
EBI Dbfetch

ID   FP929037; SV 1; linear; genomic DNA; STD; PRO; 3769775 BP.
AC   FP929037;
PR   Project:PRJEA45855;
DT   25-MAR-2010 (Rel. 104, Created)
DT   30-MAY-2010 (Rel. 105, Last updated, Version 2)
DE   Clostridium saccharolyticum-like K10 draft genome.
KW   .
OS   [Clostridium] cf. saccharolyticum K10
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
RN   [1]
RG   metaHIT consortium --
RA   Pajon A., Turner K., Parkhill J., Duncan S., Flint H.;
RT   "The genome sequence of Clostridium saccharolyticum-like K10";
RL   Unpublished.
RN   [2]
RA   Pajon A.;
RT   ;
RL   Submitted (23-MAR-2010) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
DR   MD5; 61a66a733000781b6073df226e4c6e87.
DR   BioSample; SAMEA2272117.
DR   EnsemblGenomes-Gn; CLS_R_39830.
DR   EnsemblGenomes-Gn; CLS_R_39840.
DR   EnsemblGenomes-Gn; CLS_T_39340.
DR   EnsemblGenomes-Gn; CLS_T_39350.
DR   EnsemblGenomes-Gn; CLS_T_39360.
DR   EnsemblGenomes-Gn; CLS_T_39370.
DR   EnsemblGenomes-Gn; CLS_T_39380.
DR   EnsemblGenomes-Gn; CLS_T_39390.
DR   EnsemblGenomes-Gn; CLS_T_39400.
DR   EnsemblGenomes-Gn; CLS_T_39410.
DR   EnsemblGenomes-Gn; CLS_T_39420.
DR   EnsemblGenomes-Gn; CLS_T_39430.
DR   EnsemblGenomes-Gn; CLS_T_39440.
DR   EnsemblGenomes-Gn; CLS_T_39450.
DR   EnsemblGenomes-Gn; CLS_T_39460.
DR   EnsemblGenomes-Gn; CLS_T_39470.
DR   EnsemblGenomes-Gn; CLS_T_39480.
DR   EnsemblGenomes-Gn; CLS_T_39490.
DR   EnsemblGenomes-Gn; CLS_T_39500.
DR   EnsemblGenomes-Gn; CLS_T_39510.
DR   EnsemblGenomes-Gn; CLS_T_39520.
DR   EnsemblGenomes-Gn; CLS_T_39530.
DR   EnsemblGenomes-Gn; CLS_T_39540.
DR   EnsemblGenomes-Gn; CLS_T_39550.
DR   EnsemblGenomes-Gn; CLS_T_39560.
DR   EnsemblGenomes-Gn; CLS_T_39570.
DR   EnsemblGenomes-Gn; CLS_T_39580.
DR   EnsemblGenomes-Gn; CLS_T_39590.
DR   EnsemblGenomes-Gn; CLS_T_39600.
DR   EnsemblGenomes-Gn; CLS_T_39610.
DR   EnsemblGenomes-Gn; CLS_T_39620.
DR   EnsemblGenomes-Gn; CLS_T_39630.
DR   EnsemblGenomes-Gn; CLS_T_39640.
DR   EnsemblGenomes-Gn; CLS_T_39650.
DR   EnsemblGenomes-Gn; CLS_T_39660.
DR   EnsemblGenomes-Gn; CLS_T_39670.
DR   EnsemblGenomes-Gn; CLS_T_39680.
DR   EnsemblGenomes-Gn; CLS_T_39690.
DR   EnsemblGenomes-Gn; CLS_T_39700.
DR   EnsemblGenomes-Gn; CLS_T_39710.
DR   EnsemblGenomes-Gn; CLS_T_39720.
DR   EnsemblGenomes-Gn; CLS_T_39730.
DR   EnsemblGenomes-Gn; CLS_T_39740.
DR   EnsemblGenomes-Gn; CLS_T_39750.
DR   EnsemblGenomes-Gn; CLS_T_39760.
DR   EnsemblGenomes-Gn; CLS_T_39770.
DR   EnsemblGenomes-Gn; CLS_T_39780.
DR   EnsemblGenomes-Gn; CLS_T_39790.
DR   EnsemblGenomes-Gn; CLS_T_39800.
DR   EnsemblGenomes-Gn; CLS_T_39810.
DR   EnsemblGenomes-Gn; CLS_T_39820.
DR   EnsemblGenomes-Tr; CLS_R_39830.
DR   EnsemblGenomes-Tr; CLS_R_39840.
DR   EnsemblGenomes-Tr; CLS_T_39340.
DR   EnsemblGenomes-Tr; CLS_T_39350.
DR   EnsemblGenomes-Tr; CLS_T_39360.
DR   EnsemblGenomes-Tr; CLS_T_39370.
DR   EnsemblGenomes-Tr; CLS_T_39380.
DR   EnsemblGenomes-Tr; CLS_T_39390.
DR   EnsemblGenomes-Tr; CLS_T_39400.
DR   EnsemblGenomes-Tr; CLS_T_39410.
DR   EnsemblGenomes-Tr; CLS_T_39420.
DR   EnsemblGenomes-Tr; CLS_T_39430.
DR   EnsemblGenomes-Tr; CLS_T_39440.
DR   EnsemblGenomes-Tr; CLS_T_39450.
DR   EnsemblGenomes-Tr; CLS_T_39460.
DR   EnsemblGenomes-Tr; CLS_T_39470.
DR   EnsemblGenomes-Tr; CLS_T_39480.
DR   EnsemblGenomes-Tr; CLS_T_39490.
DR   EnsemblGenomes-Tr; CLS_T_39500.
DR   EnsemblGenomes-Tr; CLS_T_39510.
DR   EnsemblGenomes-Tr; CLS_T_39520.
DR   EnsemblGenomes-Tr; CLS_T_39530.
DR   EnsemblGenomes-Tr; CLS_T_39540.
DR   EnsemblGenomes-Tr; CLS_T_39550.
DR   EnsemblGenomes-Tr; CLS_T_39560.
DR   EnsemblGenomes-Tr; CLS_T_39570.
DR   EnsemblGenomes-Tr; CLS_T_39580.
DR   EnsemblGenomes-Tr; CLS_T_39590.
DR   EnsemblGenomes-Tr; CLS_T_39600.
DR   EnsemblGenomes-Tr; CLS_T_39610.
DR   EnsemblGenomes-Tr; CLS_T_39620.
DR   EnsemblGenomes-Tr; CLS_T_39630.
DR   EnsemblGenomes-Tr; CLS_T_39640.
DR   EnsemblGenomes-Tr; CLS_T_39650.
DR   EnsemblGenomes-Tr; CLS_T_39660.
DR   EnsemblGenomes-Tr; CLS_T_39670.
DR   EnsemblGenomes-Tr; CLS_T_39680.
DR   EnsemblGenomes-Tr; CLS_T_39690.
DR   EnsemblGenomes-Tr; CLS_T_39700.
DR   EnsemblGenomes-Tr; CLS_T_39710.
DR   EnsemblGenomes-Tr; CLS_T_39720.
DR   EnsemblGenomes-Tr; CLS_T_39730.
DR   EnsemblGenomes-Tr; CLS_T_39740.
DR   EnsemblGenomes-Tr; CLS_T_39750.
DR   EnsemblGenomes-Tr; CLS_T_39760.
DR   EnsemblGenomes-Tr; CLS_T_39770.
DR   EnsemblGenomes-Tr; CLS_T_39780.
DR   EnsemblGenomes-Tr; CLS_T_39790.
DR   EnsemblGenomes-Tr; CLS_T_39800.
DR   EnsemblGenomes-Tr; CLS_T_39810.
DR   EnsemblGenomes-Tr; CLS_T_39820.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01990; SECIS_4.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   SILVA-LSU; FP929037.
CC   This is a reference genome for the metaHIT project
CC   DNA source: Rowett Institute of Nutrition and Health, University of
CC   Aberdeen --
CC   Sequencing technology: 454
CC   Genome coverage: 20x
CC   Annotation was added using ab initio prediction IMG/ER --
CC (Markowitz, Szeto et al. 2007).
FH   Key             Location/Qualifiers
FT   source          1..3769775
FT                   /organism="[Clostridium] cf. saccharolyticum K10"
FT                   /strain="K10"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:717608"
FT   CDS             274..696
FT                   /transl_table=11
FT                   /locus_tag="CLS_00110"
FT                   /product="Diadenosine tetraphosphate (Ap4A) hydrolase and
FT                   other HIT family hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75918"
FT                   /db_xref="GOA:D6DDZ4"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="UniProtKB/TrEMBL:D6DDZ4"
FT                   /protein_id="CBK75918.1"
FT   CDS             705..1274
FT                   /transl_table=11
FT                   /locus_tag="CLS_00120"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75919"
FT                   /db_xref="GOA:D6DDZ5"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D6DDZ5"
FT                   /protein_id="CBK75919.1"
FT   CDS             complement(1243..2307)
FT                   /transl_table=11
FT                   /locus_tag="CLS_00130"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape
FT                   ptide) pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /function="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentap
FT                   eptide) pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75920"
FT                   /db_xref="GOA:D6DDZ6"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D6DDZ6"
FT                   /protein_id="CBK75920.1"
FT                   AVETIMDLIHDCMN"
FT   CDS             complement(2993..3061)
FT                   /transl_table=11
FT                   /locus_tag="CLS_00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75921"
FT                   /db_xref="UniProtKB/TrEMBL:D6DDZ7"
FT                   /protein_id="CBK75921.1"
FT                   /translation="MKYLKDRCYSPPDVRFHVSMYG"
FT   CDS             complement(3173..3418)
FT                   /transl_table=11
FT                   /locus_tag="CLS_00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75922"
FT                   /db_xref="InterPro:IPR023806"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:D6DDZ8"
FT                   /protein_id="CBK75922.1"
FT   CDS             3823..4521
FT                   /transl_table=11
FT                   /locus_tag="CLS_00180"
FT                   /product="methylthioadenosine nucleosidase"
FT                   /function="methylthioadenosine nucleosidase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75923"
FT                   /db_xref="GOA:D6DDZ9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:D6DDZ9"
FT                   /protein_id="CBK75923.1"
FT                   ILEMAKRISC"
FT   CDS             4781..5848
FT                   /transl_table=11
FT                   /locus_tag="CLS_00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75924"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE00"
FT                   /protein_id="CBK75924.1"
FT                   MKVLGELIRQYFSAD"
FT   CDS             6089..7438
FT                   /transl_table=11
FT                   /locus_tag="CLS_00200"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /function="glucose-6-phosphate isomerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75925"
FT                   /db_xref="GOA:D6DE01"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE01"
FT                   /protein_id="CBK75925.1"
FT   CDS             complement(7622..8983)
FT                   /transl_table=11
FT                   /locus_tag="CLS_00210"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75926"
FT                   /db_xref="GOA:D6DE02"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE02"
FT                   /protein_id="CBK75926.1"
FT   CDS             9089..9355
FT                   /transl_table=11
FT                   /locus_tag="CLS_00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75927"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE03"
FT                   /protein_id="CBK75927.1"
FT   CDS             9477..10574
FT                   /transl_table=11
FT                   /locus_tag="CLS_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75928"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE04"
FT                   /protein_id="CBK75928.1"
FT   CDS             10726..11325
FT                   /transl_table=11
FT                   /locus_tag="CLS_00240"
FT                   /product="putative sporulation protein YyaC"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75929"
FT                   /db_xref="InterPro:IPR009665"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE05"
FT                   /protein_id="CBK75929.1"
FT   CDS             11350..11481
FT                   /transl_table=11
FT                   /locus_tag="CLS_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75930"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE06"
FT                   /protein_id="CBK75930.1"
FT   CDS             11465..12919
FT                   /transl_table=11
FT                   /locus_tag="CLS_00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75931"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE07"
FT                   /protein_id="CBK75931.1"
FT   CDS             13146..14507
FT                   /transl_table=11
FT                   /locus_tag="CLS_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75932"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE08"
FT                   /protein_id="CBK75932.1"
FT   CDS             14572..16551
FT                   /transl_table=11
FT                   /locus_tag="CLS_00280"
FT                   /product="transketolase"
FT                   /function="transketolase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75933"
FT                   /db_xref="GOA:D6DE09"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE09"
FT                   /protein_id="CBK75933.1"
FT   CDS             16609..16707
FT                   /transl_table=11
FT                   /locus_tag="CLS_00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75934"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE10"
FT                   /protein_id="CBK75934.1"
FT                   /translation="MKNGSPRFLAGCRFLIDSAEIFCSGSSAVQQD"
FT   CDS             16870..17814
FT                   /transl_table=11
FT                   /locus_tag="CLS_00300"
FT                   /product="glucokinase"
FT                   /function="glucokinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75935"
FT                   /db_xref="GOA:D6DE11"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE11"
FT                   /protein_id="CBK75935.1"
FT   CDS             18028..19680
FT                   /transl_table=11
FT                   /locus_tag="CLS_00310"
FT                   /product="Inorganic pyrophosphatase/exopolyphosphatase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75936"
FT                   /db_xref="GOA:D6DE12"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE12"
FT                   /protein_id="CBK75936.1"
FT   CDS             20014..20745
FT                   /transl_table=11
FT                   /locus_tag="CLS_00320"
FT                   /product="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenases, DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75937"
FT                   /db_xref="GOA:D6DE13"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE13"
FT                   /protein_id="CBK75937.1"
FT   CDS             20782..21357
FT                   /transl_table=11
FT                   /locus_tag="CLS_00330"
FT                   /product="Shikimate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75938"
FT                   /db_xref="GOA:D6DE14"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE14"
FT                   /protein_id="CBK75938.1"
FT   CDS             21423..23678
FT                   /transl_table=11
FT                   /locus_tag="CLS_00340"
FT                   /product="DNA topoisomerase III, bacteria and conjugative
FT                   plasmid"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75939"
FT                   /db_xref="GOA:D6DE15"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE15"
FT                   /protein_id="CBK75939.1"
FT   CDS             23744..24685
FT                   /transl_table=11
FT                   /locus_tag="CLS_00360"
FT                   /product="cysteine synthase A"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75940"
FT                   /db_xref="GOA:D6DE16"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE16"
FT                   /protein_id="CBK75940.1"
FT   CDS             complement(24814..25161)
FT                   /transl_table=11
FT                   /locus_tag="CLS_00370"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75941"
FT                   /db_xref="InterPro:IPR014580"
FT                   /db_xref="InterPro:IPR023204"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE17"
FT                   /protein_id="CBK75941.1"
FT                   AKGKPMEKILR"
FT   CDS             25432..25788
FT                   /transl_table=11
FT                   /locus_tag="CLS_00380"
FT                   /product="transcriptional regulator, PadR family"
FT                   /function="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75942"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE18"
FT                   /protein_id="CBK75942.1"
FT                   GEEGENNDGQFKGA"
FT   CDS             25763..25897
FT                   /transl_table=11
FT                   /locus_tag="CLS_00390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75943"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE19"
FT                   /protein_id="CBK75943.1"
FT   CDS             26094..27122
FT                   /transl_table=11
FT                   /locus_tag="CLS_00400"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75944"
FT                   /db_xref="GOA:D6DE20"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE20"
FT                   /protein_id="CBK75944.1"
FT                   DG"
FT   CDS             27110..28858
FT                   /transl_table=11
FT                   /locus_tag="CLS_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75945"
FT                   /db_xref="InterPro:IPR025686"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE21"
FT                   /protein_id="CBK75945.1"
FT                   PVQSGS"
FT   CDS             28938..30218
FT                   /transl_table=11
FT                   /locus_tag="CLS_00420"
FT                   /product="Protein of unknown function (DUF1576)."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75946"
FT                   /db_xref="InterPro:IPR011470"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE22"
FT                   /protein_id="CBK75946.1"
FT   CDS             complement(30299..32125)
FT                   /transl_table=11
FT                   /locus_tag="CLS_00430"
FT                   /product="Predicted ATPase of the ABC class"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75947"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE23"
FT                   /protein_id="CBK75947.1"
FT   CDS             32472..33611
FT                   /transl_table=11
FT                   /locus_tag="CLS_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75948"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE24"
FT                   /protein_id="CBK75948.1"
FT   CDS             complement(33783..34799)
FT                   /transl_table=11
FT                   /locus_tag="CLS_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75949"
FT                   /db_xref="GOA:D6DE25"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE25"
FT                   /protein_id="CBK75949.1"
FT   gap             34822..35834
FT                   /estimated_length=1013
FT   CDS             complement(36213..38129)
FT                   /transl_table=11
FT                   /locus_tag="CLS_00470"
FT                   /product="Transcriptional regulator containing PAS,
FT                   AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75950"
FT                   /db_xref="GOA:D6DE26"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE26"
FT                   /protein_id="CBK75950.1"
FT                   FSQ"
FT   CDS             38715..39731
FT                   /transl_table=11
FT                   /locus_tag="CLS_00480"
FT                   /product="Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75951"
FT                   /db_xref="GOA:D6DE27"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE27"
FT                   /protein_id="CBK75951.1"
FT   CDS             39776..40477
FT                   /transl_table=11
FT                   /locus_tag="CLS_00490"
FT                   /product="Demethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75952"
FT                   /db_xref="GOA:D6DE28"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE28"
FT                   /protein_id="CBK75952.1"
FT                   VEIIDGAYEEQ"
FT   CDS             40572..41843
FT                   /transl_table=11
FT                   /locus_tag="CLS_00500"
FT                   /product="Di-and tricarboxylate transporters"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75953"
FT                   /db_xref="GOA:D6DE29"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE29"
FT                   /protein_id="CBK75953.1"
FT   CDS             41973..43136
FT                   /transl_table=11
FT                   /locus_tag="CLS_00510"
FT                   /product="Predicted amidohydrolase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75954"
FT                   /db_xref="GOA:D6DE30"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE30"
FT                   /protein_id="CBK75954.1"
FT   gap             43375..44218
FT                   /estimated_length=844
FT   CDS             45196..45909
FT                   /transl_table=11
FT                   /locus_tag="CLS_00550"
FT                   /product="trehalose operon repressor, B. subtilis-type"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75955"
FT                   /db_xref="GOA:D6DE31"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012770"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE31"
FT                   /protein_id="CBK75955.1"
FT                   RPDQFRFVEVAQRKK"
FT   CDS             46062..47552
FT                   /transl_table=11
FT                   /locus_tag="CLS_00560"
FT                   /product="PTS system, glucose-like IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75956"
FT                   /db_xref="GOA:D6DE32"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE32"
FT                   /protein_id="CBK75956.1"
FT   CDS             47604..49316
FT                   /transl_table=11
FT                   /locus_tag="CLS_00570"
FT                   /product="Glycosidases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75957"
FT                   /db_xref="GOA:D6DE33"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE33"
FT                   /protein_id="CBK75957.1"
FT   CDS             51295..52143
FT                   /transl_table=11
FT                   /locus_tag="CLS_00590"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75958"
FT                   /db_xref="GOA:D6DE34"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE34"
FT                   /protein_id="CBK75958.1"
FT                   G"
FT   CDS             52978..53802
FT                   /transl_table=11
FT                   /locus_tag="CLS_00610"
FT                   /product="ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75959"
FT                   /db_xref="GOA:D6DE35"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE35"
FT                   /protein_id="CBK75959.1"
FT   CDS             53835..55199
FT                   /transl_table=11
FT                   /locus_tag="CLS_00620"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75960"
FT                   /db_xref="GOA:D6DE36"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE36"
FT                   /protein_id="CBK75960.1"
FT   CDS             55236..56222
FT                   /transl_table=11
FT                   /locus_tag="CLS_00630"
FT                   /product="Inosine-uridine nucleoside N-ribohydrolase"
FT                   /EC_number="3.2.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75961"
FT                   /db_xref="GOA:D6DE37"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE37"
FT                   /protein_id="CBK75961.1"
FT   CDS             56219..57097
FT                   /transl_table=11
FT                   /locus_tag="CLS_00640"
FT                   /product="Sugar phosphate isomerases/epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75962"
FT                   /db_xref="GOA:D6DE38"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE38"
FT                   /protein_id="CBK75962.1"
FT                   AYEVGEYLMGL"
FT   CDS             57290..58135
FT                   /transl_table=11
FT                   /locus_tag="CLS_00650"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75963"
FT                   /db_xref="InterPro:IPR007163"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE39"
FT                   /protein_id="CBK75963.1"
FT                   "
FT   CDS             59989..60405
FT                   /transl_table=11
FT                   /locus_tag="CLS_00670"
FT                   /product="Resolvase, N terminal domain."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75964"
FT                   /db_xref="GOA:D6DE40"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE40"
FT                   /protein_id="CBK75964.1"
FT   CDS             60462..60560
FT                   /transl_table=11
FT                   /locus_tag="CLS_00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75965"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE41"
FT                   /protein_id="CBK75965.1"
FT                   /translation="MMGKQSGQIQMVILDIDSIIPEDHLLRQIKTV"
FT   CDS             60638..60964
FT                   /transl_table=11
FT                   /locus_tag="CLS_00690"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75966"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE42"
FT                   /protein_id="CBK75966.1"
FT                   NAPL"
FT   CDS             61123..61626
FT                   /transl_table=11
FT                   /locus_tag="CLS_00700"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75967"
FT                   /db_xref="GOA:D6DE43"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE43"
FT                   /protein_id="CBK75967.1"
FT                   VRTA"
FT   CDS             61831..61953
FT                   /transl_table=11
FT                   /locus_tag="CLS_00710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75968"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE44"
FT                   /protein_id="CBK75968.1"
FT   CDS             61940..63337
FT                   /transl_table=11
FT                   /locus_tag="CLS_00720"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /function="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75969"
FT                   /db_xref="GOA:D6DE45"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE45"
FT                   /protein_id="CBK75969.1"
FT                   GEALLAE"
FT   CDS             64953..65954
FT                   /transl_table=11
FT                   /locus_tag="CLS_00740"
FT                   /product="replicative DNA helicase loader DnaI"
FT                   /function="replicative DNA helicase loader DnaI"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75970"
FT                   /db_xref="GOA:D6DE46"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE46"
FT                   /protein_id="CBK75970.1"
FT   CDS             66160..67341
FT                   /transl_table=11
FT                   /locus_tag="CLS_00750"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75971"
FT                   /db_xref="GOA:D6DE47"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE47"
FT                   /protein_id="CBK75971.1"
FT   CDS             67607..68659
FT                   /transl_table=11
FT                   /locus_tag="CLS_00770"
FT                   /product="Threonine dehydrogenase and related Zn-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75972"
FT                   /db_xref="GOA:D6DE48"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE48"
FT                   /protein_id="CBK75972.1"
FT                   GCIKWVVTGE"
FT   CDS             68810..70111
FT                   /transl_table=11
FT                   /locus_tag="CLS_00780"
FT                   /product="sodium/proton-potassium antiporter GerN, CPA2
FT                   family (TC 2.A.37.2.2)"
FT                   /function="sodium/proton-potassium antiporter GerN, CPA2
FT                   family (TC 2.A.37.2.2)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75973"
FT                   /db_xref="GOA:D6DE49"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE49"
FT                   /protein_id="CBK75973.1"
FT   CDS             complement(70414..72288)
FT                   /transl_table=11
FT                   /locus_tag="CLS_00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75974"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE50"
FT                   /protein_id="CBK75974.1"
FT   CDS             complement(73692..75083)
FT                   /transl_table=11
FT                   /locus_tag="CLS_00810"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75975"
FT                   /db_xref="GOA:D6DE51"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE51"
FT                   /protein_id="CBK75975.1"
FT                   NNCEL"
FT   CDS             76787..77908
FT                   /transl_table=11
FT                   /locus_tag="CLS_00830"
FT                   /product="glucose-1-phosphate adenylyltransferase, GlgD
FT                   subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75976"
FT                   /db_xref="GOA:D6DE52"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE52"
FT                   /protein_id="CBK75976.1"
FT   CDS             77971..78255
FT                   /transl_table=11
FT                   /locus_tag="CLS_00840"
FT                   /product="Uncharacterized protein, involved in the
FT                   regulation of septum location"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75977"
FT                   /db_xref="GOA:D6DE53"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE53"
FT                   /protein_id="CBK75977.1"
FT   CDS             78728..80212
FT                   /transl_table=11
FT                   /locus_tag="CLS_00850"
FT                   /product="transporter, NhaC family (TC 2.A.35)"
FT                   /function="transporter, NhaC family (TC 2.A.35)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75978"
FT                   /db_xref="GOA:D6DE54"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE54"
FT                   /protein_id="CBK75978.1"
FT   CDS             80376..80924
FT                   /transl_table=11
FT                   /locus_tag="CLS_00870"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /function="transcriptional regulator, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75979"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE55"
FT                   /protein_id="CBK75979.1"
FT   CDS             complement(80932..81069)
FT                   /transl_table=11
FT                   /locus_tag="CLS_00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75980"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE56"
FT                   /protein_id="CBK75980.1"
FT                   "
FT   CDS             81722..81997
FT                   /transl_table=11
FT                   /locus_tag="CLS_00900"
FT                   /product="Bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75981"
FT                   /db_xref="GOA:D6DE57"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE57"
FT                   /protein_id="CBK75981.1"
FT   CDS             82002..82241
FT                   /transl_table=11
FT                   /locus_tag="CLS_00910"
FT                   /product="Ribosome-associated heat shock protein implicated
FT                   in the recycling of the 50S subunit (S4 paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75982"
FT                   /db_xref="GOA:D6DE58"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE58"
FT                   /protein_id="CBK75982.1"
FT   CDS             82304..82588
FT                   /transl_table=11
FT                   /locus_tag="CLS_00920"
FT                   /product="sporulation protein YabP"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75983"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE59"
FT                   /protein_id="CBK75983.1"
FT   CDS             82608..82925
FT                   /transl_table=11
FT                   /locus_tag="CLS_00930"
FT                   /product="Spore cortex protein YabQ (Spore_YabQ)."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75984"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE60"
FT                   /protein_id="CBK75984.1"
FT                   R"
FT   CDS             83445..84854
FT                   /transl_table=11
FT                   /locus_tag="CLS_00950"
FT                   /product="Stage II sporulation protein E (SpoIIE)."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75985"
FT                   /db_xref="GOA:D6DE61"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE61"
FT                   /protein_id="CBK75985.1"
FT                   MTVLVGGVFGK"
FT   CDS             84952..86346
FT                   /transl_table=11
FT                   /locus_tag="CLS_00960"
FT                   /product="tRNA(Ile)-lysidine synthetase, N-terminal
FT                   domain/tRNA(Ile)-lysidine synthetase, C-terminal domain"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75986"
FT                   /db_xref="GOA:D6DE62"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE62"
FT                   /protein_id="CBK75986.1"
FT                   GGTNCG"
FT   CDS             89139..89186
FT                   /transl_table=11
FT                   /locus_tag="CLS_00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_00990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75987"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE63"
FT                   /protein_id="CBK75987.1"
FT                   /translation="MQLKLAGRLKAQGRE"
FT   CDS             89191..91389
FT                   /transl_table=11
FT                   /locus_tag="CLS_01000"
FT                   /product="Glycosidases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75988"
FT                   /db_xref="GOA:D6DE64"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE64"
FT                   /protein_id="CBK75988.1"
FT   CDS             91393..91479
FT                   /transl_table=11
FT                   /locus_tag="CLS_01010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75989"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE65"
FT                   /protein_id="CBK75989.1"
FT                   /translation="MDGASCRKKNLPKLSPWLNGYHFILKSA"
FT   tRNA            91528..91609
FT                   /locus_tag="CLS_T_39340"
FT   gap             91657..92179
FT                   /estimated_length=523
FT   CDS             92386..94098
FT                   /transl_table=11
FT                   /locus_tag="CLS_01020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75990"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE66"
FT                   /protein_id="CBK75990.1"
FT   CDS             complement(94111..94806)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01030"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75991"
FT                   /db_xref="GOA:D6DE67"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE67"
FT                   /protein_id="CBK75991.1"
FT                   NVELRGVDY"
FT   CDS             94799..94939
FT                   /transl_table=11
FT                   /locus_tag="CLS_01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75992"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE68"
FT                   /protein_id="CBK75992.1"
FT                   A"
FT   CDS             95206..95850
FT                   /transl_table=11
FT                   /locus_tag="CLS_01050"
FT                   /product="Cytosine/adenosine deaminases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75993"
FT                   /db_xref="GOA:D6DE69"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE69"
FT                   /protein_id="CBK75993.1"
FT   CDS             96565..97632
FT                   /transl_table=11
FT                   /locus_tag="CLS_01060"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75994"
FT                   /db_xref="GOA:D6DE70"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE70"
FT                   /protein_id="CBK75994.1"
FT                   MIREAKAVGISFGDK"
FT   CDS             97663..99330
FT                   /transl_table=11
FT                   /locus_tag="CLS_01070"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75995"
FT                   /db_xref="GOA:D6DE71"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE71"
FT                   /protein_id="CBK75995.1"
FT   CDS             99823..100422
FT                   /transl_table=11
