAEHFRDTGKDVLLFIDNIFRFTQAGSEVSALLGRVPSAVGYQPTLQTEMG
FT                   ALQERITSTKTGSITSVQAVYVPADDLTDPAPATTFTHLDATTVLSRSIVELGIYPAVD
FT                   PLESTSRMLDPHIVGEEHYRVARSVQEILQRYKELQDIIAILGMDELSEEDKLVVSRAR
FT                   KVQRFLSQPFFVGEQFTGLKGRYVPLSETIQGFKEIIAGKYDDIPESYFLMAGNIDDVL
FT                   AKVK"
FT   CDS             775557..775967
FT                   /transl_table=11
FT                   /locus_tag="CC1_07460"
FT                   /product="ATP synthase, F1 epsilon subunit (delta in
FT                   mitochondria)"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79624"
FT                   /db_xref="GOA:D4J5K3"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5K3"
FT                   /protein_id="CBK79624.1"
FT                   /translation="MEALMQLQIITPDHLMCDESVKMVEMRTAEGEIGVLPGHIPVTVM
FT                   MAPGVTHITKADGSIRHIAIHDGFVEIQPDKVSIMAEIAEWPEEVDLDRAKAALSRARE
FT                   RITNPGPDTDIARARRAWARAAARIELLTREW"
FT   CDS             complement(776030..778846)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79625"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5K4"
FT                   /protein_id="CBK79625.1"
FT                   /translation="MNQQKSLLLFGGRICQELSRQPFLSKDYQVTYIDSLLNTQHYPDA
FT                   VLPKEIGTDIRPDLLVIDFQAVIEECISNTLTVDRAVVWTKQFASHLLSHIAPEQILLL
FT                   HVFRPQYYVIKNRIRVKASNPYLQYIQTIEQAFLDQVDCHIISLDNCYFSFKPFNEKLA
FT                   LYRFEDAYYQDIAHRVHVWFQSKTDIFNTPPYFPLSLERFCTYFNTLEKKAFHLFLNDQ
FT                   HLLEDLVLCASPDFIEQYKPILLYLADDNHTDLPAKTYLRKLEGQTFDHLSEFCQIFEA
FT                   FDSVRQKNYKQRNINYDALFLHHFRIPSLLQDIQKWAKPQMKKLGLLHRKQITFQNYGA
FT                   WFTLMQTSDTQAFEHAAEKFGYEKETLKPTVVDLWGSCISRTNLNFDDERNFVTSAYLF
FT                   QVPPFVESTPVNYNKEAVKDYHSSWYDQIVQDELAGTYIKKLITSPGEWLLIDFFSLSS
FT                   PRAYQIDSHYFTDFRGEIAHTLQAESFSFMDDMPISELQRRIRICAEVLKKRYGDHIIM
FT                   IQCKRQSVFLTQEGTSKSFSDKVVTRNEKANPLIYDMSQYFVQLTNCYYINVAGSYLSD
FT                   EIGFMGLEDVHYEDKCYEETLNYIRYIVKNTPKQKYFASKKENASSLPSVFQEDLEGYQ
FT                   TEPTEDPTHIMYPVRFVSNLPSVCPVPSFKPNDSGNYSDEMQNKQDSIIYLPKGYSLRN
FT                   DGTAIPLENPFHLDGWHFTGWHILVTIHAKSYWYLNSGGFVAAKDYQWNNDASLYRLFD
FT                   HQPIPHLPLNHVKEVTLYATWAQNIKENAFHIYYYTSKPTRSLSWNYDETNGKVFVNPS
FT                   GSYEFRCTKDLYNDGTYMLQPNAYSQKNCTFLGWKIRIKSDRQWYWYMADGTLRQQPDT
FT                   ITSKAFSDLKAVLPDKSLLPPLPIAHLNLIVAEAVWDYDMHEQPHHSKQFKRQFRKLLS
FT                   KVYHKFFV"
FT   CDS             779021..781198
FT                   /transl_table=11
FT                   /locus_tag="CC1_07480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79626"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5K5"
FT                   /protein_id="CBK79626.1"
FT                   /translation="MKIYTWLQRISFAVMGVVFLIITLGCLYNFSQVDLGDSNNTPVLF
FT                   AFGVIVALQLFVIIRALFRLVDKIEYDASKKSHYLIPVVCFCIMAVVFIILMCVMQPRP
FT                   ITDSYDDLDTAAWIASHGAVDVDNYHIKYMGAFSNNYTLTLIFAVILKVLPFLQMSGIL
FT                   MVLTLMNAVAILVAIFLMWLILKECVGIRAANKALILCTFNPIYYCLVFWIYSLTFSLP
FT                   VMMGIVYVAIRIYKCIDIKKKEVLLEIFLGILIVVGYELRPTNVFPVIAMVLALPLVLS
FT                   KHHVLKKILRSGIVALIAAVVLSVTVSTVKDRYFGEIQDQNYPILYWISMGSHGSGDLV
FT                   SNGEEKAILEKYETADERSNAFLKRTIDNYKQLGISGTADLWVRKTLTTWADGYSTVHN
FT                   RMSHGEIQNYLYELIGGTHRQLFYIYCQAYRFLIVLGVVLFCLNGSRKKKGDVLYYIMF
FT                   LSLAGGIAFYMLWEAKNIYSAAFLLPMIILAQEGIGTLSKNIFTVPQVRERRRFINSLY
FT                   VLSIVLVSMISFHLYGTEETFNFYRINTMYNSRESTDLEMKEEICQDFYTEKAFNRIVL
FT                   MADTDEDGKYISDYTISILDSHQQLLFEKTIKPSDIKDRRITVDFNKTQCDNHYYVIIK
FT                   KNYPVFGDIHFYIRNTYFLDSYKGKLEVDGNKAYVNDLNMDVIYSVEQPYFNQSQKYLF
FT                   TGFYIVVSLVCFVCMLQEQKTVCRKRQELER"
FT   CDS             781195..782454
FT                   /transl_table=11
FT                   /locus_tag="CC1_07490"
FT                   /product="Putative glycosyl/glycerophosphate transferases
FT                   involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79627"
FT                   /db_xref="GOA:D4J5K6"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5K6"
FT                   /protein_id="CBK79627.1"
FT                   /translation="MKTRIIKDLIKRVVDYRIEGDYHVYTVKNTPLTIRILMTKKYNRK
FT                   WAGVAINPRKIIFDNYMGSSYGCNGKYITEALLKAYPEAEIVWTVRDVAIHRDEFPSQV
FT                   RLVEYLSDEAMFEYATAAIWVCNIHLVPYLFKGLRKKEGQFFIQTWHGSLGIKKIENNS
FT                   QLIRKAQNWLKMAELSSSYTDFWISNSNFETEVYKSAFWHVHDILEYGHPRNDILFGEN
FT                   KDIKEKVRNKLSIAEGTKTVLYVPTYRESDLTEKFEMDYQRVVHAFEERYDGEWKLLMR
FT                   MHPKMREKAQKIVPKLTQVVDVSCYPDIQELMVFTDAMITDYSSCIFDFILTYKPGFIY
FT                   AVNEQGYDSERGLYYPLSATPFSIAHSNTELEQNIRDFNPVEYHDKVVQFLTEKGCIDD
FT                   GKASERVVQLITKLFRRLEE"
FT   CDS             783204..784262
FT                   /transl_table=11
FT                   /locus_tag="CC1_07510"
FT                   /product="Nucleoside-diphosphate-sugar epimerases"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79628"
FT                   /db_xref="GOA:D4J5K7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5K7"
FT                   /protein_id="CBK79628.1"
FT                   /translation="MQSVLTEDFEILSQSNLAFEQFRDKKILITGATGLIGSLLVKTFL
FT                   YCNHVHQLNMKVYALVRNAEKANTIFEGCVGISDLTYVIADLEKDELYQKIQIEGNCDF
FT                   IIHAAAVTTSKLMVSQPVDNIKTAVNGTDKMLKFAVDKKCSSFVYISSMEIYGQPFTEG
FT                   KTAEQDLGYIDIASVRSCYPEGKRMCECLCTAYASQYGLNVKSARLAQTFGPGILPTEN
FT                   RVFAQFARSAMNGQDIVLHTMGTSEGNYVYTRDAVKAIIMLLTEGMSGQAYNIANEDSH
FT                   MTIRQMAELVAKEIADNQIKVVIDIPEDNRSLGYAPGVKMWLDASKMKSLGWNPEVDLV
FT                   ESYRRMMKWMER"
FT   CDS             788076..789959
FT                   /transl_table=11
FT                   /locus_tag="CC1_07540"
FT                   /product="L,D-transpeptidase catalytic domain./Putative
FT                   cell wall binding repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79629"
FT                   /db_xref="GOA:D4J5K8"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5K8"
FT                   /protein_id="CBK79629.1"
FT                   /translation="MKKSSRWKTMILTGAFVLALNCGNVFASEAGMTGESNTEATIVEE
FT                   NGAADNVQNPADSQVVNDQNGNSYSVNSADVPESGDPAVEPTEPPADPPAEMKQGWQDE
FT                   DGGRRYYIDNNYVVGEQNIDGSWYYFHENGMMATGLTEQSQNPGNLYDYGEDGKRLYGW
FT                   QNVNGVQYYFHSETGIMLKSSECKIDGFWYYFDENGQFVAGRWINHHNADYYYDDQGHM
FT                   YYGWKQEGDKNYYLNKGNGKKVIGEKKIDGFWYYFNENGEMATGWSQHNDHMYYYQANG
FT                   QMTYGEAKIDGHWYYFKEKSGIMATGWSKHNNHTYYYQLNGWMTYGEKKIDGKWYYFHE
FT                   RTGVMATGWSKHNGHTYYYQSNGQMTYGEKKISGYWYYFKNKTGVMATGLTSHSGKKYY
FT                   YQSNGRMKYGWQAVGSNAYYFEQKTGVMKPYTFKKSNGYWLAYDSNGKQVKDLRSAFNN
FT                   ASSYVIKVNKPMNAVTVYIQYGDGSYTVPLVAFICSTGADTPTGTFYTPDKWRWLRMMG
FT                   PSWGQWVTQITGDYLFHSVYYNSANNNNTLSVSAYNNLGKQVSHGCIRLTAGDAKWIYD
FT                   HCALETKVVIYSDRSTYGPLGRPTAYKLPSWHTWDPTDPNMYYKCQQRGCH"
FT   CDS             789984..791921
FT                   /transl_table=11
FT                   /locus_tag="CC1_07550"
FT                   /product="FOG: Glucan-binding domain (YG repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79630"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5K9"
FT                   /protein_id="CBK79630.1"
FT                   /translation="MKKCLIKGMTVIMISTMLASTPVVSYAAETEPKNLTESAVPESDV
FT                   QNAVNTVDIPETDKESETGGQLPQEQPPQEQPPQEQPPQEQPPQEQPPQEQPPQEQPPQ
FT                   EQPPQEQPPQEQPPAEIRQGWVTSESGTQYYIDNVYVVGEKKIDGYWYYFDANGMMATG
FT                   WTVQEAKPDKQYYYGADGKMQYGWLTLENKTYYFHPSSGVMMKECERKIDGKYYYFNAD
FT                   GTMATGWTKQAARPDKIYYYNPDGTMSYGEKKIDGHWYYFHERSGVMQTGWVNHHNHTY
FT                   YYNPDGTMYYGEKKENGHWYYFKDRTGVMATGLTKHHNHTYYYNADGTMYYGEKKISGH
FT                   WYYFKDRTGVMATGWTKHHGKQYYYAADGKMCYGLQTIDGVRYYFHPTSGVYQWKNRKY
FT                   QNPSQYYQIQESSIQLSGGGYNLNIGYEGIKTAWVIRALKLGNAVGMGGAEYTRRVFNA
FT                   VKSFQSRHGLEATGITDLATWKALGYSEADWYSLGAYASPIRTSIYSSRSDCVEAMINR
FT                   AYDYLGDDYMIGASGAPGLGIDCSGLVMQALYAAGIDMSPINPVRHASPGYEYESANIW
FT                   TSSQLKHVSYGERQRGDIIIYCNSAGVVIHSAIYLGNNRVIEAWPNKVVVSSMINNQHP
FT                   RVLGIVRPFV"
FT   CDS             792053..793018
FT                   /transl_table=11
FT                   /locus_tag="CC1_07560"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79631"
FT                   /db_xref="GOA:D4J5L0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5L0"
FT                   /protein_id="CBK79631.1"
FT                   /translation="MNSRLFIVIPCYNEEEVLPITSKMFLEELEDLIHKGKISDNSRIL
FT                   FVNDGSKDKTWEIIENLAAENPHFIGMSQSRNRGHQNAVLAGLMESKDMCDITISIDCD
FT                   GQDDIKAMEAMVDAYHDGSEVVYGVRSKRDTDTFFKRFTAESFYKLLNKMGVEVVYNHA
FT                   DYRLISARVLKEFANFKEVNLFLRGMIPLVGFKSTSVYYERHERIAGESHYPLSKMLGL
FT                   AIDGITSLSIKPIRLITGLGIGVSILSFIGVIWAVISQLTGHAVTGWASTVCLVCFMGG
FT                   VQLICLGVLGEYIGKIYMEVKARPRYIISERTWEEKDKDK"
FT   CDS             complement(793084..795579)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07570"
FT                   /product="Ricin-type beta-trefoil lectin domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79632"
FT                   /db_xref="GOA:D4J5L1"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5L1"
FT                   /protein_id="CBK79632.1"
FT                   /translation="MKHNKWLFRLTAISLSTALFLTSISFPAIAAETSDSSTDSIEVET
FT                   TALNETNLYAEDTTAATTETENDSLSETQPINTIESDSEQHTITGFAPLSEDECHLYMS
FT                   YYDKPSEADLIAELPSALNVYLDGSSEPQTIPVSWKSIGDFDTTSFFYYEFDPVWDTDS
FT                   YDLADDIDLPYIGVWLDSSDGISLMAADNASSSNESVIFKYLTEDMGLNIAAACGVLAN
FT                   IQAESSFNPNIYGDSGSSYGICQWHNERFTALKNYTEEWDTLQGQLEYLHYELKTSYPS
FT                   LWSSLKSASNDTDGAYKTAYDWCTIFEKPANMYTLAVSRGNLAKNTYWPKYSGTIIPSN
FT                   DPVTISGASSPSTMTTGSSFDIRGTLSCSGTITSVTVGVYDTSDAMKIGKTVAPGTTSY
FT                   DLKSLDAAVKFSTLPAGGYRYKVMATSSAGTVTLVNKVFMLLGTDRTIADGIYQIANVQ
FT                   NTGYVLSVDHNKNTSGTNILLWTKSSILYRQFQFIYQGNGYYKIKNMGSGIYLGVAGQS
FT                   ASSGANVEQSNVGTLWQVLPDDTGSYYLVPKCSSTSAMDLYTGVIKKGQNIGTWNYNLR
FT                   KSQRWALSEIKAKPVISGKTVPTTMTQGSSFSIRGTISSGDPISSVTVGVYDTNGKMKI
FT                   GKTVSPNTTSYNLKNIDTSIKFGSLAASGYRYKVTAVTASGTTTLVNTAFMVLSNRRTI
FT                   SNGTHIIANNYNDNYVLSVDRNQNTSGTNVLLWTKSNVAYRKFQFVYQGNGYYKIKNVG
FT                   SGLYLGVANNGSKAGSNVQLSSSATLWQVLPDGTGAYYLVPNCSSICTLDLYTGILGKG
FT                   KNIDIWSYNLGKAQRWKLQ"
FT   CDS             795770..797440
FT                   /transl_table=11
FT                   /locus_tag="CC1_07580"
FT                   /product="FOG: Glucan-binding domain (YG repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79633"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5L2"
FT                   /protein_id="CBK79633.1"
FT                   /translation="MKKGLFTAAVIAAMMMTQPVMAQEVVEQTGEVVQQTEEDVSESDM
FT                   AADYQMETDLAAEINVFSADNNETPIVSADPTGQEGDKDAEEGDKEPEIKTGWQTEEGK
FT                   TYYYDEKGNKSVGEKKIDGKWYYFAEDGVMQIGFVQLTSKRVCYGEDGAMLYGKQSVDG
FT                   NGYYFNTKTGAVTNGEKKIDGKWYYFGEDGVMQTGVQTVPTKNGGKKKVCYGEDGAMLY
FT                   GKQKCGDNWYYLQAKTGAVMYGEQKIDGKWYYFDRQTGIMAVGIQTITMNSGSKKTVCY
FT                   GADGAMCYGEQKIDGKWYLFDYKTGAMQTGMVKLSKKTVYYGADGAMRYGEQKINGKWY
FT                   YFHMRTGAMQTGLQTVPLKNGGTKTVYYGTDGTMRYGEQKIKGKWYYFQQGTGAMQIGF
FT                   AKVSGKTVYYGEDGAMRYEHQLIDGDYYYFHPKTGAMQTGLLDFGGDRWGFYGADGKQI
FT                   PMIDAKTAIDAAHEFLKETISDEDLEIIKGHYVQYLSAEPEMVDGHSNPQYYIYAIVTE
FT                   DDADFDENTDEDDVIYGDVIRVDAVTKECVYDTDVSGID"
FT   CDS             797517..798356
FT                   /transl_table=11
FT                   /locus_tag="CC1_07590"
FT                   /product="Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79634"
FT                   /db_xref="GOA:D4J5L3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5L3"
FT                   /protein_id="CBK79634.1"
FT                   /translation="MSDTYYKPLKIAENIYHIYEPGNVYTTLIIGEEKALLIDTGYGFG
FT                   DLAAFVRTLTDKPLEVVLTHGHTDHCGGNYEFPTVYMNLMDVPTYLWYEATQKRLIVEK
FT                   FKRDRSAAGLPPVWPDDFDEKAWEQQHTRHFEPLKNGQIFDLGGREEEIIFMPGHTKGS
FT                   IVVFDHETGLLFSGDNISDSLWILFDTSAPLAEYVAHLMDIKLLPLTGIVASHRDIIFP
FT                   VTIINDLLRTISCINPQTDRGFVHPRTGQKALKHREPCEAVENIHYIYVVYDENKLQ"
FT   CDS             798508..798633
FT                   /transl_table=11
FT                   /locus_tag="CC1_07600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79635"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5L4"
FT                   /protein_id="CBK79635.1"
FT                   /translation="MVKHLRDSWCSAGAFYVYKHLPQNMERASIRIVSFQNGGCY"
FT   CDS             798633..799520
FT                   /transl_table=11
FT                   /locus_tag="CC1_07610"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79636"
FT                   /db_xref="GOA:D4J5L5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5L5"
FT                   /protein_id="CBK79636.1"
FT                   /translation="MKNVKAKTNEQIAMQVSANSIAVNLMLSIFKLIAGLMASSGAMIS
FT                   DAIHSASDVFSTIIVIIGVKISGKASDEDHPYGHDRFECVASIILAILLGVTGVGIGLT
FT                   GVQKLTAGHYDTLAVPGVLALAAAVISIVVKEIMYWYTRNAAKKINSGALMADAWHHRS
FT                   DALSSVGSFVGIFGARMGFPMLDPLASVVICLFVVKAAVDIFRDAISKMTDKSCDQKTV
FT                   NQMHDCIMHVQGVEGIDLLKTRSFGSKYYVDIEIKADGDKKLWEAHAIAENVHHVIEHQ
FT                   FPLVKHCMVHVNPA"
FT   CDS             799937..800878
FT                   /transl_table=11
FT                   /locus_tag="CC1_07620"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family (TC 3.A.1.7.1)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79637"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5L6"
FT                   /protein_id="CBK79637.1"
FT                   /translation="MKKFICTALTLAMVVGSLAGCGSSSSKETTAASGAATEAATEAAQ
FT                   TEAATGDFDTSKEISVNSREDGSGTRGAFIELFGVEEKAADGTKVDNTTVEANITNSTS
FT                   VMMTSVAGDPYAIGYISLGSLNDTVKAVKIDGAEATTDNVANGTYKVARPFNIVTKDGL
FT                   SDVAKDFVDYIMSAEGQDIIEQNGYIKIDQNAAAYAGSKPEGKIVVAGSSSVSPVMEKL
FT                   KEAYLAVNTNADIEIQTSDSTTGVTSTQEGICDIGMASRDLKDTETGVTATTIAQDGIA
FT                   VIVNNENPVENLTSDQVKSIFTGETTVWADVQ"
FT   CDS             800949..801803