FT                   /locus_tag="CLS_01090"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75996"
FT                   /db_xref="GOA:D6DE72"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE72"
FT                   /protein_id="CBK75996.1"
FT   CDS             100465..102978
FT                   /transl_table=11
FT                   /locus_tag="CLS_01100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75997"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE73"
FT                   /protein_id="CBK75997.1"
FT   CDS             103095..103922
FT                   /transl_table=11
FT                   /locus_tag="CLS_01110"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75998"
FT                   /db_xref="GOA:D6DE74"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE74"
FT                   /protein_id="CBK75998.1"
FT   CDS             103968..104672
FT                   /transl_table=11
FT                   /locus_tag="CLS_01120"
FT                   /product="Colicin V production protein."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK75999"
FT                   /db_xref="GOA:D6DE75"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE75"
FT                   /protein_id="CBK75999.1"
FT                   AKFVMSLIAGIF"
FT   CDS             104720..104812
FT                   /transl_table=11
FT                   /locus_tag="CLS_01130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76000"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE76"
FT                   /protein_id="CBK76000.1"
FT                   /translation="MKKAVMKKVAMKKAACFAWNQVLARQAAFS"
FT   CDS             complement(106124..106573)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76001"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE77"
FT                   /protein_id="CBK76001.1"
FT   CDS             complement(106607..106714)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76002"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE78"
FT                   /protein_id="CBK76002.1"
FT   CDS             complement(106764..107627)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01170"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76003"
FT                   /db_xref="InterPro:IPR005363"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE79"
FT                   /protein_id="CBK76003.1"
FT                   VWMDFD"
FT   CDS             complement(107644..112074)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01180"
FT                   /product="Suppressor of fused protein (SUFU)."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76004"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="InterPro:IPR025349"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE80"
FT                   /protein_id="CBK76004.1"
FT                   ANVLRQSTVWYFWWD"
FT   CDS             complement(112116..112685)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76005"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE81"
FT                   /protein_id="CBK76005.1"
FT   CDS             complement(112700..113659)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76006"
FT                   /db_xref="InterPro:IPR028049"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE82"
FT                   /protein_id="CBK76006.1"
FT   CDS             complement(113671..114675)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76007"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE83"
FT                   /protein_id="CBK76007.1"
FT   CDS             complement(114979..115407)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76008"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE84"
FT                   /protein_id="CBK76008.1"
FT   CDS             complement(115727..116107)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76009"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE85"
FT                   /protein_id="CBK76009.1"
FT   CDS             complement(116114..116974)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01250"
FT                   /product="conserved hypothetical protein, ribA/ribD-fused"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76010"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE86"
FT                   /protein_id="CBK76010.1"
FT                   DWNAV"
FT   CDS             complement(117051..118076)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76011"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE87"
FT                   /protein_id="CBK76011.1"
FT                   E"
FT   CDS             complement(118086..120191)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76012"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE88"
FT                   /protein_id="CBK76012.1"
FT                   GIKVDLL"
FT   CDS             complement(120191..120517)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76013"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE89"
FT                   /protein_id="CBK76013.1"
FT                   NIAT"
FT   CDS             complement(120541..121059)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76014"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE90"
FT                   /protein_id="CBK76014.1"
FT                   PVKRLSSKL"
FT   CDS             complement(121235..121699)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76015"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE91"
FT                   /protein_id="CBK76015.1"
FT   CDS             complement(121724..122479)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76016"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE92"
FT                   /protein_id="CBK76016.1"
FT   CDS             complement(122501..123157)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01320"
FT                   /product="Suppressor of fused protein (SUFU)."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76017"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE93"
FT                   /protein_id="CBK76017.1"
FT   CDS             complement(123242..124075)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76018"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE94"
FT                   /protein_id="CBK76018.1"
FT   CDS             complement(124093..124494)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76019"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE95"
FT                   /protein_id="CBK76019.1"
FT   CDS             complement(124508..125599)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01350"
FT                   /product="Ankyrin repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76020"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE96"
FT                   /protein_id="CBK76020.1"
FT   CDS             complement(125618..127000)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76021"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE97"
FT                   /protein_id="CBK76021.1"
FT                   FQ"
FT   CDS             complement(126997..128427)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76022"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE98"
FT                   /protein_id="CBK76022.1"
FT                   RQIFIPITKNLEGNGGLL"
FT   CDS             complement(128662..129225)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01380"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76023"
FT                   /db_xref="GOA:D6DE99"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:D6DE99"
FT                   /protein_id="CBK76023.1"
FT   CDS             complement(129534..130949)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01390"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76024"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEA0"
FT                   /protein_id="CBK76024.1"
FT                   EQKQEKEKDHDQR"
FT   gap             130966..132348
FT                   /estimated_length=1383
FT   gap             136697..138610
FT                   /estimated_length=1914
FT   CDS             complement(139050..139883)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01440"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76025"
FT                   /db_xref="GOA:D6DEA1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEA1"
FT                   /protein_id="CBK76025.1"
FT   CDS             complement(140052..140354)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76026"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEA2"
FT                   /protein_id="CBK76026.1"
FT   CDS             complement(140489..140704)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76027"
FT                   /db_xref="InterPro:IPR026990"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEA3"
FT                   /protein_id="CBK76027.1"
FT   CDS             complement(140783..142633)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01470"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76028"
FT                   /db_xref="GOA:D6DEA4"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025378"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEA4"
FT                   /protein_id="CBK76028.1"
FT   CDS             complement(142681..142992)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76029"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEA5"
FT                   /protein_id="CBK76029.1"
FT   CDS             complement(142989..143489)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76030"
FT                   /db_xref="InterPro:IPR024234"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEA6"
FT                   /protein_id="CBK76030.1"
FT                   LER"
FT   CDS             complement(143576..144322)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01500"
FT                   /product="Prophage antirepressor"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76031"
FT                   /db_xref="GOA:D6DEA7"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEA7"
FT                   /protein_id="CBK76031.1"
FT   CDS             144414..144782
FT                   /transl_table=11
FT                   /locus_tag="CLS_01510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76032"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEA8"
FT                   /protein_id="CBK76032.1"
FT                   FGVRKENKCNREGTETNG"
FT   CDS             complement(145108..146841)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01530"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76033"
FT                   /db_xref="GOA:D6DEA9"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEA9"
FT                   /protein_id="CBK76033.1"
FT                   L"
FT   CDS             147999..149042
FT                   /transl_table=11
FT                   /locus_tag="CLS_01540"
FT                   /product="Inhibitor of the KinA pathway to sporulation,
FT                   predicted exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76034"
FT                   /db_xref="GOA:D6DEB0"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEB0"
FT                   /protein_id="CBK76034.1"
FT                   GAAGQQG"
FT   CDS             complement(149332..151041)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01550"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76035"
FT                   /db_xref="GOA:D6DEB1"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEB1"
FT                   /protein_id="CBK76035.1"
FT   CDS             complement(151182..151910)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01560"
FT                   /product="integral membrane protein TIGR01906"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76036"
FT                   /db_xref="InterPro:IPR010178"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEB2"
FT                   /protein_id="CBK76036.1"
FT   CDS             152387..153067
FT                   /transl_table=11
FT                   /locus_tag="CLS_01570"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED/haloacid
FT                   dehalogenase superfamily, subfamily IA, variant 1 with
FT                   third motif having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76037"
FT                   /db_xref="GOA:D6DEB3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEB3"
FT                   /protein_id="CBK76037.1"
FT                   NTEK"
FT   CDS             153251..153553
FT                   /transl_table=11
FT                   /locus_tag="CLS_01580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76038"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEB4"
FT                   /protein_id="CBK76038.1"
FT   CDS             complement(153734..154654)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01600"
FT                   /product="Bacterial SH3 domain."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76039"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEB5"
FT                   /protein_id="CBK76039.1"
FT   CDS             155020..155661
FT                   /transl_table=11
FT                   /locus_tag="CLS_01620"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /function="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76040"
FT                   /db_xref="GOA:D6DEB6"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEB6"
FT                   /protein_id="CBK76040.1"
FT   CDS             155758..155919
FT                   /transl_table=11
FT                   /locus_tag="CLS_01630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76041"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEB7"
FT                   /protein_id="CBK76041.1"
FT                   CAKQCRRR"
FT   tRNA            156258..156330
FT                   /locus_tag="CLS_T_39350"
FT   tRNA            156370..156442
FT                   /locus_tag="CLS_T_39360"
FT   CDS             complement(156614..157672)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01640"
FT                   /product="pilus retraction protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76042"
FT                   /db_xref="GOA:D6DEB8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEB8"
FT                   /protein_id="CBK76042.1"
FT                   SLNPEQMKMRLG"
FT   CDS             complement(157700..158167)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76043"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEB9"
FT                   /protein_id="CBK76043.1"
FT   CDS             complement(158164..158667)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76044"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEC0"
FT                   /protein_id="CBK76044.1"
FT                   GGQS"
FT   CDS             complement(158679..159284)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76045"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEC1"
FT                   /protein_id="CBK76045.1"
FT   CDS             complement(159278..159493)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76046"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEC2"
FT                   /protein_id="CBK76046.1"
FT   CDS             complement(159765..160811)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01690"
FT                   /product="Type II secretory pathway, component PulF"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76047"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEC3"
FT                   /protein_id="CBK76047.1"
FT                   AGILSSIG"
FT   CDS             complement(160845..161753)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01700"
FT                   /product="Transglutaminase-like enzymes, putative cysteine
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76048"
FT                   /db_xref="GOA:D6DEC4"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEC4"
FT                   /protein_id="CBK76048.1"
FT   CDS             161868..161963
FT                   /transl_table=11
FT                   /locus_tag="CLS_01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76049"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEC5"
FT                   /protein_id="CBK76049.1"
FT                   /translation="MKRKAAEAVRKQAVAICLKEGCRICEFICMN"
FT   CDS             162142..163539
FT                   /transl_table=11
FT                   /locus_tag="CLS_01720"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76050"
FT                   /db_xref="GOA:D6DEC6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEC6"
FT                   /protein_id="CBK76050.1"
FT                   EKRPYRA"
FT   CDS             complement(163541..165931)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01730"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76051"
FT                   /db_xref="GOA:D6DEC7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEC7"
FT                   /protein_id="CBK76051.1"
FT   CDS             complement(165941..166636)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01740"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76052"
FT                   /db_xref="GOA:D6DEC8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEC8"
FT                   /protein_id="CBK76052.1"
FT                   GVGYKIEKQ"
FT   CDS             166667..167005
FT                   /transl_table=11
FT                   /locus_tag="CLS_01750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76053"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEC9"
FT                   /protein_id="CBK76053.1"
FT                   FFLTNKRP"
FT   CDS             167149..168180
FT                   /transl_table=11
FT                   /locus_tag="CLS_01760"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /function="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76054"
FT                   /db_xref="GOA:D6DED0"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D6DED0"
FT                   /protein_id="CBK76054.1"
FT                   LEW"
FT   CDS             168351..168584
FT                   /transl_table=11
FT                   /locus_tag="CLS_01770"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76055"
FT                   /db_xref="GOA:D6DED1"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:D6DED1"
FT                   /protein_id="CBK76055.1"
FT   CDS             168584..169507
FT                   /transl_table=11
FT                   /locus_tag="CLS_01780"
FT                   /product="putative enoyl-(acyl-carrier-protein) reductase
FT                   II"
FT                   /EC_number="1.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76056"
FT                   /db_xref="GOA:D6DED2"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017569"
FT                   /db_xref="UniProtKB/TrEMBL:D6DED2"
FT                   /protein_id="CBK76056.1"
FT   CDS             169674..170591
FT                   /transl_table=11
FT                   /locus_tag="CLS_01790"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76057"
FT                   /db_xref="GOA:D6DED3"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:D6DED3"
FT                   /protein_id="CBK76057.1"
FT   CDS             170687..171430
FT                   /transl_table=11
FT                   /locus_tag="CLS_01800"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76058"
FT                   /db_xref="GOA:D6DED4"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:D6DED4"
FT                   /protein_id="CBK76058.1"
FT   CDS             171482..172720
FT                   /transl_table=11
FT                   /locus_tag="CLS_01810"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase 2"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76059"
FT                   /db_xref="GOA:D6DED5"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniProtKB/TrEMBL:D6DED5"
FT                   /protein_id="CBK76059.1"
FT                   GHNASLVVKKYEA"
FT   CDS             172739..173254
FT                   /transl_table=11
FT                   /locus_tag="CLS_01820"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76060"
FT                   /db_xref="GOA:D6DED6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D6DED6"
FT                   /protein_id="CBK76060.1"
FT                   GQPLFRIK"
FT   CDS             173314..173736
FT                   /transl_table=11
FT                   /locus_tag="CLS_01830"
FT                   /product="beta-hydroxyacyl-[acyl carrier protein]
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76061"
FT                   /db_xref="GOA:D6DED7"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D6DED7"
FT                   /protein_id="CBK76061.1"
FT   CDS             175191..177074
FT                   /transl_table=11
FT                   /locus_tag="CLS_01850"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /function="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76062"
FT                   /db_xref="GOA:D6DED8"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D6DED8"
FT                   /protein_id="CBK76062.1"
FT   CDS             177106..178206
FT                   /transl_table=11
FT                   /locus_tag="CLS_01860"
FT                   /product="Dioxygenases related to 2-nitropropane
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76063"
FT                   /db_xref="GOA:D6DED9"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6DED9"
FT                   /protein_id="CBK76063.1"
FT   CDS             complement(180240..180596)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01890"
FT                   /product="conserved hypothetical protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76064"
FT                   /db_xref="GOA:D6DEE0"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEE0"
FT                   /protein_id="CBK76064.1"
FT                   LVGFKEAEWEARLK"
FT   CDS             complement(180614..180745)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76065"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEE1"
FT                   /protein_id="CBK76065.1"
FT   CDS             181175..181702
FT                   /transl_table=11
FT                   /locus_tag="CLS_01910"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76066"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEE2"
FT                   /protein_id="CBK76066.1"
FT                   IAASVVIAGAIV"
FT   CDS             182480..183127
FT                   /transl_table=11
FT                   /locus_tag="CLS_01930"
FT                   /product="Sporulation and spore germination."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76067"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEE3"
FT                   /protein_id="CBK76067.1"
FT   CDS             complement(183409..183534)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76068"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEE4"
FT                   /protein_id="CBK76068.1"
FT   CDS             complement(183528..184268)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76069"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEE5"
FT                   /protein_id="CBK76069.1"
FT   gap             184840..185254
FT                   /estimated_length=415
FT   CDS             complement(185362..186216)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01960"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76070"
FT                   /db_xref="GOA:D6DEE6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEE6"
FT                   /protein_id="CBK76070.1"
FT                   TLP"
FT   CDS             186376..187065
FT                   /transl_table=11
FT                   /locus_tag="CLS_01970"
FT                   /product="Uncharacterized BCR, YitT family COG1284."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76071"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEE7"
FT                   /protein_id="CBK76071.1"
FT                   SEALQKD"
FT   CDS             187215..187289
FT                   /transl_table=11
FT                   /locus_tag="CLS_01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76072"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEE8"
FT                   /protein_id="CBK76072.1"
FT                   /translation="MEIQTGGCRLFYHKGSAQNALYDK"
FT   CDS             complement(187301..189178)
FT                   /transl_table=11
FT                   /locus_tag="CLS_01990"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_01990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76073"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEE9"
FT                   /protein_id="CBK76073.1"
FT   CDS             189271..189399
FT                   /transl_table=11
FT                   /locus_tag="CLS_02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76074"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEF0"
FT                   /protein_id="CBK76074.1"
FT   CDS             complement(189430..190260)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02010"
FT                   /product="Peptidase propeptide and YPEB domain."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76075"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEF1"
FT                   /protein_id="CBK76075.1"
FT   CDS             190662..191318
FT                   /transl_table=11
FT                   /locus_tag="CLS_02030"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76076"
FT                   /db_xref="GOA:D6DEF2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEF2"
FT                   /protein_id="CBK76076.1"
FT   CDS             191668..192456
FT                   /transl_table=11
FT                   /locus_tag="CLS_02050"
FT                   /product="Predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76077"
FT                   /db_xref="GOA:D6DEF3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEF3"
FT                   /protein_id="CBK76077.1"
FT   CDS             192416..193210
FT                   /transl_table=11
FT                   /locus_tag="CLS_02060"
FT                   /product="Protein of unknown function (DUF2848)."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76078"
FT                   /db_xref="GOA:D6DEF4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR021269"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEF4"
FT                   /protein_id="CBK76078.1"
FT   CDS             193210..194262
FT                   /transl_table=11
FT                   /locus_tag="CLS_02070"
FT                   /product="tripartite ATP-independent periplasmic
FT                   transporter solute receptor, DctP family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76079"
FT                   /db_xref="GOA:D6DEF5"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEF5"
FT                   /protein_id="CBK76079.1"
FT                   HEEMGGSEND"
FT   CDS             194255..194728
FT                   /transl_table=11
FT                   /locus_tag="CLS_02080"
FT                   /product="TRAP-type C4-dicarboxylate transport system,
FT                   small permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76080"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEF6"
FT                   /protein_id="CBK76080.1"
FT   CDS             194725..195993
FT                   /transl_table=11
FT                   /locus_tag="CLS_02090"
FT                   /product="TRAP transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76081"
FT                   /db_xref="GOA:D6DEF7"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEF7"
FT                   /protein_id="CBK76081.1"
FT   CDS             196177..196377
FT                   /transl_table=11
FT                   /locus_tag="CLS_02100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76082"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEF8"
FT                   /protein_id="CBK76082.1"
FT   CDS             196502..198487
FT                   /transl_table=11
FT                   /locus_tag="CLS_02110"
FT                   /product="methionyl-tRNA synthetase"
FT                   /function="methionyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76083"
FT                   /db_xref="GOA:D6DEF9"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEF9"
FT                   /protein_id="CBK76083.1"
FT   gap             198830..200324
FT                   /estimated_length=1495
FT   CDS             200398..200625
FT                   /transl_table=11
FT                   /locus_tag="CLS_02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76084"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEG0"
FT                   /protein_id="CBK76084.1"
FT   CDS             200622..201491
FT                   /transl_table=11
FT                   /locus_tag="CLS_02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76085"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEG1"
FT                   /protein_id="CBK76085.1"
FT                   EAGGPAGK"
FT   CDS             202549..203481
FT                   /transl_table=11
FT                   /locus_tag="CLS_02160"
FT                   /product="dimethyladenosine transferase"
FT                   /function="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76086"
FT                   /db_xref="GOA:D6DEG2"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR019825"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEG2"
FT                   /protein_id="CBK76086.1"
FT   tRNA            203708..203780
FT                   /locus_tag="CLS_T_39370"
FT   tRNA            203794..203864
FT                   /locus_tag="CLS_T_39380"
FT   tRNA            204121..204192
FT                   /locus_tag="CLS_T_39390"
FT   CDS             complement(205356..206552)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02180"
FT                   /product="sodium--glutamate symport carrier (gltS)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76087"
FT                   /db_xref="GOA:D6DEG3"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEG3"
FT                   /protein_id="CBK76087.1"
FT   CDS             207054..208025
FT                   /transl_table=11
FT                   /locus_tag="CLS_02190"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76088"
FT                   /db_xref="GOA:D6DEG4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEG4"
FT                   /protein_id="CBK76088.1"
FT   CDS             208022..209011
FT                   /transl_table=11
FT                   /locus_tag="CLS_02200"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76089"
FT                   /db_xref="GOA:D6DEG5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEG5"
FT                   /protein_id="CBK76089.1"
FT   CDS             208998..210026
FT                   /transl_table=11
FT                   /locus_tag="CLS_02210"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76090"
FT                   /db_xref="GOA:D6DEG6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEG6"
FT                   /protein_id="CBK76090.1"
FT                   LK"
FT   tRNA            210131..210204
FT                   /locus_tag="CLS_T_39400"
FT   tRNA            210234..210306
FT                   /locus_tag="CLS_T_39410"
FT   tRNA            210409..210484
FT                   /locus_tag="CLS_T_39420"
FT   tRNA            210505..210586
FT                   /locus_tag="CLS_T_39430"
FT   tRNA            210646..210719
FT                   /locus_tag="CLS_T_39440"
FT   tRNA            210779..210851
FT                   /locus_tag="CLS_T_39450"
FT   tRNA            210932..211004
FT                   /locus_tag="CLS_T_39460"
FT   CDS             211167..211925
FT                   /transl_table=11
FT                   /locus_tag="CLS_02220"
FT                   /product="D-alanyl-D-alanine carboxypeptidase."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76091"
FT                   /db_xref="GOA:D6DEG7"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEG7"
FT                   /protein_id="CBK76091.1"
FT   CDS             212118..213140
FT                   /transl_table=11
FT                   /locus_tag="CLS_02230"
FT                   /product="Predicted hydrolase (metallo-beta-lactamase
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76092"
FT                   /db_xref="GOA:D6DEG8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEG8"
FT                   /protein_id="CBK76092.1"
FT                   "
FT   CDS             213234..213401
FT                   /transl_table=11
FT                   /locus_tag="CLS_02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76093"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEG9"
FT                   /protein_id="CBK76093.1"
FT                   FYLKIITITV"
FT   CDS             213445..215382
FT                   /transl_table=11
FT                   /locus_tag="CLS_02250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76094"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEH0"
FT                   /protein_id="CBK76094.1"
FT                   ISTEASLVKW"
FT   CDS             215463..217160
FT                   /transl_table=11
FT                   /locus_tag="CLS_02260"
FT                   /product="Arginine/lysine/ornithine decarboxylases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76095"
FT                   /db_xref="GOA:D6DEH1"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEH1"
FT                   /protein_id="CBK76095.1"
FT   CDS             217162..217845
FT                   /transl_table=11
FT                   /locus_tag="CLS_02270"
FT                   /product="Guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76096"
FT                   /db_xref="GOA:D6DEH2"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEH2"
FT                   /protein_id="CBK76096.1"
FT                   FPQKG"
FT   CDS             217970..218032
FT                   /transl_table=11
FT                   /locus_tag="CLS_02280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76097"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEH3"
FT                   /protein_id="CBK76097.1"
FT                   /translation="MTAVQAVREETAALMRSFYA"
FT   CDS             218053..219042
FT                   /transl_table=11
FT                   /locus_tag="CLS_02290"
FT                   /product="DNA polymerase III, delta' subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76098"
FT                   /db_xref="GOA:D6DEH4"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEH4"
FT                   /protein_id="CBK76098.1"
FT   CDS             219047..219955
FT                   /transl_table=11
FT                   /locus_tag="CLS_02300"
FT                   /product="Uncharacterized homolog of PSP1"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76099"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEH5"
FT                   /protein_id="CBK76099.1"
FT   CDS             220769..221647
FT                   /transl_table=11
FT                   /locus_tag="CLS_02320"
FT                   /product="conserved hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76100"
FT                   /db_xref="GOA:D6DEH6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEH6"
FT                   /protein_id="CBK76100.1"
FT                   ISKREVYQALL"
FT   CDS             complement(221828..222208)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02340"
FT                   /product="Copper chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76101"
FT                   /db_xref="GOA:D6DEH7"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEH7"
FT                   /protein_id="CBK76101.1"
FT   CDS             complement(222446..224419)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02350"
FT                   /product="alpha-1,4-glucan:alpha-1,4-glucan
FT                   6-glycosyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76102"
FT                   /db_xref="GOA:D6DEH8"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEH8"
FT                   /protein_id="CBK76102.1"
FT   CDS             complement(224560..224784)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76103"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEH9"
FT                   /protein_id="CBK76103.1"
FT   CDS             225518..226174
FT                   /transl_table=11
FT                   /locus_tag="CLS_02380"
FT                   /product="transaldolase, putative, TalC family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76104"
FT                   /db_xref="GOA:D6DEI0"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEI0"
FT                   /protein_id="CBK76104.1"
FT   CDS             226905..227330
FT                   /transl_table=11
FT                   /locus_tag="CLS_02400"
FT                   /product="Type IV leader peptidase family."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76105"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEI1"
FT                   /protein_id="CBK76105.1"
FT   CDS             227327..228343
FT                   /transl_table=11
FT                   /locus_tag="CLS_02410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76106"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEI2"
FT                   /protein_id="CBK76106.1"
FT   CDS             228485..228529
FT                   /transl_table=11
FT                   /locus_tag="CLS_02430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76107"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEI3"
FT                   /protein_id="CBK76107.1"
FT                   /translation="MERKKRTGQYGKKA"
FT   CDS             230727..231104
FT                   /transl_table=11
FT                   /locus_tag="CLS_02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76108"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEI4"
FT                   /protein_id="CBK76108.1"
FT   gap             231408..232589
FT                   /estimated_length=1182
FT   CDS             232595..233932
FT                   /transl_table=11
FT                   /locus_tag="CLS_02490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76109"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEI5"
FT                   /protein_id="CBK76109.1"
FT   CDS             234096..234944
FT                   /transl_table=11
FT                   /locus_tag="CLS_02500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76110"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEI6"
FT                   /protein_id="CBK76110.1"
FT                   T"
FT   CDS             234941..235414
FT                   /transl_table=11
FT                   /locus_tag="CLS_02510"
FT                   /product="Type IV leader peptidase family."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76111"
FT                   /db_xref="GOA:D6DEI7"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEI7"
FT                   /protein_id="CBK76111.1"
FT   rRNA            235702..238322
FT                   /gene="16S"
FT                   /locus_tag="CLS_R_39840"
FT                   /product="16S rRNA"
FT   gap             236682..237973
FT                   /estimated_length=1292
FT   rRNA            238291..241174
FT                   /gene="23S"
FT                   /locus_tag="CLS_R_39830"
FT                   /product="23S rRNA"
FT   CDS             241565..241999
FT                   /transl_table=11
FT                   /locus_tag="CLS_02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76112"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEI8"
FT                   /protein_id="CBK76112.1"
FT   CDS             242277..243206
FT                   /transl_table=11
FT                   /locus_tag="CLS_02550"
FT                   /product="O-Antigen ligase."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76113"
FT                   /db_xref="GOA:D6DEI9"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEI9"
FT                   /protein_id="CBK76113.1"
FT   CDS             243269..245125
FT                   /transl_table=11
FT                   /locus_tag="CLS_02560"
FT                   /product="Predicted nucleoside-diphosphate sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76114"
FT                   /db_xref="GOA:D6DEJ0"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEJ0"
FT                   /protein_id="CBK76114.1"
FT   CDS             245654..246889
FT                   /transl_table=11
FT                   /locus_tag="CLS_02570"
FT                   /product="Alcohol dehydrogenase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76115"
FT                   /db_xref="GOA:D6DEJ1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEJ1"
FT                   /protein_id="CBK76115.1"
FT                   FTCIYYGTEVDF"
FT   CDS             complement(247060..247740)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02580"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76116"
FT                   /db_xref="GOA:D6DEJ2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEJ2"
FT                   /protein_id="CBK76116.1"
FT                   GKRL"
FT   CDS             247829..247921
FT                   /transl_table=11
FT                   /locus_tag="CLS_02590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76117"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEJ3"
FT                   /protein_id="CBK76117.1"
FT                   /translation="MQMQRKEISGDRRLLEINITGICKRTPLLR"
FT   CDS             247964..248968
FT                   /transl_table=11
FT                   /locus_tag="CLS_02600"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76118"
FT                   /db_xref="GOA:D6DEJ4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEJ4"
FT                   /protein_id="CBK76118.1"
FT   CDS             complement(248988..249095)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76119"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEJ5"
FT                   /protein_id="CBK76119.1"
FT   CDS             249094..250536
FT                   /transl_table=11
FT                   /locus_tag="CLS_02620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76120"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEJ6"
FT                   /protein_id="CBK76120.1"
FT   CDS             250874..251026
FT                   /transl_table=11
FT                   /locus_tag="CLS_02630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76121"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEJ7"
FT                   /protein_id="CBK76121.1"
FT                   GKQEA"
FT   CDS             complement(251199..251597)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76122"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEJ8"
FT                   /protein_id="CBK76122.1"
FT   CDS             251743..251994
FT                   /transl_table=11
FT                   /locus_tag="CLS_02660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76123"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEJ9"
FT                   /protein_id="CBK76123.1"
FT   CDS             complement(252013..253377)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02670"
FT                   /product="Putative cell wall binding repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76124"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEK0"
FT                   /protein_id="CBK76124.1"
FT   CDS             complement(253874..255481)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02690"
FT                   /product="Isopropylmalate/homocitrate/citramalate
FT                   synthases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76125"
FT                   /db_xref="GOA:D6DEK1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEK1"
FT                   /protein_id="CBK76125.1"
FT                   KLQDSLTVDFVTDSWYAE"
FT   CDS             complement(255509..256168)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02700"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76126"
FT                   /db_xref="GOA:D6DEK2"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEK2"
FT                   /protein_id="CBK76126.1"
FT   CDS             complement(256236..257018)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02710"
FT                   /product="CMP-2-keto-3-deoxyoctulosonic acid synthetase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76127"
FT                   /db_xref="GOA:D6DEK3"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEK3"
FT                   /protein_id="CBK76127.1"
FT   CDS             257295..259223
FT                   /transl_table=11
FT                   /locus_tag="CLS_02720"
FT                   /product="Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76128"
FT                   /db_xref="GOA:D6DEK4"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEK4"
FT                   /protein_id="CBK76128.1"
FT                   IIERIKK"
FT   CDS             260305..261384
FT                   /transl_table=11
FT                   /locus_tag="CLS_02740"
FT                   /product="Glycosyltransferases involved in cell wall
FT                   biogenesis"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76129"
FT                   /db_xref="GOA:D6DEK5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEK5"
FT                   /protein_id="CBK76129.1"
FT   CDS             261381..263567
FT                   /transl_table=11
FT                   /locus_tag="CLS_02750"
FT                   /product="Predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76130"
FT                   /db_xref="GOA:D6DEK6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEK6"
FT                   /protein_id="CBK76130.1"
FT   CDS             263599..264648
FT                   /transl_table=11
FT                   /locus_tag="CLS_02760"
FT                   /product="Predicted glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76131"
FT                   /db_xref="GOA:D6DEK7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEK7"
FT                   /protein_id="CBK76131.1"
FT                   PAAGCRDDA"
FT   CDS             264685..266988
FT                   /transl_table=11
FT                   /locus_tag="CLS_02770"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator common domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76132"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEK8"
FT                   /protein_id="CBK76132.1"
FT                   AGPGGSAGPAGPAA"
FT   CDS             267034..268452
FT                   /transl_table=11
FT                   /locus_tag="CLS_02780"
FT                   /product="Undecaprenyl-phosphate glucose
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76133"
FT                   /db_xref="GOA:D6DEK9"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEK9"
FT                   /protein_id="CBK76133.1"
FT                   FLTVFKGFINKNAY"
FT   CDS             268583..270562
FT                   /transl_table=11
FT                   /locus_tag="CLS_02790"
FT                   /product="cell envelope-related function transcriptional
FT                   attenuator common domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76134"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEL0"
FT                   /protein_id="CBK76134.1"
FT   CDS             complement(270662..271486)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76135"
FT                   /db_xref="GOA:D6DEL1"
FT                   /db_xref="InterPro:IPR001450"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEL1"
FT                   /protein_id="CBK76135.1"
FT   CDS             complement(271512..271661)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76136"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEL2"
FT                   /protein_id="CBK76136.1"
FT                   SSGR"
FT   CDS             271914..272144
FT                   /transl_table=11
FT                   /locus_tag="CLS_02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76137"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEL3"
FT                   /protein_id="CBK76137.1"
FT   CDS             272167..272673
FT                   /transl_table=11
FT                   /locus_tag="CLS_02840"
FT                   /product="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenases, DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76138"
FT                   /db_xref="GOA:D6DEL4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEL4"
FT                   /protein_id="CBK76138.1"
FT                   VLVRE"
FT   CDS             complement(273817..275583)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02870"
FT                   /product="hydrogenases, Fe-only"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76139"
FT                   /db_xref="GOA:D6DEL5"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEL5"
FT                   /protein_id="CBK76139.1"
FT                   GEKQAFAADEQA"
FT   CDS             277813..277872
FT                   /transl_table=11
FT                   /locus_tag="CLS_02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76140"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEL6"
FT                   /protein_id="CBK76140.1"
FT                   /translation="MKQFPLRCLEKPVQGSLKK"
FT   CDS             278040..278795
FT                   /transl_table=11
FT                   /locus_tag="CLS_02910"
FT                   /product="Chromate transport protein ChrA"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76141"
FT                   /db_xref="GOA:D6DEL7"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEL7"
FT                   /protein_id="CBK76141.1"
FT   CDS             278792..279361
FT                   /transl_table=11
FT                   /locus_tag="CLS_02920"
FT                   /product="Chromate transport protein ChrA"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76142"
FT                   /db_xref="GOA:D6DEL8"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEL8"
FT                   /protein_id="CBK76142.1"
FT   CDS             279641..280144
FT                   /transl_table=11
FT                   /locus_tag="CLS_02930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76143"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEL9"
FT                   /protein_id="CBK76143.1"
FT                   EAKS"
FT   CDS             280387..280932
FT                   /transl_table=11
FT                   /locus_tag="CLS_02940"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76144"
FT                   /db_xref="GOA:D6DEM0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEM0"
FT                   /protein_id="CBK76144.1"
FT                   HGREFPKEVRSFPENDNK"
FT   CDS             280951..282684
FT                   /transl_table=11
FT                   /locus_tag="CLS_02950"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76145"
FT                   /db_xref="GOA:D6DEM1"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEM1"
FT                   /protein_id="CBK76145.1"
FT                   E"
FT   CDS             282677..284566
FT                   /transl_table=11
FT                   /locus_tag="CLS_02960"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76146"
FT                   /db_xref="GOA:D6DEM2"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEM2"
FT                   /protein_id="CBK76146.1"
FT   CDS             complement(284673..284801)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76147"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEM3"
FT                   /protein_id="CBK76147.1"
FT   CDS             complement(284798..285520)
FT                   /transl_table=11
FT                   /locus_tag="CLS_02980"
FT                   /product="transcriptional regulator, GntR family"
FT                   /function="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76148"
FT                   /db_xref="GOA:D6DEM4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012770"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEM4"
FT                   /protein_id="CBK76148.1"
FT                   SRHRPDYFCFQDTAVRRK"
FT   CDS             285711..285794
FT                   /transl_table=11
FT                   /locus_tag="CLS_02990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_02990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76149"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEM5"
FT                   /protein_id="CBK76149.1"
FT                   /translation="MPGLSRDFSREKRYHPERGKARNKNGG"
FT   gap             286247..286648
FT                   /estimated_length=402
FT   CDS             288244..289926
FT                   /transl_table=11
FT                   /locus_tag="CLS_03020"
FT                   /product="alpha,alpha-phosphotrehalase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76150"
FT                   /db_xref="GOA:D6DEM6"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR015902"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEM6"
FT                   /protein_id="CBK76150.1"
FT   CDS             290143..290445
FT                   /transl_table=11
FT                   /locus_tag="CLS_03030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76151"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEM7"
FT                   /protein_id="CBK76151.1"
FT   CDS             290617..291765
FT                   /transl_table=11
FT                   /locus_tag="CLS_03040"
FT                   /product="Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA
FT                   dehydratase subunit, BcrC/BadD/HgdB"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76152"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEM8"
FT                   /protein_id="CBK76152.1"
FT   CDS             293528..294481
FT                   /transl_table=11
FT                   /locus_tag="CLS_03060"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /function="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family (TC 3.A.1.1.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76153"
FT                   /db_xref="GOA:D6DEM9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEM9"
FT                   /protein_id="CBK76153.1"
FT   CDS             295578..296285
FT                   /transl_table=11
FT                   /locus_tag="CLS_03080"
FT                   /product="Cell wall-associated hydrolases
FT                   (invasion-associated proteins)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76154"
FT                   /db_xref="GOA:D6DEN0"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEN0"
FT                   /protein_id="CBK76154.1"
FT                   TYRNPVKIVNVLG"
FT   CDS             296443..296583
FT                   /transl_table=11
FT                   /locus_tag="CLS_03090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76155"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEN1"
FT                   /protein_id="CBK76155.1"
FT                   Y"
FT   CDS             296617..296820
FT                   /transl_table=11
FT                   /locus_tag="CLS_03100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76156"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEN2"
FT                   /protein_id="CBK76156.1"
FT   CDS             297153..297503
FT                   /transl_table=11
FT                   /locus_tag="CLS_03120"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76157"
FT                   /db_xref="GOA:D6DEN3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEN3"
FT                   /protein_id="CBK76157.1"
FT                   SQEPFDPGGKVH"
FT   CDS             300636..301244
FT                   /transl_table=11
FT                   /locus_tag="CLS_03150"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76158"
FT                   /db_xref="GOA:D6DEN4"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEN4"
FT                   /protein_id="CBK76158.1"
FT   CDS             301241..301735
FT                   /transl_table=11
FT                   /locus_tag="CLS_03160"
FT                   /product="phosphoesterase, MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76159"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEN5"
FT                   /protein_id="CBK76159.1"
FT                   L"
FT   tRNA            302136..302210
FT                   /locus_tag="CLS_T_39470"
FT   tRNA            302218..302288
FT                   /locus_tag="CLS_T_39480"
FT   tRNA            302394..302467
FT                   /locus_tag="CLS_T_39490"
FT   tRNA            302509..302582
FT                   /locus_tag="CLS_T_39500"
FT   tRNA            302603..302675
FT                   /locus_tag="CLS_T_39510"
FT   tRNA            302687..302759
FT                   /locus_tag="CLS_T_39520"
FT   CDS             303068..303763
FT                   /transl_table=11
FT                   /locus_tag="CLS_03170"
FT                   /product="Pyruvate-formate lyase-activating enzyme"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76160"
FT                   /db_xref="GOA:D6DEN6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEN6"
FT                   /protein_id="CBK76160.1"
FT                   REGEVQIGG"
FT   CDS             303887..306262
FT                   /transl_table=11
FT                   /locus_tag="CLS_03180"
FT                   /product="Pyruvate-formate lyase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76161"
FT                   /db_xref="GOA:D6DEN7"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEN7"
FT                   /protein_id="CBK76161.1"
FT   CDS             306381..307745
FT                   /transl_table=11
FT                   /locus_tag="CLS_03190"
FT                   /product="Permeases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76162"
FT                   /db_xref="GOA:D6DEN8"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEN8"
FT                   /protein_id="CBK76162.1"
FT   CDS             307747..307920
FT                   /transl_table=11
FT                   /locus_tag="CLS_03200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76163"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEN9"
FT                   /protein_id="CBK76163.1"
FT                   KQTNPRYAQSCC"
FT   tRNA            308076..308146
FT                   /locus_tag="CLS_T_39530"
FT   CDS             308395..309030
FT                   /transl_table=11
FT                   /locus_tag="CLS_03210"
FT                   /product="Predicted EndoIII-related endonuclease"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76164"
FT                   /db_xref="GOA:D6DEP0"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEP0"
FT                   /protein_id="CBK76164.1"
FT   CDS             309207..309281
FT                   /transl_table=11
FT                   /locus_tag="CLS_03220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76165"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEP1"
FT                   /protein_id="CBK76165.1"
FT                   /translation="MTALRDRAEGSFLKNRKTRRNRII"
FT   CDS             310774..311676
FT                   /transl_table=11
FT                   /locus_tag="CLS_03240"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76166"
FT                   /db_xref="GOA:D6DEP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEP2"
FT                   /protein_id="CBK76166.1"
FT   CDS             311670..312890
FT                   /transl_table=11
FT                   /locus_tag="CLS_03250"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76167"
FT                   /db_xref="GOA:D6DEP3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEP3"
FT                   /protein_id="CBK76167.1"
FT                   IDALRYE"
FT   CDS             312941..313021
FT                   /transl_table=11
FT                   /locus_tag="CLS_03260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76168"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEP4"
FT                   /protein_id="CBK76168.1"
FT                   /translation="MKEDSGLPLFAGCMRPATPDFFMWDE"
FT   CDS             313125..313553
FT                   /transl_table=11
FT                   /locus_tag="CLS_03270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76169"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEP5"
FT                   /protein_id="CBK76169.1"
FT   CDS             313550..314497
FT                   /transl_table=11
FT                   /locus_tag="CLS_03280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76170"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEP6"
FT                   /protein_id="CBK76170.1"
FT   CDS             314525..315397
FT                   /transl_table=11
FT                   /locus_tag="CLS_03290"
FT                   /product="conserved hypothetical protein TIGR00159"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76171"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEP7"
FT                   /protein_id="CBK76171.1"
FT                   RRKNERKAD"
FT   CDS             315378..316763
FT                   /transl_table=11
FT                   /locus_tag="CLS_03300"
FT                   /product="YbbR-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76172"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEP8"
FT                   /protein_id="CBK76172.1"
FT                   RQE"
FT   CDS             316827..317090
FT                   /transl_table=11
FT                   /locus_tag="CLS_03310"
FT                   /product="Phosphotransferase System HPr (HPr) Family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76173"
FT                   /db_xref="GOA:D6DEP9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEP9"
FT                   /protein_id="CBK76173.1"
FT   CDS             317121..318842
FT                   /transl_table=11
FT                   /locus_tag="CLS_03320"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /function="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76174"
FT                   /db_xref="GOA:D6DEQ0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEQ0"
FT                   /protein_id="CBK76174.1"
FT   CDS             319171..320511
FT                   /transl_table=11
FT                   /locus_tag="CLS_03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76175"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEQ1"
FT                   /protein_id="CBK76175.1"
FT   CDS             320569..321759
FT                   /transl_table=11
FT                   /locus_tag="CLS_03340"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76176"
FT                   /db_xref="GOA:D6DEQ2"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEQ2"
FT                   /protein_id="CBK76176.1"
FT   CDS             321857..322996
FT                   /transl_table=11
FT                   /locus_tag="CLS_03350"
FT                   /product="sporulation integral membrane protein YtvI"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76177"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="InterPro:IPR014227"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEQ3"
FT                   /protein_id="CBK76177.1"
FT   CDS             327554..328363
FT                   /transl_table=11
FT                   /locus_tag="CLS_03400"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76178"
FT                   /db_xref="GOA:D6DEQ4"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEQ4"
FT                   /protein_id="CBK76178.1"
FT   CDS             328496..329395
FT                   /transl_table=11
FT                   /locus_tag="CLS_03410"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76179"
FT                   /db_xref="GOA:D6DEQ5"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEQ5"
FT                   /protein_id="CBK76179.1"
FT                   MIVRDYSTEDKKKMESSM"
FT   CDS             329439..329510
FT                   /transl_table=11
FT                   /locus_tag="CLS_03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76180"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEQ6"
FT                   /protein_id="CBK76180.1"
FT                   /translation="MAGTDLAEWIARKEDKLDREGNF"
FT   CDS             329603..331657
FT                   /transl_table=11
FT                   /locus_tag="CLS_03430"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76181"
FT                   /db_xref="GOA:D6DEQ7"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEQ7"
FT                   /protein_id="CBK76181.1"
FT   CDS             complement(331826..332848)
FT                   /transl_table=11
FT                   /locus_tag="CLS_03450"
FT                   /product="Rubrerythrin."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76182"
FT                   /db_xref="GOA:D6DEQ8"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEQ8"
FT                   /protein_id="CBK76182.1"
FT                   "
FT   CDS             333055..333969
FT                   /transl_table=11
FT                   /locus_tag="CLS_03460"
FT                   /product="homoserine O-succinyltransferase"
FT                   /function="homoserine O-succinyltransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76183"
FT                   /db_xref="GOA:D6DEQ9"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEQ9"
FT                   /protein_id="CBK76183.1"
FT   CDS             334028..334081
FT                   /transl_table=11
FT                   /locus_tag="CLS_03470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76184"
FT                   /db_xref="UniProtKB/TrEMBL:D6DER0"
FT                   /protein_id="CBK76184.1"
FT                   /translation="MEKVKAELAAEKEEAEN"
FT   CDS             334392..336419
FT                   /transl_table=11
FT                   /locus_tag="CLS_03480"
FT                   /product="Predicted aminopeptidase, Iap family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76185"
FT                   /db_xref="GOA:D6DER1"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:D6DER1"
FT                   /protein_id="CBK76185.1"
FT   CDS             336429..337064
FT                   /transl_table=11
FT                   /locus_tag="CLS_03490"
FT                   /product="Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76186"
FT                   /db_xref="GOA:D6DER2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6DER2"
FT                   /protein_id="CBK76186.1"
FT   CDS             338433..339800
FT                   /transl_table=11
FT                   /locus_tag="CLS_03510"
FT                   /product="PAS domain S-box/diguanylate cyclase (GGDEF)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76187"
FT                   /db_xref="GOA:D6DER3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="UniProtKB/TrEMBL:D6DER3"
FT                   /protein_id="CBK76187.1"
FT   CDS             339778..341166
FT                   /transl_table=11
FT                   /locus_tag="CLS_03520"
FT                   /product="Transglutaminase-like enzymes, putative cysteine
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76188"
FT                   /db_xref="GOA:D6DER4"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="UniProtKB/TrEMBL:D6DER4"
FT                   /protein_id="CBK76188.1"
FT                   TEEL"
FT   CDS             341284..341574
FT                   /transl_table=11
FT                   /locus_tag="CLS_03530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76189"
FT                   /db_xref="UniProtKB/TrEMBL:D6DER5"
FT                   /protein_id="CBK76189.1"
FT   CDS             complement(341810..343165)
FT                   /transl_table=11
FT                   /locus_tag="CLS_03540"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76190"
FT                   /db_xref="GOA:D6DER6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6DER6"
FT                   /protein_id="CBK76190.1"
FT   CDS             complement(343180..343332)
FT                   /transl_table=11
FT                   /locus_tag="CLS_03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76191"
FT                   /db_xref="UniProtKB/TrEMBL:D6DER7"
FT                   /protein_id="CBK76191.1"
FT                   FVKKR"
FT   CDS             343331..345517
FT                   /transl_table=11
FT                   /locus_tag="CLS_03560"
FT                   /product="Sulfate permease and related transporters (MFS
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76192"
FT                   /db_xref="GOA:D6DER8"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:D6DER8"
FT                   /protein_id="CBK76192.1"
FT   CDS             345563..345862
FT                   /transl_table=11
FT                   /locus_tag="CLS_03570"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76193"
FT                   /db_xref="GOA:D6DER9"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:D6DER9"
FT                   /protein_id="CBK76193.1"
FT   CDS             345938..348343
FT                   /transl_table=11
FT                   /locus_tag="CLS_03580"
FT                   /product="ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76194"
FT                   /db_xref="GOA:D6DES0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="UniProtKB/TrEMBL:D6DES0"