FT                   /transl_table=11
FT                   /locus_tag="CC1_07630"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter membrane protein 1,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79638"
FT                   /db_xref="GOA:D4J5L7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5L7"
FT                   /protein_id="CBK79638.1"
FT                   /translation="MKVKEKVMEIVFLVAACVSILAVLLICVFLFSSGIPAIGKIGPLN
FT                   FLGGTVWKPSNNLFGILPMILGSIYVTAGAIIIGVPIGIFMAVFMARFCPGSLYKILKP
FT                   AVELLAGIPSIVYGFFGMEVLVPLLRNTFAVFNCKGNSMLAASILLGIMILPTIIGVSE
FT                   SAIRAVPNSYYEGSLALGADHERSVFFAVLPAAKSGILAGVVLGIGRAIGETMAVIMVA
FT                   GNQPAMAHSIFKGVRTMTANVVIEMGYATGIHREALIATGVVLFVFILLINLLFSVIKR
FT                   REK"
FT   CDS             801803..802687
FT                   /transl_table=11
FT                   /locus_tag="CC1_07640"
FT                   /product="phosphate ABC transporter membrane protein 2,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter membrane protein 2,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79639"
FT                   /db_xref="GOA:D4J5L8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5L8"
FT                   /protein_id="CBK79639.1"
FT                   /translation="MSKVDGVKAINKVTFGQRLKAYKRSKLSFLLAVLVLLSAIITIGV
FT                   LGYLIFYILIKGVPNLSPDLFSLTYTSENVSMIPAIINTLIMTILALLIAVPLGIFSAI
FT                   YMVEYAKKGNKLVGVVSVTTETLAGIPSIVYGLFGMLFFVTYCHWKYSILAGAFTLSIM
FT                   ILPSIMRTTQEALLSVPDSFREGSYGLGAGKLRTVFRIVLPSAIPGILAGIILAIGRIV
FT                   GETAALIFTAGTVPDIAKNLMSSGRTLAVHMYVLSGEGLHTDQAYATAVMLLVVVIIIN
FT                   GLSTLIAKKFTKA"
FT   CDS             802709..803461
FT                   /transl_table=11
FT                   /locus_tag="CC1_07650"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /function="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family (TC 3.A.1.7.1)"
FT                   /EC_number="3.6.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79640"
FT                   /db_xref="GOA:D4J5L9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5L9"
FT                   /protein_id="CBK79640.1"
FT                   /translation="MDKFNVEHLDLYYGDFKALKDINLKLPANEITAFIGPSGCGKSTF
FT                   LKSLNRMNDLVEGCKITGKVTLDGEDIYGSNMDVNVLRKKVGMVFQKPNPFPMSVYDNI
FT                   TYGPRTHGIHKKSQLDEIVERSLRGAAIWDELKDRLNKSALGLSGGQQQRLCIARALAV
FT                   QPDVILMDEPTSALDPISTSKIEDLVLELKKDYTIIMVTHNMQQATRVSDRTVFFLLGE
FT                   VIEDGKTEELFSMPRDKRTEDYITGRFG"
FT   CDS             803461..804117
FT                   /transl_table=11
FT                   /locus_tag="CC1_07660"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /function="phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79641"
FT                   /db_xref="GOA:D4J5M0"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5M0"
FT                   /protein_id="CBK79641.1"
FT                   /translation="MRNRFDLQLKQLNDEIIEMGNMIERAIEMGVYALIGHDTDKAKQT
FT                   IDYDMDIDHMERDIEALCMKLLLQQQPVARDLRQISSALKMITDMERIGDQASDIAELS
FT                   LQLGDVSDIDEISLIQKMANETMMMVVRGTEAYVTKDLDVAHNVIDNDDVVDDLFDQIK
FT                   MALVKRIQDNHVKSFEAADLLMVAKYFERIGDHATNIAEWVIYSITGKHVDEADN"
FT   CDS             804101..804421
FT                   /transl_table=11
FT                   /locus_tag="CC1_07670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79642"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5M1"
FT                   /protein_id="CBK79642.1"
FT                   /translation="MRQIIKPCNEIAGEIKERRERMMMKRMWYKLNILALRKHVRPVSL
FT                   FLLVHTLLWCDLTWLICQIGCDILEIPKALYQMNILLITAYAGVFGGLIGGMIYLMHEN
FT                   LT"
FT   CDS             804595..804747
FT                   /transl_table=11
FT                   /locus_tag="CC1_07680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79643"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5M2"
FT                   /protein_id="CBK79643.1"
FT                   /translation="MLWKSRYTGHFQIVCKTRKSAEPAINRPMIIHYIRPAECTENQWN
FT                   VVCKW"
FT   CDS             805029..807545
FT                   /transl_table=11
FT                   /locus_tag="CC1_07690"
FT                   /product="Lyzozyme M1 (1,4-beta-N-acetylmuramidase)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79644"
FT                   /db_xref="GOA:D4J5M3"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5M3"
FT                   /protein_id="CBK79644.1"
FT                   /translation="MKKFISAICVIALMMPSTLSAFADAGTADNLSGQQAVVVDVADST
FT                   ENAAETETETVVETESASVVSTEKASDTKATSDTSKASETEIMDETEDEPEVDPQYADD
FT                   PQYWKEMKKQYGVATMSAVPDEYIHNSRFSDCVVRYGVDVSSYQEDIDWAKAKDDGVEF
FT                   AIIRAGYRGWGSAGNPGKDPYLIKNIEGAQAQGIRVGVYIYSQAITPDEARQEVDWVIG
FT                   WLQGHQIDLPMVLDYEYAESYGALTGRLYNANLSRQAATNVCLAFCDYASQKGYIPMVY
FT                   ANKGMLENNLNASAISEKYPIWLAHYTYQTGYTGDYDFWQYSSQTTVDGIPGSVDGDFW
FT                   YEDADNYEVTLDNYTAPQCMEAGEGFSVEGRVSSGLKLDAVTVGVYDRNNHQVTGGTAY
FT                   PGTYTYDLSALDASVKISGLSGGMYHYKVIVQDSEGEHQMLDKVFSVCSNSPTIQDGTY
FT                   LIASAKNQNKVLSVDNNRNTSGTNILLWNRAEIPYRQFQFTYQGNGYYKIKNMGSGLYL
FT                   SAAGQRGSSGTNVEQSSSATLWQVLPDGAGGYYIVPNCSYTSCLDLYTGIPDNGKNIDL
FT                   WNYNMRGSQRWYLISSSAKPSISGQTIPGNMQQGSSFSIRGTVSSSEKITSVTVGAYDT
FT                   NGRMKIGKTAQTNAKGYNLKNLDTSIKFGSLPAGAYRYKVTVKTTTGTYTLINRIFMVK
FT                   SNGRTVSNGTYRLVLAQNKNYAISVDRDGKTSGTNLLLWANRNVAFRRFKFTYQSNGYY
FT                   TIKNEGSGLYLSVKGQGSASGSNVELSSSATQWQVLPDGTGSYYLVPKCSSTSCLDMYS
FT                   GIPANGKNIEIWNYNMGKAQRWSLVK"
FT   CDS             807918..809294
FT                   /transl_table=11
FT                   /locus_tag="CC1_07710"
FT                   /product="Uncharacterized FAD-dependent dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79645"
FT                   /db_xref="GOA:D4J5M4"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5M4"
FT                   /protein_id="CBK79645.1"
FT                   /translation="MKQYDVIIIGAGPGGIYSAWELAMKKPELKIAVFEKGRELEKRKC
FT                   PINGDTVKNCVGCPSCAIMSGFGGAGAFSDGKYNITNEFGGTLHEYIGKKKAMELMRYV
FT                   DDINMSHGGEGTRMYSTGDTKFKKICIQNNLHLLDASVRHLGTDVNYIVLEQLFAELKD
FT                   RVDFFFNCAVEHVTKEGEGYGVHTSDESYFCKQCIISVGRSGSKWMETVCQEMDIPTKS
FT                   NRVDIGVRVELPAVVFSDLTDELYESKIVYRTEKFEDLVRTFCMNPKGAVVAENTNGIV
FT                   TVNGHSYENPELQTENTNFALLVAKHFSEPFKDSNGYGESIARLSNMLGGGVIVQRFGD
FT                   LIRGRRSTEKRIRESLVVPTLSATPGDLSLVLPKRILDGIIEMIYALDKIAPGTANADT
FT                   LLYGVEVKFYNMEVSIDENLETRHKGLYIIGDGSGVTHSLSHASASGVFVARRIMEGIE
FT                   "
FT   CDS             complement(809275..809598)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07720"
FT                   /product="Predicted branched-chain amino acid permeases
FT                   (azaleucine resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79646"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5M5"
FT                   /protein_id="CBK79646.1"
FT                   /translation="MNTGHSILLIAIASGITFLIRAFPFLVFKKRQMPAFLKEIADKLP
FT                   PAIIAVLVIYCLKGPLTVLGTETIAAVIAIAGVVILHLWKRNTLLSVAAGTVLYMIFIR
FT                   CLP"
FT   CDS             complement(809598..810293)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07730"
FT                   /product="Predicted branched-chain amino acid permease
FT                   (azaleucine resistance)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79647"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5M6"
FT                   /protein_id="CBK79647.1"
FT                   /translation="MKKYIKYAFSRTLPVLFGYIFLGIAFGIVLQQAGFNFIWAFCISL
FT                   FLYAGSMQFVLVPLLASAASPLTVAVTTLFVNSRHVFYGLSFIESFKKMKTQLYMIFSL
FT                   SDETYSVLCSCKNEDPEEKNRPAWFLINLFDQSYWIIGSVIGALLGQVLPFDFTGIDFS
FT                   MTALFVVILLDQVLAHPKAAGRCAVTGLLAGVICLFIFGSGNFLLPALIITVLFVTAFA
FT                   QAERRKELP"
FT   CDS             810483..811631
FT                   /transl_table=11
FT                   /locus_tag="CC1_07740"
FT                   /product="Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79648"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5M7"
FT                   /protein_id="CBK79648.1"
FT                   /translation="MSEVAEITIKGLSDLAVGTYLLVDVRDAISFGYGAIPGAVSMPDI
FT                   VEQAEAGKLAKDKKYILYCMKGMNSARLVPKLRELDYDAVSLSGGYSAWLMASFGGDDK
FT                   QEEIEKSLRKGRFHKALFSKFAKAINTYDLIQPGDKIAVCISGGKDSMLMAKLFQELKR
FT                   HNKFPFELVFLVMDPGYSEVNRKLIENNARIMGVPITVFESQIFEAVYDIQKSPCYLCA
FT                   RMRRGHLYNKAKELGCNKIALGHHYDDVIETILMGMLYGAQVQTMMPKLHSSNFEGMEL
FT                   IRPMYLIREEDIKQWRDLNGLHFIQCACRFTDTCSSCRPDGTSASKRMEIKQLISELKK
FT                   VNPFVEGNIFKSVENVNLSTIIAYKQNGQVHHFLDTYNDQKE"
FT   CDS             811643..812239
FT                   /transl_table=11
FT                   /locus_tag="CC1_07750"
FT                   /product="Lysophospholipase L1 and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79649"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5M8"
FT                   /protein_id="CBK79649.1"
FT                   /translation="MAYKIICYGDSNTYGACGFAGGRHHADIRWTGILQNSGLYDVVNL
FT                   GENGREIPSDQWELNELAEILRREGDFDLLTVMLGTNDLLTMVRSGSAKVAVRMEQFLT
FT                   EFLQVQPMVCRPEQVLLIAPPSTALGEMAPSSNGLDEACRELGDYYADIAEKLHLHFVN
FT                   ASVWPVELGADGVHMTAKGHQIFAKELKKVLADIF"
FT   CDS             complement(812315..812974)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07760"
FT                   /product="butyryl-CoA:acetoacetate CoA-transferase beta
FT                   subunit"
FT                   /function="butyryl-CoA:acetoacetate CoA-transferase beta
FT                   subunit"
FT                   /EC_number="2.8.3.5"
FT                   /EC_number="2.8.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79650"
FT                   /db_xref="GOA:D4J5M9"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5M9"
FT                   /protein_id="CBK79650.1"
FT                   /translation="MAELTGRALIASRCAKFFKNGDFVNLGIDVPLMCGNYLPEGVELW
FT                   LEAEIGTVGSGPSPSWDDVDIDCIDAGGQPASIIPGGSVYDNETSFMFIRGGHIDAAVL
FT                   GTLQVDQEGSIANWTIPGKLVPGMGGAMDLCAGVKKIIVATDHCEKNGQSKILKKCTLP
FT                   LTGYQCVTDIVTERCYFEVTPEGLVLREVAPGYTVEDILACTDADVIVPDEVGVMQ"
FT   CDS             complement(812974..813540)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07770"
FT                   /product="Enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79651"
FT                   /db_xref="GOA:D4J5N0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5N0"
FT                   /protein_id="CBK79651.1"
FT                   /translation="MELKKLICTVNEDGIAVITMNYMKNLNAIDEQMADELMYIVDAAE
FT                   KDSNVKVVVLKGTDRAFSAGGDIGYFYGLIQAGGEVNMDGLISKVGVVADGLKRMSKMV
FT                   ITSVCGATAGTGVSLALGGDFVIAEVEEIVEVGELGPEEIHVPAPIVDMVYVRTGEKRP
FT                   LCPMWQRAKAKAEAKAREKAEGGNK"
FT   CDS             814931..815611
FT                   /transl_table=11
FT                   /locus_tag="CC1_07790"
FT                   /product="ABC-type metal ion transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79652"
FT                   /db_xref="GOA:D4J5N1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5N1"
FT                   /protein_id="CBK79652.1"
FT                   /translation="MVELLNQWLPNVMDRPDVFIKSIQETFIMVGWSGAISFVVGLFLG
FT                   VLITVTKPGNILEHPLVYQITDKVVNLFRSVPFIILLACLVPLSRLIMGTAIGVKGAIV
FT                   PLVFGCAPFFTRQIESALADVDPGLIEAAQSMGLDNKDIIFRVYLKESIAGIARGTTIT
FT                   IISLIGLTAMAGAIGAGGLGNFAIMYGHQRNMPDITYTTVVVLVIIVTVVQLIGNYIAK
FT                   KNTH"
FT   CDS             815645..816565
FT                   /transl_table=11
FT                   /locus_tag="CC1_07800"
FT                   /product="ABC-type metal ion transport system, periplasmic
FT                   component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79653"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5N2"
FT                   /protein_id="CBK79653.1"
FT                   /translation="MKKKGIIALAVTAVLALGALTGCGNTTAKETTGSTDTAAETTKAS
FT                   ETAGSEAAGSETAVSGETRVVKLGLTGVIYEDIWNPIKEELAKEGIDLEYVQFSDYSLP
FT                   NEALNAGEIDINAFQHHAYFNNDVEKNGYDITPIADTFIIAMNLYSDKVKSVDEIKDGD
FT                   VIAIPDDASNGGRALKVLASAGLITLKAEAGANPTVADIDTYNVKIEIKEMGAADIPSV
FT                   LPDVTAAVVNGNYALDYGIDPSTAIFEEKDYDDDSYFCLMAVRSSDADDAVYKRIVELF
FT                   QSETTKQIFQDEFNGYFVPAWEVQK"
FT   CDS             816798..818165
FT                   /transl_table=11
FT                   /locus_tag="CC1_07810"
FT                   /product="FAD/FMN-containing dehydrogenases"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79654"
FT                   /db_xref="GOA:D4J5N3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5N3"
FT                   /protein_id="CBK79654.1"
FT                   /translation="MKEALLSIIKDENRIITGQIDPQYLSDNLGRKKGTAEAVVFPVST
FT                   EEISGVMRYAWKNNLPVTPRGAGTNLVGSTVPSGYGIVLDVSLMNHVLELDEETFTATV
FT                   EPGVVLEDFQAYVESKGLFYPPDPGEKKATIGGNISTNAGGMRAVKYGVTRDYVMGLEL
FT                   VLADGTVVMAGSKNRKDTSGLDLKEIVIGSEGTLAVITKCILKLIPKPEDSLSVLLSFD
FT                   SLKAGIESVRQIIQANLNPTAMEFIERKVIQLGEDYLKMSFPEPEASAYVLTTLDGSRN
FT                   EINDHLEGLRKVAKESGALSVLPLEDKEEAARVWKIRGMLVKGVEAVSEQEPLDIVVPI
FT                   NQIDAFVNFVNAFEKECGMRMISFGHAGDGNVHLCVIRGDRDDKTWEKELDANLTVLYD
FT                   KAYALGGLASGEHGIGLSKQKYLLKASKPENIALMKRVKAAFDEKNILNAGISYNV"
FT   CDS             818181..819347
FT                   /transl_table=11
FT                   /locus_tag="CC1_07820"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79655"
FT                   /db_xref="GOA:D4J5N4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5N4"
FT                   /protein_id="CBK79655.1"
FT                   /translation="MKPLSDKTAGFTDSVIRRMTRVSNQYGAVNLSQGFPDFDPPKEIT
FT                   DRLREIAPHGPHQYALTWGAQNFREALARKHEHFSGMKVDPNKEIVVTCGSTEAMMASM
FT                   LTVCNPGDKVVVFSPFYENYGADAILSGAQPIYVPLNPPEFNFDANVLEDAMKQDGVKA
FT                   LILCNPSNPCGKVFTLEELKIIADLAIKYDLYVITDEVYEHILYKPNKHIYMATLPGMR
FT                   ERTIICNSLSKTYSITGWRLGYVIAPPEVIDRVKKVHDFLTVGAAAPLMEAVVPGLNFG
FT                   DDYYIELQNHYTHMKNLFVDGLKNIGLTFTEPQGAYYVMVDISEFGYKDDYEFCVDLAE