FT                   /protein_id="CBK76194.1"
FT   CDS             348340..349524
FT                   /transl_table=11
FT                   /locus_tag="CLS_03590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76195"
FT                   /db_xref="UniProtKB/TrEMBL:D6DES1"
FT                   /protein_id="CBK76195.1"
FT   CDS             349864..350829
FT                   /transl_table=11
FT                   /locus_tag="CLS_03600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76196"
FT                   /db_xref="UniProtKB/TrEMBL:D6DES2"
FT                   /protein_id="CBK76196.1"
FT   gap             351547..351912
FT                   /estimated_length=366
FT   tRNA            complement(351981..352052)
FT                   /locus_tag="CLS_T_39820"
FT   CDS             complement(352109..353476)
FT                   /transl_table=11
FT                   /locus_tag="CLS_03620"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76197"
FT                   /db_xref="GOA:D6DES3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6DES3"
FT                   /protein_id="CBK76197.1"
FT   CDS             355072..356535
FT                   /transl_table=11
FT                   /locus_tag="CLS_03640"
FT                   /product="Amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76198"
FT                   /db_xref="GOA:D6DES4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D6DES4"
FT                   /protein_id="CBK76198.1"
FT   CDS             complement(356522..356692)
FT                   /transl_table=11
FT                   /locus_tag="CLS_03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76199"
FT                   /db_xref="UniProtKB/TrEMBL:D6DES5"
FT                   /protein_id="CBK76199.1"
FT                   YLVFILLLTVP"
FT   CDS             complement(356686..357963)
FT                   /transl_table=11
FT                   /locus_tag="CLS_03660"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76200"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/TrEMBL:D6DES6"
FT                   /protein_id="CBK76200.1"
FT   CDS             358157..358618
FT                   /transl_table=11
FT                   /locus_tag="CLS_03680"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76201"
FT                   /db_xref="GOA:D6DES7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6DES7"
FT                   /protein_id="CBK76201.1"
FT   CDS             359244..360446
FT                   /transl_table=11
FT                   /locus_tag="CLS_03700"
FT                   /product="amidohydrolase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76202"
FT                   /db_xref="GOA:D6DES8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="UniProtKB/TrEMBL:D6DES8"
FT                   /protein_id="CBK76202.1"
FT                   M"
FT   CDS             360582..361391
FT                   /transl_table=11
FT                   /locus_tag="CLS_03710"
FT                   /product="Predicted glutamine amidotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76203"
FT                   /db_xref="GOA:D6DES9"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6DES9"
FT                   /protein_id="CBK76203.1"
FT   CDS             361479..361823
FT                   /transl_table=11
FT                   /locus_tag="CLS_03720"
FT                   /product="Macrophage migration inhibitory factor (MIF)."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76204"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:D6DET0"
FT                   /protein_id="CBK76204.1"
FT                   LHWGWNGANF"
FT   CDS             361886..362398
FT                   /transl_table=11
FT                   /locus_tag="CLS_03730"
FT                   /product="Ferritin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76205"
FT                   /db_xref="GOA:D6DET1"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D6DET1"
FT                   /protein_id="CBK76205.1"
FT                   TAPSLTL"
FT   CDS             362451..363563
FT                   /transl_table=11
FT                   /locus_tag="CLS_03740"
FT                   /product="L-aminopeptidase/D-esterase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76206"
FT                   /db_xref="GOA:D6DET2"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:D6DET2"
FT                   /protein_id="CBK76206.1"
FT   CDS             complement(363705..364424)
FT                   /transl_table=11
FT                   /locus_tag="CLS_03760"
FT                   /product="Predicted glutamine amidotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76207"
FT                   /db_xref="GOA:D6DET3"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6DET3"
FT                   /protein_id="CBK76207.1"
FT                   LPLFESLVREACVPFKD"
FT   CDS             364600..364749
FT                   /transl_table=11
FT                   /locus_tag="CLS_03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76208"
FT                   /db_xref="UniProtKB/TrEMBL:D6DET4"
FT                   /protein_id="CBK76208.1"
FT                   IIKR"
FT   CDS             364857..366584
FT                   /transl_table=11
FT                   /locus_tag="CLS_03780"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76209"
FT                   /db_xref="GOA:D6DET5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:D6DET5"
FT                   /protein_id="CBK76209.1"
FT   CDS             366877..367797
FT                   /transl_table=11
FT                   /locus_tag="CLS_03790"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76210"
FT                   /db_xref="GOA:D6DET6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D6DET6"
FT                   /protein_id="CBK76210.1"
FT   CDS             367816..368697
FT                   /transl_table=11
FT                   /locus_tag="CLS_03800"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76211"
FT                   /db_xref="GOA:D6DET7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D6DET7"
FT                   /protein_id="CBK76211.1"
FT                   GLRDALDPKLTD"
FT   CDS             368750..369727
FT                   /transl_table=11
FT                   /locus_tag="CLS_03810"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76212"
FT                   /db_xref="GOA:D6DET8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DET8"
FT                   /protein_id="CBK76212.1"
FT   CDS             369740..370717
FT                   /transl_table=11
FT                   /locus_tag="CLS_03820"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76213"
FT                   /db_xref="GOA:D6DET9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DET9"
FT                   /protein_id="CBK76213.1"
FT   CDS             370920..371720
FT                   /transl_table=11
FT                   /locus_tag="CLS_03830"
FT                   /product="D-aminopeptidase"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76214"
FT                   /db_xref="GOA:D6DEU0"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEU0"
FT                   /protein_id="CBK76214.1"
FT   CDS             372029..373159
FT                   /transl_table=11
FT                   /locus_tag="CLS_03840"
FT                   /product="Cellulase M and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76215"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEU1"
FT                   /protein_id="CBK76215.1"
FT   CDS             373274..373477
FT                   /transl_table=11
FT                   /locus_tag="CLS_03850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76216"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEU2"
FT                   /protein_id="CBK76216.1"
FT   CDS             373534..374259
FT                   /transl_table=11
FT                   /locus_tag="CLS_03860"
FT                   /product="hypothetical protein"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76217"
FT                   /db_xref="GOA:D6DEU3"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEU3"
FT                   /protein_id="CBK76217.1"
FT   CDS             374287..376563
FT                   /transl_table=11
FT                   /locus_tag="CLS_03870"
FT                   /product="CRISPR-associated helicase, Cas3 family"
FT                   /function="CRISPR-associated helicase, Cas3 family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76218"
FT                   /db_xref="GOA:D6DEU4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEU4"
FT                   /protein_id="CBK76218.1"
FT                   KAFLM"
FT   CDS             378386..379048
FT                   /transl_table=11
FT                   /locus_tag="CLS_03900"
FT                   /product="CRISPR-associated protein, Csd5d family"
FT                   /function="CRISPR-associated protein, Csd5d family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76219"
FT                   /db_xref="InterPro:IPR010155"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEU5"
FT                   /protein_id="CBK76219.1"
FT   CDS             379248..380822
FT                   /transl_table=11
FT                   /locus_tag="CLS_03910"
FT                   /product="CRISPR-associated protein, Csd1 family"
FT                   /function="CRISPR-associated protein, Csd1 family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76220"
FT                   /db_xref="InterPro:IPR010144"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEU6"
FT                   /protein_id="CBK76220.1"
FT                   YTKKEDK"
FT   CDS             380823..381722
FT                   /transl_table=11
FT                   /locus_tag="CLS_03920"
FT                   /product="CRISPR-associated protein, Csd2 family"
FT                   /function="CRISPR-associated protein, Csd2 family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76221"
FT                   /db_xref="InterPro:IPR006482"
FT                   /db_xref="InterPro:IPR013418"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEU7"
FT                   /protein_id="CBK76221.1"
FT                   IAIHREQIPESVEVMDKI"
FT   CDS             381862..382524
FT                   /transl_table=11
FT                   /locus_tag="CLS_03930"
FT                   /product="CRISPR-associated exonuclease, Cas4 family"
FT                   /function="CRISPR-associated exonuclease, Cas4 family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76222"
FT                   /db_xref="GOA:D6DEU8"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEU8"
FT                   /protein_id="CBK76222.1"
FT   gap             382989..384491
FT                   /estimated_length=1503
FT   repeat_region   384525..385089
FT                   /rpt_family="CRISPR"
FT   CDS             385218..386810
FT                   /transl_table=11
FT                   /locus_tag="CLS_03950"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76223"
FT                   /db_xref="GOA:D6DEU9"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEU9"
FT                   /protein_id="CBK76223.1"
FT                   NMPEEIKNAGPRA"
FT   CDS             386939..387172
FT                   /transl_table=11
FT                   /locus_tag="CLS_03960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76224"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEV0"
FT                   /protein_id="CBK76224.1"
FT   CDS             complement(387203..388093)
FT                   /transl_table=11
FT                   /locus_tag="CLS_03970"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76225"
FT                   /db_xref="GOA:D6DEV1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEV1"
FT                   /protein_id="CBK76225.1"
FT                   NPCACQLAKLLCRED"
FT   CDS             complement(388240..389127)
FT                   /transl_table=11
FT                   /locus_tag="CLS_03980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76226"
FT                   /db_xref="InterPro:IPR025504"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEV2"
FT                   /protein_id="CBK76226.1"
FT                   VSSLVRKAQEEQAA"
FT   CDS             389221..389847
FT                   /transl_table=11
FT                   /locus_tag="CLS_03990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_03990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76227"
FT                   /db_xref="InterPro:IPR024617"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEV3"
FT                   /protein_id="CBK76227.1"
FT   CDS             complement(392235..393641)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04010"
FT                   /product="Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76228"
FT                   /db_xref="GOA:D6DEV4"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEV4"
FT                   /protein_id="CBK76228.1"
FT                   LCTYCWNGKE"
FT   CDS             393883..394890
FT                   /transl_table=11
FT                   /locus_tag="CLS_04020"
FT                   /product="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76229"
FT                   /db_xref="GOA:D6DEV5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEV5"
FT                   /protein_id="CBK76229.1"
FT   CDS             394954..395373
FT                   /transl_table=11
FT                   /locus_tag="CLS_04030"
FT                   /product="Predicted DNA-binding protein with PD1-like
FT                   DNA-binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76230"
FT                   /db_xref="GOA:D6DEV6"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR025707"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEV6"
FT                   /protein_id="CBK76230.1"
FT   CDS             complement(395405..395860)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04040"
FT                   /product="Protein of unknown function (DUF2726)."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76231"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEV7"
FT                   /protein_id="CBK76231.1"
FT   CDS             396214..397104
FT                   /transl_table=11
FT                   /locus_tag="CLS_04050"
FT                   /product="Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76232"
FT                   /db_xref="GOA:D6DEV8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEV8"
FT                   /protein_id="CBK76232.1"
FT                   NQQGWGLLDVERLVE"
FT   CDS             complement(398041..398694)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04070"
FT                   /product="K+ transport systems, NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76233"
FT                   /db_xref="GOA:D6DEV9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEV9"
FT                   /protein_id="CBK76233.1"
FT   CDS             complement(398724..400070)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04080"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76234"
FT                   /db_xref="GOA:D6DEW0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEW0"
FT                   /protein_id="CBK76234.1"
FT   gap             400351..400744
FT                   /estimated_length=394
FT   CDS             400806..401069
FT                   /transl_table=11
FT                   /locus_tag="CLS_04090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76235"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEW1"
FT                   /protein_id="CBK76235.1"
FT   CDS             401181..402278
FT                   /transl_table=11
FT                   /locus_tag="CLS_04100"
FT                   /product="protein RecA"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76236"
FT                   /db_xref="GOA:D6DEW2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEW2"
FT                   /protein_id="CBK76236.1"
FT   CDS             402366..402974
FT                   /transl_table=11
FT                   /locus_tag="CLS_04110"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76237"
FT                   /db_xref="GOA:D6DEW3"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEW3"
FT                   /protein_id="CBK76237.1"
FT   CDS             404884..405765
FT                   /transl_table=11
FT                   /locus_tag="CLS_04130"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /function="pyrroline-5-carboxylate reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76238"
FT                   /db_xref="GOA:D6DEW4"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEW4"
FT                   /protein_id="CBK76238.1"
FT                   ADACFKKCTDMR"
FT   CDS             406621..407202
FT                   /transl_table=11
FT                   /locus_tag="CLS_04150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76239"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEW5"
FT                   /protein_id="CBK76239.1"
FT   CDS             407218..407466
FT                   /transl_table=11
FT                   /locus_tag="CLS_04160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76240"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEW6"
FT                   /protein_id="CBK76240.1"
FT   CDS             407572..408435
FT                   /transl_table=11
FT                   /locus_tag="CLS_04170"
FT                   /product="tyrosine recombinase XerD subunit"
FT                   /function="tyrosine recombinase XerD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76241"
FT                   /db_xref="GOA:D6DEW7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEW7"
FT                   /protein_id="CBK76241.1"
FT                   SQTAKE"
FT   CDS             complement(408549..408647)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76242"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEW8"
FT                   /protein_id="CBK76242.1"
FT                   /translation="MRLRADVYFRPGLAFSYNPYLCCRQVILNKKL"
FT   CDS             complement(408697..409743)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04190"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76243"
FT                   /db_xref="GOA:D6DEW9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEW9"
FT                   /protein_id="CBK76243.1"
FT                   LPVEAPAD"
FT   CDS             complement(409740..410417)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04200"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76244"
FT                   /db_xref="GOA:D6DEX0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEX0"
FT                   /protein_id="CBK76244.1"
FT                   QEP"
FT   CDS             complement(410410..410499)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76245"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEX1"
FT                   /protein_id="CBK76245.1"
FT                   /translation="MGDRNCLHHVQPDCSAAGKMTVIRGESNV"
FT   CDS             410778..412019
FT                   /transl_table=11
FT                   /locus_tag="CLS_04220"
FT                   /product="RND family efflux transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76246"
FT                   /db_xref="GOA:D6DEX2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEX2"
FT                   /protein_id="CBK76246.1"
FT                   DALPLEPVADAEER"
FT   CDS             412035..415049
FT                   /transl_table=11
FT                   /locus_tag="CLS_04230"
FT                   /product="Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76247"
FT                   /db_xref="GOA:D6DEX3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEX3"
FT                   /protein_id="CBK76247.1"
FT                   LMNRKPKAYNGWDID"
FT   CDS             415151..415210
FT                   /transl_table=11
FT                   /locus_tag="CLS_04240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76248"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEX4"
FT                   /protein_id="CBK76248.1"
FT                   /translation="MEKLLGTVLAEALQKEYKL"
FT   CDS             415207..416376
FT                   /transl_table=11
FT                   /locus_tag="CLS_04250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76249"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEX5"
FT                   /protein_id="CBK76249.1"
FT   CDS             416401..417714
FT                   /transl_table=11
FT                   /locus_tag="CLS_04260"
FT                   /product="Outer membrane efflux protein."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76250"
FT                   /db_xref="GOA:D6DEX6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEX6"
FT                   /protein_id="CBK76250.1"
FT   CDS             complement(417876..418343)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76251"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEX7"
FT                   /protein_id="CBK76251.1"
FT   CDS             complement(418530..419255)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04280"
FT                   /product="Predicted acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76252"
FT                   /db_xref="GOA:D6DEX8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEX8"
FT                   /protein_id="CBK76252.1"
FT   CDS             complement(419209..423480)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04290"
FT                   /product="CoA-substrate-specific enzyme activase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76253"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEX9"
FT                   /protein_id="CBK76253.1"
FT   CDS             423835..424722
FT                   /transl_table=11
FT                   /locus_tag="CLS_04300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76254"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEY0"
FT                   /protein_id="CBK76254.1"
FT                   KHVTKEDLEKRRED"
FT   CDS             424843..426279
FT                   /transl_table=11
FT                   /locus_tag="CLS_04310"
FT                   /product="pyruvate kinase"
FT                   /function="pyruvate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76255"
FT                   /db_xref="GOA:D6DEY1"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEY1"
FT                   /protein_id="CBK76255.1"
FT   CDS             426363..426410
FT                   /transl_table=11
FT                   /locus_tag="CLS_04320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76256"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEY2"
FT                   /protein_id="CBK76256.1"
FT                   /translation="MARPEGRLSRTFEIR"
FT   CDS             426463..427818
FT                   /transl_table=11
FT                   /locus_tag="CLS_04330"
FT                   /product="Diaminopimelate decarboxylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76257"
FT                   /db_xref="GOA:D6DEY3"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEY3"
FT                   /protein_id="CBK76257.1"
FT   CDS             complement(428246..429478)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04340"
FT                   /product="Carbohydrate binding domain./Collagen triple
FT                   helix repeat (20 copies)."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76258"
FT                   /db_xref="GOA:D6DEY4"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEY4"
FT                   /protein_id="CBK76258.1"
FT                   GLLIQKISDTP"
FT   CDS             429971..432505
FT                   /transl_table=11
FT                   /locus_tag="CLS_04350"
FT                   /product="diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76259"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEY5"
FT                   /protein_id="CBK76259.1"
FT   CDS             complement(432589..433617)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04360"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /function="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76260"
FT                   /db_xref="GOA:D6DEY6"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEY6"
FT                   /protein_id="CBK76260.1"
FT                   SI"
FT   CDS             433873..434520
FT                   /transl_table=11
FT                   /locus_tag="CLS_04370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76261"
FT                   /db_xref="InterPro:IPR025648"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEY7"
FT                   /protein_id="CBK76261.1"
FT   CDS             434582..436021
FT                   /transl_table=11
FT                   /locus_tag="CLS_04380"
FT                   /product="Predicted membrane protein involved in D-alanine
FT                   export"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76262"
FT                   /db_xref="GOA:D6DEY8"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEY8"
FT                   /protein_id="CBK76262.1"
FT   CDS             436091..437329
FT                   /transl_table=11
FT                   /locus_tag="CLS_04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76263"
FT                   /db_xref="InterPro:IPR025945"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEY9"
FT                   /protein_id="CBK76263.1"
FT                   GFASDENVTKIAR"
FT   CDS             complement(437830..438834)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04400"
FT                   /product="ABC-type spermidine/putrescine transport systems,
FT                   ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76264"
FT                   /db_xref="GOA:D6DEZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEZ0"
FT                   /protein_id="CBK76264.1"
FT   CDS             complement(438840..439646)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04410"
FT                   /product="ABC-type spermidine/putrescine transport system,
FT                   permease component II"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76265"
FT                   /db_xref="GOA:D6DEZ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEZ1"
FT                   /protein_id="CBK76265.1"
FT   CDS             complement(439646..440491)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04420"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76266"
FT                   /db_xref="GOA:D6DEZ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEZ2"
FT                   /protein_id="CBK76266.1"
FT                   "
FT   CDS             complement(440563..441663)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04430"
FT                   /product="ABC-type Fe3+ transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76267"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEZ3"
FT                   /protein_id="CBK76267.1"
FT   CDS             complement(441756..442628)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04440"
FT                   /product="L-serine ammonia-lyase"
FT                   /function="L-serine ammonia-lyase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76268"
FT                   /db_xref="GOA:D6DEZ4"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEZ4"
FT                   /protein_id="CBK76268.1"
FT                   KIKFNLNLQ"
FT   CDS             complement(442628..443293)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04450"
FT                   /product="L-serine ammonia-lyase"
FT                   /function="L-serine ammonia-lyase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76269"
FT                   /db_xref="GOA:D6DEZ5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEZ5"
FT                   /protein_id="CBK76269.1"
FT   CDS             443424..443909
FT                   /transl_table=11
FT                   /locus_tag="CLS_04460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76270"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEZ6"
FT                   /protein_id="CBK76270.1"
FT   CDS             443906..444691
FT                   /transl_table=11
FT                   /locus_tag="CLS_04470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76271"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEZ7"
FT                   /protein_id="CBK76271.1"
FT   CDS             444862..445116
FT                   /transl_table=11
FT                   /locus_tag="CLS_04480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76272"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEZ8"
FT                   /protein_id="CBK76272.1"
FT   CDS             445091..446485
FT                   /transl_table=11
FT                   /locus_tag="CLS_04490"
FT                   /product="Phage integrase family."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76273"
FT                   /db_xref="GOA:D6DEZ9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D6DEZ9"
FT                   /protein_id="CBK76273.1"
FT                   QLANKQ"
FT   CDS             complement(447050..448453)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04500"
FT                   /product="Site-specific recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76274"
FT                   /db_xref="GOA:D6DF00"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF00"
FT                   /protein_id="CBK76274.1"
FT                   LLKTLAKSL"
FT   CDS             complement(448437..449096)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04510"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76275"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF01"
FT                   /protein_id="CBK76275.1"
FT   CDS             complement(449083..449316)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04520"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76276"
FT                   /db_xref="GOA:D6DF02"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF02"
FT                   /protein_id="CBK76276.1"
FT   CDS             complement(449425..449655)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04530"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76277"
FT                   /db_xref="GOA:D6DF03"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF03"
FT                   /protein_id="CBK76277.1"
FT   CDS             complement(449674..450090)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04540"
FT                   /product="Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76278"
FT                   /db_xref="GOA:D6DF04"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF04"
FT                   /protein_id="CBK76278.1"
FT   gap             450621..451197
FT                   /estimated_length=577
FT   CDS             complement(451548..451919)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04550"
FT                   /product="Mn-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76279"
FT                   /db_xref="GOA:D6DF05"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF05"
FT                   /protein_id="CBK76279.1"
FT   CDS             complement(451932..452459)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04560"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76280"
FT                   /db_xref="GOA:D6DF06"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF06"
FT                   /protein_id="CBK76280.1"
FT                   ALENFFAPQEIH"
FT   CDS             complement(453050..454786)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04580"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76281"
FT                   /db_xref="GOA:D6DF07"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF07"
FT                   /protein_id="CBK76281.1"
FT                   AV"
FT   CDS             complement(454789..456603)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04590"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76282"
FT                   /db_xref="GOA:D6DF08"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF08"
FT                   /protein_id="CBK76282.1"
FT   CDS             complement(456763..457380)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04600"
FT                   /product="conserved hypothetical integral membrane protein
FT                   TIGR02185"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76283"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF09"
FT                   /protein_id="CBK76283.1"
FT   CDS             complement(457413..458825)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04610"
FT                   /product="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76284"
FT                   /db_xref="GOA:D6DF10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF10"
FT                   /protein_id="CBK76284.1"
FT                   SRVIRVTERTSS"
FT   CDS             complement(459662..460612)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04630"
FT                   /product="transcriptional regulator, AraC family"
FT                   /function="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76285"
FT                   /db_xref="GOA:D6DF11"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF11"
FT                   /protein_id="CBK76285.1"
FT   gap             460932..461738
FT                   /estimated_length=807
FT   CDS             complement(462070..464202)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04640"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76286"
FT                   /db_xref="GOA:D6DF12"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF12"
FT                   /protein_id="CBK76286.1"
FT                   NEILSRLGARLERILI"
FT   CDS             complement(464205..464957)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04650"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76287"
FT                   /db_xref="GOA:D6DF13"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF13"
FT                   /protein_id="CBK76287.1"
FT   CDS             complement(464954..466117)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04660"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76288"
FT                   /db_xref="GOA:D6DF14"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF14"
FT                   /protein_id="CBK76288.1"
FT   CDS             complement(466129..467187)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04670"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76289"
FT                   /db_xref="GOA:D6DF15"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF15"
FT                   /protein_id="CBK76289.1"
FT                   SQIGEAGQNTYE"
FT   CDS             complement(468458..469150)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04690"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76290"
FT                   /db_xref="GOA:D6DF16"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF16"
FT                   /protein_id="CBK76290.1"
FT                   GCGYKIEK"
FT   CDS             complement(469170..469340)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76291"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF17"
FT                   /protein_id="CBK76291.1"
FT                   EKPADRRRKNK"
FT   CDS             469505..469861
FT                   /transl_table=11
FT                   /locus_tag="CLS_04710"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76292"
FT                   /db_xref="GOA:D6DF18"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF18"
FT                   /protein_id="CBK76292.1"
FT                   SEELTELSRKFEKE"
FT   CDS             complement(470050..471462)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04720"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76293"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF19"
FT                   /protein_id="CBK76293.1"
FT                   EPQQKEKDHGQR"
FT   CDS             complement(471521..471871)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76294"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF20"
FT                   /protein_id="CBK76294.1"
FT                   FDFYMDEETDIE"
FT   CDS             complement(471868..472716)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04740"
FT                   /product="Domain of unknown function (DUF1814)."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76295"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF21"
FT                   /protein_id="CBK76295.1"
FT                   V"
FT   CDS             complement(472713..473306)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76296"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF22"
FT                   /protein_id="CBK76296.1"
FT   CDS             complement(473409..473720)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76297"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF23"
FT                   /protein_id="CBK76297.1"
FT   CDS             complement(473717..474022)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76298"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF24"
FT                   /protein_id="CBK76298.1"
FT   CDS             complement(474505..475572)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76299"
FT                   /db_xref="InterPro:IPR024380"
FT                   /db_xref="InterPro:IPR024383"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF25"
FT                   /protein_id="CBK76299.1"
FT                   AEKKAPVRKEKEPER"
FT   CDS             complement(475574..483391)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04800"
FT                   /product="DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76300"
FT                   /db_xref="GOA:D6DF26"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF26"
FT                   /protein_id="CBK76300.1"
FT   CDS             complement(483469..483684)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76301"
FT                   /db_xref="InterPro:IPR025468"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF27"
FT                   /protein_id="CBK76301.1"
FT   CDS             complement(483686..486817)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04820"
FT                   /product="DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76302"
FT                   /db_xref="GOA:D6DF28"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR025465"
FT                   /db_xref="InterPro:IPR025923"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF28"
FT                   /protein_id="CBK76302.1"
FT   CDS             complement(486820..487101)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76303"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF29"
FT                   /protein_id="CBK76303.1"
FT   CDS             complement(487098..489197)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04840"
FT                   /product="DNA topoisomerase III, bacteria and conjugative
FT                   plasmid"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76304"
FT                   /db_xref="GOA:D6DF30"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF30"
FT                   /protein_id="CBK76304.1"
FT                   KGGGK"
FT   CDS             complement(489178..489864)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76305"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF31"
FT                   /protein_id="CBK76305.1"
FT                   DAPCDR"
FT   CDS             complement(489861..490061)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76306"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF32"
FT                   /protein_id="CBK76306.1"
FT   CDS             complement(490058..490840)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76307"
FT                   /db_xref="InterPro:IPR025376"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF33"
FT                   /protein_id="CBK76307.1"
FT   CDS             complement(490830..491066)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76308"
FT                   /db_xref="InterPro:IPR025464"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF34"
FT                   /protein_id="CBK76308.1"
FT   CDS             complement(492825..493205)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76309"
FT                   /db_xref="InterPro:IPR024216"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF35"
FT                   /protein_id="CBK76309.1"
FT   CDS             complement(493208..494032)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04910"
FT                   /product="DNA modification methylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76310"
FT                   /db_xref="GOA:D6DF36"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF36"
FT                   /protein_id="CBK76310.1"
FT   CDS             complement(496474..496857)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76311"
FT                   /db_xref="InterPro:IPR024414"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF37"
FT                   /protein_id="CBK76311.1"
FT   CDS             complement(496880..497128)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76312"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF38"
FT                   /protein_id="CBK76312.1"
FT   CDS             complement(497258..499090)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04950"
FT                   /product="Retron-type reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76313"
FT                   /db_xref="GOA:D6DF39"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR024937"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF39"
FT                   /protein_id="CBK76313.1"
FT   CDS             complement(499667..500338)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76314"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF40"
FT                   /protein_id="CBK76314.1"
FT                   R"
FT   CDS             complement(500409..500627)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76315"
FT                   /db_xref="InterPro:IPR024272"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF41"
FT                   /protein_id="CBK76315.1"
FT   CDS             complement(501705..501863)
FT                   /transl_table=11
FT                   /locus_tag="CLS_04990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_04990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76316"
FT                   /db_xref="InterPro:IPR026990"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF42"
FT                   /protein_id="CBK76316.1"
FT                   REEVRKM"
FT   CDS             complement(502007..502183)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76317"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF43"
FT                   /protein_id="CBK76317.1"
FT                   EKDGTAWVCYLRD"
FT   gap             502215..502803
FT                   /estimated_length=589
FT   gap             505199..507963
FT                   /estimated_length=2765
FT   CDS             complement(507982..509514)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76318"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF44"
FT                   /protein_id="CBK76318.1"
FT   CDS             complement(509646..509930)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76319"
FT                   /db_xref="InterPro:IPR024271"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF45"
FT                   /protein_id="CBK76319.1"
FT   CDS             complement(509944..510321)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76320"
FT                   /db_xref="InterPro:IPR026989"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF46"
FT                   /protein_id="CBK76320.1"
FT   gap             512131..512493
FT                   /estimated_length=363
FT   CDS             complement(513503..514003)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76321"
FT                   /db_xref="InterPro:IPR024234"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF47"
FT                   /protein_id="CBK76321.1"
FT                   LER"
FT   CDS             complement(514091..514828)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05090"
FT                   /product="Prophage antirepressor"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76322"
FT                   /db_xref="GOA:D6DF48"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF48"
FT                   /protein_id="CBK76322.1"
FT   CDS             complement(514867..515745)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76323"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF49"
FT                   /protein_id="CBK76323.1"
FT                   QVNHDMHAGGW"
FT   CDS             complement(515805..516308)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76324"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF50"
FT                   /protein_id="CBK76324.1"
FT                   FYEV"
FT   CDS             complement(516310..516576)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76325"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF51"
FT                   /protein_id="CBK76325.1"
FT   CDS             complement(519106..520569)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05150"
FT                   /product="Phage integrase family."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76326"
FT                   /db_xref="GOA:D6DF52"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF52"
FT                   /protein_id="CBK76326.1"
FT   CDS             complement(520582..520788)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05160"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76327"
FT                   /db_xref="GOA:D6DF53"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF53"
FT                   /protein_id="CBK76327.1"
FT   CDS             complement(520778..521479)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05170"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76328"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF54"
FT                   /protein_id="CBK76328.1"
FT                   KEIEEVEGYVD"
FT   CDS             complement(521466..521717)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05180"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76329"
FT                   /db_xref="GOA:D6DF55"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF55"
FT                   /protein_id="CBK76329.1"
FT   CDS             complement(521824..522084)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05190"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76330"
FT                   /db_xref="GOA:D6DF56"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF56"
FT                   /protein_id="CBK76330.1"
FT   CDS             complement(522077..522694)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05200"
FT                   /product="Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76331"
FT                   /db_xref="GOA:D6DF57"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF57"
FT                   /protein_id="CBK76331.1"
FT   CDS             complement(522756..523295)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76332"
FT                   /db_xref="GOA:D6DF58"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF58"
FT                   /protein_id="CBK76332.1"
FT                   VRESVNSAIKKLRKFF"
FT   CDS             complement(524485..524736)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76333"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF59"
FT                   /protein_id="CBK76333.1"
FT   CDS             complement(525051..526286)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05250"
FT                   /product="Nucleotidyltransferase/DNA polymerase involved in
FT                   DNA repair"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76334"
FT                   /db_xref="GOA:D6DF60"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF60"
FT                   /protein_id="CBK76334.1"
FT                   KAEITMPTGMVG"
FT   CDS             526437..526847
FT                   /transl_table=11
FT                   /locus_tag="CLS_05260"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76335"
FT                   /db_xref="GOA:D6DF61"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF61"
FT                   /protein_id="CBK76335.1"
FT   CDS             complement(527523..527972)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05280"
FT                   /product="GIY-YIG catalytic domain."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76336"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR027299"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF62"
FT                   /protein_id="CBK76336.1"
FT   CDS             complement(527969..528013)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76337"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF63"
FT                   /protein_id="CBK76337.1"
FT                   /translation="MAYRVKAWEEPMSL"
FT   CDS             complement(528097..528522)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76338"
FT                   /db_xref="GOA:D6DF64"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF64"
FT                   /protein_id="CBK76338.1"
FT   CDS             complement(528617..529129)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05310"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76339"
FT                   /db_xref="GOA:D6DF65"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF65"
FT                   /protein_id="CBK76339.1"
FT                   LRKIIEN"
FT   CDS             complement(529725..530945)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05320"
FT                   /product="Major Facilitator Superfamily."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76340"
FT                   /db_xref="GOA:D6DF66"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF66"
FT                   /protein_id="CBK76340.1"
FT                   VAGKKRD"
FT   CDS             complement(530996..532915)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05330"
FT                   /product="small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76341"
FT                   /db_xref="GOA:D6DF67"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF67"
FT                   /protein_id="CBK76341.1"
FT                   HKLA"
FT   CDS             533343..533675
FT                   /transl_table=11
FT                   /locus_tag="CLS_05340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76342"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF68"
FT                   /protein_id="CBK76342.1"
FT                   NTDDKT"
FT   CDS             533662..533883
FT                   /transl_table=11
FT                   /locus_tag="CLS_05350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76343"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF69"
FT                   /protein_id="CBK76343.1"
FT   CDS             complement(533942..535651)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76344"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF70"
FT                   /protein_id="CBK76344.1"
FT   CDS             complement(535692..536462)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05370"
FT                   /product="sortase, SrtB family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76345"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF71"
FT                   /protein_id="CBK76345.1"
FT   CDS             complement(536500..538833)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05380"
FT                   /product="Domain of unknown function DUF87."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76346"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF72"
FT                   /protein_id="CBK76346.1"
FT   CDS             complement(538826..539191)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76347"
FT                   /db_xref="InterPro:IPR024414"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF73"
FT                   /protein_id="CBK76347.1"
FT                   MKPTIEQKQKEAYKNND"
FT   CDS             complement(539191..539376)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76348"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF74"
FT                   /protein_id="CBK76348.1"
FT                   DEIRHAKQAYRRERSF"
FT   CDS             complement(539391..540227)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76349"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF75"
FT                   /protein_id="CBK76349.1"
FT   CDS             complement(540301..540660)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76350"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF76"
FT                   /protein_id="CBK76350.1"
FT                   IIITFAKEILTLITG"
FT   CDS             complement(542458..542661)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76351"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF77"
FT                   /protein_id="CBK76351.1"
FT   CDS             complement(542671..543555)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76352"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF78"
FT                   /protein_id="CBK76352.1"
FT                   YKKKQERSKDYER"
FT   CDS             complement(543561..544355)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76353"
FT                   /db_xref="InterPro:IPR024234"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF79"
FT                   /protein_id="CBK76353.1"
FT   gap             544634..544889
FT                   /estimated_length=256
FT   CDS             complement(545766..545939)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76354"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF80"
FT                   /protein_id="CBK76354.1"
FT                   AKDEEKTEREFS"
FT   CDS             complement(545930..546271)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05500"
FT                   /product="Bacterial mobilisation protein (MobC)."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76355"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF81"
FT                   /protein_id="CBK76355.1"
FT                   PDKSDMKWQ"
FT   CDS             complement(546529..547446)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76356"
FT                   /db_xref="InterPro:IPR024559"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF82"
FT                   /protein_id="CBK76356.1"
FT   CDS             complement(547443..548396)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76357"
FT                   /db_xref="InterPro:IPR025054"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF83"
FT                   /protein_id="CBK76357.1"
FT   CDS             complement(548413..548805)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76358"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF84"
FT                   /protein_id="CBK76358.1"
FT   CDS             complement(556476..557159)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76359"
FT                   /db_xref="InterPro:IPR025463"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF85"
FT                   /protein_id="CBK76359.1"
FT                   KEKTR"
FT   gap             557295..557689
FT                   /estimated_length=395
FT   CDS             complement(558098..558331)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76360"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF86"
FT                   /protein_id="CBK76360.1"
FT   CDS             complement(558345..558938)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76361"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF87"
FT                   /protein_id="CBK76361.1"
FT   CDS             complement(558948..559241)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76362"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF88"
FT                   /protein_id="CBK76362.1"
FT   CDS             complement(559301..559390)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76363"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF89"
FT                   /protein_id="CBK76363.1"
FT                   /translation="MDAKTIVAVVLVAFIIGGFIFLQIKNRKK"
FT   CDS             complement(559390..563640)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05630"
FT                   /product="Cna protein B-type domain."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76364"
FT                   /db_xref="GOA:D6DF90"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR008970"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014766"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF90"
FT                   /protein_id="CBK76364.1"
FT                   AVVAYRKKKKEDNE"
FT   gap             564299..564532
FT                   /estimated_length=234
FT   CDS             complement(564834..565778)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05650"
FT                   /product="ParB-like partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76365"
FT                   /db_xref="GOA:D6DF91"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF91"
FT                   /protein_id="CBK76365.1"
FT   CDS             567170..567391
FT                   /transl_table=11
FT                   /locus_tag="CLS_05670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76366"
FT                   /db_xref="InterPro:IPR017259"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF92"
FT                   /protein_id="CBK76366.1"
FT   CDS             complement(567764..567883)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76367"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF93"
FT                   /protein_id="CBK76367.1"
FT   tRNA            complement(568017..568093)
FT                   /locus_tag="CLS_T_39810"
FT   CDS             complement(568647..569528)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76368"
FT                   /db_xref="InterPro:IPR024541"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF94"
FT                   /protein_id="CBK76368.1"
FT                   KVWMQGIADFKG"
FT   CDS             complement(570131..571225)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05720"
FT                   /product="ParB-like partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76369"
FT                   /db_xref="GOA:D6DF95"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF95"
FT                   /protein_id="CBK76369.1"
FT   CDS             complement(571228..571995)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05730"
FT                   /product="ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76370"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF96"
FT                   /protein_id="CBK76370.1"
FT   CDS             572331..573281
FT                   /transl_table=11
FT                   /locus_tag="CLS_05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76371"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF97"
FT                   /protein_id="CBK76371.1"
FT   CDS             complement(573387..573545)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76372"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF98"
FT                   /protein_id="CBK76372.1"
FT                   FLLYFSC"
FT   CDS             complement(573619..574347)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05760"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /function="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.-.-"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76373"
FT                   /db_xref="GOA:D6DF99"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6DF99"
FT                   /protein_id="CBK76373.1"
FT   CDS             complement(574344..576269)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05770"
FT                   /product="glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76374"
FT                   /db_xref="GOA:D6DFA0"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFA0"
FT                   /protein_id="CBK76374.1"
FT                   NTQEES"
FT   CDS             complement(576285..576392)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76375"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFA1"
FT                   /protein_id="CBK76375.1"
FT   CDS             complement(576652..577056)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76376"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFA2"
FT                   /protein_id="CBK76376.1"
FT   CDS             577357..577509
FT                   /transl_table=11
FT                   /locus_tag="CLS_05800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76377"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFA3"
FT                   /protein_id="CBK76377.1"
FT                   ILISV"
FT   CDS             complement(577684..577761)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76378"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFA4"
FT                   /protein_id="CBK76378.1"
FT                   /translation="MSSQPQQSEKLIKNERRNNRIKTYN"
FT   CDS             complement(578028..579404)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05820"
FT                   /product="tRNA modification GTPase trmE"
FT                   /function="tRNA modification GTPase trmE"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76379"
FT                   /db_xref="GOA:D6DFA5"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFA5"
FT                   /protein_id="CBK76379.1"
FT                   "
FT   gap             579810..580261
FT                   /estimated_length=452
FT   CDS             complement(580412..581065)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05840"
FT                   /product="Predicted RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76380"
FT                   /db_xref="GOA:D6DFA6"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFA6"
FT                   /protein_id="CBK76380.1"
FT   CDS             complement(582581..582940)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05860"
FT                   /product="ribonuclease P protein component"
FT                   /function="ribonuclease P protein component"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76381"
FT                   /db_xref="GOA:D6DFA7"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFA7"
FT                   /protein_id="CBK76381.1"
FT                   CGLHNILENRSENIG"
FT   CDS             complement(583015..583149)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05870"
FT                   /product="LSU ribosomal protein L34P"
FT                   /function="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76382"
FT                   /db_xref="GOA:D6DFA8"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFA8"
FT                   /protein_id="CBK76382.1"
FT   CDS             complement(583255..583860)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76383"
FT                   /db_xref="InterPro:IPR024211"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFA9"
FT                   /protein_id="CBK76383.1"
FT   CDS             complement(583836..584387)
FT                   /transl_table=11
FT                   /locus_tag="CLS_05890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76384"
FT                   /db_xref="InterPro:IPR024211"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFB0"
FT                   /protein_id="CBK76384.1"
FT   CDS             585278..586648
FT                   /transl_table=11
FT                   /locus_tag="CLS_05920"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /function="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76385"
FT                   /db_xref="GOA:D6DFB1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFB1"
FT                   /protein_id="CBK76385.1"
FT   CDS             587034..588152
FT                   /transl_table=11
FT                   /locus_tag="CLS_05930"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /function="DNA polymerase III, beta subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76386"
FT                   /db_xref="GOA:D6DFB2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFB2"
FT                   /protein_id="CBK76386.1"
FT   CDS             588273..588578
FT                   /transl_table=11
FT                   /locus_tag="CLS_05940"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76387"
FT                   /db_xref="GOA:D6DFB3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFB3"
FT                   /protein_id="CBK76387.1"
FT   CDS             588620..589726
FT                   /transl_table=11
FT                   /locus_tag="CLS_05950"
FT                   /product="DNA replication and repair protein RecF"
FT                   /function="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76388"
FT                   /db_xref="GOA:D6DFB4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFB4"
FT                   /protein_id="CBK76388.1"
FT   CDS             589740..591650
FT                   /transl_table=11
FT                   /locus_tag="CLS_05960"
FT                   /product="DNA gyrase subunit B"
FT                   /function="DNA gyrase subunit B"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76389"
FT                   /db_xref="GOA:D6DFB5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFB5"
FT                   /protein_id="CBK76389.1"
FT                   I"
FT   CDS             591743..594310
FT                   /transl_table=11
FT                   /locus_tag="CLS_05970"
FT                   /product="DNA gyrase subunit A"
FT                   /function="DNA gyrase subunit A"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76390"
FT                   /db_xref="GOA:D6DFB6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFB6"
FT                   /protein_id="CBK76390.1"
FT   CDS             594480..595322
FT                   /transl_table=11
FT                   /locus_tag="CLS_05980"
FT                   /product="hydro-lyases, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha region"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76391"
FT                   /db_xref="GOA:D6DFB7"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFB7"
FT                   /protein_id="CBK76391.1"
FT   CDS             595380..595946
FT                   /transl_table=11
FT                   /locus_tag="CLS_05990"
FT                   /product="hydro-lyases, Fe-S type, tartrate/fumarate
FT                   subfamily, beta region"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76392"
FT                   /db_xref="GOA:D6DFB8"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFB8"
FT                   /protein_id="CBK76392.1"
FT   CDS             595960..596088
FT                   /transl_table=11
FT                   /locus_tag="CLS_06000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76393"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFB9"
FT                   /protein_id="CBK76393.1"
FT   tRNA            596225..596312
FT                   /locus_tag="CLS_T_39540"
FT   CDS             596671..597540
FT                   /transl_table=11
FT                   /locus_tag="CLS_06010"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76394"
FT                   /db_xref="GOA:D6DFC0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFC0"
FT                   /protein_id="CBK76394.1"
FT                   QLGGTFYA"
FT   CDS             597533..598687
FT                   /transl_table=11
FT                   /locus_tag="CLS_06020"
FT                   /product="Putative transposase."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76395"
FT                   /db_xref="GOA:D6DFC1"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFC1"
FT                   /protein_id="CBK76395.1"
FT   CDS             598746..598862
FT                   /transl_table=11
FT                   /locus_tag="CLS_06030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76396"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFC2"
FT                   /protein_id="CBK76396.1"
FT   CDS             complement(599136..599594)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06040"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76397"
FT                   /db_xref="GOA:D6DFC3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFC3"
FT                   /protein_id="CBK76397.1"
FT   CDS             600320..602182
FT                   /transl_table=11
FT                   /locus_tag="CLS_06060"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76398"
FT                   /db_xref="GOA:D6DFC4"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFC4"
FT                   /protein_id="CBK76398.1"
FT   CDS             602419..602589
FT                   /transl_table=11
FT                   /locus_tag="CLS_06070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76399"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFC5"
FT                   /protein_id="CBK76399.1"
FT                   KPKEKAVPAAF"
FT   CDS             602767..602838
FT                   /transl_table=11