FT                   KVGVGAVPGSSFFREDVNQYIRFHFAKKDDTLNAALERLADIRKILKK"
FT   CDS             complement(820086..820289)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07840"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79656"
FT                   /db_xref="GOA:D4J5N5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5N5"
FT                   /protein_id="CBK79656.1"
FT                   /translation="MALLTNLKTYREKYNLKQADLAELVGVRRETIVNLERGKYNPSLK
FT                   LAMDIARVFHTTVEELFQYTDE"
FT   CDS             complement(820291..820698)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79657"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5N6"
FT                   /protein_id="CBK79657.1"
FT                   /translation="MRKVSLREIVADKIVFAILIALYYWMWARNDWHNYYTSIQYAVFT
FT                   FTFFYFISRASRLRKYKQERPDEMSEANLKRCDALCLKIGAAAIIVLSFVCAVGRLSIT
FT                   TDLIGYCLMGILIALAIIRTILFYIMDTKGV"
FT   CDS             821173..822549
FT                   /transl_table=11
FT                   /locus_tag="CC1_07860"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79658"
FT                   /db_xref="GOA:D4J5N7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5N7"
FT                   /protein_id="CBK79658.1"
FT                   /translation="MVNMQTNRSPLETEPLTKLLFRYSVPTTLTLMVNYIYNIVDQIFV
FT                   GQGVGITGMAAINIAFPLSILVNAVSLLLGDGCAANVSLCLGRREQENANKIFGQAVTW
FT                   IVASGIALAFICGIFAPHIVTLFGTTNTAYGESLAYMRVIAIGIPFQLICPAFTAMIRA
FT                   DGSPQYTMKCMMAGAVVNIILDPVFIFGLKMGVVGASIATVIGEMAAGILCLLYLRRLQ
FT                   SVQLEKGALRPTWPVLKMILQLGFPSLLTQGLTALVQIVLNNLMRVYGEVSIYGSDMAL
FT                   SVYGMMMKVYQLAHSMFVGVSSAIQPINGYNFGAKNYQRVRQTYRLATGIAVVISAVWW
FT                   LVYMVFSRQIAGLFVADNQLYFDCTQHCFRLYMMAFFLYGVHMTTASFFQGIGKPTRSL
FT                   LVPLIRQGVLLIPLALVMSRLIGLDGALLAAPAADTVTCLLCVALARTEFRRWEKAGML
FT                   "
FT   CDS             822766..823308
FT                   /transl_table=11
FT                   /locus_tag="CC1_07870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79659"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5N8"
FT                   /protein_id="CBK79659.1"
FT                   /translation="MILTYRQCLEKYGTDYRIKKAIEAGILFQKEKGLYSDKKICSELE
FT                   LMTAKYPRAIFAGSSAYYYYGLTDIIPDYYCLTTKREDSRIKDKRVKQSFVNDDLYDIG
FT                   KCLIEYQSVKIPIYSRERLLVDLIRFRGRIPFDYYKDVIGSYRRIINDMDFFSMEDYAE
FT                   KVKGGKKIMDAIQLEVL"
FT   CDS             823386..824408
FT                   /transl_table=11
FT                   /locus_tag="CC1_07880"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79660"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5N9"
FT                   /protein_id="CBK79660.1"
FT                   /translation="MDKLVDNKMINKIEKLLQEARTHVAVEVNNTLLRTYMEIGKLLVE
FT                   DINLHENEENYQNKTISMLSKELTRKFGKGFSRANIWNMITFYKEYGSVQTVSERLSWS
FT                   HYCELLSISDKAKRHFYEIECANSRWSVRELRRQIASSLFERLLLSDGKANKQKVLELS
FT                   LKGNEIVKPQDIVKDPYVFEFLGIPENKPMMESDLEEALVRQIEKFLLELGKGFMFVGT
FT                   QQRVTFGNVHYYVDMVFYNKILKSYVLIELKTIKLMPEAVGQLNMYLNYYAAEVNDEDD
FT                   NPPIGLILCTDKGNVDMQYALGGLSNNIFASKYVTYMPDKEQLIAQVEAVLSLKDKEKK
FT                   "
FT   CDS             complement(824641..826050)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07890"
FT                   /product="Transcriptional regulator containing PAS,
FT                   AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79661"
FT                   /db_xref="GOA:D4J5P0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5P0"
FT                   /protein_id="CBK79661.1"
FT                   /translation="MNLKKLAENYPKDFFNYAEKILDSYFGNIFITYRNEQILYVNERM
FT                   ANSVHMSKDEITNMSLAELRAKKLWLRSVSQEMYDSQKHPFNAYNVSKYGDELFTHIEP
FT                   IFDESGELIMSAQFSIPRQMLTSFSSYIDTEKSNLDQYKDIVKYLEVQNTFSDSIICES
FT                   QASKFVFEDARYFGSIDGTVLICGETGSGKDVIANYIYKNSKRAEQPFIPVNCSAIPSE
FT                   LMESEFFGYEKGAFTGARSSGKPGLFDMANNGTLFLDEIGELPLPMQAKLLRVLETGEF
FT                   MRIGGLKQVKTNVRIIAATNRDLRQMVSEKTFREDLYYRLNVMLLLIPPLRKRQEDIIP
FT                   MAERFLRKYNQKYNLKRILTPELCQCLLDYQYPGNVRELKNLIERYAITGHLDIVSSPE
FT                   SSNNPTPSMIADVQDNHLPFHEACALFEKQYIQKTLDECRGSVAKAANVLGIHRSLLYK
FT                   KIAKLGISRTD"
FT   CDS             826274..827587
FT                   /transl_table=11
FT                   /locus_tag="CC1_07900"
FT                   /product="citrate transporter, CitMHS family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79662"
FT                   /db_xref="GOA:D4J5P1"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5P1"
FT                   /protein_id="CBK79662.1"
FT                   /translation="MEMWLSIVGFLVVVAIIVTIMTKKLSTMVALSVIPLVGAILVGGA
FT                   ADIPAYLTAGINKVAANGVMFVFAILFFGSMMTAGAFDPIVKFIIKCCKGNPLYVCIGT
FT                   YVLSIVGHLDGSATTTVLLVCGAMIPIYKKMNMKLRNLAAILAMGSGLMNMSPWGGPTL
FT                   RAAVVMETDLTQFFKPILVPILITIAIGLIPVVMIGLSETKRLKKEGFDFSSVITEHEE
FT                   NEVTEENNLARPKLVVINLIMIVLVVGAMISGILSPGASFLVGTAVCWLINYRKMEEQQ
FT                   AIIRIHGANVVFVVSALYGAGVLMGVLTESGMAAAMANTLVNIIPAALTKFVPFIIGIF
FT                   AVPFSLLFDADTFYYGVLPVLTQSASALGLSGAGICYAAICGQLTLGWAITPLTPATLL
FT                   MCGMCDLDLGEHQKYTIKYVWGLSIILLIILTIFGVII"
FT   CDS             827642..828991
FT                   /transl_table=11
FT                   /locus_tag="CC1_07910"
FT                   /product="Protein of unknown function (DUF1446)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79663"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5P2"
FT                   /protein_id="CBK79663.1"
FT                   /translation="MKKIRIGGGAGFAGDRVDAAVILIEKGNLDYIIFECLAERTIGLA
FT                   KQEMLKDPTKGYSRLLEYRMSQVLKPAKEHGVKIITNMGAVNPHAAVMKVMEIAEEQGI
FT                   TGLKFAAVTGDSIDDSIEQYYDEEILEFKGKVADWKDQIVSANVYMGAEGIIEALRNGA
FT                   DVIITGRVADPTLTLAPLRYEYGWTPDDADKMGQCVLAGHLLECGGQVTGGYYADPGYK
FT                   EVPDLDNLGFPLVEFDEDGSFIITKAEGTGGIVCVDTCKEQMLYEIHNPTAYLTPDCIA
FT                   DFSAVKFTQEGENRVRAKGATSHGLTENLKVNVCYRDSFITDCEISYGGCNALERAKLA
FT                   GDMFVKRLDRLGISYNEVRVDYIGYNSLYKDKLAEYISEGRWGEIRLHVAVRTQDRENA
FT                   VRVSNEGDSIYTNGPTGGGGATMRISEIISVFSFFVPRNAVQTDVSYKEV"
FT   CDS             828999..829298
FT                   /transl_table=11
FT                   /locus_tag="CC1_07920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79664"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5P3"
FT                   /protein_id="CBK79664.1"
FT                   /translation="MKLKEICHSRTGDKGDISNVSLIPWNESDYELIKEKVTAEKVKDY
FT                   FSEICHGKVTRYEVDGICALNFVMEEALGGGVLRSLAMDKHGKALSSALLEMEI"
FT   CDS             complement(830241..830438)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07940"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79665"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5P4"
FT                   /protein_id="CBK79665.1"
FT                   /translation="MIDEYVPCEDILSQINAAKFALHKAGQVVLKGHIQHCVRYNIEHG
FT                   DADKTIANFTKAVEHFANMH"
FT   CDS             830618..831316
FT                   /transl_table=11
FT                   /locus_tag="CC1_07950"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79666"
FT                   /db_xref="GOA:D4J5P5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5P5"
FT                   /protein_id="CBK79666.1"
FT                   /translation="MFLEINQIRKSYGSGESRVEVLKGIDLYVEQGEFCVLLGPSGSGK
FT                   STLLNIIGGIDQADSGDICIRGERMADMKEKKLTLYRRKHLGYIFQMYNLIPNLTVREN
FT                   VEVGAYLSEKPLDVDELLHTLGLYDHRNKLPNQLSGGQQQRTAIGRAIVKNPDILLCDE
FT                   PTGALDYNTSKEILKLIEKVNQKYGNTVIMVTHNDAIKDMADRVVRLRDGMIRKNYLNE
FT                   QKLSADALDW"
FT   CDS             831329..833650
FT                   /transl_table=11
FT                   /locus_tag="CC1_07960"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79667"
FT                   /db_xref="GOA:D4J5P6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5P6"
FT                   /protein_id="CBK79667.1"
FT                   /translation="MKNPLNRRLTRELKGELSKYLVILILLIATIGFVSGFLVADGSML
FT                   TAYNESFEKYNIEDGHFSVVKQMNKAQKKNIESLGITLYDLFYVEEPLTTNESTLRIFA
FT                   NRKEINKVCLMEGSMPEKTDEIAIDRMYADNNRLKVGDVIASTDHSWRVTGLVALSDYS
FT                   ALFSDNNDSMFDAIKFGVAIVAEKGFAQLDQSKMTWQYAWKYNQSPKNDIEEKEMSDDL
FT                   MSDINSTIVLDSYTPRYLNQAINFTGEDMGSDRGMMIVLLYMVIVIMAFVFSVTISNTI
FT                   SKEANVIGTLRASGYTRSELVRHYMMVPIFVTLIGAGIGNILGYTVLKDVCAGMYYGSY
FT                   SLPTYVTLWNSEAFVLTTVVPVIMMAVITFAVLSYKLTLSPLKFLRRDLSRRKQKHALP
FT                   LSVHIPFFNRFRIRVILQNLSNYLVLFVGILFANMLLLFGLGLPVVLDHYKATIADNML
FT                   ANYQYLLQMPVGTVDEDHKLESMLNMMMFSRSVETDNSDAEKFSAYSLKMQQNATKTEE
FT                   VLLYGIEPDSQYIHLDLQPKDVYISSAYADKYLLQPGDTITLKETYEDKSYNLTVTGIY
FT                   EYEGALDVFMSREALNDMFDLGSDYFCGYFSNSEITDIDSKYIGSVIDIDDMTRISRQL
FT                   EQSMGSMMYMVDGFAMLIFIVLMYLLSKIIIEKNAQSISMSKILGYTNSEISRLYIVST
FT                   LVMVVVCILISMPIVYEGLVYIFRWMLINSMSGWIPIYLGKSIYVKMFIMGVVSYGVVA
FT                   LLEYRRIQKIPMDTALKNVE"
FT   CDS             833666..835831
FT                   /transl_table=11
FT                   /locus_tag="CC1_07970"
FT                   /product="X-X-X-Leu-X-X-Gly heptad repeats"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79668"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5P7"
FT                   /protein_id="CBK79668.1"
FT                   /translation="MKIKKRLKDKAGMLVLTAVLVVAALIASVVSGCTEQVKAAENEVS
FT                   AETSADTDNSSHKETKTTDADKNGSKNDQVSDSDKSADKGRDKTDKTETVYAKADSSGK
FT                   IYDVSVEAVLKNEGEGEITDYSTLSDIRNTEGDEDFTEKGSNVVVWENHGEDIHYKGTS
FT                   TDALPVDVKITYYLNDKQVTADELKGQSGKVRIRFDYTNKYSQKVEVNGKTVEVSTPFV
FT                   VCSAMFLSSDNFSNIEVTNGKTVEMDDQNIVIGYAMPGLSDSLQLKDYEATEDVDIPEY
FT                   VELTADVTDFSLDFTATIISNGMFGDMDTDDLKDVDDLIDAMDDLSEASGKLVDGTAEL
FT                   ADGADELGDYFGQYLTGVSALDEGSAGLMQGLKAVNDQKGTLLEGAKGLQQGLETLNQS
FT                   LATVNLDGQSVDMQPMSAAAAALGQDAAKLKEALTAMQSTLNDVKTFANDAKSYKESVQ
FT                   KKTSEAKGALDAVDLSEAEKKAESEAKEQASKAVKEALAGTDLTDDQKAEIQSKVKDSI
FT                   SISDTTDTASGKIVEAKDALKDMPDLEIPEFSLGTDTITVLVEDMQKQLQVLGQYSEAL
FT                   SNLGTQMSGLSGTLEQLKTGVSSLADGSGQLTAGVQALNDGIEQLYQGSVALNNGTVQL
FT                   ITAGNAISKGFDGLSEGTDALSDGMKEFDKEGIQELKKLAGDDLENIIIRVRALKKADE
FT                   QYNNFSGLEKGKTGSVRFIVETDEIKK"
FT   CDS             complement(835837..836499)
FT                   /transl_table=11
FT                   /locus_tag="CC1_07980"
FT                   /product="cAMP-binding proteins-catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79669"
FT                   /db_xref="GOA:D4J5P8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5P8"
FT                   /protein_id="CBK79669.1"
FT                   /translation="MREYFPVIKKSALFQGISEDDLDGMLTCLGARTASYSKNQTIFWE
FT                   GEPASLIGVVLSGKVQIAKDDFFGNRNIISMMEPSQLFGEAFACAGIEKLPVTATAVTD
FT                   SEILLLDCRRVITTCGNSCEFHNQIIANLLRIVAAKNIMLNQKIELTSKRTTKEKLMSY
FT                   LLMQAKQNKSRIFAIPYDRQELADYLCVERSAMSAELSKLRREGRIDYHKNQFKILE"
FT   CDS             836585..838183
FT                   /transl_table=11
FT                   /locus_tag="CC1_07990"
FT                   /product="hydroxylamine reductase"
FT                   /EC_number="1.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_07990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79670"
FT                   /db_xref="GOA:D4J5P9"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5P9"
FT                   /protein_id="CBK79670.1"
FT                   /translation="MENNMFCFQCEQTAGCGGCTGRAGVCGKQADTAQLQDQLTGALIG
FT                   LARAAEGNVPGPSTDKVIIEGLFTTVTNVNFNNETINALIDRVHEEKHKLVPDCESCGS
FT                   PCGRTEDYDMKGIWEADEDIRSLKSLILFGIRGMAAYAYHAAVLGYTDKDVNQFFYKAL
FT                   FVIGENWKVDELLPVVMEVGEVNLKCMALLDKANTETYGTPEPTTVPLTVEKGPFIVVT
FT                   GHDLYDLKQLLEQTKDKGINIYTHGEMLPAHAYPELKKYPHLKGNFGTAWQNQQKEFAN
FT                   MPAPVLFTTNCLMPPKASYADRVFTTEMVSYPEIVHIGDEKDFSPVIEKALELGGYKED
FT                   QHFTGINGGHEVTTGFGHGTILSVADKVVEAVKAGDIRHFFLVGGCDGARPGRNYFTDF
FT                   VKQTPKDSIVLTLACGKYRFNDLDLGTIGGLPRLMDMGQCNDAYGAIQVAVALASAFDC
FT                   GVNDLPLSMVLSWYEQKAVCILLTLLHLGIKNILLGPTLPAFISPNVLKILVDTYNIGA
FT                   VTTPEADMARCLGRE"
FT   CDS             838510..839895
FT                   /transl_table=11
FT                   /locus_tag="CC1_08000"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79671"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Q0"
FT                   /protein_id="CBK79671.1"
FT                   /translation="MKKRSLLALAMVGALSVSMLAGCGSSSTKETQAPAGSEAATEAAT
FT                   EAAKESTAAGDGKVYYLNFKPEQDAQWQELAKLYTEETGVPVTVLTAASGNYETTLKSE
FT                   MAKTDAPTLFQVNGPVGLASWKDYCYDLKDSKIAGELTNDEFALMDGDSMAGIGYVIET
FT                   YGIIYNKALLEKAGYTQDDIKSFDDLKKVAEDITARKDELGFSAFTSAGMDGSSDWRFK
FT                   THLANLPIYYEYKADDIDTTDAIKGTYLDNYRNIWNLYINNATCDPSLLSTKTGDDAVA
FT                   EFVTEQAVFYQNGTWAYNDVAELGDDNLGMLPIYIGAEGEDKQGLCTGTENYWCVNSKA
FT                   SEADIQATLDFMYWCVTSEVGTKAMCGGEGAMPSGDAGMGFVIPFKGNLESSNPLVNIA
FT                   NQYVADGYTPVAWTFSTMPSEEWKNGVGSALTTYAADQTDDNWAAVVSAFVDGWAKEAA
FT                   ASK"
FT   CDS             840889..841725
FT                   /transl_table=11
FT                   /locus_tag="CC1_08020"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79672"
FT                   /db_xref="GOA:D4J5Q1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Q1"
FT                   /protein_id="CBK79672.1"
FT                   /translation="MRNKKTLSWIGTIFFTILGLIYIAPIIIVLLNSFKKKSFINLEPF
FT                   KLPSAKNFIGLDNYTTALDQYGLLKAVGWTVFITVGSVIVILICTSMCAWAITRVKNKF
FT                   TNAFYLLCVFSMVVPFQMVMFTLSLIADRLKLNTPWGIIIIYLGFGAGLAVFMFCGFVK
FT                   SIPIEIEEAAMIDGCNPVRTFFSVVLPIMQPTYISVGILETMWIWNDFLLPYLVLDINK
FT                   YKTISIAIQYMKGSYGRVDMGAIMAALIMAVIPVIIFYLACQKYIIEGVAAGAVKG"
FT   CDS             844594..845988
FT                   /transl_table=11
FT                   /locus_tag="CC1_08060"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79673"
FT                   /db_xref="GOA:D4J5Q2"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Q2"
FT                   /protein_id="CBK79673.1"
FT                   /translation="MFIVQLIEATYNFLWGDLFQIPLPVGGSIGISLLIIFLVPAAVYF
FT                   TIRTRFMQVRLFPDMVRALTEQKSGENGLSPFQTLIVSTATRVGMGNLVGVVAAISAGG
FT                   AGAVFWMWIMAVLGSATAFIEATLAQLYKEKDPLYGGYRGGPAYYIHRFFERKEGRKKR
FT                   YVLPAVLFAISGLICWCGISQVISNSVSESFNNAFNIPPLYTTIALVILAAVIVLRKNA
FT                   TVKVLDVLVPVMAVLYFVITLIIIGMNITALPGVFQRIFEEAFGIRQFAGGSFGAILMN
FT                   GVKRGLFSNEAGSGSAPCAAAAAEGKTPVTMGLVQSLGVFIDTIVICSCTAFIMLLVPQ
FT                   EVTDGLSGMALLQTAMEFHLGRFGVIFIAVTLAMFSFSTFLGILFYARSNVAYLFGDKW
FT                   CWQMAYKVLALVMLFIGGIAAYTFVWDLGDVGIGLMTLFNISILYPLSKEAFQALGQYE
FT                   KEKAEK"
FT   CDS             complement(846104..847342)
FT                   /transl_table=11
FT                   /locus_tag="CC1_08070"
FT                   /product="Sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79674"
FT                   /db_xref="GOA:D4J5Q3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Q3"
FT                   /protein_id="CBK79674.1"
FT                   /translation="MSHEKNTYFHYAWCIVIGGFIIMALLHSMIQTCFSLFLPAVTDYM
FT                   HISNTAFSGCSSIVAIASMLVAPKMGKYMQNSHQFKSIMTICIIGTGLSYASYGFATSI
FT                   IHMYISGFCLGIFSCGATILPITIILVRWFHKNTGLAIGITLSGSGIGGSIISPFLTDF
FT                   ISTYGWRRSFILFGILMIVIEVPVAYFMMIPNPEDIGYKPYGMTSDRASASPLKNLPFQ
FT                   DLKKHTFFYIYLIGIFCICVAGYGSLGYLSASLTENYGPSLAYAIIPFFLFLLTPAKIF
FT                   LGWLYDHIRTEICTIYVSFTFATAFILLQISNNESLMWIMAIFFSLGISAGTVIPSFIT
FT                   YDFFDSDDFGSLFGFVYAVCMGAMAVGNPLLAAIYDLTNSYDLAWSACASFCILSGICI
FT                   VYIAEKKQRHTML"
FT   CDS             complement(847368..848180)
FT                   /transl_table=11
FT                   /locus_tag="CC1_08080"
FT                   /product="Response regulator containing CheY-like receiver
FT                   and SARP domains"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79675"
FT                   /db_xref="GOA:D4J5Q4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Q4"
FT                   /protein_id="CBK79675.1"
FT                   /translation="MKIISIDDELWSSDLLKMMIQRIKSNNPDFKDIEFTGSFTNVTDA
FT                   IDYLKKHKTDLIFLDIEMPEMNGLAFANHLEELHIDSKIVFLTAYSRYALEAWRTSAID
FT                   YILKPFDQSQLERALSRALPDIPNISAQKALFLRCFPKFELLINGEPKAFQSKRAKELL
FT                   AYLIHNQCCWVSIGTLVYDLFGDLDEKSCKSHYRVILARLKKELSSCHMEHMIETRYGF
FT                   IRVNIPENLCDYYMLLAGYNDDLFHGEYMQDYSWAEIERSRLIKKYSL"
FT   CDS             complement(848184..850028)
FT                   /transl_table=11
FT                   /locus_tag="CC1_08090"
FT                   /product="Putative regulator of cell autolysis"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79676"
FT                   /db_xref="GOA:D4J5Q5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Q5"
FT                   /protein_id="CBK79676.1"
FT                   /translation="MKREKPNTDFIFFVVCIISLICIAARIIFSIIQLNTAENADLIEN
FT                   AYCKVNSMDIDKQEQYALYGQWQYYPEQHIYSAPGIHSDKGFSYVNIPIQWNMFDKRFW
FT                   NTSGWASYQLTLDIADHHDYVLYLHSMPIHFNIYVDGQPCPLINNQLSLFNRGIFISPG
FT                   THTIVIECSSNWLTGLYASPWLYTYSRFQKQTHFFTGIWEISIGGFIIAILYGIIFLRK
FT                   SHESLFFKKQIINTGLFFIFYQLTFCEFSLDINLLSRFLPISKIHILTLLSAIALGTHT
FT                   IKMFEDHLSNMILRNTLDVVVKLFFSLLVLKTFIGNYVNLQFIIDLFIMFIIGILIICI
FT                   LQERSPQAYGIIESLLSVLLIGTAIVCSTSANMHKFSSEVYFILPFTFMITLLCYGCFI
FT                   ASEFARIEKEAEHKQLLEQELLNAKMAYLTSQIQPHFQYNTLAMIQELCYSNPLKAADA
FT                   IVKFSSVLRRRVDFNHYSQLEPFEKELSCITDYIDLQRMRFGDTLIFHSDIQYTQFDIP
FT                   PLSIQTLIENAIYHGIRKKKSGGILTLKTYKENNIIYIIVSDNGIGFDLNVLHNSKGNG
FT                   IHNSQARIVSLTGGSLNIASTPGTGTTVTIEIPQKRTF"
FT   CDS             850227..851462
FT                   /transl_table=11
FT                   /locus_tag="CC1_08100"
FT                   /product="Imidazolonepropionase and related
FT                   amidohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79677"
FT                   /db_xref="GOA:D4J5Q6"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Q6"
FT                   /protein_id="CBK79677.1"
FT                   /translation="MKTVMYCGTLFDGTTGQTAKNQVIVIEENKITEILEKSQYQPEAD
FT                   DKIIDCSDQFVMPGLIDMHVHLAFCGKAALTELTEPPELVALKALNNAQEDLMGGFTTV
FT                   RDAGFSSLRGAQAVRDAISSGIVWGPRVFTSGMYITQTGGHLATTYSQESFGQQIFKPV
FT                   NTADSPDEVRTACRMMLKYGADQLKLMVTGGVLSNSGGVGEQNMSYEEIVAAVEVGKMH
FT                   NRVVSCHAHGTSGILAAAKAGVTSIEHCTMVDDEGIEYMLKNNVAAVPTLIVLHVLADG
FT                   LSKGVAQSAVDKAAYLLPKHADNIRNAYERGVRCVFGTDTGTPLGPHGYQHKEFVYMAE
FT                   AGISSEDILLAATRYAAELLKWEDQIGTIQPGKFADIIAVKGNPLEDISSLNRDTISFI
FT                   MKDGIVYKNEQN"
FT   CDS             851476..852744
FT                   /transl_table=11
FT                   /locus_tag="CC1_08110"
FT                   /product="Sugar phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79678"
FT                   /db_xref="GOA:D4J5Q7"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Q7"
FT                   /protein_id="CBK79678.1"
FT                   /translation="MEKKRGKFKFHYGFAIVFGGFIIMALLHSMLQTCFSLFLVPVTEG
FT                   MGIARTQFSLCTSIVAIVMMIISPKMGKVLGKKHTRAVFTICVAGMGISYATYGFATQI
FT                   WHMYISAALVGFFSCGAVVMPVSIIIANWFQKGRGTAMSIALAGSGIGGTIITPILNRI
FT                   IMNQGYSKAFLIFGILMVVVEVPVAFFIMRPKPSDMGLEPYGADSGTETAQGEVKKASK
FT                   SIKLSDLKKQPFFYIYLVGIFAMCICGYGSLGQLSAALTDSYGATFSAVIISFFLLVLT
FT                   PAKISLGWIYDKFGSKVGTIYVMTVYGIAFLLLAFVTNSPMIMYFMAICFSIGVSSGTV
FT                   SPSVVTAATFGSEDYGAIFGFVNCFSMAAMVIGSPAIASVYDMTGSYKIAWITCFALSI
FT                   LSIICLVYADIRCKKVYADCIES"
FT   CDS             853019..853474
FT                   /transl_table=11
FT                   /locus_tag="CC1_08120"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79679"
FT                   /db_xref="GOA:D4J5Q8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Q8"
FT                   /protein_id="CBK79679.1"
FT                   /translation="MRNTEKDKYWREMIRKQGELRHFGSMAIRKSSKGDLASAQEVDLL
FT                   FRVALSGGMMTPGQLAADMGVSKTIISRLIDSLEKKALIIKERTLNDRRSYGIRVTDDG
FT                   KEEVDRMYYYYLDPLYTLREQMTSDDFEKLFRLIEAANTILSNANSK"
FT   CDS             853555..854616
FT                   /transl_table=11
FT                   /locus_tag="CC1_08130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79680"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Q9"
FT                   /protein_id="CBK79680.1"
FT                   /translation="MTFYQELQLSSAGSKQLIKNTTDKKEKRRHILIYNFKVYLVMAFC
FT                   FALVTLYSMIFGSDNSVAGVVFLLALLVLRQADFGIRTHHGLLCIAGIFAILIVGPRVS
FT                   NMVSPWAAFVINIGCIFTLMLLGCHNVIMYNHSTFVLGYLLLQGYDVTGRSYYLRVISL
FT                   LVGMLICMAVFYKNQRKRPYRRHFLDIFREFNIRSARNWWYIKLTLVVSTALLIFSLLG
FT                   LPRAMWAGIACMSVCLPFSSDIVERAKKRGPYNIVGCLIFLVLYYILPPSMYPYIGIIG
FT                   GIGVGYSAGYAWQTVFNTFGALSIASGLFGAAGAVALRIGANVFGSVYTVLFDKAMNGL
FT                   IQLVNSRECRKAV"
FT   CDS             complement(854853..856190)
FT                   /transl_table=11
FT                   /locus_tag="CC1_08140"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79681"
FT                   /db_xref="GOA:D4J5R0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5R0"
FT                   /protein_id="CBK79681.1"
FT                   /translation="MSHSINGHFTPASLLKFAAPSIIMMMFMSLYTIIDGIFISRFVGS
FT                   NALSSLNIVYPIINIVFAIGTMLGTGGNAIISRYMGEGKDKEAKECMTQFVIISLLISV
FT                   VILVLTHMNLTSISRILGASDLLLADCDSYLSVVVSFAPAAILQCLFQSYFVTAGRPNL
FT                   GLVLTMIAGILNAVLDYVFIVVCQMGISGAALATGIGQSIPAIAGLLFFTFSKGSLHFT
FT                   HFRLHLRELGQACYNGSSEMISQLSNAIVTFLFNIVMMRLAGEQGVAAITILLYGQFLF
FT                   NAFYLGFSIGIGPIVGFQYGAGNKKELKNIHRIAFLFVGISSVLLTIAAVTLSTPIVSV
FT                   FTHDADTFRLAAPGFKIFAFNFLFSGLNITSSGFFTALSNGLVSAIISFCRTLVFIVLC
FT                   LLILPAFLDLTGAWIAIPVAEFLTLLLSTVMHVRYFFRPGKQNYFI"
FT   CDS             856334..857161
FT                   /transl_table=11
FT                   /locus_tag="CC1_08150"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79682"
FT                   /db_xref="GOA:D4J5R1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5R1"
FT                   /protein_id="CBK79682.1"
FT                   /translation="MDRHEYMTTGEFASAMGVSKDTLFHYDDIGLFCPEKVSENGYRYY
FT                   SIYQIETFDTIRMLRDLGMPLKEIRDMLEHRSPERVMHVFAEREQQIDREIEKLRAMKQ
FT                   WLSRRREKIADAEKTDFSEVTIQEFPERYYLYGHVADGLEKSIYRKTRELIAEFKRSGM
FT                   RSDYDVAYIQYDENVQKGKFTEYDNTILLVDERPATGQYEILPGGRYITAYHVGHWMNI
FT                   GQTYERLLQYKERHHLKTESFYIERYVVDNFIAKEIEDYVTEVAVRILDASDR"
FT   CDS             857217..858272
FT                   /transl_table=11
FT                   /locus_tag="CC1_08160"
FT                   /product="Histidinol-phosphate/aromatic aminotransferase
FT                   and cobyric acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79683"
FT                   /db_xref="GOA:D4J5R2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5R2"
FT                   /protein_id="CBK79683.1"
FT                   /translation="MKNIHGGDIYQYNNILDFSANINPLGAPESVNRSIADAIGQIGHY
FT                   PEMYSDSLRKAIGEKYHIDSSQIICGNGAADVIYRYVYAVRPKKILVTAPCFAEYEGAW
FT                   RSLWASHDVPEAVVYALNHRDFCIKEDILTLIEQKMPDVVFLCNPNNPTGVLIPAQILT
FT                   SIAECCRDNKIRLFLDECFLDFTGREEENSLVRKLKEYPNLMILKAFTKMYAMAGVRLG
FT                   FGLTADTELVDRMYQAGPPWNVSVLASAAGKAALKEDDFVKETVQYIRKEKEYLYQTLD
FT                   TLRVRYWKSAVNYILLKSDRTLKERLITEGILIRDCSNYRNLSEGYFRIAVKSHADNEK
FT                   LTAALKVVLER"
FT   CDS             858273..858356
FT                   /transl_table=11
FT                   /locus_tag="CC1_08170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79684"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5R3"
FT                   /protein_id="CBK79684.1"
FT                   /translation="MNWSSEITGERLNRQNEKIFEKMIKSD"
FT   CDS             858466..859008
FT                   /transl_table=11
FT                   /locus_tag="CC1_08180"
FT                   /product="Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79685"
FT                   /db_xref="GOA:D4J5R4"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5R4"
FT                   /protein_id="CBK79685.1"
FT                   /translation="MKKWVCTVCGYVYEGENPPEFCPVCKQPASKFKEQSEDKTWAAEH
FT                   VVGVAQGAPEDIMADLRANFEGECSEVGMYLAMARVAHREGYPEIGLYWEKAAYEEAEH
FT                   AAKFAELLGEVVTDSTKKNLEMRVDAEHGATEGKFDLAKRAKALNLDAIHDTVHEMARD
FT                   EARHGKAFEGLLKRYFG"
FT   CDS             859283..860140
FT                   /transl_table=11
FT                   /locus_tag="CC1_08190"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79686"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5R5"
FT                   /protein_id="CBK79686.1"
FT                   /translation="MKKINFNEVIKEIVILTVAVAIIAAAVYFFLVPSHTSVSSISGLG
FT                   IVLANFVPLPLSAITMILNVVLLIIGFLTCGREFGVKTVYTSIMLPVFIGIFEKVFAGY
FT                   DSMTGSQELDVICYILVVSVGLSILFNRNASSGGLDIVAKIMNKYLRMELGKAMSLSGM
FT                   CVALSAALVYDKKTVVLSILGTYFNGIVLDHFIFDHNIKRRVCIITEKEEALRQFIIHE
FT                   LHSGATIYEAIGAYNKEKHNEIITIVDKSEYQKLMAYINHEDPKAFITVYNVSHMQYQP
FT                   KVWE"
FT   CDS             860228..860818
FT                   /transl_table=11
FT                   /locus_tag="CC1_08200"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79687"
FT                   /db_xref="GOA:D4J5R6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5R6"
FT                   /protein_id="CBK79687.1"
FT                   /translation="MEFKDVVYGRRSVRKFKDTPVDDKILEEIVDAALWAPSGVNLQPW
FT                   YYVVIRTPEKMTRLKEMMSVVSDRDRPHLEERFSAHPEVVKTTLSFISTLGGAPAVVLA
FT                   FRDKPDYTWALLDEGVVQSVAASMENLVLSAYDHGVSSCWMTAANQAHMTKDLRDEFAP
FT                   GHGELVGIIALGYNAAEEAPKAPKRKADKFVLI"
FT   CDS             860960..861097
FT                   /transl_table=11
FT                   /locus_tag="CC1_08210"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79688"
FT                   /db_xref="GOA:D4J5R7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5R7"
FT                   /protein_id="CBK79688.1"
FT                   /translation="MDTVKIGKYIAGKRKALGMTQAQVAEKLGMSNKSVSKWERGVSHS
FT                   "
FT   CDS             861309..862001
FT                   /transl_table=11
FT                   /locus_tag="CC1_08220"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79689"
FT                   /db_xref="GOA:D4J5R8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5R8"
FT                   /protein_id="CBK79689.1"
FT                   /translation="MEQILIVEDDSFLNKMLDYNLTADGYGVTSALNARTAAEAIRQRE
FT                   FDLVLLDINLPDGNGFELCKLIKPQHPDTIVIFLTANDQESDQIRGYEVGAVDYITKPF
FT                   VIRALQRKIKAMFAMLEHHKPAKDIYDDGRLFLDFSEQTASLNGKPLTLSPMEYKMLNL
FT                   FRKNPRQVLTRGQLLEKLWDIDEKYVDEHTLTTSISRIRSKIESDGGAPYIKTVYGMGY
FT                   QWTGGEAK"
FT   CDS             861998..863029
FT                   /transl_table=11
FT                   /locus_tag="CC1_08230"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79690"
FT                   /db_xref="GOA:D4J5R9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5R9"
FT                   /protein_id="CBK79690.1"
FT                   /translation="MKFQNLSVKRLFGWVAIGLVLSMSGITIALFFVTKQTAVLLTGGA
FT                   MLLCALAGIFVLTQAFGKRLSQFTVDLCQTLDHMITGNEAPKRPEDSETQLARIGHRLA
FT                   RLYQIMQENRRRVDEERQELQTLVSDISHQVKTPVSNLKMATDTLLEKPMTEAERTDFI
FT                   RGIRTQTDKLDFLFQALVKTSRLETGVIQLNKKPVCLFDTVAQAMSGIVYAAEKKKIAV
FT                   SVDCPENLTFSHDSKWTSEALFNLLDNAVKYTPAGGKITVSVIPWEMYVEIKVADTGKG
FT                   ISESNQAAIFRRFYREEEVHEQQGVGIGLYLTREIVTRQGGYIKVVSEPGKGSEFSIML
FT                   PTK"
FT   CDS             863251..863916
FT                   /transl_table=11
FT                   /locus_tag="CC1_08240"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79691"
FT                   /db_xref="GOA:D4J5S0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5S0"
FT                   /protein_id="CBK79691.1"
FT                   /translation="MSVLQAIDLKKYYGTEPNITRALDGVNFSVEDGEFVAVVGTSGSG
FT                   KSTLLHMMGGLDTPTSGTVIVRGEELAKKNDEQLTIFRRRNIGFIFQNYNLVPILNVYE
FT                   NIVLPVELDGDTVDQKFLDEIVHLLGLEDKLKNMPNNLSGGQQQRVAIARALITKPAIV