FT                   /locus_tag="CLS_06080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76400"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFC6"
FT                   /protein_id="CBK76400.1"
FT                   /translation="MSNFAGEFWPKAGCLRGRIDKNR"
FT   CDS             602932..605772
FT                   /transl_table=11
FT                   /locus_tag="CLS_06090"
FT                   /product="excinuclease ABC, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76401"
FT                   /db_xref="GOA:D6DFC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFC7"
FT                   /protein_id="CBK76401.1"
FT                   YTGEYVKKYLEAAGRN"
FT   CDS             complement(608388..609569)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06120"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76402"
FT                   /db_xref="GOA:D6DFC8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFC8"
FT                   /protein_id="CBK76402.1"
FT   CDS             complement(609607..609798)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06130"
FT                   /product="Protein of unknown function (DUF3173)."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76403"
FT                   /db_xref="InterPro:IPR021512"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFC9"
FT                   /protein_id="CBK76403.1"
FT                   VPKEAVEELLGIKLPDEQ"
FT   CDS             complement(610175..610492)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06140"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76404"
FT                   /db_xref="GOA:D6DFD0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFD0"
FT                   /protein_id="CBK76404.1"
FT                   K"
FT   CDS             610690..610896
FT                   /transl_table=11
FT                   /locus_tag="CLS_06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76405"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFD1"
FT                   /protein_id="CBK76405.1"
FT   CDS             611169..611330
FT                   /transl_table=11
FT                   /locus_tag="CLS_06160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76406"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFD2"
FT                   /protein_id="CBK76406.1"
FT                   FKERWKKQ"
FT   CDS             611327..612466
FT                   /transl_table=11
FT                   /locus_tag="CLS_06170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76407"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFD3"
FT                   /protein_id="CBK76407.1"
FT   CDS             612441..613520
FT                   /transl_table=11
FT                   /locus_tag="CLS_06180"
FT                   /product="putative phage-type endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76408"
FT                   /db_xref="GOA:D6DFD4"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR017482"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFD4"
FT                   /protein_id="CBK76408.1"
FT   CDS             613520..613936
FT                   /transl_table=11
FT                   /locus_tag="CLS_06190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76409"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFD5"
FT                   /protein_id="CBK76409.1"
FT   CDS             616216..617148
FT                   /transl_table=11
FT                   /locus_tag="CLS_06210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76410"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFD6"
FT                   /protein_id="CBK76410.1"
FT   CDS             617210..618424
FT                   /transl_table=11
FT                   /locus_tag="CLS_06220"
FT                   /product="CHC2 zinc finger."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76411"
FT                   /db_xref="GOA:D6DFD7"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFD7"
FT                   /protein_id="CBK76411.1"
FT                   KGVDI"
FT   CDS             618421..619194
FT                   /transl_table=11
FT                   /locus_tag="CLS_06230"
FT                   /product="sortase B. Cysteine peptidase. MEROPS family
FT                   C60B"
FT                   /function="sortase B. Cysteine peptidase. MEROPS family
FT                   C60B"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76412"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFD8"
FT                   /protein_id="CBK76412.1"
FT   CDS             619279..619716
FT                   /transl_table=11
FT                   /locus_tag="CLS_06250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76413"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFD9"
FT                   /protein_id="CBK76413.1"
FT   CDS             619740..619937
FT                   /transl_table=11
FT                   /locus_tag="CLS_06260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76414"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFE0"
FT                   /protein_id="CBK76414.1"
FT   CDS             complement(620020..620319)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76415"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFE1"
FT                   /protein_id="CBK76415.1"
FT   CDS             620485..621417
FT                   /transl_table=11
FT                   /locus_tag="CLS_06280"
FT                   /product="plasmid segregation actin-type ATPase ParM"
FT                   /function="plasmid segregation actin-type ATPase ParM"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76416"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFE2"
FT                   /protein_id="CBK76416.1"
FT   CDS             621417..621824
FT                   /transl_table=11
FT                   /locus_tag="CLS_06290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFE3"
FT                   /protein_id="CBK76417.1"
FT   CDS             complement(621956..622300)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06300"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76418"
FT                   /db_xref="GOA:D6DFE4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFE4"
FT                   /protein_id="CBK76418.1"
FT                   GLHTRTENPT"
FT   CDS             622713..623165
FT                   /transl_table=11
FT                   /locus_tag="CLS_06310"
FT                   /product="Sigma-70, region 4."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76419"
FT                   /db_xref="GOA:D6DFE5"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFE5"
FT                   /protein_id="CBK76419.1"
FT   CDS             623155..623343
FT                   /transl_table=11
FT                   /locus_tag="CLS_06320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76420"
FT                   /db_xref="GOA:D6DFE6"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFE6"
FT                   /protein_id="CBK76420.1"
FT                   ELAVELMKCIRYFRDVE"
FT   CDS             623424..623558
FT                   /transl_table=11
FT                   /locus_tag="CLS_06330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76421"
FT                   /db_xref="InterPro:IPR026989"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFE7"
FT                   /protein_id="CBK76421.1"
FT   CDS             complement(623591..624562)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06340"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76422"
FT                   /db_xref="GOA:D6DFE8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFE8"
FT                   /protein_id="CBK76422.1"
FT   CDS             624764..625471
FT                   /transl_table=11
FT                   /locus_tag="CLS_06350"
FT                   /product="ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76423"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFE9"
FT                   /protein_id="CBK76423.1"
FT                   VICGLLYLDFLNF"
FT   CDS             625483..626970
FT                   /transl_table=11
FT                   /locus_tag="CLS_06360"
FT                   /product="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76424"
FT                   /db_xref="GOA:D6DFF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFF0"
FT                   /protein_id="CBK76424.1"
FT   CDS             626974..627642
FT                   /transl_table=11
FT                   /locus_tag="CLS_06370"
FT                   /product="conserved hypothetical integral membrane protein
FT                   TIGR02185"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76425"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFF1"
FT                   /protein_id="CBK76425.1"
FT                   "
FT   CDS             627570..629384
FT                   /transl_table=11
FT                   /locus_tag="CLS_06380"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76426"
FT                   /db_xref="GOA:D6DFF2"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFF2"
FT                   /protein_id="CBK76426.1"
FT   CDS             629381..631123
FT                   /transl_table=11
FT                   /locus_tag="CLS_06390"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76427"
FT                   /db_xref="GOA:D6DFF3"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFF3"
FT                   /protein_id="CBK76427.1"
FT                   WQIN"
FT   CDS             631135..631524
FT                   /transl_table=11
FT                   /locus_tag="CLS_06400"
FT                   /product="Mn-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76428"
FT                   /db_xref="GOA:D6DFF4"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFF4"
FT                   /protein_id="CBK76428.1"
FT   CDS             631514..631918
FT                   /transl_table=11
FT                   /locus_tag="CLS_06410"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76429"
FT                   /db_xref="GOA:D6DFF5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFF5"
FT                   /protein_id="CBK76429.1"
FT   gap             632010..632468
FT                   /estimated_length=459
FT   CDS             633666..634190
FT                   /transl_table=11
FT                   /locus_tag="CLS_06440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76430"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFF6"
FT                   /protein_id="CBK76430.1"
FT                   HALDQIAEAIK"
FT   gap             635017..635622
FT                   /estimated_length=606
FT   CDS             635731..636183
FT                   /transl_table=11
FT                   /locus_tag="CLS_06470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76431"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFF7"
FT                   /protein_id="CBK76431.1"
FT   CDS             636183..636812
FT                   /transl_table=11
FT                   /locus_tag="CLS_06480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76432"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFF8"
FT                   /protein_id="CBK76432.1"
FT   CDS             637101..637673
FT                   /transl_table=11
FT                   /locus_tag="CLS_06490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76433"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFF9"
FT                   /protein_id="CBK76433.1"
FT   CDS             637981..638211
FT                   /transl_table=11
FT                   /locus_tag="CLS_06500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76434"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFG0"
FT                   /protein_id="CBK76434.1"
FT   CDS             638228..638539
FT                   /transl_table=11
FT                   /locus_tag="CLS_06510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76435"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFG1"
FT                   /protein_id="CBK76435.1"
FT   CDS             638536..639021
FT                   /transl_table=11
FT                   /locus_tag="CLS_06520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76436"
FT                   /db_xref="GOA:D6DFG2"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFG2"
FT                   /protein_id="CBK76436.1"
FT   CDS             639995..640111
FT                   /transl_table=11
FT                   /locus_tag="CLS_06540"
FT                   /product="Phage integrase family."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76437"
FT                   /db_xref="GOA:D6DFG3"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFG3"
FT                   /protein_id="CBK76437.1"
FT   CDS             640186..641430
FT                   /transl_table=11
FT                   /locus_tag="CLS_06550"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76438"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFG4"
FT                   /protein_id="CBK76438.1"
FT                   VHYNIIDFLLDEKDI"
FT   CDS             complement(641488..642849)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06560"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76439"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFG5"
FT                   /protein_id="CBK76439.1"
FT   CDS             complement(643191..643922)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76440"
FT                   /db_xref="InterPro:IPR025923"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFG6"
FT                   /protein_id="CBK76440.1"
FT   CDS             complement(643989..644435)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76441"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFG7"
FT                   /protein_id="CBK76441.1"
FT   CDS             complement(644451..644957)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06590"
FT                   /product="conserved hypothetical protein, ribA/ribD-fused"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76442"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFG8"
FT                   /protein_id="CBK76442.1"
FT                   ENEIA"
FT   CDS             complement(645287..645976)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76443"
FT                   /db_xref="InterPro:IPR024269"
FT                   /db_xref="InterPro:IPR025051"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFG9"
FT                   /protein_id="CBK76443.1"
FT                   ESRKEVV"
FT   gap             646593..646843
FT                   /estimated_length=251
FT   CDS             complement(647348..649378)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06640"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76444"
FT                   /db_xref="GOA:D6DFH0"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFH0"
FT                   /protein_id="CBK76444.1"
FT   CDS             649760..651034
FT                   /transl_table=11
FT                   /locus_tag="CLS_06650"
FT                   /product="Nucleotidyltransferase/DNA polymerase involved in
FT                   DNA repair"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76445"
FT                   /db_xref="GOA:D6DFH1"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFH1"
FT                   /protein_id="CBK76445.1"
FT   CDS             651047..651364
FT                   /transl_table=11
FT                   /locus_tag="CLS_06660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76446"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFH2"
FT                   /protein_id="CBK76446.1"
FT                   R"
FT   CDS             651392..651982
FT                   /transl_table=11
FT                   /locus_tag="CLS_06670"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76447"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFH3"
FT                   /protein_id="CBK76447.1"
FT   CDS             652707..653189
FT                   /transl_table=11
FT                   /locus_tag="CLS_06690"
FT                   /product="His Kinase A (phosphoacceptor) domain."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76448"
FT                   /db_xref="GOA:D6DFH4"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFH4"
FT                   /protein_id="CBK76448.1"
FT   CDS             653801..655720
FT                   /transl_table=11
FT                   /locus_tag="CLS_06700"
FT                   /product="small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76449"
FT                   /db_xref="GOA:D6DFH5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFH5"
FT                   /protein_id="CBK76449.1"
FT                   QKVM"
FT   CDS             655771..656538
FT                   /transl_table=11
FT                   /locus_tag="CLS_06710"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76450"
FT                   /db_xref="GOA:D6DFH6"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFH6"
FT                   /protein_id="CBK76450.1"
FT   CDS             656710..657132
FT                   /transl_table=11
FT                   /locus_tag="CLS_06720"
FT                   /product="Sigma-70, region 4."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76451"
FT                   /db_xref="GOA:D6DFH7"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFH7"
FT                   /protein_id="CBK76451.1"
FT   CDS             657125..657337
FT                   /transl_table=11
FT                   /locus_tag="CLS_06730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76452"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFH8"
FT                   /protein_id="CBK76452.1"
FT   CDS             657835..658233
FT                   /transl_table=11
FT                   /locus_tag="CLS_06740"
FT                   /product="Bacterial mobilisation protein (MobC)."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76453"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFH9"
FT                   /protein_id="CBK76453.1"
FT   gap             660066..660604
FT                   /estimated_length=539
FT   CDS             660818..661612
FT                   /transl_table=11
FT                   /locus_tag="CLS_06770"
FT                   /product="Replication initiator protein A (RepA)
FT                   N-terminus."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76454"
FT                   /db_xref="InterPro:IPR010724"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFI0"
FT                   /protein_id="CBK76454.1"
FT   CDS             661609..662451
FT                   /transl_table=11
FT                   /locus_tag="CLS_06780"
FT                   /product="phage DNA replication protein (predicted
FT                   replicative helicase loader)"
FT                   /function="phage DNA replication protein (predicted
FT                   replicative helicase loader)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76455"
FT                   /db_xref="GOA:D6DFI1"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFI1"
FT                   /protein_id="CBK76455.1"
FT   CDS             662466..662660
FT                   /transl_table=11
FT                   /locus_tag="CLS_06790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76456"
FT                   /db_xref="InterPro:IPR026990"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFI2"
FT                   /protein_id="CBK76456.1"
FT   CDS             complement(662725..662925)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76457"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFI3"
FT                   /protein_id="CBK76457.1"
FT   CDS             663151..664767
FT                   /transl_table=11
FT                   /locus_tag="CLS_06810"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76458"
FT                   /db_xref="GOA:D6DFI4"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025378"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFI4"
FT                   /protein_id="CBK76458.1"
FT   CDS             664860..665342
FT                   /transl_table=11
FT                   /locus_tag="CLS_06820"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76459"
FT                   /db_xref="GOA:D6DFI5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFI5"
FT                   /protein_id="CBK76459.1"
FT   CDS             665435..666154
FT                   /transl_table=11
FT                   /locus_tag="CLS_06830"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76460"
FT                   /db_xref="GOA:D6DFI6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFI6"
FT                   /protein_id="CBK76460.1"
FT                   PEVSEKIYDADLNQERR"
FT   CDS             666159..668639
FT                   /transl_table=11
FT                   /locus_tag="CLS_06840"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76461"
FT                   /db_xref="GOA:D6DFI7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFI7"
FT                   /protein_id="CBK76461.1"
FT                   SGNRSIVERLREYE"
FT   gap             669247..669588
FT                   /estimated_length=342
FT   CDS             complement(669727..672354)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06860"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76462"
FT                   /db_xref="GOA:D6DFI8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFI8"
FT                   /protein_id="CBK76462.1"
FT                   RTSE"
FT   CDS             complement(672368..673033)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06870"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76463"
FT                   /db_xref="GOA:D6DFI9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFI9"
FT                   /protein_id="CBK76463.1"
FT   CDS             complement(673153..674025)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06880"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76464"
FT                   /db_xref="GOA:D6DFJ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFJ0"
FT                   /protein_id="CBK76464.1"
FT                   TFSVFLPHS"
FT   CDS             complement(674181..674864)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06890"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76465"
FT                   /db_xref="GOA:D6DFJ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFJ1"
FT                   /protein_id="CBK76465.1"
FT                   GGGNK"
FT   CDS             675284..675442
FT                   /transl_table=11
FT                   /locus_tag="CLS_06900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76466"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFJ2"
FT                   /protein_id="CBK76466.1"
FT                   AILKDSL"
FT   CDS             complement(675666..676964)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06910"
FT                   /product="His Kinase A (phosphoacceptor) domain./Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76467"
FT                   /db_xref="GOA:D6DFJ3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFJ3"
FT                   /protein_id="CBK76467.1"
FT   CDS             complement(676957..677646)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06920"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76468"
FT                   /db_xref="GOA:D6DFJ4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFJ4"
FT                   /protein_id="CBK76468.1"
FT                   RLEKSNA"
FT   CDS             677811..678317
FT                   /transl_table=11
FT                   /locus_tag="CLS_06930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76469"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFJ5"
FT                   /protein_id="CBK76469.1"
FT                   ITRFN"
FT   CDS             678334..679554
FT                   /transl_table=11
FT                   /locus_tag="CLS_06940"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76470"
FT                   /db_xref="GOA:D6DFJ6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFJ6"
FT                   /protein_id="CBK76470.1"
FT                   ILSRMEG"
FT   CDS             681016..681693
FT                   /transl_table=11
FT                   /locus_tag="CLS_06960"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76471"
FT                   /db_xref="GOA:D6DFJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFJ7"
FT                   /protein_id="CBK76471.1"
FT                   AIY"
FT   CDS             681707..682117
FT                   /transl_table=11
FT                   /locus_tag="CLS_06970"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76472"
FT                   /db_xref="GOA:D6DFJ8"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFJ8"
FT                   /protein_id="CBK76472.1"
FT   CDS             complement(682152..682883)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06980"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76473"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFJ9"
FT                   /protein_id="CBK76473.1"
FT   CDS             complement(682978..683238)
FT                   /transl_table=11
FT                   /locus_tag="CLS_06990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_06990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76474"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFK0"
FT                   /protein_id="CBK76474.1"
FT   CDS             complement(683262..683840)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76475"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFK1"
FT                   /protein_id="CBK76475.1"
FT   CDS             complement(683840..684391)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76476"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFK2"
FT                   /protein_id="CBK76476.1"
FT   CDS             complement(684950..685198)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76477"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFK3"
FT                   /protein_id="CBK76477.1"
FT   CDS             complement(685215..685721)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76478"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFK4"
FT                   /protein_id="CBK76478.1"
FT                   INPIC"
FT   CDS             complement(686274..686795)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76479"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFK5"
FT                   /protein_id="CBK76479.1"
FT                   PGRPVPLCKL"
FT   CDS             complement(686792..687340)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07070"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76480"
FT                   /db_xref="GOA:D6DFK6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFK6"
FT                   /protein_id="CBK76480.1"
FT   CDS             complement(687350..687877)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07080"
FT                   /product="looped-hinge helix DNA binding domain, AbrB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76481"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFK7"
FT                   /protein_id="CBK76481.1"
FT                   SNMITRKYKQDK"
FT   CDS             complement(687965..688651)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76482"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFK8"
FT                   /protein_id="CBK76482.1"
FT                   PYPYAA"
FT   CDS             complement(691069..692883)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07120"
FT                   /product="MoxR-like ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76483"
FT                   /db_xref="GOA:D6DFK9"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFK9"
FT                   /protein_id="CBK76483.1"
FT   CDS             complement(692899..693675)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76484"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFL0"
FT                   /protein_id="CBK76484.1"
FT   CDS             complement(693838..694623)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07140"
FT                   /product="Single-strand binding protein family."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76485"
FT                   /db_xref="GOA:D6DFL1"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFL1"
FT                   /protein_id="CBK76485.1"
FT   CDS             694978..695217
FT                   /transl_table=11
FT                   /locus_tag="CLS_07150"
FT                   /product="looped-hinge helix DNA binding domain, AbrB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76486"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFL2"
FT                   /protein_id="CBK76486.1"
FT   CDS             695603..696334
FT                   /transl_table=11
FT                   /locus_tag="CLS_07170"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76487"
FT                   /db_xref="GOA:D6DFL3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFL3"
FT                   /protein_id="CBK76487.1"
FT   CDS             696331..697065
FT                   /transl_table=11
FT                   /locus_tag="CLS_07180"
FT                   /product="ABC-2 type transporter."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76488"
FT                   /db_xref="GOA:D6DFL4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFL4"
FT                   /protein_id="CBK76488.1"
FT   CDS             697224..697640
FT                   /transl_table=11
FT                   /locus_tag="CLS_07190"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76489"
FT                   /db_xref="GOA:D6DFL5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFL5"
FT                   /protein_id="CBK76489.1"
FT   CDS             697770..698447
FT                   /transl_table=11
FT                   /locus_tag="CLS_07200"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76490"
FT                   /db_xref="GOA:D6DFL6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFL6"
FT                   /protein_id="CBK76490.1"
FT                   ENQ"
FT   CDS             700251..700925
FT                   /transl_table=11
FT                   /locus_tag="CLS_07220"
FT                   /product="Putative transcription activator"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76491"
FT                   /db_xref="GOA:D6DFL7"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFL7"
FT                   /protein_id="CBK76491.1"
FT                   EE"
FT   CDS             700922..701725
FT                   /transl_table=11
FT                   /locus_tag="CLS_07230"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76492"
FT                   /db_xref="GOA:D6DFL8"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFL8"
FT                   /protein_id="CBK76492.1"
FT   CDS             701738..702373
FT                   /transl_table=11
FT                   /locus_tag="CLS_07240"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /function="thiamine-phosphate diphosphorylase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76493"
FT                   /db_xref="GOA:D6DFL9"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFL9"
FT                   /protein_id="CBK76493.1"
FT   CDS             702363..703019
FT                   /transl_table=11
FT                   /locus_tag="CLS_07250"
FT                   /product="haloacid dehalogenase superfamily, subfamily IA,
FT                   variant 3 with third motif having DD or ED"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76494"
FT                   /db_xref="GOA:D6DFM0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFM0"
FT                   /protein_id="CBK76494.1"
FT   CDS             703022..703507
FT                   /transl_table=11
FT                   /locus_tag="CLS_07260"
FT                   /product="NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76495"
FT                   /db_xref="GOA:D6DFM1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFM1"
FT                   /protein_id="CBK76495.1"
FT   CDS             703672..704451
FT                   /transl_table=11
FT                   /locus_tag="CLS_07270"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76496"
FT                   /db_xref="GOA:D6DFM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFM2"
FT                   /protein_id="CBK76496.1"
FT   CDS             704441..706582
FT                   /transl_table=11
FT                   /locus_tag="CLS_07280"
FT                   /product="Predicted permease."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76497"
FT                   /db_xref="GOA:D6DFM3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFM3"
FT                   /protein_id="CBK76497.1"
FT   CDS             706582..707295
FT                   /transl_table=11
FT                   /locus_tag="CLS_07290"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76498"
FT                   /db_xref="GOA:D6DFM4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFM4"
FT                   /protein_id="CBK76498.1"
FT                   TVRGEGYRLKEQVDI"
FT   CDS             707292..708359
FT                   /transl_table=11
FT                   /locus_tag="CLS_07300"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76499"
FT                   /db_xref="GOA:D6DFM5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFM5"
FT                   /protein_id="CBK76499.1"
FT                   KVKSSVRRCSDAANN"
FT   CDS             708343..708840
FT                   /transl_table=11
FT                   /locus_tag="CLS_07310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76500"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFM6"
FT                   /protein_id="CBK76500.1"
FT                   EQ"
FT   CDS             709162..709488
FT                   /transl_table=11
FT                   /locus_tag="CLS_07320"
FT                   /product="Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76501"
FT                   /db_xref="GOA:D6DFM7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFM7"
FT                   /protein_id="CBK76501.1"
FT                   FRLL"
FT   CDS             710692..710820
FT                   /transl_table=11
FT                   /locus_tag="CLS_07340"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76502"
FT                   /db_xref="GOA:D6DFM8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFM8"
FT                   /protein_id="CBK76502.1"
FT   gap             711399..711714
FT                   /estimated_length=316
FT   CDS             complement(711749..712615)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07360"
FT                   /product="Streptomycin adenylyltransferase."