FT                   LADEPTGNLDSKTSAEVLGLIKRTSAEFRQTVVMITHNDDIARLADRIVRIEDGRIVE"
FT   CDS             863931..866423
FT                   /transl_table=11
FT                   /locus_tag="CC1_08250"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79692"
FT                   /db_xref="GOA:D4J5S1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5S1"
FT                   /protein_id="CBK79692.1"
FT                   /translation="MTWPFENDTSDIEKKLAKRSLHRERQRNLFAIIALVLTAFMITAT
FT                   FSIGFSYFETYQMQQIRLMGTTADVGITNVTENQLVEISKSNLVLDVGIQQRLGSVDTE
FT                   QLQNARLGIVWIDDTEWEHHRLPTISGVVGNYPSSKNEIMLPTWVLEQMGISDPQIGME
FT                   IVLSYQIGDSYDYVTDTFLLSGYYTDYIPMRTNNRGYVYVSSVFKDSLNVSLDNSVTAM
FT                   IRFQGNDNADKNCERLRREIDFTEGQTFEIVPLEQANGGTIILAVIILAVFISFSGYLL
FT                   IYNILYVSVIKDVQFYGRLKTIGTTQRQIKRIIYKQAIRISCIGIPIGLLLGAVVSFGI
FT                   VPYFLNMMYSTNSDVGTKVSFSPFIFIGAAIFTFITVMIASMKPAKIAGSVSPIAALQY
FT                   TAASTKSSARNCSKMKLSRMAWNNVFRNAKSTTLVFASLFFGLSLFLVVTGLLHGLSPE
FT                   NYVSQWGVSDFALTYSIHEREDLISSEMVSEIGQLDGIENLRLTYAPYPQVAVDVVYDD
FT                   AVFHEFLASLDGVNGIDFSDPAKLENYQQNFFSGVFGIDSAYLEEINKTLNLPIDTSAF
FT                   EQGKVVLLSKTVEDLIQPGQEITIQTQNGQHSFIVANGYLNEGFRAGGGNERGTAPDLY
FT                   ISQTALKELFPQYRVFRVAFDTDGQHDESILQELKQITASQANIDIISRYERRKEMQEY
FT                   LITAKVLGTGLSVILLLVGVMNFVNTMVVNVNTRRYELAVLESIGMTKRQIKRMLFMEG
FT                   FYYWGVSLSLAVTIGTAIFILLYMIFSKVAYYAVFSYPFIPLVLVSGLVLLICLIVPIW
FT                   VYKTDVNLPVVERLRLTE"
FT   CDS             complement(866680..867720)
FT                   /transl_table=11
FT                   /locus_tag="CC1_08260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79693"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5S2"
FT                   /protein_id="CBK79693.1"
FT                   /translation="MENQFIRHEPCFERILFVLTLDRKKMKERILIGEEQQIRFRLNGS
FT                   QNAEVLCDMTRPLGTFLINFERDTDRDWNLYGLSPLRQALHSNRWKQPELEQAASEFLW
FT                   EKYLSNDPLKMYVAFRIWNSYLLAREPRDRNAACDRFMDKMSRLTGVFQNETMSFDRET
FT                   GKPKQFQAGSLYFKGAPSEDTRLDLWFPDNRRTEECVSAYASLYPLITYYLNRLNDWGL
FT                   CFRRCKVCGKYFLAKSQRYELCSDKCRKAQALQNKREFDERSRENNYDLLYKNECQNWR
FT                   NKINRVKNTAGFPADRLEKIQASFSDFKKEALQRKKAVKTGTASPKEFTDWLYQQSNVI
FT                   VELTEI"
FT   CDS             867925..867996
FT                   /transl_table=11
FT                   /locus_tag="CC1_08270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79694"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5S3"
FT                   /protein_id="CBK79694.1"
FT                   /translation="MQGNTAGMGQENGFWGERQQEAF"
FT   CDS             868023..868247
FT                   /transl_table=11
FT                   /locus_tag="CC1_08280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79695"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5S4"
FT                   /protein_id="CBK79695.1"
FT                   /translation="MNDKKRLNSYEDLPLVLDVADIQRIMGISRASAYELVHTPGFPAF
FT                   RRGRLIKVSKIAFFEWMAKGSETVPGSDK"
FT   CDS             868395..868598
FT                   /transl_table=11
FT                   /locus_tag="CC1_08290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79696"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5S5"
FT                   /protein_id="CBK79696.1"
FT                   /translation="MARMSNKRRLEWSFFLNDRSRITYNELCRKCQHECKQSFRAVVVD
FT                   CPKYLSKRSKKKDKTAGNGKIP"
FT   CDS             868885..869202
FT                   /transl_table=11
FT                   /locus_tag="CC1_08300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79697"
FT                   /db_xref="InterPro:IPR024215"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5S6"
FT                   /protein_id="CBK79697.1"
FT                   /translation="MEKSLEQLKQEYEKTTVLLEQEKRKMQRLKNRQAYLESGSRKQRT
FT                   HRLITRGAAIESIAPQTKELSEAEFYSLMESILNLPQAEHFIRSATENHARISGQEKGG
FT                   D"
FT   CDS             869364..870677
FT                   /transl_table=11
FT                   /locus_tag="CC1_08310"
FT                   /product="plasmid mobilization system relaxase"
FT                   /function="plasmid mobilization system relaxase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79698"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5S7"
FT                   /protein_id="CBK79698.1"
FT                   /translation="MLPPHAPEIYLDRATLWNAVENCEKHPKAQLAYSFDIAMQNELTL
FT                   EENMELARKFVQEQFVTKGMIADLAFHSPEKEDGGIPNPHFHVMTTMRPLNPDGTWGQK
FT                   QRREYLLDEDGNRIRDKNGDYMFNAVHTTDWHEPETLEHWREQWAAAVNTKFEEKGLDV
FT                   RIDHRSYVRQGLDLIPTVHEGANVRQMEAKGIRTEKGELNRWIKATNRLMQDVRKKIKA
FT                   LFVWMAEVKEELSKPQTPSLADLLIAYYNQRNAGAWSNKARTGNLKQFAEAVNYLTENK
FT                   LLTLEDLQERLSSVNEEFEALSDSMKKKSARIKELQELIREGENYQRLKPVHTELNNIK
FT                   FKKQREKFETSHDAELRLFYAARRILKEKLDGKPIALKAWKQEYAQLKTEYAELSPQHK
FT                   PLREEVIRLRQVQNAVDTALRRRGQPQAVQRKKHEMEL"
FT   CDS             872961..873146
FT                   /transl_table=11
FT                   /locus_tag="CC1_08340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79699"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5S8"
FT                   /protein_id="CBK79699.1"
FT                   /translation="MAKSKNESNNKNSGTLLTEKDGTQYFVMGKVRIKVSEHFAQDGKP
FT                   LDSLLEDVIQHAAAAS"
FT   CDS             874949..875722
FT                   /transl_table=11
FT                   /locus_tag="CC1_08360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79700"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5S9"
FT                   /protein_id="CBK79700.1"
FT                   /translation="MALCEILGISLNEFIAGEDIEPAEVVQKSEKNLIQVTEDGEHRKR
FT                   KLKKIIVLLAVFGSVMAGILIYLLTFKNQPRVNYIEPLAQDSTEMNIAGMLSDADGAFL
FT                   YDYAVDKEIKGISFELAVYKKGVLESESSLGTISWSELEQISLRNGMIAVISDFQNFKV
FT                   KLIAAGEGTKFSTEFNILEDVQGRNYYGRSAKSIDEGKTTIQPGKEIGILALYYAKNAL
FT                   SVTPFSDIGNGNMDSCNDEVYYLTVKFEKDDDALN"
FT   CDS             875971..876504
FT                   /transl_table=11
FT                   /locus_tag="CC1_08370"
FT                   /product="death-on-curing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79701"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5T0"
FT                   /protein_id="CBK79701.1"
FT                   /translation="MKQTQNNSFDSQQVLSVIEQYSTALDLLDAYDHQTMERPKGNEAA
FT                   YVLTYEECMHVIACMRFGKESDLFGKEKDDSFKGSIGNIYQSFAGMEVYPTLEEKAAHL
FT                   LYFVTKNHSFFDGNKRIAAAMFLYFLDKNGALFDNGQKTIDDHTLVALTIMIAESRPDE
FT                   MEMMITVVMNCMKK"
FT   CDS             876593..876913
FT                   /transl_table=11
FT                   /locus_tag="CC1_08380"
FT                   /product="Predicted pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79702"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011394"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5T1"
FT                   /protein_id="CBK79702.1"
FT                   /translation="MKQETIDRIRKFTEDREWEQFHSPGNLAKSIVIEAAELLECFQWN
FT                   DKEYDLQHVKEELADVMVYSQNLLDALGLDVDEIINMKMTMNEAKYPVEKAKGSAKKYN
FT                   EL"
FT   CDS             877027..878067
FT                   /transl_table=11
FT                   /locus_tag="CC1_08390"
FT                   /product="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79703"
FT                   /db_xref="GOA:D4J5T2"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5T2"
FT                   /protein_id="CBK79703.1"
FT                   /translation="MQTYTYVSKGKFELREKSKPVIMHERDAIVKVTLASICSSDLHIK
FT                   HGSVPRAVPGITVGHEMVGIVEEVGGAVTHVKPGDRVTVNVETFCGECYFCKKGYVNNC
FT                   TDQNGGWALGCRIDGGQAEYVRVPFADQGLNKIPDEVTERQALFVGDVLATGYWATRIS
FT                   EITEDDTVLIIGAGPTGICTLLCVMLKNPKHIIMCEKDEERIQFINKHYPDVLTVSPEE
FT                   CEKFVKKTSDHGGADVVLEVAGAESTFRLAWECARPNAIVTIVALYDKAQSLPLPDMYG
FT                   KNLIFKIGGVDGCDCDETLKLIADGKINTEPLITHTYPLSKIEAAYDLFENKRDGVIKV
FT                   AVECWH"
FT   CDS             878162..879310
FT                   /transl_table=11
FT                   /locus_tag="CC1_08400"
FT                   /product="isoaspartyl dipeptidase IadA"
FT                   /EC_number="3.4.19.5"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79704"
FT                   /db_xref="GOA:D4J5T3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010229"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5T3"
FT                   /protein_id="CBK79704.1"
FT                   /translation="MKLIQNIDVYAPQHLGKKDVLTINDKIVKVKDAGSISADGFLSEA
FT                   EIINGEGLLLTPGFIDSHVHVLGGGGEGGFANRTPEATMEGITKFGVTTVVGCLGTDGI
FT                   GRDMCALVAKTKGLNEQGMSAYCYTGNYHIPVRTLTDSIVKDIMMIQEIIGTGEIAISD
FT                   HRSSQPTFEEFTRVVADTRLGGVLSGKAGIVNVHLGDSPRCLDLIERVVDETEIPASQI
FT                   LPTHINRNEMLFGKSIEYALKGGAVDFTGNENIDYWETIRDEVRVCNGIKRMLDAGVNP
FT                   NRMTISSDGQGSLPIYSSDGEFLGMGVGQSSCLLKEVKECVFKTEIPLEIAISTITSNP
FT                   ADILRLKGKGKIEEGYDADLCILDQELQLVEVIAKGNTVYTK"
FT   CDS             879451..879528
FT                   /transl_table=11
FT                   /locus_tag="CC1_08410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79705"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5T4"
FT                   /protein_id="CBK79705.1"
FT                   /translation="MGPICIKNEYKRKGYGKILLDYSLE"
FT   CDS             879651..880562
FT                   /transl_table=11
FT                   /locus_tag="CC1_08420"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79706"
FT                   /db_xref="GOA:D4J5T5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5T5"
FT                   /protein_id="CBK79706.1"
FT                   /translation="MESDIIKISHLNKSFGEVKAVNDLSFRVKKGELFAFLGVNGAGKS
FT                   TTISILCGLLKKDSGTVQVNRIETDKAGAQTKRMLGVVFQDSVLDKPLTVKENLMSRAA
FT                   LYGITGNAFDKRLQELVEILNFDEFLNRPVGKLSGGQRRRIDIARALLHRPEILILDEP
FT                   TTGLDPQTRQLIWNVIEKLQKTENMTVFLTTHYMEEAANAGYVVILDKGSVAAEGTPFE
FT                   LKNDYVQDIVSVYGVSEDEIKTLNREYKKIRDGYQIKVKNTKEATELIVEHQDLFMDYE
FT                   VVKGGMDDVFLAVTGKKLGGEH"
FT   CDS             880562..881461
FT                   /transl_table=11
FT                   /locus_tag="CC1_08430"
FT                   /product="ABC-2 type transporter."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79707"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5T6"
FT                   /protein_id="CBK79707.1"
FT                   /translation="MRTVLALMNRNRKLFFKDKGMLFTAMITPVILIVLYATFLARVFK
FT                   DSFTAAIPDMITISDKLINGTVAAQLTASLMAVSCITVTFCVNLTMVQDKANGTRKDFD
FT                   VSPVSKGKIYLGYFLSTVANSLMVNGIAFILCLGYLLKMGWYMNVAEVLWVLFDMILLV
FT                   LFGSTLSSIISFPLTTQGQLSAVGTIVSAGYGFICGAYMPISNFGSGLQKALSYLPSTY
FT                   ATSLIKNHMLHGVFMEMERKNYPDEMVEAIRDTLDCNPVFHGNVVGVNQMIGIMMGSIA
FT                   VFGIIYYFVTLLPEGEGR"
FT   CDS             881518..881583
FT                   /transl_table=11
FT                   /locus_tag="CC1_08440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79708"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5T7"
FT                   /protein_id="CBK79708.1"
FT                   /translation="MESKEKNTKEKILEEALKLFA"
FT   CDS             881593..882132
FT                   /transl_table=11
FT                   /locus_tag="CC1_08450"
FT                   /product="transcriptional regulator, TetR family"
FT                   /function="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79709"
FT                   /db_xref="GOA:D4J5T8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5T8"
FT                   /protein_id="CBK79709.1"
FT                   /translation="MGTSMNDIASKLGVTKAALYKHYKSKQEILDSIIEKMNELDIARV
FT                   KQYEMPEGDLEKVTAEYKETAFDKIKQFTKVQFLHWTEEEFSSCFRKMLTLEQYREPQM
FT                   AQLYQNYLVSGPLTYMEALFSGMLGDAGKARQTALDFYGPIFLLYSIYDGTENKSHVIK
FT                   LLEEHMDQFLQEMQIR"
FT   CDS             882269..883042
FT                   /transl_table=11
FT                   /locus_tag="CC1_08460"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79710"
FT                   /db_xref="GOA:D4J5T9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025685"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5T9"
FT                   /protein_id="CBK79710.1"
FT                   /translation="MKVEIVERFMEYIKVTNENIDKEHICCAISNNNDIQVSSKKEWLK
FT                   EQFREGLVFLKSVERGKCFIEYLPAENAWNPITADGYMYIDCLWVAGSFKGHGYGADLL
FT                   DACMEDSKSKGKKGLCILSSGKKKPFLSDPKFLRYKGFKVCDEADNGIQLWYLPFAADA
FT                   PLPEFKECARHPHIEEKGYVLYYTSQCPFNAKYVPIVEEVARENGVSFQAIHLQSKEEA
FT                   QNAPTPVTTYALFYNGAYLTNEQMNDRKFLKLLSK"
FT   CDS             883273..883521
FT                   /transl_table=11
FT                   /locus_tag="CC1_08480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79711"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5U0"
FT                   /protein_id="CBK79711.1"
FT                   /translation="MRVETERMYLYPLRDEEMRLVIEKESDPEMKQAYTEMLEGSLSNS
FT                   DKRIWYAIWNMELKDESGIIVGDFCFKGFGADYVELE"
FT   CDS             883527..883910
FT                   /transl_table=11
FT                   /locus_tag="CC1_08490"
FT                   /product="Lactoylglutathione lyase and related lyases"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79712"
FT                   /db_xref="GOA:D4J5U1"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5U1"
FT                   /protein_id="CBK79712.1"
FT                   /translation="MRIEHVALYVKDLENAKKFFMKYLGAKSNDGYHNQKTGFCSYFLT
FT                   FEDGARIEIMNIPEMADLPKKLARTGYSHIAFSVGSIEKVDALTAELKADGYEVISGPR
FT                   TTGDGYYESCIVAVEDNQIEITV"
FT   CDS             883944..884258
FT                   /transl_table=11
FT                   /locus_tag="CC1_08500"
FT                   /product="Regulator of competence-specific genes"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79713"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5U2"
FT                   /protein_id="CBK79713.1"
FT                   /translation="MASGKEYLHFILEQLSDLEEINYRAMMGEYILYYRSRIAGGIYDD
FT                   RLLVKPTKSAVSYMVTATYELPYEGAKEMLLVEDVDSKEYLTGLFKAMYDELPVHKAHK
FT                   "
FT   CDS             884369..885622
FT                   /transl_table=11
FT                   /locus_tag="CC1_08510"
FT                   /product="Predicted transcriptional regulator containing an
FT                   HTH domain and an uncharacterized domain shared with the
FT                   mammalian protein Schlafen"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79714"
FT                   /db_xref="GOA:D4J5U3"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5U3"
FT                   /protein_id="CBK79714.1"
FT                   /translation="MRETRILEFKETITNTFLKTVSAFSNYDGGTILFGVDDDGNVKGL
FT                   PDVKQACLDIENKINDSISPQPNYTLEIQNNDQMIKLTVTSGLQKPYLYKSKAYKRNDT
FT                   ATIEVDTLEFSRLVLDGKNIRFEELPCKDQDLSFEVLQCKLKESIQIETFNQDTLRTLN
FT                   LYDNVNGFNNAAGLLADKNHFPGIDIVKFGENISIIQKRTTIENTSVLDAYEKALAVFR
FT                   DYYQYEVIQGADRKKMEKIPEAAFREAIANALIHRVWDVDSHIRVSMFDDRVEVVSPGG
FT                   LPSGITAEEYLSGKLSVLRNRNLANVFYRLGFVEIFGTGITRIKQLYAEGLMKPDFEVS
FT                   ENAIKIVLPLFEKDANLSEDEKVIYKLLSKTMLKPISEIAPYVPFGKSKTTQLLKAMEK
FT                   KGVIAVEGKGRGTKYIIK"
FT   CDS             886100..886462
FT                   /transl_table=11
FT                   /locus_tag="CC1_08520"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79715"
FT                   /db_xref="GOA:D4J5U4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5U4"
FT                   /protein_id="CBK79715.1"
FT                   /translation="MGFGSYFRDLRIEKQITQKQIADVIKKKPMLVSNVENGKNGPFSD
FT                   NDLKKIVSFLELSKDEERQLYKEAAKARGKLPQEMQAYIIKNDEAYYLLETLARNELGS
FT                   ESLSQIIQMVEEQILC"
FT   CDS             886456..888021
FT                   /transl_table=11
FT                   /locus_tag="CC1_08530"
FT                   /product="DNA-methyltransferase (dcm)"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79716"
FT                   /db_xref="GOA:D4J5U5"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5U5"
FT                   /protein_id="CBK79716.1"
FT                   /translation="MLKTIDLFAGAGGLSYGFESTGEFLIVAAAENNKNARKTYIENHK
FT                   GRNDIRLIPDVRDYDFSALASEFDGIDVVIGGPPCQGFSNANRQKNHIISMNNSLVKEY
FT                   FRAVKEIRPKAFVMENVSMLSSETHRFYDSAKDHDVVTSLGVQMREDELVLADSDYNGY
FT                   SLMNIIQADAVADYKISDELFQLLNVLYKNRNSEERLSKYIKNKSKLIIDKIASQAEEV
FT                   KNNLGILNRIVDMINTEQISACFTELGQFIKFQKTFRLKEELDSNEIIYEIENDLQTGK
FT                   IIARVKSYSVIEYVNKILGDDYKKNSGVINSLWFGVPQERRRFIMIGVRSDIIQEKEIE
FT                   MPEGNGAEIVTVGQAIGDLRDYEVDEEDNEPEKLPYDSSTENLSDYARIMRKGSEGISN
FT                   HIVPKSRDKAKARFAALKEGENFHNLDNGLKDNYAVPERTQNSIYLRLDSNRPSGTVIN
FT                   VRKSMWIHPAIDRAISVREAARLQSFPDRFVFKGTKDAQYQQVGNAVPPLMAKGIAETV
FT                   LKYL"
FT   CDS             888282..888515
FT                   /transl_table=11
FT                   /locus_tag="CC1_08540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79717"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5U6"
FT                   /protein_id="CBK79717.1"
FT                   /translation="MKNEETKREKFVRIAEARTNKIINMIQLLGNCSNQSLYEYSQKDV
FT                   NKIFNTIQTELDEAKKRYSKQDSQKGSKFTLD"
FT   CDS             888535..889887
FT                   /transl_table=11
FT                   /locus_tag="CC1_08550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79718"
FT                   /db_xref="GOA:D4J5U7"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5U7"
FT                   /protein_id="CBK79718.1"
FT                   /translation="MFQWKENFQWIFSNLGSSDKVGVNESGIGIFKRQPYKGLAKEILQ
FT                   NVTDAKNPELPDEVPVRAKFELIYVDLEDIPGHERLREVIHKCSEYYSDGDDGEKLRSI
FT                   RDAADKYFSGDTKVPVLKISDYNTTGLRGVKEETGSNWTGLVRERSATNKSNASSGAFG
FT                   VGKFAPYNFTSVRTVLYSTKTINDEYAFQGKAILTTFKEDGKNKQNIGLFADKDSENFD
FT                   AVFDVNDIAPVFRRTETGTDIFVLGFVKEDEDTWVEQSAISVIEYFFYSIYRGKLEVEI
FT                   RDGEKRVEITQNNLGEMITFYEKYCKEHMADDTAFKFTAPSYWRLLQDSRHKIIKAPFE
FT                   YNGKSMGNYELYLLTGDDVVEKKVLEMRQAGMKIREDCAFRIPMNFSEYWISKISRNKE
FT                   RDDEINKKLLFLGWTVIRFWGNDIKKNTDECIRVIEETIFEIKTMDDYTEE"
FT   CDS             complement(890350..890490)
FT                   /transl_table=11
FT                   /locus_tag="CC1_08560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79719"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5U8"
FT                   /protein_id="CBK79719.1"
FT                   /translation="MIQDCKRHPEDMSVKQWCDAHSITVANYYYQMKEVRKPLLMRSVE
FT                   C"
FT   CDS             complement(890725..891072)
FT                   /transl_table=11
FT                   /locus_tag="CC1_08570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79720"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5U9"
FT                   /protein_id="CBK79720.1"
FT                   /translation="MNSTATQIAKIISTPNPSAPITTHALAELGNGSMQNGLRRIISYF
FT                   AAESASKLRLGRIQGVLVGVIGTAVVAGGIAFIYQETQKKQLETEGKIILNTLQKSANE
FT                   NTIYCRENSLR"
FT   CDS             891238..892059
FT                   /transl_table=11
FT                   /locus_tag="CC1_08580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79721"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5V0"
FT                   /protein_id="CBK79721.1"
FT                   /translation="MFLKGKPLDEYKGFSYRLVKVAIEKGIEDTRELADALYENAECKK
FT                   AITIRKTQKKNPDDPLKNIMKNIQIHLNTEDAYEVNSRYMYAYSTIFDCSYDYLYGRSE
FT                   IMTADLDVRDICNKTGLSEKAVVNLVERHQDEIESSGFSVIEWWSELLYGIPFTAIPMA
FT                   FMAYASRLVELHDIDKKIEACEKAVKDVSMDDPIMKCLMDDDNQKTLKHIRRDKEDSIL
FT                   GAHHKMVSCVADLLNQYAEQWAEKQHPEYSELYYHGEINKRKIINEALKTQ"
FT   CDS             892360..892515
FT                   /transl_table=11
FT                   /locus_tag="CC1_08590"
FT                   /product="Cation transporter/ATPase, N-terminus."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79722"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5V1"
FT                   /protein_id="CBK79722.1"
FT                   /translation="MPKTTLIDCCIKKYAYREVSQIYQELEISVEGLSQSQVELMRENY
FT                   GINRRF"
FT   CDS             895373..895903
FT                   /transl_table=11
FT                   /locus_tag="CC1_08610"
FT                   /product="Replication initiator protein A (RepA)
FT                   N-terminus."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79723"
FT                   /db_xref="InterPro:IPR010724"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5V2"
FT                   /protein_id="CBK79723.1"
FT                   /translation="MKYEYMKESEQMLQYFQFPKFLLKLRISQTAKFLYMILYDRALIS
FT                   RKNSWIDKYGNVYLIFPIEELSAQIGKCKSSVKTALKELDDVGLLVRRSGGFSKPNHLY
FT                   VKIPSDEIGLQLVENKAVEKMVATESEKQPSSGRKNGCAGVGNVAPSKVTEKYKRNKYH
FT                   EVNYCYGEGESLR"
FT   CDS             895900..895944
FT                   /transl_table=11
FT                   /locus_tag="CC1_08620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79724"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5V3"
FT                   /protein_id="CBK79724.1"
FT                   /translation="MREEDTVCVGSDGL"
FT   CDS             896005..896715
FT                   /transl_table=11
FT                   /locus_tag="CC1_08630"
FT                   /product="phage DNA replication protein (predicted
FT                   replicative helicase loader)"
FT                   /function="phage DNA replication protein (predicted
FT                   replicative helicase loader)"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79725"
FT                   /db_xref="GOA:D4J5V4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5V4"
FT                   /protein_id="CBK79725.1"
FT                   /translation="MKKHSRQCACDRKTYEEEQKYFKDKEHRELVSRNTSICFDESRME
FT                   EWTFENADMSDAVMHRAKNYVDNWEEMKRNHIGCLFWGAVGTGKSFIAGCIANELLKQE
FT                   VTVKMTNFNTIIDDIFPLADKTEYINALASYQLLIIDDLGVERNSEYALGIIFSVIDRR
FT                   IRSGRPLIITTNLPLKEIKSETMLDKRRIYDRILGMCTPMYVGGTSKREVIASMKMEKA
FT                   KTLLNTDRGEEECE"
FT   CDS             896712..896921
FT                   /transl_table=11
FT                   /locus_tag="CC1_08640"
FT                   /product="Excisionase from transposon Tn916."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79726"
FT                   /db_xref="InterPro:IPR015122"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5V5"
FT                   /protein_id="CBK79726.1"
FT                   /translation="MNHTEKTIPVWKKYSLNVSEAAEYYGIGEKRLRQIAGENEGADFI
FT                   LEVGSHIRFKRKLFEDYLDTASTV"
FT   CDS             897057..898325
FT                   /transl_table=11
FT                   /locus_tag="CC1_08650"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79727"
FT                   /db_xref="GOA:D4J5V6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5V6"
FT                   /protein_id="CBK79727.1"
FT                   /translation="MSEKRRDHRGRILHNGEIQLSDGRYRFKYVDEMGKERCVYSWRLD
FT                   HNDATPKGKRRTLSHREMEKKIQADHFEQIATNGGNMTVLELVEKYTSTKTGVRPTTVA
FT                   GYGTVINLLKKDPFGKRRIDMVRISDAKCWLIHLQQVEKKSYSSIHSIRGVLRPAFQLA
FT                   VDDDLIRKNPFQFQLMEVVVNDSVTREAISRAEERKFLRFVKEDPHFCRYYEGIYILFK
FT                   TGLRISEFCGLTISDIDFKEHTINIDHQLQKKSKIGDYIQETKTTSGTRKIPMTADVEK
FT                   CFRKIIEKRNPPKVEPMVDGKSGFLYFDKNESICYSLHWEHYFQHIIQKYNNTYKVQMP
FT                   VITPHVCRHTYCSNMAKSGMNPKTLQYLMGHSDISVTMNVYTHIGFDDAEEELKRMEEF
FT                   RKAQAEVEQKKEKPMSQKMFKGG"
FT   gap             899262..899770
FT                   /estimated_length=509
FT   CDS             899776..900225
FT                   /transl_table=11
FT                   /locus_tag="CC1_08670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79728"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5V7"
FT                   /protein_id="CBK79728.1"
FT                   /translation="MELIEIKEKNRLLVNTFSQCYINALETLLNEYSDFELLQVLYKEY
FT                   KNQSKDGIDYTSINVENNSAHYLYSRTYDRIYISLNYNPAHGDDKYCNLTISYNISSPS
FT                   VSRTFRVKFAENNTMVCEIDDDMELLNVATIIKVLNIIVEDYISE"
FT   CDS             900736..901104
FT                   /transl_table=11
FT                   /locus_tag="CC1_08680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79729"
FT                   /db_xref="GOA:D4J5V8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5V8"
FT                   /protein_id="CBK79729.1"
FT                   /translation="MKFDELFEQRSLVASKLKDCIRDMGYTKVSFAAKADISRPTLDKL
FT                   LNGSIDSKSSFDRHLQKILKLLNMTVEDLMLYHSAPSKLSTATVYSQNAPMDHEMNETA
FT                   KKQYNLLLDVIDLCAIYY"
FT   CDS             901170..901952
FT                   /transl_table=11
FT                   /locus_tag="CC1_08690"
FT                   /product="Domain of unknown function (DUF955)."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79730"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5V9"
FT                   /protein_id="CBK79730.1"
FT                   /translation="MSELITAQNLELVIKKNHEIKEEVLAQAIRLQTNPSIMKVASAPQ
FT                   LALLILQGFGLIQMPIEDKYWSGAIFVKDEKIIPVINTALPRANQYFTAWHEIYHLIFD
FT                   KVSFDHFIETDNTLEERKAEYFAACMLLNGVDRYFTELPEAEFVSKIFHCMSTFQAPYK
FT                   AVLVCLYEYAIQSENEKLCGKIKEVFDLQFDDLPNRFRMLGLDDSLVCPSYVVNTSSLQ
FT                   EKIKRTRDENPELRYHEDNEEYLKNIMAEIALITRRSE"
FT   CDS             901949..902791
FT                   /transl_table=11
FT                   /locus_tag="CC1_08700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79731"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5W0"
FT                   /protein_id="CBK79731.1"
FT                   /translation="MIDIEKIENIDDKKHIALLDTSSISFMQGLKMKGIQPEVILKDYD
FT                   LILIPEWVLTEINDAPGRANYVQGLIEMGYPIYCIKEESYSDLTNNEEGNLYQIVLAST
FT                   HQLARIRSYLRRHVEKVDPLDMEAYEEWIQRLYDEWPISEEMLSTGRIKKKNAGEVSIT
FT                   ILSEIISWYYPETKTLTIYSQDGDTYDFQRKAETDLRKVFVAKAPVPISYKSNDAILCQ
FT                   LVREGKINIDDINEYRKDVRKITYSKEQDDYAIVLVTELVNNELFAKLVSDKTVHIIF"
FT   CDS             902990..903868
FT                   /transl_table=11
FT                   /locus_tag="CC1_08710"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79732"
FT                   /db_xref="GOA:D4J5W1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5W1"
FT                   /protein_id="CBK79732.1"
FT                   /translation="MELRLLRYFLTVAKEQSFTKAAEQLHITQPTLSRQMASFEENLGI
FT                   TLFIRSGKKITLTDEGILLKRRAMEILNLEERTLKELNRKEDVVEGNITIGCGEFAAVE
FT                   TLAKICKTYKEKYPLVQIVLHTATADTVYEMMNKGLVDIALFLEPVDTEGLDYIRISDC
FT                   DHWCVGMRPDDPLAEKEFIKKEDLIGKPLILPERTNVQSELANWFGKDFSKLQIAFTSN
FT                   LGTNAGVMAANGLGYPVSIEGAAKYWREDILVQRRISPEITTSTVIAWRRNIPYSLAIR
FT                   KMIEEINAFRA"
FT   CDS             903994..904266
FT                   /transl_table=11
FT                   /locus_tag="CC1_08720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79733"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5W2"
FT                   /protein_id="CBK79733.1"
FT                   /translation="MSKKLVAFFSASGTTKKAAKMIAEEAKADLFEIEPKIPYTKADLD
FT                   WMDKKSRSSVEMSDKKYRPEIMKKEMDMSSYDEILLGFPKMEYSL"
FT   CDS             complement(904574..904810)
FT                   /transl_table=11
FT                   /locus_tag="CC1_08730"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79734"
FT                   /db_xref="GOA:D4J5W3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5W3"
FT                   /protein_id="CBK79734.1"
FT                   /translation="MQKIRPDMDIGKNIQAIRYKNNMTQDQVVAKLNLMGISITKSTYA
FT                   KLETNRMNIKASELVALAKLFHTDINAFFSGLL"
FT   CDS             904940..905332
FT                   /transl_table=11
FT                   /locus_tag="CC1_08740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79735"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5W4"
FT                   /protein_id="CBK79735.1"
FT                   /translation="MDVEMEKRKFLNLCGKRDRALLSGEKRMTLGDMERLTYLTEFFEL
FT                   ENYGIALWKEFGDDVKEPFEAMMKMLDEPECIEDRWLDDEAKGEKWLLEFQELALTEEY
FT                   REWIRNYIDKKYEERGLPYPTGADFD"
FT   CDS             905989..906801
FT                   /transl_table=11
FT                   /locus_tag="CC1_08760"
FT                   /product="plasmid segregation actin-type ATPase ParM"
FT                   /function="plasmid segregation actin-type ATPase ParM"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79736"