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76503"
FT                   /db_xref="GOA:D6DFM9"
FT                   /db_xref="InterPro:IPR007530"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFM9"
FT                   /protein_id="CBK76503.1"
FT                   GIEDDNK"
FT   CDS             complement(712789..713304)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76504"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFN0"
FT                   /protein_id="CBK76504.1"
FT                   DNDGNKYE"
FT   CDS             complement(714185..714880)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07390"
FT                   /product="methylthioadenosine nucleosidase"
FT                   /function="methylthioadenosine nucleosidase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76505"
FT                   /db_xref="GOA:D6DFN1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFN1"
FT                   /protein_id="CBK76505.1"
FT                   LLREIKKSW"
FT   gap             715749..716898
FT                   /estimated_length=1150
FT   CDS             717028..717423
FT                   /transl_table=11
FT                   /locus_tag="CLS_07410"
FT                   /product="Replication initiator protein A (RepA)
FT                   N-terminus."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76506"
FT                   /db_xref="InterPro:IPR010724"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFN2"
FT                   /protein_id="CBK76506.1"
FT   CDS             718624..718818
FT                   /transl_table=11
FT                   /locus_tag="CLS_07430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76507"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFN3"
FT                   /protein_id="CBK76507.1"
FT   CDS             720628..720861
FT                   /transl_table=11
FT                   /locus_tag="CLS_07450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76508"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFN4"
FT                   /protein_id="CBK76508.1"
FT   CDS             720967..721842
FT                   /transl_table=11
FT                   /locus_tag="CLS_07460"
FT                   /product="CAAX amino terminal protease family."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76509"
FT                   /db_xref="GOA:D6DFN5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFN5"
FT                   /protein_id="CBK76509.1"
FT                   RRKGTFNKNM"
FT   CDS             722383..723243
FT                   /transl_table=11
FT                   /locus_tag="CLS_07480"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76510"
FT                   /db_xref="GOA:D6DFN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFN6"
FT                   /protein_id="CBK76510.1"
FT                   GDQTK"
FT   gap             723292..723677
FT                   /estimated_length=386
FT   CDS             723721..724167
FT                   /transl_table=11
FT                   /locus_tag="CLS_07500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76511"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFN7"
FT                   /protein_id="CBK76511.1"
FT   CDS             724194..724361
FT                   /transl_table=11
FT                   /locus_tag="CLS_07510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76512"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFN8"
FT                   /protein_id="CBK76512.1"
FT                   DKDGKPIVTK"
FT   CDS             724869..726206
FT                   /transl_table=11
FT                   /locus_tag="CLS_07520"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76513"
FT                   /db_xref="GOA:D6DFN9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFN9"
FT                   /protein_id="CBK76513.1"
FT   CDS             726222..727496
FT                   /transl_table=11
FT                   /locus_tag="CLS_07530"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76514"
FT                   /db_xref="GOA:D6DFP0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFP0"
FT                   /protein_id="CBK76514.1"
FT   CDS             727509..728798
FT                   /transl_table=11
FT                   /locus_tag="CLS_07540"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76515"
FT                   /db_xref="GOA:D6DFP1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFP1"
FT                   /protein_id="CBK76515.1"
FT   CDS             728811..730076
FT                   /transl_table=11
FT                   /locus_tag="CLS_07550"
FT                   /product="ABC-type transport system, involved in
FT                   lipoprotein release, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76516"
FT                   /db_xref="GOA:D6DFP2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFP2"
FT                   /protein_id="CBK76516.1"
FT   CDS             730106..730783
FT                   /transl_table=11
FT                   /locus_tag="CLS_07560"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76517"
FT                   /db_xref="GOA:D6DFP3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFP3"
FT                   /protein_id="CBK76517.1"
FT                   RGR"
FT   CDS             730783..731196
FT                   /transl_table=11
FT                   /locus_tag="CLS_07570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76518"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFP4"
FT                   /protein_id="CBK76518.1"
FT   CDS             731226..731750
FT                   /transl_table=11
FT                   /locus_tag="CLS_07580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76519"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFP5"
FT                   /protein_id="CBK76519.1"
FT                   TAGKAVRNRYD"
FT   CDS             731743..732153
FT                   /transl_table=11
FT                   /locus_tag="CLS_07590"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76520"
FT                   /db_xref="GOA:D6DFP6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFP6"
FT                   /protein_id="CBK76520.1"
FT   CDS             733076..734320
FT                   /transl_table=11
FT                   /locus_tag="CLS_07610"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76521"
FT                   /db_xref="GOA:D6DFP7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFP7"
FT                   /protein_id="CBK76521.1"
FT                   TFIISFFTNLTESQG"
FT   CDS             734377..735060
FT                   /transl_table=11
FT                   /locus_tag="CLS_07620"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76522"
FT                   /db_xref="GOA:D6DFP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFP8"
FT                   /protein_id="CBK76522.1"
FT                   GGVQQ"
FT   CDS             737590..738006
FT                   /transl_table=11
FT                   /locus_tag="CLS_07640"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76523"
FT                   /db_xref="GOA:D6DFP9"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFP9"
FT                   /protein_id="CBK76523.1"
FT   CDS             complement(738079..739443)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07650"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76524"
FT                   /db_xref="GOA:D6DFQ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFQ0"
FT                   /protein_id="CBK76524.1"
FT   CDS             complement(739443..740135)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07660"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76525"
FT                   /db_xref="GOA:D6DFQ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFQ1"
FT                   /protein_id="CBK76525.1"
FT                   RLNIKGAK"
FT   CDS             740308..740793
FT                   /transl_table=11
FT                   /locus_tag="CLS_07670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76526"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFQ2"
FT                   /protein_id="CBK76526.1"
FT   CDS             740923..741339
FT                   /transl_table=11
FT                   /locus_tag="CLS_07680"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76527"
FT                   /db_xref="GOA:D6DFQ3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFQ3"
FT                   /protein_id="CBK76527.1"
FT   CDS             741507..742007
FT                   /transl_table=11
FT                   /locus_tag="CLS_07690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76528"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFQ4"
FT                   /protein_id="CBK76528.1"
FT                   GIA"
FT   CDS             complement(742931..743203)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07720"
FT                   /product="prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76529"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFQ5"
FT                   /protein_id="CBK76529.1"
FT   CDS             743440..743955
FT                   /transl_table=11
FT                   /locus_tag="CLS_07730"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76530"
FT                   /db_xref="GOA:D6DFQ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFQ6"
FT                   /protein_id="CBK76530.1"
FT                   IIFTYKNR"
FT   gap             744295..745493
FT                   /estimated_length=1199
FT   CDS             745578..745847
FT                   /transl_table=11
FT                   /locus_tag="CLS_07750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76531"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFQ7"
FT                   /protein_id="CBK76531.1"
FT   CDS             746045..746692
FT                   /transl_table=11
FT                   /locus_tag="CLS_07770"
FT                   /product="DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76532"
FT                   /db_xref="GOA:D6DFQ8"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFQ8"
FT                   /protein_id="CBK76532.1"
FT   CDS             746640..747989
FT                   /transl_table=11
FT                   /locus_tag="CLS_07780"
FT                   /product="Predicted P-loop ATPase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76533"
FT                   /db_xref="InterPro:IPR007936"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFQ9"
FT                   /protein_id="CBK76533.1"
FT   gap             748121..749561
FT                   /estimated_length=1441
FT   gap             751418..751437
FT                   /estimated_length=20
FT   CDS             752793..753956
FT                   /transl_table=11
FT                   /locus_tag="CLS_07820"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07820"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76534"
FT                   /db_xref="GOA:D6DFR0"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFR0"
FT                   /protein_id="CBK76534.1"
FT   gap             754011..754984
FT                   /estimated_length=974
FT   CDS             755025..756377
FT                   /transl_table=11
FT                   /locus_tag="CLS_07830"
FT                   /product="FOG: Glucan-binding domain (YG repeat)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76535"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFR1"
FT                   /protein_id="CBK76535.1"
FT   CDS             complement(756595..757770)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07840"
FT                   /product="Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76536"
FT                   /db_xref="GOA:D6DFR2"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFR2"
FT                   /protein_id="CBK76536.1"
FT   CDS             757837..757944
FT                   /transl_table=11
FT                   /locus_tag="CLS_07850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76537"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFR3"
FT                   /protein_id="CBK76537.1"
FT   gap             758126..759251
FT                   /estimated_length=1126
FT   CDS             complement(759618..761060)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07870"
FT                   /product="Putative cell wall binding repeat."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76538"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFR4"
FT                   /protein_id="CBK76538.1"
FT   CDS             761103..761828
FT                   /transl_table=11
FT                   /locus_tag="CLS_07880"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76539"
FT                   /db_xref="GOA:D6DFR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFR5"
FT                   /protein_id="CBK76539.1"
FT   CDS             761825..762568
FT                   /transl_table=11
FT                   /locus_tag="CLS_07890"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76540"
FT                   /db_xref="GOA:D6DFR6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFR6"
FT                   /protein_id="CBK76540.1"
FT   CDS             763122..763556
FT                   /transl_table=11
FT                   /locus_tag="CLS_07900"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76541"
FT                   /db_xref="GOA:D6DFR7"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFR7"
FT                   /protein_id="CBK76541.1"
FT   CDS             763541..763780
FT                   /transl_table=11
FT                   /locus_tag="CLS_07910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76542"
FT                   /db_xref="InterPro:IPR024760"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFR8"
FT                   /protein_id="CBK76542.1"
FT   CDS             764175..764381
FT                   /transl_table=11
FT                   /locus_tag="CLS_07920"
FT                   /product="Excisionase from transposon Tn916."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76543"
FT                   /db_xref="InterPro:IPR015122"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFR9"
FT                   /protein_id="CBK76543.1"
FT   CDS             765820..766005
FT                   /transl_table=11
FT                   /locus_tag="CLS_07940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76544"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFS0"
FT                   /protein_id="CBK76544.1"
FT                   IVLKALEKQGFFQNPT"
FT   CDS             766075..766443
FT                   /transl_table=11
FT                   /locus_tag="CLS_07950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76545"
FT                   /db_xref="InterPro:IPR026989"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFS1"
FT                   /protein_id="CBK76545.1"
FT                   CSIHNRAEEIVLNELIYR"
FT   CDS             766643..767551
FT                   /transl_table=11
FT                   /locus_tag="CLS_07960"
FT                   /product="Abortive infection bacteriophage resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76546"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFS2"
FT                   /protein_id="CBK76546.1"
FT   CDS             complement(767730..769055)
FT                   /transl_table=11
FT                   /locus_tag="CLS_07970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_07970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76547"
FT                   /db_xref="GOA:D6DFS3"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFS3"
FT                   /protein_id="CBK76547.1"
FT   gap             769795..770282
FT                   /estimated_length=488
FT   CDS             770825..771583
FT                   /transl_table=11
FT                   /locus_tag="CLS_08000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76548"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFS4"
FT                   /protein_id="CBK76548.1"
FT   CDS             complement(771668..772483)
FT                   /transl_table=11
FT                   /locus_tag="CLS_08010"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76549"
FT                   /db_xref="GOA:D6DFS5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFS5"
FT                   /protein_id="CBK76549.1"
FT   CDS             772874..773182
FT                   /transl_table=11
FT                   /locus_tag="CLS_08020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76550"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFS6"
FT                   /protein_id="CBK76550.1"
FT   CDS             773336..773944
FT                   /transl_table=11
FT                   /locus_tag="CLS_08030"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76551"
FT                   /db_xref="GOA:D6DFS7"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFS7"
FT                   /protein_id="CBK76551.1"
FT   CDS             774140..774631
FT                   /transl_table=11
FT                   /locus_tag="CLS_08040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76552"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFS8"
FT                   /protein_id="CBK76552.1"
FT                   "
FT   gap             776387..777791
FT                   /estimated_length=1405
FT   CDS             782535..782870
FT                   /transl_table=11
FT                   /locus_tag="CLS_08090"
FT                   /product="DNA primase (bacterial type)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76553"
FT                   /db_xref="GOA:D6DFS9"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFS9"
FT                   /protein_id="CBK76553.1"
FT                   CTDLRRS"
FT   CDS             784721..784930
FT                   /transl_table=11
FT                   /locus_tag="CLS_08110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76554"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFT0"
FT                   /protein_id="CBK76554.1"
FT   CDS             784937..785167
FT                   /transl_table=11
FT                   /locus_tag="CLS_08120"
FT                   /product="Excisionase from transposon Tn916."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76555"
FT                   /db_xref="InterPro:IPR015122"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFT1"
FT                   /protein_id="CBK76555.1"
FT   CDS             785273..786514
FT                   /transl_table=11
FT                   /locus_tag="CLS_08130"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76556"
FT                   /db_xref="GOA:D6DFT2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR004191"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFT2"
FT                   /protein_id="CBK76556.1"
FT                   ASMKSTTHRKRCVS"
FT   CDS             786675..787136
FT                   /transl_table=11
FT                   /locus_tag="CLS_08140"
FT                   /product="Protein-tyrosine-phosphatase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76557"
FT                   /db_xref="GOA:D6DFT3"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFT3"
FT                   /protein_id="CBK76557.1"
FT   CDS             complement(787247..788593)
FT                   /transl_table=11
FT                   /locus_tag="CLS_08150"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76558"
FT                   /db_xref="GOA:D6DFT4"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFT4"
FT                   /protein_id="CBK76558.1"
FT   CDS             790670..790912
FT                   /transl_table=11
FT                   /locus_tag="CLS_08180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76559"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFT5"
FT                   /protein_id="CBK76559.1"
FT   CDS             790909..791088
FT                   /transl_table=11
FT                   /locus_tag="CLS_08190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76560"
FT                   /db_xref="InterPro:IPR025346"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFT6"
FT                   /protein_id="CBK76560.1"
FT                   RAGYTYDREKNQFR"
FT   CDS             792946..793716
FT                   /transl_table=11
FT                   /locus_tag="CLS_08210"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferases"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76561"
FT                   /db_xref="GOA:D6DFT7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFT7"
FT                   /protein_id="CBK76561.1"
FT   CDS             793676..794803
FT                   /transl_table=11
FT                   /locus_tag="CLS_08220"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76562"
FT                   /db_xref="GOA:D6DFT8"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR020822"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFT8"
FT                   /protein_id="CBK76562.1"
FT   CDS             794986..796395
FT                   /transl_table=11
FT                   /locus_tag="CLS_08230"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76563"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFT9"
FT                   /protein_id="CBK76563.1"
FT                   GMSNKEGSYGN"
FT   CDS             796385..797950
FT                   /transl_table=11
FT                   /locus_tag="CLS_08240"
FT                   /product="Exopolyphosphatase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76564"
FT                   /db_xref="GOA:D6DFU0"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFU0"
FT                   /protein_id="CBK76564.1"
FT                   KRRV"
FT   CDS             797953..800151
FT                   /transl_table=11
FT                   /locus_tag="CLS_08250"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76565"
FT                   /db_xref="GOA:D6DFU1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFU1"
FT                   /protein_id="CBK76565.1"
FT   CDS             800500..801204
FT                   /transl_table=11
FT                   /locus_tag="CLS_08270"
FT                   /product="Response regulators consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76566"
FT                   /db_xref="GOA:D6DFU2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFU2"
FT                   /protein_id="CBK76566.1"
FT                   TTVWGVGYKIEK"
FT   CDS             801209..802330
FT                   /transl_table=11
FT                   /locus_tag="CLS_08280"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76567"
FT                   /db_xref="GOA:D6DFU3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFU3"
FT                   /protein_id="CBK76567.1"
FT   CDS             802426..804927
FT                   /transl_table=11
FT                   /locus_tag="CLS_08290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76568"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFU4"
FT                   /protein_id="CBK76568.1"
FT   CDS             804927..805889
FT                   /transl_table=11
FT                   /locus_tag="CLS_08300"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76569"
FT                   /db_xref="GOA:D6DFU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFU5"
FT                   /protein_id="CBK76569.1"
FT   CDS             805867..806871
FT                   /transl_table=11
FT                   /locus_tag="CLS_08310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76570"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFU6"
FT                   /protein_id="CBK76570.1"
FT   CDS             806864..807697
FT                   /transl_table=11
FT                   /locus_tag="CLS_08320"
FT                   /product="Endonuclease IV"
FT                   /function="Endonuclease IV"
FT                   /EC_number=""
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76571"
FT                   /db_xref="GOA:D6DFU7"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFU7"
FT                   /protein_id="CBK76571.1"
FT   CDS             807807..808289
FT                   /transl_table=11
FT                   /locus_tag="CLS_08330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76572"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFU8"
FT                   /protein_id="CBK76572.1"
FT   CDS             808382..809803
FT                   /transl_table=11
FT                   /locus_tag="CLS_08340"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76573"
FT                   /db_xref="GOA:D6DFU9"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFU9"
FT                   /protein_id="CBK76573.1"
FT                   LPNEKGEAETQTDRK"
FT   CDS             809936..810502
FT                   /transl_table=11
FT                   /locus_tag="CLS_08350"
FT                   /product="Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76574"
FT                   /db_xref="GOA:D6DFV0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFV0"
FT                   /protein_id="CBK76574.1"
FT   CDS             810720..811526
FT                   /transl_table=11
FT                   /locus_tag="CLS_08360"
FT                   /product="Response regulator containing CheY-like receiver
FT                   domain and AraC-type DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76575"
FT                   /db_xref="GOA:D6DFV1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012052"
FT                   /db_xref="InterPro:IPR014879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFV1"
FT                   /protein_id="CBK76575.1"
FT   CDS             811712..813157
FT                   /transl_table=11
FT                   /locus_tag="CLS_08370"
FT                   /product="glycogen synthase (ADP-glucose)"
FT                   /function="glycogen synthase (ADP-glucose)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76576"
FT                   /db_xref="GOA:D6DFV2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFV2"
FT                   /protein_id="CBK76576.1"
FT   CDS             813378..813896
FT                   /transl_table=11
FT                   /locus_tag="CLS_08380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76577"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFV3"
FT                   /protein_id="CBK76577.1"
FT                   KLGAALKAA"
FT   CDS             813939..814397
FT                   /transl_table=11
FT                   /locus_tag="CLS_08390"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76578"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFV4"
FT                   /protein_id="CBK76578.1"
FT   CDS             complement(814427..815503)
FT                   /transl_table=11
FT                   /locus_tag="CLS_08400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76579"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFV5"
FT                   /protein_id="CBK76579.1"
FT                   RELLFKVRESENEAGLMS"
FT   CDS             complement(815863..816300)
FT                   /transl_table=11
FT                   /locus_tag="CLS_08420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76580"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFV6"
FT                   /protein_id="CBK76580.1"
FT   CDS             complement(816517..817701)
FT                   /transl_table=11
FT                   /locus_tag="CLS_08430"
FT                   /product="sodium--glutamate symport carrier (gltS)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76581"
FT                   /db_xref="GOA:D6DFV7"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFV7"
FT                   /protein_id="CBK76581.1"
FT   CDS             817915..818007
FT                   /transl_table=11
FT                   /locus_tag="CLS_08440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76582"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFV8"
FT                   /protein_id="CBK76582.1"
FT                   /translation="MQYTDSEWGIQEEKREAYVPEKIRAHRRRT"
FT   gap             818954..819335
FT                   /estimated_length=382
FT   CDS             complement(820574..821770)
FT                   /transl_table=11
FT                   /locus_tag="CLS_08480"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase apoenzyme"
FT                   /function="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase apoenzyme"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76583"
FT                   /db_xref="GOA:D6DFV9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFV9"
FT                   /protein_id="CBK76583.1"
FT   CDS             complement(821855..822616)
FT                   /transl_table=11
FT                   /locus_tag="CLS_08490"
FT                   /product="dethiobiotin synthase"
FT                   /function="dethiobiotin synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76584"
FT                   /db_xref="GOA:D6DFW0"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFW0"
FT                   /protein_id="CBK76584.1"
FT   CDS             complement(822600..823628)
FT                   /transl_table=11
FT                   /locus_tag="CLS_08500"
FT                   /product="biotin synthase"
FT                   /function="biotin synthase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76585"
FT                   /db_xref="GOA:D6DFW1"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFW1"
FT                   /protein_id="CBK76585.1"
FT                   QI"
FT   CDS             complement(823645..824226)
FT                   /transl_table=11
FT                   /locus_tag="CLS_08510"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76586"
FT                   /db_xref="GOA:D6DFW2"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFW2"
FT                   /protein_id="CBK76586.1"
FT   CDS             824631..825095
FT                   /transl_table=11
FT                   /locus_tag="CLS_08520"
FT                   /product="heat shock protein Hsp20"
FT                   /function="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76587"
FT                   /db_xref="GOA:D6DFW3"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFW3"
FT                   /protein_id="CBK76587.1"
FT   CDS             827912..828697
FT                   /transl_table=11
FT                   /locus_tag="CLS_08550"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76588"
FT                   /db_xref="GOA:D6DFW4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFW4"
FT                   /protein_id="CBK76588.1"
FT   CDS             828684..829484
FT                   /transl_table=11
FT                   /locus_tag="CLS_08560"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76589"
FT                   /db_xref="GOA:D6DFW5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFW5"
FT                   /protein_id="CBK76589.1"
FT   CDS             829915..831306
FT                   /transl_table=11
FT                   /locus_tag="CLS_08570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76590"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFW6"
FT                   /protein_id="CBK76590.1"
FT                   ICPTT"
FT   CDS             831303..832457
FT                   /transl_table=11
FT                   /locus_tag="CLS_08580"
FT                   /product="His Kinase A (phosphoacceptor) domain./Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase./Response
FT                   regulator receiver domain."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76591"
FT                   /db_xref="GOA:D6DFW7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFW7"
FT                   /protein_id="CBK76591.1"
FT   CDS             832435..833295
FT                   /transl_table=11
FT                   /locus_tag="CLS_08590"
FT                   /product="Predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76592"
FT                   /db_xref="GOA:D6DFW8"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFW8"
FT                   /protein_id="CBK76592.1"
FT                   AAKGR"
FT   CDS             833337..833861
FT                   /transl_table=11
FT                   /locus_tag="CLS_08600"
FT                   /product="Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76593"
FT                   /db_xref="GOA:D6DFW9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFW9"
FT                   /protein_id="CBK76593.1"
FT                   KRAWFNRYGED"
FT   CDS             833848..833958
FT                   /transl_table=11
FT                   /locus_tag="CLS_08610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76594"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFX0"
FT                   /protein_id="CBK76594.1"
FT   CDS             834160..834627
FT                   /transl_table=11
FT                   /locus_tag="CLS_08620"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76595"
FT                   /db_xref="GOA:D6DFX1"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFX1"
FT                   /protein_id="CBK76595.1"
FT   CDS             834652..835878
FT                   /transl_table=11
FT                   /locus_tag="CLS_08630"
FT                   /product="transcription termination factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76596"
FT                   /db_xref="GOA:D6DFX2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR028620"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFX2"
FT                   /protein_id="CBK76596.1"
FT                   SGAVYSDGQ"
FT   gap             837173..837600
FT                   /estimated_length=428
FT   CDS             837839..839626
FT                   /transl_table=11
FT                   /locus_tag="CLS_08670"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /function="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76597"
FT                   /db_xref="GOA:D6DFX3"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFX3"
FT                   /protein_id="CBK76597.1"
FT   CDS             839637..840068
FT                   /transl_table=11
FT                   /locus_tag="CLS_08680"
FT                   /product="ribosome-binding factor A"
FT                   /function="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76598"
FT                   /db_xref="GOA:D6DFX4"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFX4"
FT                   /protein_id="CBK76598.1"
FT   CDS             840188..841159
FT                   /transl_table=11
FT                   /locus_tag="CLS_08690"
FT                   /product="Exopolyphosphatase-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76599"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFX5"
FT                   /protein_id="CBK76599.1"
FT   CDS             841159..842085
FT                   /transl_table=11
FT                   /locus_tag="CLS_08700"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /function="tRNA pseudouridine synthase B"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76600"
FT                   /db_xref="GOA:D6DFX6"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFX6"
FT                   /protein_id="CBK76600.1"
FT   CDS             842088..843029
FT                   /transl_table=11
FT                   /locus_tag="CLS_08710"
FT                   /product="riboflavin kinase/FMN adenylyltransferase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76601"
FT                   /db_xref="GOA:D6DFX7"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFX7"
FT                   /protein_id="CBK76601.1"
FT   CDS             complement(843135..843662)
FT                   /transl_table=11
FT                   /locus_tag="CLS_08720"
FT                   /product="Acetyltransferase (GNAT) family."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76602"
FT                   /db_xref="GOA:D6DFX8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFX8"
FT                   /protein_id="CBK76602.1"
FT                   LQRPLLSQETQI"
FT   CDS             complement(843841..844284)
FT                   /transl_table=11
FT                   /locus_tag="CLS_08730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76603"
FT                   /db_xref="InterPro:IPR024208"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFX9"
FT                   /protein_id="CBK76603.1"
FT   CDS             844568..847783
FT                   /transl_table=11
FT                   /locus_tag="CLS_08740"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /function="carbamoyl-phosphate synthase large subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76604"
FT                   /db_xref="GOA:D6DFY0"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFY0"
FT                   /protein_id="CBK76604.1"
FT   CDS             848061..848549
FT                   /transl_table=11
FT                   /locus_tag="CLS_08750"
FT                   /product="RNA polymerase, sigma subunit, SigV"
FT                   /function="RNA polymerase, sigma subunit, SigV"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76605"
FT                   /db_xref="GOA:D6DFY1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFY1"
FT                   /protein_id="CBK76605.1"
FT   CDS             848549..849430
FT                   /transl_table=11
FT                   /locus_tag="CLS_08760"
FT                   /product="Protein of unknown function (DUF3298)."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76606"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFY2"
FT                   /protein_id="CBK76606.1"
FT                   GSSGEIEFEIGG"
FT   CDS             849435..850073
FT                   /transl_table=11
FT                   /locus_tag="CLS_08770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08770"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76607"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFY3"
FT                   /protein_id="CBK76607.1"
FT   CDS             850184..850276
FT                   /transl_table=11
FT                   /locus_tag="CLS_08780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76608"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFY4"
FT                   /protein_id="CBK76608.1"
FT                   /translation="MELAENGQQARQVKMKQAVSGREGGNPEFF"
FT   CDS             850466..851113
FT                   /transl_table=11
FT                   /locus_tag="CLS_08790"
FT                   /product="selenium metabolism protein YedF"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76609"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR019870"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFY5"
FT                   /protein_id="CBK76609.1"
FT   CDS             851276..851551
FT                   /transl_table=11
FT                   /locus_tag="CLS_08800"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76610"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFY6"
FT                   /protein_id="CBK76610.1"
FT   CDS             851669..852037
FT                   /transl_table=11
FT                   /locus_tag="CLS_08810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76611"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFY7"
FT                   /protein_id="CBK76611.1"
FT                   ALLEDLTVAKARAGIENW"
FT   gap             852376..852612
FT                   /estimated_length=237
FT   CDS             852637..853809
FT                   /transl_table=11
FT                   /locus_tag="CLS_08830"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76612"
FT                   /db_xref="GOA:D6DFY8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFY8"
FT                   /protein_id="CBK76612.1"
FT   CDS             854239..854538
FT                   /transl_table=11
FT                   /locus_tag="CLS_08840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76613"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFY9"
FT                   /protein_id="CBK76613.1"
FT   CDS             855035..856315
FT                   /transl_table=11
FT                   /locus_tag="CLS_08860"
FT                   /product="Glycine/sarcosine/betaine reductase component B
FT                   subunits."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76614"
FT                   /db_xref="GOA:D6DFZ0"
FT                   /db_xref="InterPro:IPR015417"
FT                   /db_xref="InterPro:IPR016585"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFZ0"
FT                   /protein_id="CBK76614.1"
FT   CDS             856325..857374
FT                   /transl_table=11
FT                   /locus_tag="CLS_08870"
FT                   /product="selenoprotein B,
FT                   glycine/betaine/sarcosine/D-proline reductase family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76615"
FT                   /db_xref="GOA:D6DFZ1"
FT                   /db_xref="InterPro:IPR010187"
FT                   /db_xref="InterPro:IPR022787"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFZ1"
FT                   /protein_id="CBK76615.1"
FT                   VDAVILTST"
FT   CDS             857402..857638
FT                   /transl_table=11
FT                   /locus_tag="CLS_08880"
FT                   /product="selenoprotein B,
FT                   glycine/betaine/sarcosine/D-proline reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76616"
FT                   /db_xref="GOA:D6DFZ2"
FT                   /db_xref="InterPro:IPR010187"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFZ2"
FT                   /protein_id="CBK76616.1"
FT   CDS             857826..858767
FT                   /transl_table=11
FT                   /locus_tag="CLS_08890"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76617"
FT                   /db_xref="GOA:D6DFZ3"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFZ3"
FT                   /protein_id="CBK76617.1"
FT   CDS             858800..859117
FT                   /transl_table=11
FT                   /locus_tag="CLS_08900"
FT                   /product="Thioredoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76618"
FT                   /db_xref="GOA:D6DFZ4"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFZ4"
FT                   /protein_id="CBK76618.1"
FT                   L"
FT   CDS             859346..859477
FT                   /transl_table=11
FT                   /locus_tag="CLS_08910"
FT                   /product="Glycine reductase complex selenoprotein A."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76619"
FT                   /db_xref="GOA:D6DFZ5"
FT                   /db_xref="InterPro:IPR006812"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFZ5"
FT                   /protein_id="CBK76619.1"
FT   CDS             859493..859819
FT                   /transl_table=11
FT                   /locus_tag="CLS_08920"
FT                   /product="Glycine reductase complex selenoprotein A."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76620"
FT                   /db_xref="GOA:D6DFZ6"
FT                   /db_xref="InterPro:IPR006812"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFZ6"