FT                   /db_xref="InterPro:IPR009440"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5W5"
FT                   /protein_id="CBK79736.1"
FT                   /translation="MQNVLQYQGKYYVCGTGRQTLVKNKTSNDNYYLLTLAAIAEEIKH
FT                   RKAERKTEVILAVGLPLSSFGREKQGFREYLLRKEQPVRFLYESELYEITIKDVKLFPQ
FT                   GYSALALHPEYLKNEPSVLLVDIGGWTVDLMRLDNAVPNAATCRSLELGVIRCIDETAE
FT                   QVRRNTGLSVTETQIERVLRGESCSMAEEARRIIQENGRKYIERILSAVTESGFDLRAV
FT                   PTVFMGGGSAILKRHVTTQDAICRPVFIEDVHANATGYERIVEQMWTR"
FT   CDS             906798..907088
FT                   /transl_table=11
FT                   /locus_tag="CC1_08770"
FT                   /product="plasmid segregation centromere-binding protein
FT                   ParR"
FT                   /function="plasmid segregation centromere-binding protein
FT                   ParR"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79737"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5W6"
FT                   /protein_id="CBK79737.1"
FT                   /translation="MTRPVYSFRPNLKNPEHQRAWEKFQSVPEGQKSQYLVQAILEKED
FT                   RKWMEEVIQKTIKESVRELGICGTTEQSTTNPSSEEIPDQMMDFLSQMENL"
FT   CDS             907243..907833
FT                   /transl_table=11
FT                   /locus_tag="CC1_08780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79738"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5W7"
FT                   /protein_id="CBK79738.1"
FT                   /translation="MAEMKNICGKIPMDLHEKVREEIELTESSTQKFLQQVIEEHFNRL
FT                   EGKGEISMGAVRTVAVQVSEELFQRLKVVIGKKHMKQKDFLIQIIEEALEKAEAEWQSK
FT                   DQPEESEQTIGELGTEETQPEESTEPERDSEPEEESEPDGESEPKEENEPEGESEPKEE
FT                   NEPEGDSEPEEETEPERETDLEEETKTEEPTEW"
FT   CDS             909202..910158
FT                   /transl_table=11
FT                   /locus_tag="CC1_08800"
FT                   /product="Putative amidoligase enzyme."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79739"
FT                   /db_xref="GOA:D4J5W8"
FT                   /db_xref="InterPro:IPR022025"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5W8"
FT                   /protein_id="CBK79739.1"
FT                   /translation="MIGIKDQYFGTEIEMTGITRQRAAEVVAEMFGTEAYYDGTTYGVW
FT                   SVIDLEGKKWKFMSDGSIYTQRKVYGRIVDASGEYSTEMVSPKLSYDEMGKLQEVVRCL
FT                   RQHGGFVNESCGQHVHVDASNHTPQSLKNALTIMYAKEDILFKALKVQERRANSYCQRV
FT                   RPEVLEKIRKIPNKSITMDRVRNVWYGGRDGSHTHYDHTRYYALNLHAVFSKGTLEWRC
FT                   FESTLHAGKVRANITLALAISAQAINQRSTQMKKTLISENPAFTFRTFLLRLGLIGDEY
FT                   KNVRKHLLANLDGDLAWRYDKSTYECLKKNQRTEGVR"
FT   CDS             910171..910653
FT                   /transl_table=11
FT                   /locus_tag="CC1_08810"
FT                   /product="AIG2-like family."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79740"
FT                   /db_xref="GOA:D4J5W9"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5W9"
FT                   /protein_id="CBK79740.1"
FT                   /translation="MEDRYYFAYGSNMNLEQMKYRCPAAEVVENVRLEDYRLAFRGKAP
FT                   GNGVATVLPEKGSCVEGVLWKITEACEKSLDFYEGFPSFYGKESIQVKNQDGVEKEVFV
FT                   YMMNAPHKDVPARPSKFYLDGILEGYKDNQIPTDSVMKAVKRTRQEVKKEKNRYTR"
FT   CDS             910728..915092
FT                   /transl_table=11
FT                   /locus_tag="CC1_08820"
FT                   /product="Cna protein B-type domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79741"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR008970"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5X0"
FT                   /protein_id="CBK79741.1"
FT                   /translation="MKVRKLKTRIAAFGLAVLMGISTLSSVNAFAVEQTGSEQQTEVQA
FT                   VTSQKDTSVTADDITKAVSDETFAVETCMEGIHYDAEKEDVTLVSIKDENGGEYHSDKA
FT                   GTYIATYMVVPKDKSDSYTITRKVTLTDTEGQAHSEENGGEKQKSDTESEDDSDSPVQN
FT                   YTDVEIETSEEDASAQAVKELKEDIEEGNVMVLSAAERATSSGSTVTLTKGRTIYYPSY
FT                   IGNYLTCLFTVNGKIAYCLQSQKASPPSGSYVAQVLDSNKNLQKVLYYGYGGAGDLTGS
FT                   YLSGKTEDEKYVYTHIAASYAYAGEAGFTGCNYNDLVNAGVIAYINYLFGQEEPPKGEL
FT                   SLSSTKLNAVRDGNIQKTPNITLSGDHRNYVTLSVPENVTAHNLSKGTSVTNGKIQIYG
FT                   GDTFYLSADLLLTGSYASGNLYGSVGKTWRTLVLTTGNSKQDIGVFESETAAPVSFSVQ
FT                   WLNMTRIELMKKDVNTQNLLSGAVYGIYTDKKCENLLMTMSATGRDGKAVSDYFDSALK
FT                   TVYVKEITAPTGYKLNTEVYKVDVAAGKTLNVTATDERVTGKVKIAKIDKETLAFKAQG
FT                   DSALRGAVYGLYAKEDIVHPDGTTGVLYKQDSLIAQGVIGDDGTLEFSELYLGEMYLKE
FT                   ITPPEGYTLDTTKYEVSVTYEGQDVAEVTRDLTVKEQVKKQAFQLIKVSEDGEQTETDL
FT                   VAGARFKVYLISDLTQVKNGKLKPSNGESYTASDFKNYDFSKEQVAVTYENGTAVPVPE
FT                   LITDTKGYAVSPELPYGSYVVVESTTPENLKTIDPFVVNVENDSREPMQWRVFDDRPFE
FT                   FLLKIVKKDAQTGNTVLKAGASYKIYDVTNKKYVEQVVQYPKKEKISVFKTNEEGYLIT
FT                   PQELKCATYRIEEVKAPEGFVRQGSEESLYDGTTIISPLEQTTKGTYKENPQNGIVITV
FT                   SSNTAHQIDPDTGAAIVEVEQKNDEQVGSLLLTKKGEQLTEVTGDSVLAKVKALVSKVR
FT                   NTVSGKEETGIYKGFKYEETGVEGAEFEVYAKDTIYSPDGAKDEEGNPVVRYEKDDLVA
FT                   KLTTDENGTAVINNLPLGTYYLKEVVAGENFVLNTEQKEFTLTAEDDTQAVVYEGVTYK
FT                   NERQKVSVSVEKKDSVTGEKLEGVIFGLYAAEDILSNQGEVLVEKDTLLEKKATDTKGT
FT                   LTFDSDLPHGKYYVKEEVRKAGYLPNEEVWNVDATYENQNLAKIELNKEVENQPTETRI
FT                   TKTDATTGNELEGAKLQVIDKDGTVVEEWISTKEEHVIYGLPEGSYTLHEELAPYEDGY
FT                   VSASDVTFEVKEDGSVTKVEMKDEYSKVEISKTDLTTGKELEGAKLQIIRKDGTVLEEW
FT                   ITDGKPHSVAKLPVNEELTLREITAPDGYEIAEDVTFTLKDTMEVQKVEMKDARTPEKT
FT                   TEKTNAPKTGDNQKVWPFVLLALASAGTATGVTVYRRKKSKMTDNKEETEVK"
FT   CDS             915181..916341
FT                   /transl_table=11
FT                   /locus_tag="CC1_08830"
FT                   /product="methionine adenosyltransferase"
FT                   /function="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79742"
FT                   /db_xref="GOA:D4J5X1"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5X1"
FT                   /protein_id="CBK79742.1"
FT                   /translation="MRRFYTAESVTEGHPDKVCDQIADAILDECLRYDPSSRVACEVLA
FT                   TRGNVFVAGEITSGYEPPVFDVIRKVLEECGYCTDGIEMDTFVHQQSPDIAKAVSVSKE
FT                   FRDNIGAKLRDRSRGAGDQGVMVGYACDDTPQLMPMPTVLAHRITRELSACRRSGYIKD
FT                   IFSDGKAQVTVEYEDGKPVRLESVVVSCQHGAEKNLKKLDAEIREKVLRSALRLLPPDE
FT                   DTKILINPSGKFVCGGFDADTGLTGRKLMVDTYGSMVPHGGGAFSGKDCSKVDRSAAYM
FT                   ARYIAKNIVAAEFASKCQVSLAYAIGVAEPVMIEVDTFGTGKVCADDCLAAAIPLVFGV
FT                   TPVQIMESLRLNRPIFRQTAVFGHFGRKEFPWERTDKVLALQDTIL"
FT   CDS             916341..917318
FT                   /transl_table=11
FT                   /locus_tag="CC1_08840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79743"
FT                   /db_xref="InterPro:IPR025054"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5X2"
FT                   /protein_id="CBK79743.1"
FT                   /translation="MPWVTEEEIQAAKNMTAYEYLRTHQAQRLQKTRTRNEWQLTDHDS
FT                   FKINELSSKWHWKSRDIGGVSALRFLIEVDGMKFTDAVKLLCEESPSFIPTQSAKKEKP
FT                   PFKLPERYCNCRRIRAYLNHRGISDEVITYCISHEILYESVPYHNAVFVGKDESGKARY
FT                   AFLRGIYEKNGKGFKMEQTGSEKKYSFCIPPERETKRVVVYEACIDALAHMTLEEGKRD
FT                   KYRLSLGGIAAPKENTQIQSERFKKLPDALEEFLKNHPEIKEIEICTDNDFAGRWAKEQ
FT                   MKKHYEGTYQIICNLPEKEGADYADLAKEKKQTNKCRDRPLERR"
FT   CDS             917325..918071
FT                   /transl_table=11
FT                   /locus_tag="CC1_08850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79744"
FT                   /db_xref="InterPro:IPR025463"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5X3"
FT                   /protein_id="CBK79744.1"
FT                   /translation="MEEKGTMHVHLLTELTGNLYSEESEWEEEWSESDEYGMPLDGTEL
FT                   ADYEEVIREELERYGEDDLMQYFDGSESIQEKIQSAVVTIENKDGILYGCTKLELNEFL
FT                   SQEELQEFTEYITGQYSDGWGEGFEQRDIKVDGGTMNVHFWHPNMEQPKMYEKKTEQIP
FT                   TKPEKQRPKLQLLGHDGNIFSIMGDASTLLKKNKQTAEAKEMRKRVLESGDYYKALLII
FT                   SEYVETELSPPPKENKKTKKKNQPER"
FT   CDS             918092..918895
FT                   /transl_table=11
FT                   /locus_tag="CC1_08860"
FT                   /product="DNA modification methylase"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79745"
FT                   /db_xref="GOA:D4J5X4"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5X4"
FT                   /protein_id="CBK79745.1"
FT                   /translation="MTNGLSLEELMKEGTYPEEYAEGENWRILHGDTLKLVKAFQPGIF
FT                   DAVITDPPYASGGTKQNERNRTTNQKYSSMSAANALPDFDGDNKDQRSWTHWMAEWLYD
FT                   VRKACKKGAPICLFIDWRQYPSITDALQWAGWIWRGTAVWDKGNSRPQKGRFRQQAEYI
FT                   VWGSNGPMPINRPVSCLPGVFRYGNPQNRIHVTEKPLQLMKDVIQICEPGGLILDPFAG
FT                   AGTTVLAAVVTGYRAVGIEVTDAYYKLGSDRVRIALEAEQKEDEK"
FT   CDS             918977..919300
FT                   /transl_table=11
FT                   /locus_tag="CC1_08870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79746"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5X5"
FT                   /protein_id="CBK79746.1"
FT                   /translation="MEQALAYVCCSAEESRVKVQKYCRKIYELGYVPICPRFVFSPFLE
FT                   ESDAEDMQGYGRMSHILLRRCRMVVVCGKEVTGTMNTEISMADRLHIICTTLDGLVQIK
FT                   ESK"
FT   CDS             919439..919615
FT                   /transl_table=11
FT                   /locus_tag="CC1_08880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79747"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5X6"
FT                   /protein_id="CBK79747.1"
FT                   /translation="MLRNGVMIVIALMSGGFIGVIVTCCMVAAKKSDEDLGGMMKEEEK
FT                   KEGTVMQCENETM"
FT   CDS             919594..919902
FT                   /transl_table=11
FT                   /locus_tag="CC1_08890"
FT                   /product="Bacterial mobilisation protein
FT                   (MobC)./Ribbon-helix-helix protein, copG family."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79748"
FT                   /db_xref="GOA:D4J5X7"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5X7"
FT                   /protein_id="CBK79748.1"
FT                   /translation="MRKRNHVIPVRLNAREVRELNEQVERSGLSREEFMRSLILGAQVH
FT                   AKPCEHHPELLRKIAGLCNNANQLAHVANASGMASEQSIQEMLRLTKETWHLVKEEW"
FT   CDS             919909..921198
FT                   /transl_table=11
FT                   /locus_tag="CC1_08900"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79749"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5X8"
FT                   /protein_id="CBK79749.1"
FT                   /translation="MAYTSVIPVHRLDRSIEYVKDKEKTTQKADSLEAAIDYAMNRTKT
FT                   EQAVFEDTIGCTNENAYEDMLATKKRFHKMGGVEGYHLVQSFAEGEVTPELAHLIGQEL
FT                   ADRLLKGQFEVVITTHLNTRHYHNHIVWNSVSMVDGHKYHSNAKSYYTEIRKISDDLCR
FT                   KYGLSIIESNQKKSIPYVQWKAEQEGKPTWRTAIRLDIRESVQESYSWSQFLKEMEKRG
FT                   YTWKLNRKYISLKAPGMERYIRLRSLGKNYSEEEIRGQILQPKVKRVYQKAVQIHPKKK
FT                   LTGIQALYYSYLYQMGVLPKRPKRSPYAVREDIRKLDRRIEQIEFLMKHDIITREQLAA
FT                   YREPLQKQIAELMKERRRLYRNGGSKTGEERLSEINEELKRLRKEVRMTVQIEKHSLEI
FT                   EARLQEAEEQSQDEKRVEDKERMQKSQEVR"
FT   CDS             921201..922007
FT                   /transl_table=11
FT                   /locus_tag="CC1_08910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79750"
FT                   /db_xref="InterPro:IPR024234"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5X9"
FT                   /protein_id="CBK79750.1"
FT                   /translation="MNYGAEPADQVVRYSLEGMEYSLKITGNVAKHVAVFIAAALKDQK
FT                   KTRGKTRLTRMLKEQRPMKFFTVPGDRLKEFAKEAKARGILYVVIKNKVNPDQTEVMVF
FT                   ADDAAKMNRVLDRMNLDFVKAESGSMVTEAVEKENAPEKAENQMEKETGENVRTETVVL
FT                   PEGKIEFELDDAEEMFQIGDEAFPEGNFTQAQEGEVKNPSEPFLRNKNIFSGRETSWEE
FT                   KNEKPSVRKELGDIRKEQEEKRKRPDRRKNARESRKKRKNMKTKGR"
FT   CDS             922007..922987
FT                   /transl_table=11
FT                   /locus_tag="CC1_08920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79751"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Y0"
FT                   /protein_id="CBK79751.1"
FT                   /translation="MYMDLTDMISGGTEEQQIPEQKLTKEEYAAKKQQEREEVWAEVDS
FT                   QAQGVFQDGEKLKGFLDFMAECNTQRTPNLLLIYGQHPDFKVVRSYERWREEHRSVKAG
FT                   EHGITYMISTEYEKDGEMRRGYTIGKGFDISQMSGKPLEERPQRSLTELIGTVLKDQSV
FT                   RVQIEDDLPDKVQAQYNPRYRTIYIRNGMSEVTTFHALNRELACAALDQHTGTYSRQKV
FT                   SAQAYCAAYVIAKRYGVDVTGFNLEYIAQRNECGKKDPQELRDFLNDVRQASYSIRNHI
FT                   ERNFGAKEQEYITDEFAIGDPVKTPETKDEKASGKEKKAKNQPER"
FT   CDS             923071..923382
FT                   /transl_table=11
FT                   /locus_tag="CC1_08930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79752"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Y1"
FT                   /protein_id="CBK79752.1"
FT                   /translation="MTKYYLKMDNIMKNMFVVALNDELQAQSEQDECLEETKALLKKVS
FT                   EYDLAQKRLQITAGEQRQIRKALNRLRSKYLAAGRYSDGIDKVIIQVAKPNTSRHIFW"
FT   CDS             926765..927196
FT                   /transl_table=11
FT                   /locus_tag="CC1_08980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79753"
FT                   /db_xref="InterPro:IPR025462"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Y2"
FT                   /protein_id="CBK79753.1"
FT                   /translation="MDTKKTLRYNWEFGRETVAIRVSSYRNNGNLYVGLCHKEGREWED
FT                   FGDVTINLPYQFLEPNEAFITGDFTKDMLHFIKEHKLGKVLNETGRSGYATYQKVAFDL
FT                   ARLAEFDPEGVAEHCRFAGIEVPKEKPQKTKKQNRGEER"
FT   CDS             927200..927640
FT                   /transl_table=11
FT                   /locus_tag="CC1_08990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_08990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79754"
FT                   /db_xref="InterPro:IPR024414"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Y3"
FT                   /protein_id="CBK79754.1"
FT                   /translation="MEVKMNKEIRDYQESMFMGLDLRQCVCSVLAILTAVGIYFGMRDI
FT                   TGQEITGWLCVLGAAPFAACGFFKYHGMTAEQFLWAVIKSELLYPKKLVFQSEDIYYSC
FT                   MQETISLGEKNQKDGAEIIKEREQKAEAKQRKKRKGRSDAFD"
FT   CDS             929963..930313
FT                   /transl_table=11
FT                   /locus_tag="CC1_09010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_09010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79755"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Y4"
FT                   /protein_id="CBK79755.1"
FT                   /translation="MKKKEEVTITFYAAECGEFHDLGEYTKCRTLEEAYKKYQKYCRTS
FT                   ANMCPAIEFSIHDPESIYSDMEYPLPLSSKDRGDLELVPYYNEHPLANEAIRQLEQLQK
FT                   QQEKKKHRDVAR"
FT   CDS             930343..932034
FT                   /transl_table=11
FT                   /locus_tag="CC1_09020"
FT                   /product="CHAP domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_09020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79756"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Y5"
FT                   /protein_id="CBK79756.1"
FT                   /translation="MRDIKERVRDKNPKIRNPAARLPKELVRQTVLEAKEKPRELHEKS
FT                   SGQSDSPTQYGTEKIESVQYRAASVAGRTIGKTTYRGGKKLAGVTYRKIKERKSRQEEA
FT                   KAAEEAMEQGAESGKKLIKLKPEQAALAKENGKRQVKAAPRVVKVSGLSQEKIKTQASM
FT                   QKQQVEKSLQAMQKARVVQMARKSAQASAESGKAVFQVTGKGSKLSVQGITAAIQKGVV
FT                   ALEKMGKWIAAGGGAFLLVFILIVGIIAGAAFSSSSESSESLSEEVLAYTSVIQQYASQ
FT                   YGIPEYVSAIQAIMMQESGGRGTDPMQCSESPYNTRFPHTPGSITDPDYSIEVGVQTFA
FT                   DCIRQAGCSSPQDLDKLKLAWQGYNYGNGYIGWALQRGGYTEANALQFSQEQAASHGWS
FT                   SYGDPQYVPHVMRYYSGGSLFAGLFGNQQIVSVAMGQLGNSGGQKFWSWYGFDSRVEWC
FT                   ACFVSWCADQSGLIASGNVPKFSLCSDGVSWFQGKNKWQSGGTTPTAGMIIFFDWDHDG
FT                   TSDHVGIVEKCEGGRVYTIEGNSSDQVRQRNYAVDYSSIMGYGVIN"
FT   CDS             932205..934466
FT                   /transl_table=11
FT                   /locus_tag="CC1_09030"
FT                   /product="Domain of unknown function (DUF1906)./Putative
FT                   peptidoglycan binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_09030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79757"
FT                   /db_xref="GOA:D4J5Y6"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Y6"
FT                   /protein_id="CBK79757.1"
FT                   /translation="MSDQNVKAAQKYLNAMFGGHKDWVKLDEDGKTGTAVMQGIIRAFQ
FT                   IQNGISTITGTVGPLTINTMKKLAIITKMDPNDTPQVNVCLIQCALFCKGYAAGGITGI
FT                   YYTSGVNAVKKMQENAGLEVTGKIDWKVWSGLLSLNWFTKVSGGDSNIVLIQQQLNSDW
FT                   SDVIGVGPCDGIASRQTILSLVGALQAAEGVTTELITDLNSVNFGDATTNAFPGTLQNG
FT                   QNSTKYVPFNKIAQYGLYFNGYNPGRFDGVFDSTTESKVSEFQEFYGLTGIGLVTKGKV
FT                   NVSTMKSLLTSKGDTNRAAKACDCATVLNKQQALDIKNAGYTHVGRYLTGSVGKEHTPK
FT                   YLTSTEVKNIENAGLSVFPIYQDGGYELNYFKDPSQGSVDAQTAILAAERIGIPSGTTI
FT                   YFAVDFDCYSYQIDTFIIPYFEQIHMIFFSSTNDKNYKVGIYAPRYVCTKVYEAGLASK
FT                   SFVADMSTGFSCNLGYSMPKNWAFDQFCELNSFSSSPSFPLDKDAYSGRDTGFKKFDAV
FT                   STKTDEEIAQENLRAKVKIARNQYVYNVMEPLGYLNKIMDVGVEYDKEISLGTMMSPQG
FT                   AIDISTKISTSLESSTGKIYNIKVDIGNDGELTQTCKNQIMEISSNLSDTGIEGADNFG
FT                   NTIEKIALSVKSGNIAFEINNVFANSVEFSIVFSTSDLLPEEEKEWTISVALIFTMTLN
FT                   SNSGLEFNVVEFTKEHSNILAGAVILVLAGALVVNAIPSIIALFSAGAGTVFGLLIQAL
FT                   "
FT   CDS             934547..935107
FT                   /transl_table=11
FT                   /locus_tag="CC1_09040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_09040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79758"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Y7"
FT                   /protein_id="CBK79758.1"
FT                   /translation="MHIKSIVSDEDREELERMLSLGFIIPNQLFKTRQKSRMIIYIFTP
FT                   VEFLLSINCYLSESYLMFGIGIGTCVACVAWIIWYQMIGKNFEKNVHEFVWGRSGYETV
FT                   DIDENAIKIDEDQIYEFKNIDRMFLYKNFFFFITNEKKIFIFKTTDMESDELIKIIKTT
FT                   GILFEKKEKPFNIYKYCKKGKSF"
FT   CDS             935511..936224
FT                   /transl_table=11
FT                   /locus_tag="CC1_09050"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_09050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79759"
FT                   /db_xref="GOA:D4J5Y8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Y8"
FT                   /protein_id="CBK79759.1"
FT                   /translation="MLELAICDDDIILCNWLEQKLLHYGKANDCQISIEIYYSAEQLLN
FT                   RLEEESYDMLFLDICLEHENGIDIGTEIRKKNYGKELRITYISTYQEYAMKLFRIHPFD
FT                   FLVKPIREEELFRVIGELRELLKERKKIFEYTDTKGIHKISYDKILYFYSLGKRVHIVT
FT                   SEKEYEYRGKLKDVADVTEEYFLLIHKSYLINMEHVEHYEYDNVVMKDKTRLSISKANR
FT                   KKVRERLLQTEKKRL"
FT   CDS             936221..937423
FT                   /transl_table=11
FT                   /locus_tag="CC1_09060"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CC1_09060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79760"
FT                   /db_xref="GOA:D4J5Y9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Y9"
FT                   /protein_id="CBK79760.1"
FT                   /translation="MNIHLITYLTSKLFWIYTVFRYNTILYPKNEDTQKLFAYFCAYLL
FT                   SCWGSMQWGTMYGDLIFELIALLIITVAYQADWQHHVWNTLMVYIMGILCDGIPIVFFQ
FT                   RYAVARNPVHHHMGPGTIVMGNFIFFLLEVIIERKVGVKRSYYIKNRHWLAMLSVPVIS
FT                   IIVCIRILLPDRRGVRSTIVLFLLFINVFIFYLHDEVQKSYIETAKQEEMKIQMSQYAK
FT                   ELEMMMKSQDRLNKIHHDYKHHLTTIGAMAKTGGNEEILSYLKQMENIAGTALCHHLYT
FT                   ENRNMNNLLNYILEDSKSVIENPEISVEIPNHIGEELFDISIIVGNLMDNAIRGTAASD
FT                   ERRLSFQMYYGKGIMNIQIENSIKDTPKVRNGIYLTTKSRKEGHGIGLQNVKLVVEKYH
FT                   G"
FT   CDS             937687..947220
FT                   /transl_table=11
FT                   /locus_tag="CC1_09070"
FT                   /product="Rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_09070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79761"
FT                   /db_xref="GOA:D4J5Z0"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR028899"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Z0"
FT                   /protein_id="CBK79761.1"
FT                   /translation="MKRFRKSAIALVLALLMALQGTEPIFVQAKEAIEDVQKNADFSRP
FT                   EALTEEEAGITDSTSGEQDKSQQSDADVQNETTPSEDTETQEEQTTPAEETEENPQEKE
FT                   VELKEPQDYYPIPEEPEGELIDYDAISKTYKTGDKQYTTVYGGYVGTYKNEDGDTELVD
FT                   NTLVKPEEADTPASEEAQEASSVVATEEKEEKTEVYQNKANDYAILLPEQMSEENGVTI
FT                   ENGKTRIGIIPVDGDYTHSVIKDNAILYNEVYEGADVQYTVLDSSIKEDIVLQQPTDRE
FT                   VYEYELQIPGYQAEVKDNQVYIYPEGKTIKDAKYLLETPSMEDAAGEISFLITLELREE
FT                   DGKTILTVKPDRDWLSAEERQYPVRIDPTPVEIQKSSFNMIGVEEGSPTSQIGDNNYPY
FT                   VGFDDGIKSGNLAGFGTAHQNCRTYIKVNSNFSQIPKDSKIDSATFAVSQKTAYSGGAS
FT                   QFGLYRVDQSWNTSITWKTKPVNLTFQDVQNASTSRNSYINYDVKDLVNDWVQGTHANN
FT                   GFALVAIAEANNLGASMQCEVLNNRASVYGPKLSIQWSPAEDPYLRDMSLDETTILLRP
FT                   MTEKNTNGKLKFDAVFADGIAKSKSTVEYYLLPDEENEEHHETDAKPLYSYPDSTEYNK
FT                   QFPEANKYYSKDSNWQSALYSGLTKDKLYKIKAKASKEIDGKLETGKEVTSDSFVIYEV
FT                   KQFDTFPKIAKYYGVPLKNIMKDNQVMDALVVANNTIFIRNPQTNVPYSPAPLTDQDKM
FT                   RIDGALMGRGLHCEFGFEPVNLNTGNFYMDQSDATMNELNGEFSITRSYNSKGTDQHSM
FT                   FGRGWSFNYDQSLSQMEDGSLLYMRGDGSYLIFDKNEDGSYTAPDGYVYDLKAVSYKDT
FT                   DHDYIGWELTDADQSVWSFDKYGILRYVTDVNGFKTVLDYDDDYNLSKITTPSGKTFGV
FT                   KQDKFGHIKELSLPDGGKVSYKYDEQGNLISVTDPNGTTKEYKYDDDSRMTSWKDENGN
FT                   TVLKNTYDKEGRVVEQTDAEKGTATFKYGKSSTTTTDNEGNKTVYHYDDQYRTTSIEYP
FT                   DGTTCEKTYNAENQLASETTAAGTKTYTYDTFGNVATETREDGKTASYTYNEQNKLTSA
FT                   TGYNGATVTYSYDGNGNMVTSTKPDGTAITYTYDDKHRMVSQTDGRGVTTTYSYDGPNM
FT                   TGYVDGNGAAWGFTYDAMNRAVTMTDPLGNVTSNSYDANGNLTSKTAADGGVTAYTLDG
FT                   VGNITASTDALGNTTTYTYDKMYNMTSGTDPKGNQISYVYDKNYQQVKATDAKGNTITY
FT                   KYDSMGRVIEESNKDFGTKLYEYDKAGNLKKYTDGNGNATVSKFDSLGQVLQSKDAVGN
FT                   ITKYEYDALGNETKITYGDGSSHSKEYDNCGRLAKETDELGAVTTYTYDAADNLVSKSD
FT                   DSGRTWTYTYDNTGNRLSETNPEGGTTTYTYDKAGNLVSSTDEEGRTDTYAYDKAGNLT
FT                   TSKDALGYTVSMKYDLNGNLVSSTDENGNTSTMTYDGNGNMTSVSDAKGNITAMKYDST
FT                   DNLEQTVDALKGKTTYEYDSQGNSTKMTDALGNAYSYVYDKEGNNTSIILPTGDKVLME
FT                   YDAIGQLVKCTDAQGLVITYQYDGAGNLIHSSDNGGNSMDYTYDGAGNVLTQTDELGRT
FT                   ATYQYDQYGRLLKLTEADGSTTSYGYDVMDRITAVTDAEGHRTTFTYDKVGNQLSMTEE
FT                   DEATYQYAYDKKDRVISQTNPLGASSTFKYDGNDNVTEAADENGTVTKYAYDKNDNLVS
FT                   QTDGNGNTTTYQYDELDRKIGETSPLKETNEYRYDAIGNLTKSKDPMGLITEYKYDSLS
FT                   NLTEQISPKGAVTKYDYDKHGNVISVTDAKGNETQYSVDLNDNVTKMTQANGGEYTYSY
FT                   DKAGRLKSMTSPLGYTKNFSYDKVDNVVKESDSLKSTTTYTYDKLHNMKSSTNALDGTT
FT                   SFSYDKYGNLVKETDPLGRSNTYSYDMAGQMTSAADPLGKITAYTYDPAGNITEITKPG
FT                   GRKTSYGYDKNYNVTSVTDPMGYVAKTVYDKDNRVTEETDALGQKESYTYDKDSRVTSI
FT                   TDKRGFTTGFDYDAHGNIQVVTDKTGLKSHLEYDKNDNLTKVTDALGGVTTYGYDNMDN
FT                   LVTFTNAANKTTNYTYDLEGNLTSIKDPAGRTEKFDYDEKGRLTGHTQASGKKTTYDYD
FT                   KLNDLLEKSYQDAKGEKSEKDVTYAYNSAGERVSMKDQTGKSSYEYDALGRITKVTSGS
FT                   KKDVSYVYDDADNLQAIVYPDGTKVSYEYDLNDNLVKLTDRNGKVTTYKHDALNRVTEV
FT                   IRSNGTKTEVSYDAEDHITKIVNTCGSCGKVISTYEYKYNDQGYVVSETATELEAGTRK
FT                   APSWEDWYNWGDTQKETDKADCEHQEKEIQTTRTYEYDDNWELTRCTEKAEGGKKTVHN
FT                   YTYDKIGNRTSYEKIEDGVSKAKYNYKYNDSNQLIKRTNAKIWGDPGTTYSYDKDGNLI
FT                   QECDKTNSADPVTYEYTAENRLAVVKQGGTVLMAAMYDGDNNRVFELDNTYKWEDCYGD
FT                   EVLIPENQRTEDGDSPKEQLASLVKGGSNAKGYTLTEYINDINRENTEVLAEYGTDEKV
FT                   RQAYTYGESGIGERVSVDKSKESSYYLYDGRNSVTGILTETANLTNSYQYDPYGNLTSG
FT                   TADGVNYYGYNGESTNVKTGLQYLRARYYDAENGTFTTEDSDLGTTENPLTRNRYDYTT
FT                   NNPLNYSDPTGHSLWSRIKSTAKKAAKAVKSVGKKIVNTAKKVVKTVVNTAKKAAKTIV
FT                   NAVKGAAKTVKNAVTHPKKTYQSVRSSVTNSYRKVVSRGSSFVRSVSNGVQKIGKTYTS
FT                   FKSYVSERTSEIRSEVVRHMCTTTNRITDQLGKVNWKNVAIGVTAMVVSGVVVAATGGL
FT                   ATGAVLAALPAMGGLGTAMVSGAVAGAIGGASYGAISSGLSGNSLKQVAKDTLTGGLTG
FT                   AISGGVLGGLTYGAGKALSAVKDLVKGKSSSTKPGHITEMATKKLDYTSENEAPLLTQT
FT                   DQSSASKVTARNNSASISDNNIESVAAGNNTTKSTTASKQGNNVKTATTNTAENNAEAT
FT                   SGYYKDNNGRWHRKNGQFASNEEVGIPSKKTSASHNHGNSLEDTRTNYGYALVDKDTNE
FT                   ILKFGETLNPEKRYSQKYLNENNAVMKVIESGSKRDIHMWQYDMNKYYESKYGEFPPLL
FT                   KSKGW"
FT   CDS             947297..947719
FT                   /transl_table=11
FT                   /locus_tag="CC1_09080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_09080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79762"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Z1"
FT                   /protein_id="CBK79762.1"
FT                   /translation="MELNINSPSYFTKQYGVIDEIYSMCRGISKHVENKQYSDLVDIVG
FT                   ITPIIAPKDIIEQGLFKQEKKCDIKYGFASVSLWIDYDEYLKADITDKQIMIVKNILAS
FT                   IKTISRKAKIDYKQFCEDIFQYCKLINLPIESNLKV"
FT   CDS             947772..948458
FT                   /transl_table=11
FT                   /locus_tag="CC1_09090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_09090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79763"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Z2"
FT                   /protein_id="CBK79763.1"
FT                   /translation="MRRKIIIVIVVVVLVIVATITFFVIKDLQQEKSLRKEIDEIQKEM
FT                   VDFEQIDVDKISKKLKATVTTGDYAKIEKAIKNYMADNLNTMLTISEALNDEVIPNALT
FT                   AENYQNDGPDFVKTRKILKNTQDKLSASKETMIILSKDDTVMSYLKNVDDSYYIDLYKE
FT                   MVGEESSVDDIKKNIDDIVNLIQSQQNVLEFLSENKNMWNVQNGKIQFDDDILLNQYNQ
FT                   LLLAVQ"
FT   CDS             949269..949634
FT                   /transl_table=11
FT                   /locus_tag="CC1_09110"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_09110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79764"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Z3"
FT                   /protein_id="CBK79764.1"
FT                   /translation="MNQQEIFTYIQKQYPTHPDTINKSGYLVTIFKNPRTAAPYAIFYQ
FT                   PAERTTFMEVQAEPDMIGNYIEMYHLAPAKYMDKKHWLAVPLDGSVSDSKVLDLLDMSY
FT                   DLVDGQAETDGETGADR"
FT   gap             950126..950773
FT                   /estimated_length=648
FT   CDS             950824..951303
FT                   /transl_table=11
FT                   /locus_tag="CC1_09130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_09130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79765"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Z4"
FT                   /protein_id="CBK79765.1"
FT                   /translation="METKKVAKEYLQKDILRTIFQMWYSFYTTEIGKERKAAIEDMRFK
FT                   RDGWLYIEPWEIWLELTEHPENEDDRIIWYQNMHGIWKKAEVNDQIIKIPATAFHIEYE
FT                   QQWLGEIHFTCNLGVSQRKRKAPRKKRYAYWMEGFCRKYRISCSGQIYKKDRWER"
FT   CDS             951305..952123
FT                   /transl_table=11
FT                   /locus_tag="CC1_09140"
FT                   /product="Mn-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_09140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79766"
FT                   /db_xref="GOA:D4J5Z5"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Z5"
FT                   /protein_id="CBK79766.1"
FT                   /translation="MVKKIENRNIDVTKARGELEEDLLEYVYRTWRQGRQITSKEYARE
FT                   VNITGYEAAGLVRSLVKKGFLCEPENGHLELSDKGKLEGMECLARHEKLTQFFQMVSEM
FT                   DQQRAQEDACRVEHYISPEGLKGIENFLQYGDVYDRVYDDMDLYTFYEDGEFPMAFGLY
FT                   EPERRNPRFLAPEYGKLEHSVILRVKKSQNCFLLKTKKDESIGYVWYRRDDEWIQAKEE
FT                   KGVYQLPTDICTYTANTGIPITEAVAIIAITRFEQKPLPIDYRELNIHVW"
FT   CDS             952113..952979
FT                   /transl_table=11
FT                   /locus_tag="CC1_09150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_09150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK79767"
FT                   /db_xref="UniProtKB/TrEMBL:D4J5Z6"
FT                   /protein_id="CBK79767.1"
FT                   /translation="MYGDEERNRKMEKGEHLKRQNRPTMLQLQYLQGLSKVEKKRGAQG
FT                   SIAEYYGVNRSTVNRYFKNCIERGILTESLEFTPVGEEWLERYTKLYENLEKYLEEIGA
FT                   KPEEIEESLDVMVENIDIHMLELMINAYTEKKSVYKKKENELDQEIQHNLQKCERHPVV
FT                   FRLYRMNKKQGQGRDSMAMRGFEEIAEIVQENGESYLELKLKEMAAHSRVSGEMMAGKL
FT                   KTLKYEHNEVLEEARIENNIVKIPMEACRIHRWTGIGTMGIVPVTVTCSVGPMHMPEST
FT                   ALLYFWV"
FT   CDS             953323..953796
FT                   /transl_table=11
FT                   /locus_tag="CC1_09160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CC1_09160"
FT                   /db_xref="EnsemblGenomes