FT                   /protein_id="CBK76620.1"
FT                   CKYL"
FT   CDS             859997..861544
FT                   /transl_table=11
FT                   /locus_tag="CLS_08930"
FT                   /product="3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase
FT                   III."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08930"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76621"
FT                   /db_xref="GOA:D6DFZ7"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFZ7"
FT                   /protein_id="CBK76621.1"
FT   CDS             861573..862691
FT                   /transl_table=11
FT                   /locus_tag="CLS_08940"
FT                   /product="Fatty acid synthesis protein."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76622"
FT                   /db_xref="GOA:D6DFZ8"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012116"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFZ8"
FT                   /protein_id="CBK76622.1"
FT   tRNA            862934..863026
FT                   /locus_tag="CLS_T_39550"
FT   CDS             863070..864542
FT                   /transl_table=11
FT                   /locus_tag="CLS_08960"
FT                   /product="seryl-tRNA(sec) selenium transferase"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08960"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76623"
FT                   /db_xref="GOA:D6DFZ9"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:D6DFZ9"
FT                   /protein_id="CBK76623.1"
FT   CDS             864547..866460
FT                   /transl_table=11
FT                   /locus_tag="CLS_08970"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor SelB"
FT                   /function="selenocysteine-specific translation elongation
FT                   factor SelB"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76624"
FT                   /db_xref="GOA:D6DG00"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG00"
FT                   /protein_id="CBK76624.1"
FT                   GK"
FT   CDS             866492..866728
FT                   /transl_table=11
FT                   /locus_tag="CLS_08980"
FT                   /product="Protein of unknown function (DUF3343)."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76625"
FT                   /db_xref="InterPro:IPR021778"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG01"
FT                   /protein_id="CBK76625.1"
FT   CDS             866837..867985
FT                   /transl_table=11
FT                   /locus_tag="CLS_08990"
FT                   /product="cysteine desulfurase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_08990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76626"
FT                   /db_xref="GOA:D6DG02"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010969"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG02"
FT                   /protein_id="CBK76626.1"
FT   CDS             complement(868242..869843)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09000"
FT                   /product="transporter, NhaC family (TC 2.A.35)"
FT                   /function="transporter, NhaC family (TC 2.A.35)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76627"
FT                   /db_xref="GOA:D6DG03"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG03"
FT                   /protein_id="CBK76627.1"
FT                   DPNYSKTMTEDHVVAK"
FT   CDS             complement(870213..871934)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09020"
FT                   /product="Transcriptional regulator containing PAS,
FT                   AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76628"
FT                   /db_xref="GOA:D6DG04"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG04"
FT                   /protein_id="CBK76628.1"
FT   CDS             872264..872347
FT                   /transl_table=11
FT                   /locus_tag="CLS_09040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76629"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG05"
FT                   /protein_id="CBK76629.1"
FT                   /translation="MGEKRIRLLKAKQKRKKRLKEQKRLLF"
FT   CDS             872400..873197
FT                   /transl_table=11
FT                   /locus_tag="CLS_09050"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76630"
FT                   /db_xref="GOA:D6DG06"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG06"
FT                   /protein_id="CBK76630.1"
FT   CDS             873238..873306
FT                   /transl_table=11
FT                   /locus_tag="CLS_09060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76631"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG07"
FT                   /protein_id="CBK76631.1"
FT                   /translation="MKEEMKGNGAERLISPEYKTRN"
FT   CDS             873323..874714
FT                   /transl_table=11
FT                   /locus_tag="CLS_09070"
FT                   /product="glycine dehydrogenase (decarboxylating) alpha
FT                   subunit"
FT                   /function="glycine dehydrogenase (decarboxylating) alpha
FT                   subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76632"
FT                   /db_xref="GOA:D6DG08"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020580"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG08"
FT                   /protein_id="CBK76632.1"
FT                   AEVIK"
FT   CDS             876656..877786
FT                   /transl_table=11
FT                   /locus_tag="CLS_09090"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76633"
FT                   /db_xref="GOA:D6DG09"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR011386"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG09"
FT                   /protein_id="CBK76633.1"
FT   CDS             complement(877997..878818)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09100"
FT                   /product="Integral membrane protein (intg_mem_TP0381)."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76634"
FT                   /db_xref="InterPro:IPR011737"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG10"
FT                   /protein_id="CBK76634.1"
FT   CDS             879237..880085
FT                   /transl_table=11
FT                   /locus_tag="CLS_09110"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family (TC 3.A.1.3.-)"
FT                   /function="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family (TC 3.A.1.3.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76635"
FT                   /db_xref="GOA:D6DG11"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG11"
FT                   /protein_id="CBK76635.1"
FT                   E"
FT   CDS             880196..880888
FT                   /transl_table=11
FT                   /locus_tag="CLS_09120"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family (TC 3.A.1.3.-)"
FT                   /function="amino acid ABC transporter membrane protein,
FT                   PAAT family (TC 3.A.1.3.-)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76636"
FT                   /db_xref="GOA:D6DG12"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG12"
FT                   /protein_id="CBK76636.1"
FT                   RRLRQSEH"
FT   CDS             881740..881838
FT                   /transl_table=11
FT                   /locus_tag="CLS_09140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76637"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG13"
FT                   /protein_id="CBK76637.1"
FT                   /translation="MRTPRRGKRLFKAAARRREKAGKPLMIEGVES"
FT   CDS             complement(881888..882982)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09150"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76638"
FT                   /db_xref="GOA:D6DG14"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG14"
FT                   /protein_id="CBK76638.1"
FT   CDS             complement(882982..883905)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09160"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76639"
FT                   /db_xref="GOA:D6DG15"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG15"
FT                   /protein_id="CBK76639.1"
FT   CDS             884172..886223
FT                   /transl_table=11
FT                   /locus_tag="CLS_09170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76640"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG16"
FT                   /protein_id="CBK76640.1"
FT   tRNA            886501..886573
FT                   /locus_tag="CLS_T_39560"
FT   tRNA            886671..886742
FT                   /locus_tag="CLS_T_39570"
FT   tRNA            886747..886817
FT                   /locus_tag="CLS_T_39580"
FT   CDS             complement(887043..888194)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09190"
FT                   /product="Phage integrase family."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76641"
FT                   /db_xref="GOA:D6DG17"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG17"
FT                   /protein_id="CBK76641.1"
FT   CDS             complement(888271..890373)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76642"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG18"
FT                   /protein_id="CBK76642.1"
FT                   ILHKLE"
FT   CDS             890484..892037
FT                   /transl_table=11
FT                   /locus_tag="CLS_09210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76643"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG19"
FT                   /protein_id="CBK76643.1"
FT                   "
FT   gap             892329..893632
FT                   /estimated_length=1304
FT   CDS             complement(893774..894088)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09240"
FT                   /product="Helix-turn-helix."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76644"
FT                   /db_xref="GOA:D6DG20"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG20"
FT                   /protein_id="CBK76644.1"
FT                   "
FT   gap             896518..897457
FT                   /estimated_length=940
FT   CDS             898174..898932
FT                   /transl_table=11
FT                   /locus_tag="CLS_09280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76645"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG21"
FT                   /protein_id="CBK76645.1"
FT   CDS             898943..899260
FT                   /transl_table=11
FT                   /locus_tag="CLS_09290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76646"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG22"
FT                   /protein_id="CBK76646.1"
FT                   Q"
FT   gap             899846..900477
FT                   /estimated_length=632
FT   CDS             complement(900651..900824)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09320"
FT                   /product="DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76647"
FT                   /db_xref="GOA:D6DG23"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG23"
FT                   /protein_id="CBK76647.1"
FT                   KADFLQLLYQQL"
FT   CDS             901300..901566
FT                   /transl_table=11
FT                   /locus_tag="CLS_09330"
FT                   /product="Ribbon-helix-helix protein, copG family."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76648"
FT                   /db_xref="GOA:D6DG24"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG24"
FT                   /protein_id="CBK76648.1"
FT   CDS             901566..902129
FT                   /transl_table=11
FT                   /locus_tag="CLS_09340"
FT                   /product="Relaxase/Mobilisation nuclease domain."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76649"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG25"
FT                   /protein_id="CBK76649.1"
FT   CDS             902135..902431
FT                   /transl_table=11
FT                   /locus_tag="CLS_09350"
FT                   /product="Predicted double-stranded RNA/RNA-DNA hybrid
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76650"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG26"
FT                   /protein_id="CBK76650.1"
FT   gap             902510..903047
FT                   /estimated_length=538
FT   CDS             903516..903644
FT                   /transl_table=11
FT                   /locus_tag="CLS_09370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76651"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG27"
FT                   /protein_id="CBK76651.1"
FT   CDS             903736..904866
FT                   /transl_table=11
FT                   /locus_tag="CLS_09380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76652"
FT                   /db_xref="InterPro:IPR025582"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG28"
FT                   /protein_id="CBK76652.1"
FT   CDS             905328..905918
FT                   /transl_table=11
FT                   /locus_tag="CLS_09390"
FT                   /product="Type I restriction modification DNA specificity
FT                   domain."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76653"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG29"
FT                   /protein_id="CBK76653.1"
FT   gap             905925..906323
FT                   /estimated_length=399
FT   CDS             906364..907779
FT                   /transl_table=11
FT                   /locus_tag="CLS_09400"
FT                   /product="Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76654"
FT                   /db_xref="GOA:D6DG30"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG30"
FT                   /protein_id="CBK76654.1"
FT                   QSQIRKYLEELGL"
FT   CDS             907860..908411
FT                   /transl_table=11
FT                   /locus_tag="CLS_09410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76655"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG31"
FT                   /protein_id="CBK76655.1"
FT   CDS             908923..911373
FT                   /transl_table=11
FT                   /locus_tag="CLS_09420"
FT                   /product="type I restriction system adenine methylase
FT                   (hsdM)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76656"
FT                   /db_xref="GOA:D6DG32"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002296"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG32"
FT                   /protein_id="CBK76656.1"
FT                   GFVW"
FT   gap             913109..914477
FT                   /estimated_length=1369
FT   CDS             914501..917593
FT                   /transl_table=11
FT                   /locus_tag="CLS_09440"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76657"
FT                   /db_xref="GOA:D6DG33"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG33"
FT                   /protein_id="CBK76657.1"
FT   CDS             918709..919008
FT                   /transl_table=11
FT                   /locus_tag="CLS_09460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76658"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG34"
FT                   /protein_id="CBK76658.1"
FT   gap             919121..919568
FT                   /estimated_length=448
FT   CDS             919640..919888
FT                   /transl_table=11
FT                   /locus_tag="CLS_09470"
FT                   /product="prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76659"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG35"
FT                   /protein_id="CBK76659.1"
FT   CDS             919890..920189
FT                   /transl_table=11
FT                   /locus_tag="CLS_09480"
FT                   /product="Plasmid stabilization system protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76660"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG36"
FT                   /protein_id="CBK76660.1"
FT   CDS             920237..921103
FT                   /transl_table=11
FT                   /locus_tag="CLS_09490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76661"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG37"
FT                   /protein_id="CBK76661.1"
FT                   KNGRKNK"
FT   CDS             921075..921242
FT                   /transl_table=11
FT                   /locus_tag="CLS_09500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76662"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG38"
FT                   /protein_id="CBK76662.1"
FT                   DILTRKMING"
FT   CDS             921326..922258
FT                   /transl_table=11
FT                   /locus_tag="CLS_09510"
FT                   /product="phage/plasmid-related protein TIGR03299"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76663"
FT                   /db_xref="InterPro:IPR017686"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG39"
FT                   /protein_id="CBK76663.1"
FT   CDS             922352..923242
FT                   /transl_table=11
FT                   /locus_tag="CLS_09520"
FT                   /product="conserved hypothetical protein (putative
FT                   transposase or invertase)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76664"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG40"
FT                   /protein_id="CBK76664.1"
FT                   EKYQLTGQELEEYLK"
FT   CDS             923343..923861
FT                   /transl_table=11
FT                   /locus_tag="CLS_09530"
FT                   /product="DNA repair proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76665"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG41"
FT                   /protein_id="CBK76665.1"
FT                   ALNNRFDVA"
FT   CDS             923967..924899
FT                   /transl_table=11
FT                   /locus_tag="CLS_09540"
FT                   /product="putative phage-type endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76666"
FT                   /db_xref="GOA:D6DG42"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR017482"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG42"
FT                   /protein_id="CBK76666.1"
FT   CDS             925796..925891
FT                   /transl_table=11
FT                   /locus_tag="CLS_09560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76667"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG43"
FT                   /protein_id="CBK76667.1"
FT                   /translation="MQYEPFGAYIYGMGVEEDQIERACASRPRNI"
FT   CDS             925923..926222
FT                   /transl_table=11
FT                   /locus_tag="CLS_09570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76668"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG44"
FT                   /protein_id="CBK76668.1"
FT   CDS             926381..927121
FT                   /transl_table=11
FT                   /locus_tag="CLS_09580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76669"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG45"
FT                   /protein_id="CBK76669.1"
FT   CDS             927118..928011
FT                   /transl_table=11
FT                   /locus_tag="CLS_09590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09590"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76670"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG46"
FT                   /protein_id="CBK76670.1"
FT                   HMYHYCREKGKLEIEE"
FT   CDS             928082..928339
FT                   /transl_table=11
FT                   /locus_tag="CLS_09600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09600"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76671"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG47"
FT                   /protein_id="CBK76671.1"
FT   CDS             928419..929024
FT                   /transl_table=11
FT                   /locus_tag="CLS_09610"
FT                   /product="Site-specific recombinases, DNA invertase Pin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09610"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76672"
FT                   /db_xref="GOA:D6DG48"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG48"
FT                   /protein_id="CBK76672.1"
FT   CDS             929252..930616
FT                   /transl_table=11
FT                   /locus_tag="CLS_09620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09620"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76673"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG49"
FT                   /protein_id="CBK76673.1"
FT   CDS             930665..932356
FT                   /transl_table=11
FT                   /locus_tag="CLS_09630"
FT                   /product="Protein of unknown function (DUF1703)./Predicted
FT                   AAA-ATPase."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09630"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76674"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG50"
FT                   /protein_id="CBK76674.1"
FT   CDS             932388..932537
FT                   /transl_table=11
FT                   /locus_tag="CLS_09640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09640"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76675"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG51"
FT                   /protein_id="CBK76675.1"
FT                   KKIY"
FT   CDS             932539..933744
FT                   /transl_table=11
FT                   /locus_tag="CLS_09650"
FT                   /product="Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09650"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76676"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG52"
FT                   /protein_id="CBK76676.1"
FT                   DL"
FT   CDS             complement(934145..934699)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09660"
FT                   /product="Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09660"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76677"
FT                   /db_xref="GOA:D6DG53"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG53"
FT                   /protein_id="CBK76677.1"
FT   CDS             complement(934726..935298)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09670"
FT                   /product="Conserved protein/domain typically associated
FT                   with flavoprotein oxygenases, DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09670"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76678"
FT                   /db_xref="GOA:D6DG54"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG54"
FT                   /protein_id="CBK76678.1"
FT   CDS             935445..935777
FT                   /transl_table=11
FT                   /locus_tag="CLS_09680"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09680"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76679"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG55"
FT                   /protein_id="CBK76679.1"
FT                   GDKNRL"
FT   CDS             935928..936596
FT                   /transl_table=11
FT                   /locus_tag="CLS_09690"
FT                   /product="4Fe-4S binding domain."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09690"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76680"
FT                   /db_xref="GOA:D6DG56"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG56"
FT                   /protein_id="CBK76680.1"
FT                   "
FT   CDS             936662..936805
FT                   /transl_table=11
FT                   /locus_tag="CLS_09700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09700"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76681"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG57"
FT                   /protein_id="CBK76681.1"
FT                   EQ"
FT   CDS             complement(936868..937818)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09710"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09710"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76682"
FT                   /db_xref="GOA:D6DG58"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG58"
FT                   /protein_id="CBK76682.1"
FT   CDS             938122..939309
FT                   /transl_table=11
FT                   /locus_tag="CLS_09720"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09720"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76683"
FT                   /db_xref="GOA:D6DG59"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG59"
FT                   /protein_id="CBK76683.1"
FT   CDS             939381..940307
FT                   /transl_table=11
FT                   /locus_tag="CLS_09730"
FT                   /product="2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
FT                   (catechol pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09730"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76684"
FT                   /db_xref="GOA:D6DG60"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG60"
FT                   /protein_id="CBK76684.1"
FT   CDS             940389..941183
FT                   /transl_table=11
FT                   /locus_tag="CLS_09740"
FT                   /product="Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09740"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76685"
FT                   /db_xref="GOA:D6DG61"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG61"
FT                   /protein_id="CBK76685.1"
FT   CDS             complement(941237..942013)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09750"
FT                   /product="3-dehydroquinate dehydratase, type I"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09750"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76686"
FT                   /db_xref="GOA:D6DG62"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG62"
FT                   /protein_id="CBK76686.1"
FT   CDS             complement(942070..943416)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09760"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09760"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76687"
FT                   /db_xref="GOA:D6DG63"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG63"
FT                   /protein_id="CBK76687.1"
FT   CDS             943825..943992
FT                   /transl_table=11
FT                   /locus_tag="CLS_09780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09780"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76688"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG64"
FT                   /protein_id="CBK76688.1"
FT                   AEKGRPLIGE"
FT   CDS             943989..944072
FT                   /transl_table=11
FT                   /locus_tag="CLS_09790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09790"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76689"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG65"
FT                   /protein_id="CBK76689.1"
FT                   /translation="MRAAGAFSGKRWGEVCIKKGRREAHRT"
FT   CDS             944069..944185
FT                   /transl_table=11
FT                   /locus_tag="CLS_09800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09800"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76690"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG66"
FT                   /protein_id="CBK76690.1"
FT   CDS             944182..946866
FT                   /transl_table=11
FT                   /locus_tag="CLS_09810"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09810"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76691"
FT                   /db_xref="GOA:D6DG67"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG67"
FT                   /protein_id="CBK76691.1"
FT   CDS             947639..949258
FT                   /transl_table=11
FT                   /locus_tag="CLS_09830"
FT                   /product="Predicted metal-dependent hydrolase with the
FT                   TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09830"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76692"
FT                   /db_xref="GOA:D6DG68"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG68"
FT                   /protein_id="CBK76692.1"
FT   CDS             complement(949338..950276)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09840"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09840"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76693"
FT                   /db_xref="GOA:D6DG69"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG69"
FT                   /protein_id="CBK76693.1"
FT   CDS             950488..952059
FT                   /transl_table=11
FT                   /locus_tag="CLS_09850"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09850"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76694"
FT                   /db_xref="GOA:D6DG70"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG70"
FT                   /protein_id="CBK76694.1"
FT                   NDMYWK"
FT   CDS             952149..953075
FT                   /transl_table=11
FT                   /locus_tag="CLS_09860"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09860"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76695"
FT                   /db_xref="GOA:D6DG71"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG71"
FT                   /protein_id="CBK76695.1"
FT   CDS             953090..953971
FT                   /transl_table=11
FT                   /locus_tag="CLS_09870"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09870"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76696"
FT                   /db_xref="GOA:D6DG72"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG72"
FT                   /protein_id="CBK76696.1"
FT                   DGLRDALDPRLK"
FT   CDS             954005..955072
FT                   /transl_table=11
FT                   /locus_tag="CLS_09880"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09880"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76697"
FT                   /db_xref="GOA:D6DG73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG73"
FT                   /protein_id="CBK76697.1"
FT                   NCQTQRAGRGEDDRG"
FT   CDS             955059..956015
FT                   /transl_table=11
FT                   /locus_tag="CLS_09890"
FT                   /product="oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09890"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76698"
FT                   /db_xref="GOA:D6DG74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG74"
FT                   /protein_id="CBK76698.1"
FT   CDS             956094..957014
FT                   /transl_table=11
FT                   /locus_tag="CLS_09900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09900"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76699"
FT                   /db_xref="InterPro:IPR026002"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG75"
FT                   /protein_id="CBK76699.1"
FT   CDS             957064..957954
FT                   /transl_table=11
FT                   /locus_tag="CLS_09910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09910"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76700"
FT                   /db_xref="InterPro:IPR026002"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG76"
FT                   /protein_id="CBK76700.1"
FT                   LINSFYKIFFRELGL"
FT   CDS             957990..959222
FT                   /transl_table=11
FT                   /locus_tag="CLS_09920"
FT                   /product="Bifunctional PLP-dependent enzyme with
FT                   beta-cystathionase and maltose regulon repressor
FT                   activities"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09920"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76701"
FT                   /db_xref="GOA:D6DG77"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG77"
FT                   /protein_id="CBK76701.1"
FT                   DRTERRSFREQ"
FT   CDS             complement(960750..963293)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09940"
FT                   /product="Uncharacterized flavoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09940"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76702"
FT                   /db_xref="GOA:D6DG78"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG78"
FT                   /protein_id="CBK76702.1"
FT   CDS             complement(963320..963550)
FT                   /transl_table=11
FT                   /locus_tag="CLS_09950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09950"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76703"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG79"
FT                   /protein_id="CBK76703.1"
FT   CDS             964299..964937
FT                   /transl_table=11
FT                   /locus_tag="CLS_09970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09970"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76704"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG80"
FT                   /protein_id="CBK76704.1"
FT   CDS             964942..965529
FT                   /transl_table=11
FT                   /locus_tag="CLS_09980"
FT                   /product="Methyltransferase domain."
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09980"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76705"
FT                   /db_xref="GOA:D6DG81"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG81"
FT                   /protein_id="CBK76705.1"
FT   CDS             965877..966326
FT                   /transl_table=11
FT                   /locus_tag="CLS_09990"
FT                   /product="Molecular chaperone (small heat shock protein)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_09990"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76706"
FT                   /db_xref="GOA:D6DG82"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG82"
FT                   /protein_id="CBK76706.1"
FT   CDS             966663..966833
FT                   /transl_table=11
FT                   /locus_tag="CLS_10000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10000"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76707"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG83"
FT                   /protein_id="CBK76707.1"
FT                   NTDTVLKEHRI"
FT   CDS             966869..969094
FT                   /transl_table=11
FT                   /locus_tag="CLS_10010"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76708"
FT                   /db_xref="GOA:D6DG84"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG84"
FT                   /protein_id="CBK76708.1"
FT   CDS             969150..969899
FT                   /transl_table=11
FT                   /locus_tag="CLS_10020"
FT                   /product="NAD-dependent protein deacetylases, SIR2 family"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76709"
FT                   /db_xref="GOA:D6DG85"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG85"
FT                   /protein_id="CBK76709.1"
FT   CDS             969975..970979
FT                   /transl_table=11
FT                   /locus_tag="CLS_10030"
FT                   /product="Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76710"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG86"
FT                   /protein_id="CBK76710.1"
FT   CDS             971054..971263
FT                   /transl_table=11
FT                   /locus_tag="CLS_10040"
FT                   /product="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76711"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG87"
FT                   /protein_id="CBK76711.1"
FT   CDS             971412..971699
FT                   /transl_table=11
FT                   /locus_tag="CLS_10050"
FT                   /product="SSU ribosomal protein S6P"
FT                   /function="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76712"
FT                   /db_xref="GOA:D6DG88"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG88"
FT                   /protein_id="CBK76712.1"
FT   CDS             971791..972171
FT                   /transl_table=11
FT                   /locus_tag="CLS_10060"
FT                   /product="single-strand binding protein"
FT                   /function="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76713"
FT                   /db_xref="GOA:D6DG89"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG89"
FT                   /protein_id="CBK76713.1"
FT   CDS             972311..972577
FT                   /transl_table=11
FT                   /locus_tag="CLS_10070"
FT                   /product="SSU ribosomal protein S18P"
FT                   /function="SSU ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76714"
FT                   /db_xref="GOA:D6DG90"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG90"
FT                   /protein_id="CBK76714.1"
FT   CDS             972752..974107
FT                   /transl_table=11
FT                   /locus_tag="CLS_10080"
FT                   /product="putative efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76715"
FT                   /db_xref="GOA:D6DG91"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG91"
FT                   /protein_id="CBK76715.1"
FT   CDS             974285..974905
FT                   /transl_table=11
FT                   /locus_tag="CLS_10090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76716"
FT                   /db_xref="InterPro:IPR026865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG92"
FT                   /protein_id="CBK76716.1"
FT   CDS             complement(975120..976469)
FT                   /transl_table=11
FT                   /locus_tag="CLS_10100"
FT                   /product="hydroxymethylpyrimidine synthase"
FT                   /function="hydroxymethylpyrimidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76717"
FT                   /db_xref="GOA:D6DG93"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG93"
FT                   /protein_id="CBK76717.1"
FT   CDS             977022..979082
FT                   /transl_table=11
FT                   /locus_tag="CLS_10110"
FT                   /product="Predicted signaling protein consisting of a
FT                   modified GGDEF domain and a DHH domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76718"
FT                   /db_xref="GOA:D6DG94"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG94"
FT                   /protein_id="CBK76718.1"
FT   CDS             979084..979530
FT                   /transl_table=11
FT                   /locus_tag="CLS_10120"
FT                   /product="LSU ribosomal protein L9P"
FT                   /function="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76719"
FT                   /db_xref="GOA:D6DG95"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG95"
FT                   /protein_id="CBK76719.1"
FT   CDS             979534..980871
FT                   /transl_table=11
FT                   /locus_tag="CLS_10130"
FT                   /product="primary replicative DNA helicase"
FT                   /function="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76720"
FT                   /db_xref="GOA:D6DG96"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG96"
FT                   /protein_id="CBK76720.1"
FT   CDS             981248..982057
FT                   /transl_table=11
FT                   /locus_tag="CLS_10150"
FT                   /product="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76721"
FT                   /db_xref="GOA:D6DG97"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG97"
FT                   /protein_id="CBK76721.1"
FT   CDS             982689..982997
FT                   /transl_table=11
FT                   /locus_tag="CLS_10160"
FT                   /product="Vacuolar (H+)-ATPase G subunit."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76722"
FT                   /db_xref="GOA:D6DG98"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG98"
FT                   /protein_id="CBK76722.1"
FT   CDS             983133..985145
FT                   /transl_table=11
FT                   /locus_tag="CLS_10170"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit I"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76723"
FT                   /db_xref="GOA:D6DG99"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:D6DG99"
FT                   /protein_id="CBK76723.1"
FT   CDS             985148..985621
FT                   /transl_table=11
FT                   /locus_tag="CLS_10180"
FT                   /product="ATP synthase subunit C."
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76724"
FT                   /db_xref="GOA:D6DGA0"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="UniProtKB/TrEMBL:D6DGA0"
FT                   /protein_id="CBK76724.1"
FT   CDS             985677..986291
FT                   /transl_table=11
FT                   /locus_tag="CLS_10190"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit E"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76725"
FT                   /db_xref="GOA:D6DGA1"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="UniProtKB/TrEMBL:D6DGA1"
FT                   /protein_id="CBK76725.1"
FT   CDS             986395..987369
FT                   /transl_table=11
FT                   /locus_tag="CLS_10200"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit C"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76726"
FT                   /db_xref="GOA:D6DGA2"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="UniProtKB/TrEMBL:D6DGA2"
FT                   /protein_id="CBK76726.1"
FT   CDS             987362..987682
FT                   /transl_table=11
FT                   /locus_tag="CLS_10210"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit F"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76727"
FT                   /db_xref="GOA:D6DGA3"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="UniProtKB/TrEMBL:D6DGA3"
FT                   /protein_id="CBK76727.1"
FT                   TV"
FT   CDS             987731..989500
FT                   /transl_table=11
FT                   /locus_tag="CLS_10220"
FT                   /product="Archaeal/vacuolar-type H+-ATPase subunit A"
FT                   /EC_number=""
FT                   /db_xref="EnsemblGenomes-Gn:CLS_10220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK76728"
FT                   /db_xref="GOA:D6DGA4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6DGA4"
FT                   /protein_id="CBK76728.1"
FT                   GKEIDDVLRREDF"
FT   CDS             989500..990873